BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8261

Length=852
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK71505.2|  soluble acid invertase Ib2FRUCT3                        321   5e-101   Ipomoea batatas [batate]
gb|AAK71504.1|  soluble acid invertase FRUCT2                           305   5e-95    Ipomoea batatas [batate]
ref|XP_009619840.1|  PREDICTED: acid beta-fructofuranosidase AIV-...    294   7e-91    Nicotiana tomentosiformis
gb|ADM47340.1|  vacuolar invertase                                      293   2e-90    Solanum tuberosum [potatoes]
gb|AAQ17074.1|  acid invertase                                          290   2e-89    Solanum tuberosum [potatoes]
gb|AEV46289.1|  vacuolar invertase                                      290   2e-89    Solanum tuberosum [potatoes]
gb|ABF18956.1|  acid invertase                                          290   4e-89    Solanum tuberosum [potatoes]
gb|AEV46294.1|  vacuolar invertase                                      290   4e-89    Solanum tuberosum [potatoes]
ref|XP_009794076.1|  PREDICTED: acid beta-fructofuranosidase AIV-18     289   6e-89    Nicotiana sylvestris
gb|AEV46287.1|  vacuolar invertase                                      289   7e-89    Solanum tuberosum [potatoes]
sp|P93761.1|INV1_CAPAN  RecName: Full=Acid beta-fructofuranosidas...    288   1e-88    Capsicum annuum
ref|NP_001274993.1|  beta-fructosidase                                  288   2e-88    Solanum tuberosum [potatoes]
gb|ACC93585.1|  beta-fructofuranosidase                                 288   2e-88    Solanum tuberosum [potatoes]
gb|AEV46296.1|  vacuolar invertase                                      287   3e-88    Solanum tuberosum [potatoes]
emb|CAA49831.1|  beta-fructofuranosidase                                286   8e-88    Solanum tuberosum [potatoes]
gb|AAA50305.1|  beta-fructosidase                                       284   4e-87    Solanum tuberosum [potatoes]
gb|ACC93584.1|  beta-fructofuranosidase                                 284   4e-87    Solanum tuberosum [potatoes]
sp|P29000.1|INVA_SOLLC  RecName: Full=Acid beta-fructofuranosidas...    282   3e-86    Solanum lycopersicum
gb|ADE44160.1|  acid invertase                                          281   4e-86    Solanum lycopersicum var. cerasiforme [cherry tomato]
gb|AAL75450.1|AF465613_1  minor allergen beta-fructofuranosidase ...    281   4e-86    Solanum lycopersicum
prf||1905419A  invertase                                                278   8e-85 
gb|ADF27779.1|  soluble acid invertase 1                                279   8e-85    Phelipanche ramosa
ref|NP_001234843.1|  acid invertase                                     277   2e-84    
gb|ABX55832.1|  soluble acid invertase                                  276   5e-84    Cucumis melo [Oriental melon]
sp|P80065.2|INVB_DAUCA  RecName: Full=Beta-fructofuranosidase, so...    276   8e-84    Daucus carota [carrots]
emb|CAA53099.1|  beta-fructofuranosidase                                276   8e-84    Daucus carota [carrots]
gb|ABI17894.1|  vacuolar invertase                                      274   9e-84    Coffea canephora [robusta coffee]
emb|CDP05324.1|  unnamed protein product                                272   2e-83    Coffea canephora [robusta coffee]
gb|AFV59227.2|  vacuolar invertase NvINV                                274   4e-83    Elsholtzia haichowensis
gb|AFV59228.1|  vacuolar invertase CvINV                                274   4e-83    Elsholtzia haichowensis
emb|CAA53098.1|  beta-fructofuranosidase                                273   9e-83    Daucus carota [carrots]
ref|XP_011076337.1|  PREDICTED: beta-fructofuranosidase, soluble ...    271   9e-82    Sesamum indicum [beniseed]
ref|XP_006440371.1|  hypothetical protein CICLE_v10019134mg             266   2e-81    
ref|XP_007157332.1|  hypothetical protein PHAVU_002G061200g             267   1e-80    Phaseolus vulgaris [French bean]
gb|KJB51890.1|  hypothetical protein B456_008G236700                    262   2e-80    Gossypium raimondii
dbj|BAP47496.1|  invertase                                              266   3e-80    Gentiana triflora
emb|CAH18938.1|  2,1-fructan:2,1-fructan 1-fructosyltransferase p...    263   6e-80    Bellis perennis [English daisy]
gb|KJB37600.1|  hypothetical protein B456_006G212600                    260   1e-79    Gossypium raimondii
ref|NP_001275813.1|  acid beta-fructofuranosidase-like                  266   1e-79    Citrus sinensis [apfelsine]
dbj|BAB82419.1|  acid invertase                                         266   1e-79    Citrus unshiu [satsuma mandarin]
gb|EYU24965.1|  hypothetical protein MIMGU_mgv1a004782mg                259   8e-79    Erythranthe guttata [common monkey flower]
gb|KJB51893.1|  hypothetical protein B456_008G236700                    262   1e-78    Gossypium raimondii
gb|KJB51889.1|  hypothetical protein B456_008G236700                    262   2e-78    Gossypium raimondii
gb|KHG18769.1|  Acid beta-fructofuranosidase                            257   2e-78    Gossypium arboreum [tree cotton]
ref|XP_011101120.1|  PREDICTED: beta-fructofuranosidase, soluble ...    261   3e-78    Sesamum indicum [beniseed]
gb|KJB37598.1|  hypothetical protein B456_006G212600                    260   7e-78    Gossypium raimondii
pdb|3UGF|A  Chain A, Crystal Structure Of A 6-Sst6-Sft From Pachy...    258   7e-78    Pachysandra terminalis
gb|AJW82912.1|  acid invertase                                          260   1e-77    Dimocarpus longan [longan]
gb|AFU25742.1|  soluble acid invertase 2                                259   1e-77    Rhododendron hybrid cultivar
gb|ACT21538.1|  acid invertase                                          256   5e-77    Vigna radiata [mung bean]
emb|CAA08811.1|  1,2-beta-fructan 1F-fructosyltransferase               257   5e-77    Helianthus tuberosus [Jerusalem artichoke]
ref|NP_001284386.1|  acid beta-fructofuranosidase-like                  258   6e-77    Cucumis melo [Oriental melon]
emb|CBM41476.2|  sucrose:(sucrose/fructan) 6-fructosyltransferase...    258   6e-77    Pachysandra terminalis
gb|KHN34956.1|  Acid beta-fructofuranosidase                            258   7e-77    Glycine soja [wild soybean]
emb|CDP09916.1|  unnamed protein product                                258   8e-77    Coffea canephora [robusta coffee]
gb|AAD10239.1|  invertase                                               258   9e-77    Oryza sativa Japonica Group [Japonica rice]
emb|CAA04120.2|  fructan fructan 1-fructosyltransferase                 256   1e-76    Cynara cardunculus var. scolymus [artichoke]
emb|CAH18892.1|  2,1-fructan:2,1-fructan 1-fructosyltransferase p...    256   1e-76    Viguiera discolor
sp|P29001.1|INVA_VIGRR  RecName: Full=Acid beta-fructofuranosidas...    256   2e-76    Vigna radiata var. radiata [golden gram]
gb|KEH31660.1|  soluble acid invertase FRUCT2                           253   3e-76    Medicago truncatula
gb|AFB83199.1|  fructan-fructan 1-fructosyltransferase                  255   3e-76    Cichorium intybus [radicchio]
ref|XP_008238615.1|  PREDICTED: acid beta-fructofuranosidase-like       256   4e-76    Prunus mume [ume]
ref|XP_002532576.1|  Acid beta-fructofuranosidase precursor, puta...    256   4e-76    Ricinus communis
gb|AEM00023.1|  vacuolar acid invertase                                 252   5e-76    Manihot esculenta [manioc]
ref|XP_011101190.1|  PREDICTED: beta-fructofuranosidase, soluble ...    254   1e-75    Sesamum indicum [beniseed]
emb|CAH25486.1|  1,2-beta-fructan 1F-fructosyltransferase               254   1e-75    Taraxacum officinale [dandelion]
gb|ACJ04701.1|  invertase 1                                             254   2e-75    Cucumis melo [Oriental melon]
dbj|BAJ24841.1|  fructan:fructan 1-fructosyltransferase                 253   2e-75    Arctium lappa
ref|XP_003608758.1|  Acid beta-fructofuranosidase                       253   2e-75    
gb|AES90955.2|  soluble acid invertase FRUCT2                           253   3e-75    Medicago truncatula
ref|XP_008373808.1|  PREDICTED: acid beta-fructofuranosidase            254   4e-75    
gb|KHN42709.1|  Acid beta-fructofuranosidase                            253   4e-75    Glycine soja [wild soybean]
ref|XP_006573732.1|  PREDICTED: acid beta-fructofuranosidase-like       253   5e-75    Glycine max [soybeans]
ref|XP_007039920.1|  Glycosyl hydrolases family 32 protein              254   7e-75    
ref|XP_012087134.1|  PREDICTED: acid beta-fructofuranosidase-like       252   1e-74    Jatropha curcas
gb|AFR69121.1|  vacuolar invertase                                      252   1e-74    Manihot esculenta [manioc]
emb|CAH18891.1|  2,1-fructan:2,1-fructan 1-fructosyltransferase p...    251   1e-74    Echinops ritro
ref|XP_009350311.1|  PREDICTED: acid beta-fructofuranosidase-like       252   1e-74    Pyrus x bretschneideri [bai li]
ref|XP_007155629.1|  hypothetical protein PHAVU_003G217900g             251   2e-74    Phaseolus vulgaris [French bean]
ref|XP_007210314.1|  hypothetical protein PRUPE_ppa002334mg             252   2e-74    Prunus persica
gb|AJO70155.1|  invertase 5                                             251   2e-74    Camellia sinensis [black tea]
sp|O24509.1|INVA_PHAVU  RecName: Full=Acid beta-fructofuranosidas...    251   3e-74    Phaseolus vulgaris [French bean]
ref|XP_002303584.2|  hypothetical protein POPTR_0003s12640g             250   3e-74    
ref|XP_004511663.1|  PREDICTED: acid beta-fructofuranosidase-like       249   6e-74    Cicer arietinum [garbanzo]
ref|XP_004515737.1|  PREDICTED: acid beta-fructofuranosidase-like       250   7e-74    Cicer arietinum [garbanzo]
gb|AEY79730.1|  vacuolar invertase isoform 2                            249   7e-74    Rosa hybrid cultivar
ref|XP_011022761.1|  PREDICTED: acid beta-fructofuranosidase-like       249   8e-74    Populus euphratica
gb|AAD00558.1|  fructan-fructan 1-fructosyltransferase                  249   8e-74    Cichorium intybus [radicchio]
sp|Q43857.1|INVA_VICFA  RecName: Full=Acid beta-fructofuranosidas...    249   8e-74    Vicia faba [broad bean]
ref|XP_011033927.1|  PREDICTED: acid beta-fructofuranosidase            249   9e-74    Populus euphratica
gb|AFO84092.1|  vacuolar invertase                                      248   2e-73    Actinidia chinensis
ref|XP_004147588.1|  PREDICTED: acid beta-fructofuranosidase-like       249   2e-73    Cucumis sativus [cucumbers]
emb|CAH18937.1|  2,1-fructan:2,1-fructan 1-fructosyltransferase p...    248   2e-73    Doronicum pardalianches
gb|KHN04338.1|  Acid beta-fructofuranosidase                            246   3e-73    Glycine soja [wild soybean]
ref|XP_009343902.1|  PREDICTED: acid beta-fructofuranosidase-like       249   3e-73    Pyrus x bretschneideri [bai li]
gb|KHN09790.1|  Acid beta-fructofuranosidase                            247   3e-73    Glycine soja [wild soybean]
ref|XP_011010942.1|  PREDICTED: beta-fructofuranosidase, soluble ...    244   4e-73    Populus euphratica
ref|XP_010053435.1|  PREDICTED: acid beta-fructofuranosidase-like       248   4e-73    Eucalyptus grandis [rose gum]
ref|XP_010093687.1|  Acid beta-fructofuranosidase                       248   5e-73    Morus notabilis
gb|ABX90020.1|  fructan:fructan 1-fructosyltransferase                  247   5e-73    Lactuca sativa [cultivated lettuce]
ref|XP_003549902.1|  PREDICTED: acid beta-fructofuranosidase-like...    247   6e-73    Glycine max [soybeans]
gb|AFD62255.1|  acid invertase                                          247   6e-73    Kummerowia stipulacea
gb|ABX90019.1|  sucrose:sucrose 1-fructosyltransferase                  247   6e-73    Lactuca sativa [cultivated lettuce]
ref|XP_009401797.1|  PREDICTED: beta-fructofuranosidase 1-like          248   7e-73    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB51453.1|  hypothetical protein B456_008G216800                    243   8e-73    Gossypium raimondii
dbj|BAF35859.1|  soluble acid invertase                                 248   9e-73    Pyrus pyrifolia var. culta [Asian pear]
gb|KJB25624.1|  hypothetical protein B456_004G200800                    248   1e-72    Gossypium raimondii
ref|XP_010259020.1|  PREDICTED: beta-fructofuranosidase, soluble ...    246   1e-72    Nelumbo nucifera [Indian lotus]
gb|ACZ05614.1|  vacuolar invertase 2                                    246   1e-72    Gossypium hirsutum [American cotton]
emb|CBI31885.3|  unnamed protein product                                242   1e-72    Vitis vinifera
ref|XP_003525803.1|  PREDICTED: acid beta-fructofuranosidase-like       246   2e-72    Glycine max [soybeans]
gb|AFD62256.1|  acid invertase                                          246   2e-72    Kummerowia stipulacea
ref|NP_001169591.1|  uncharacterized protein LOC100383472               242   2e-72    Zea mays [maize]
emb|CBI24585.3|  unnamed protein product                                243   2e-72    Vitis vinifera
emb|CAA54480.1|  acid invertase                                         231   2e-72    Solanum lycopersicum
ref|XP_002303519.1|  vacuolar invertase family protein                  246   2e-72    Populus trichocarpa [western balsam poplar]
gb|KJB19681.1|  hypothetical protein B456_003G114000                    245   3e-72    Gossypium raimondii
ref|XP_002321831.2|  hypothetical protein POPTR_0015s14790g             245   4e-72    
ref|XP_011000150.1|  PREDICTED: beta-fructofuranosidase, soluble ...    245   4e-72    Populus euphratica
ref|XP_007218855.1|  hypothetical protein PRUPE_ppa002732mg             242   4e-72    
gb|AAL05427.2|  vacuolar acid invertase                                 244   5e-72    Prunus cerasus [pie cherry]
gb|KHG09862.1|  Beta-fructofuranosidase, soluble isoenzyme I            241   7e-72    Gossypium arboreum [tree cotton]
ref|XP_002510944.1|  Beta-fructofuranosidase, soluble isoenzyme I...    244   8e-72    
ref|XP_004298661.1|  PREDICTED: acid beta-fructofuranosidase-like       245   9e-72    Fragaria vesca subsp. vesca
gb|AFH77957.1|  vacuolar invertase                                      244   1e-71    Manihot esculenta [manioc]
gb|AAL65643.1|  beta-fructosidase                                       232   1e-71    Arabidopsis thaliana [mouse-ear cress]
gb|AAB47171.1|  vacuolar invertase 1, GIN1                              243   2e-71    Vitis vinifera
ref|XP_002265534.1|  PREDICTED: beta-fructofuranosidase, soluble ...    243   2e-71    Vitis vinifera
gb|AGU12782.1|  vacuolar invertase 2a                                   243   2e-71    Gossypium hirsutum [American cotton]
gb|AAL65660.1|  beta-fructosidase                                       231   2e-71    Arabidopsis lyrata [lyrate rockcress]
emb|CAB60153.1|  sucrose:sucrose 1-fructosyl transferase                243   2e-71    Taraxacum officinale [dandelion]
gb|AFB83198.1|  sucrose:sucrose 1-fructosyl transferase                 243   2e-71    Cichorium intybus [radicchio]
gb|AAL65650.1|  beta-fructosidase                                       231   2e-71    Arabidopsis thaliana [mouse-ear cress]
gb|AAL65639.1|  beta-fructosidase                                       231   2e-71    Arabidopsis thaliana [mouse-ear cress]
pir||S49256  beta-fructofuranosidase (EC 3.2.1.26) - red goosefoo...    239   3e-71 
gb|AAL65648.1|  beta-fructosidase                                       231   3e-71    Arabidopsis thaliana [mouse-ear cress]
gb|KJB51452.1|  hypothetical protein B456_008G216800                    242   4e-71    Gossypium raimondii
gb|AAL65642.1|  beta-fructosidase                                       230   5e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002446857.1|  hypothetical protein SORBIDRAFT_06g023760          243   6e-71    Sorghum bicolor [broomcorn]
gb|AFP23357.1|  soluble acid invertase                                  242   6e-71    Litchi chinensis [litchi]
gb|AAL65640.1|  beta-fructosidase                                       230   6e-71    Arabidopsis thaliana [mouse-ear cress]
gb|KJB51451.1|  hypothetical protein B456_008G216800                    243   6e-71    Gossypium raimondii
ref|XP_007218853.1|  hypothetical protein PRUPE_ppa002732mg             241   7e-71    
emb|CAA08812.1|  sucrose 1F-fructosyltransferase                        241   7e-71    Helianthus tuberosus [Jerusalem artichoke]
emb|CAH25487.1|  1,2-beta-fructan 1F-fructosyltransferase               241   7e-71    Taraxacum officinale [dandelion]
ref|NP_001234069.1|  invertase                                          241   1e-70    Solanum lycopersicum
ref|XP_006355490.1|  PREDICTED: acid beta-fructofuranosidase-like       241   1e-70    Solanum tuberosum [potatoes]
gb|ADP08983.1|  vacuolar invertase 1                                    241   1e-70    Gossypium hirsutum [American cotton]
gb|AAK72492.2|  soluble acid invertase bfruct2                          241   2e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008668436.1|  PREDICTED: uncharacterized protein LOC100383...    241   2e-70    Zea mays [maize]
gb|AAL65641.1|  beta-fructosidase                                       229   2e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002272809.3|  PREDICTED: acid beta-fructofuranosidase-like       241   2e-70    
gb|AAB47172.1|  vacuolar invertase 2, GIN2                              241   3e-70    Vitis vinifera
ref|XP_007038395.1|  Glycosyl hydrolases family 32 protein isoform 1    240   3e-70    
ref|XP_009630517.1|  PREDICTED: acid beta-fructofuranosidase-like       240   3e-70    Nicotiana tomentosiformis
emb|CAD12104.1|  beta-fructofuranosidase                                240   3e-70    Cichorium intybus [radicchio]
gb|KJB51450.1|  hypothetical protein B456_008G216800                    239   3e-70    Gossypium raimondii
gb|AFH77956.1|  vacuolar invertase                                      239   4e-70    Manihot esculenta [manioc]
sp|P49175.1|INV1_MAIZE  RecName: Full=Beta-fructofuranosidase 1; ...    240   4e-70    Zea mays [maize]
gb|AEX15265.1|  vacuolar invertase                                      239   4e-70    Musa acuminata AAA Group [Cavendish banana]
gb|ACQ82802.1|  vacuolar invertase                                      239   6e-70    Gossypium hirsutum [American cotton]
ref|XP_003580229.1|  PREDICTED: beta-fructofuranosidase 1-like          239   7e-70    Brachypodium distachyon [annual false brome]
gb|EPS61897.1|  soluble acid invertase 1                                237   9e-70    Genlisea aurea
gb|AAB58909.1|  sucrose:sucrose 1-fructosyl transferase                 238   1e-69    Cichorium intybus [radicchio]
ref|XP_006307369.1|  hypothetical protein CARUB_v10008995mg             234   1e-69    
dbj|BAJ95733.1|  predicted protein                                      236   1e-69    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008234397.1|  PREDICTED: beta-fructofuranosidase, soluble ...    238   1e-69    Prunus mume [ume]
ref|XP_009384549.1|  PREDICTED: beta-fructofuranosidase 1-like          238   2e-69    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008778382.1|  PREDICTED: beta-fructofuranosidase 1-like          236   2e-69    Phoenix dactylifera
gb|AAD01606.1|  beta-fructofuranosidase                                 238   3e-69    Ipomoea batatas [batate]
emb|CAA70855.1|  sucrose sucrose 1-fructosyltransferase                 237   3e-69    Cynara cardunculus var. scolymus [artichoke]
ref|XP_008376436.1|  PREDICTED: beta-fructofuranosidase, soluble ...    237   3e-69    Malus domestica [apple tree]
gb|KFK40573.1|  hypothetical protein AALP_AA2G014000                    229   5e-69    Arabis alpina [alpine rockcress]
gb|KHN32440.1|  Beta-fructofuranosidase, soluble isoenzyme I            235   6e-69    Glycine soja [wild soybean]
ref|XP_009775767.1|  PREDICTED: acid beta-fructofuranosidase-like       236   7e-69    Nicotiana sylvestris
ref|XP_009374489.1|  PREDICTED: beta-fructofuranosidase, soluble ...    236   7e-69    Pyrus x bretschneideri [bai li]
emb|CAA47636.1|  soluble beta-fructosidase                              236   7e-69    Daucus carota [carrots]
ref|XP_011623822.1|  PREDICTED: beta-fructofuranosidase, soluble ...    236   8e-69    Amborella trichopoda
gb|ERM94735.1|  hypothetical protein AMTR_s00011p00252750               236   9e-69    Amborella trichopoda
gb|AHK05786.1|  vacuolar invertase                                      236   9e-69    Eriobotrya japonica [loquat]
ref|XP_009340588.1|  PREDICTED: beta-fructofuranosidase, soluble ...    236   1e-68    Pyrus x bretschneideri [bai li]
ref|XP_010906620.1|  PREDICTED: beta-fructofuranosidase 1-like          236   1e-68    Elaeis guineensis
ref|XP_010430328.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    235   2e-68    Camelina sativa [gold-of-pleasure]
ref|XP_006300839.1|  hypothetical protein CARUB_v10019930mg             235   2e-68    Capsella rubella
ref|XP_006417255.1|  hypothetical protein EUTSA_v10007016mg             235   2e-68    Eutrema salsugineum [saltwater cress]
ref|XP_011070162.1|  PREDICTED: beta-fructofuranosidase, soluble ...    235   2e-68    
gb|AGW23637.1|  soluble acid invertase                                  235   2e-68    Lilium davidii
ref|XP_009370474.1|  PREDICTED: beta-fructofuranosidase, soluble ...    235   2e-68    Pyrus x bretschneideri [bai li]
gb|KHN11662.1|  Beta-fructofuranosidase, soluble isoenzyme I            232   3e-68    Glycine soja [wild soybean]
ref|XP_010106222.1|  hypothetical protein L484_003380                   235   3e-68    
ref|XP_009113064.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    235   3e-68    Brassica rapa
gb|KDO65461.1|  hypothetical protein CISIN_1g006523mg                   230   3e-68    Citrus sinensis [apfelsine]
ref|XP_010264216.1|  PREDICTED: beta-fructofuranosidase, soluble ...    235   3e-68    Nelumbo nucifera [Indian lotus]
ref|XP_012090431.1|  PREDICTED: beta-fructofuranosidase, soluble ...    234   4e-68    Jatropha curcas
ref|XP_003533514.1|  PREDICTED: beta-fructofuranosidase, soluble ...    234   4e-68    Glycine max [soybeans]
gb|KHN42772.1|  Beta-fructofuranosidase, soluble isoenzyme I            232   4e-68    Glycine soja [wild soybean]
emb|CDY46906.1|  BnaA09g12880D                                          234   5e-68    Brassica napus [oilseed rape]
ref|XP_010672026.1|  PREDICTED: beta-fructofuranosidase, soluble ...    234   5e-68    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003540575.1|  PREDICTED: beta-fructofuranosidase, soluble ...    233   7e-68    Glycine max [soybeans]
ref|XP_006421676.1|  hypothetical protein CICLE_v10004465mg             234   1e-67    
gb|KDO65460.1|  hypothetical protein CISIN_1g006523mg                   230   1e-67    Citrus sinensis [apfelsine]
dbj|BAF35858.1|  Soluble acid invertase                                 233   2e-67    Pyrus pyrifolia var. culta [Asian pear]
dbj|BAG30919.1|  soluble acid invertase                                 233   2e-67    Pyrus pyrifolia [sha li]
ref|XP_003526374.1|  PREDICTED: beta-fructofuranosidase, soluble ...    233   2e-67    Glycine max [soybeans]
gb|AAM52062.1|  vacuolar acid invertase PsI-1                           233   2e-67    Pisum sativum [garden pea]
emb|CDY30056.1|  BnaC05g09640D                                          233   2e-67    Brassica napus [oilseed rape]
gb|AFU56882.1|  vacuolar invertase                                      232   2e-67    Malus domestica [apple tree]
gb|AFJ21571.1|  sucrose:sucrose 1-fructosyltransferase                  232   2e-67    Agave tequilana
gb|AAG36943.1|AF274299_1  acid invertase                                233   2e-67    Brassica oleracea
emb|CAA66237.1|  invertase 5                                            232   3e-67    Tulipa gesneriana
ref|XP_010418267.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    232   3e-67    Camelina sativa [gold-of-pleasure]
ref|XP_002888009.1|  predicted protein                                  232   3e-67    Arabidopsis lyrata subsp. lyrata
ref|XP_009406946.1|  PREDICTED: beta-fructofuranosidase 1-like          230   4e-67    
ref|XP_008794813.1|  PREDICTED: beta-fructofuranosidase 1-like          232   4e-67    Phoenix dactylifera
ref|XP_009112697.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    232   4e-67    Brassica rapa
emb|CDY31826.1|  BnaC09g13230D                                          232   5e-67    Brassica napus [oilseed rape]
emb|CAD19321.1|  acid vacuolar invertase                                232   5e-67    Beta vulgaris [beet]
ref|XP_010676175.1|  PREDICTED: acid beta-fructofuranosidase-like...    232   5e-67    Beta vulgaris subsp. vulgaris [field beet]
gb|KDO65459.1|  hypothetical protein CISIN_1g006523mg                   231   7e-67    Citrus sinensis [apfelsine]
ref|XP_010676174.1|  PREDICTED: acid beta-fructofuranosidase-like...    231   1e-66    Beta vulgaris subsp. vulgaris [field beet]
sp|Q5FC15.1|GFT_ASPOF  RecName: Full=6(G)-fructosyltransferase; A...    229   1e-66    Asparagus officinalis
ref|XP_009118103.1|  PREDICTED: acid beta-fructofuranosidase 4, v...    230   2e-66    Brassica rapa
emb|CDY26548.1|  BnaA09g47290D                                          230   2e-66    Brassica napus [oilseed rape]
gb|AAG36942.1|AF274298_1  acid invertase                                230   2e-66    Brassica oleracea
emb|CDX98080.1|  BnaA06g08310D                                          230   3e-66    
emb|CDY15984.1|  BnaC08g41390D                                          230   3e-66    Brassica napus [oilseed rape]
ref|NP_001275874.1|  beta-fructofuranosidase, soluble isoenzyme I...    229   3e-66    Citrus sinensis [apfelsine]
ref|XP_010473488.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    229   3e-66    Camelina sativa [gold-of-pleasure]
ref|XP_011081205.1|  PREDICTED: beta-fructofuranosidase, soluble ...    229   5e-66    Sesamum indicum [beniseed]
ref|XP_009148607.1|  PREDICTED: acid beta-fructofuranosidase 4, v...    229   5e-66    Brassica rapa
ref|XP_007131343.1|  hypothetical protein PHAVU_011G005900g             228   5e-66    Phaseolus vulgaris [French bean]
emb|CAA06838.1|  sucrose sucrose 1-fructosyltransferase                 228   6e-66    Allium cepa
emb|CDY39805.1|  BnaA09g10570D                                          228   7e-66    Brassica napus [oilseed rape]
gb|ABG00265.1|  sucrose:sucrose 1-fructosyltransferase                  228   7e-66    Agave tequilana
ref|XP_006300852.1|  hypothetical protein CARUB_v10019944mg             228   8e-66    
dbj|BAM66575.1|  sucrose:sucrose 1-fructosyltransferase                 228   9e-66    Asparagus officinalis
emb|CAA66238.1|  invertase 6                                            227   1e-65    Tulipa gesneriana
ref|NP_563901.1|  acid beta-fructofuranosidase 4                        228   1e-65    Arabidopsis thaliana [mouse-ear cress]
gb|AAZ85379.1|  vacuolar invertase                                      221   2e-65    Solanum ochranthum
gb|AFJ21579.1|  fructan:fructan 6G-fructosyltransferase                 227   2e-65    Agave tequilana
emb|CAA66330.1|  beta-fructosidase                                      228   2e-65    Arabidopsis thaliana [mouse-ear cress]
emb|CAA64953.1|  invertase                                              227   2e-65    Tulipa gesneriana
ref|XP_002889923.1|  beta-fructosidase                                  228   2e-65    Arabidopsis lyrata subsp. lyrata
gb|AFJ21573.1|  fructan:fructan 6G-fructosyltransferase                 226   4e-65    Agave tequilana
gb|AFJ21570.1|  sucrose:sucrose 1-fructosyltransferase                  226   4e-65    Agave tequilana
ref|XP_004307805.1|  PREDICTED: beta-fructofuranosidase, soluble ...    226   5e-65    Fragaria vesca subsp. vesca
gb|AFJ21576.1|  sucrose:sucrose 1-fructosyltransferase                  225   6e-65    Agave tequilana
emb|CDY03264.1|  BnaC09g10840D                                          225   7e-65    
ref|XP_010062212.1|  PREDICTED: beta-fructofuranosidase, soluble ...    226   8e-65    Eucalyptus grandis [rose gum]
ref|XP_006391837.1|  hypothetical protein EUTSA_v10023331mg             225   1e-64    Eutrema salsugineum [saltwater cress]
gb|AAK72493.2|  soluble acid invertase bfruct3                          226   1e-64    Oryza sativa Japonica Group [Japonica rice]
gb|AFJ21575.1|  vacuolar invertase                                      225   1e-64    Agave tequilana
ref|XP_010546426.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    225   2e-64    Tarenaya hassleriana [spider flower]
ref|XP_006653622.1|  PREDICTED: beta-fructofuranosidase 1-like          224   2e-64    
gb|AAM21931.1|  sucrose:sucrose 1-fructosyltransferase                  224   3e-64    Allium sativum
emb|CAA61624.1|  beta-fructofuranosidase                                222   4e-64    Arabidopsis thaliana [mouse-ear cress]
gb|AAB71136.1|  acid invertase                                          224   4e-64    Asparagus officinalis
ref|XP_004143623.1|  PREDICTED: acid beta-fructofuranosidase-like       223   6e-64    Cucumis sativus [cucumbers]
ref|NP_001284469.1|  acid beta-fructofuranosidase-like                  223   6e-64    Cucumis melo [Oriental melon]
gb|AAL99550.1|AF490530_1  beta-fructofuranosidase TAI 20-19             216   6e-64    Solanum lycopersicum
ref|XP_004976364.1|  PREDICTED: beta-fructofuranosidase 1-like          223   7e-64    Setaria italica
gb|AAD43622.1|AC005698_21  T3P18.21                                     223   8e-64    Arabidopsis thaliana [mouse-ear cress]
emb|CAA64781.1|  beta-fructosidase                                      223   8e-64    Arabidopsis thaliana [mouse-ear cress]
ref|NP_564798.1|  acid beta-fructofuranosidase 3                        223   8e-64    Arabidopsis thaliana [mouse-ear cress]
gb|AAK62665.1|  At1g62660/F23N19_3                                      223   8e-64    Arabidopsis thaliana [mouse-ear cress]
gb|ADF27780.1|  soluble acid invertase 2                                221   8e-64    Phelipanche ramosa
ref|XP_004499664.1|  PREDICTED: beta-fructofuranosidase, soluble ...    222   1e-63    Cicer arietinum [garbanzo]
dbj|BAJ88213.1|  predicted protein                                      217   1e-63    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAF19535.1|AC007190_3  F23N19.3                                      223   1e-63    Arabidopsis thaliana [mouse-ear cress]
gb|ABS72186.1|  fructan:fructan 1-fructosyltransferase                  222   2e-63    Agave tequilana
gb|AAM77272.1|AF519809_1  acid invertase                                222   2e-63    Lagenaria siceraria [bottle gourd]
gb|AFS17280.1|  acid vacuolar invertase                                 222   2e-63    Amaranthus cruentus/Amaranthus hypocondriacus mixed library
ref|XP_010941127.1|  PREDICTED: beta-fructofuranosidase 1-like          222   3e-63    Elaeis guineensis
gb|AAX38331.1|  sucrose accumulator                                     214   4e-63    Solanum peruvianum [Peruvian tomato]
gb|AAX38330.1|  sucrose accumulator                                     214   4e-63    Solanum peruvianum [Peruvian tomato]
gb|AAX38332.1|  sucrose accumulator                                     214   4e-63    Solanum peruvianum [Peruvian tomato]
gb|AAX38329.1|  sucrose accumulator                                     214   4e-63    Solanum peruvianum [Peruvian tomato]
gb|AAX38335.1|  sucrose accumulator                                     214   5e-63    Solanum peruvianum [Peruvian tomato]
ref|XP_010933713.1|  PREDICTED: beta-fructofuranosidase 1               220   7e-63    Elaeis guineensis
gb|AAX38345.1|  sucrose accumulator                                     214   7e-63    
gb|AAX38351.1|  sucrose accumulator                                     214   7e-63    
gb|KFK40589.1|  hypothetical protein AALP_AA2G015400                    220   8e-63    
ref|XP_010536536.1|  PREDICTED: acid beta-fructofuranosidase-like       220   1e-62    
ref|XP_003598216.1|  Acid beta-fructofuranosidase                       217   1e-62    
ref|XP_007148711.1|  hypothetical protein PHAVU_005G008200g             219   1e-62    
gb|AAX38361.1|  sucrose accumulator                                     213   1e-62    
gb|AAX38328.1|  sucrose accumulator                                     213   1e-62    
gb|AAX38326.1|  sucrose accumulator                                     213   2e-62    
emb|CDY39804.1|  BnaA09g10560D                                          219   2e-62    
ref|XP_010493951.1|  PREDICTED: acid beta-fructofuranosidase 4, v...    219   2e-62    
ref|XP_010458650.1|  PREDICTED: acid beta-fructofuranosidase 4, v...    219   2e-62    
dbj|BAM66574.1|  fructan:fructan 1-fructosyltransferase                 218   4e-62    
gb|AES68467.2|  soluble acid invertase FRUCT2                           218   6e-62    
ref|XP_010476187.1|  PREDICTED: acid beta-fructofuranosidase 4, v...    218   6e-62    
gb|AAX38336.1|  sucrose accumulator                                     211   6e-62    
gb|AAX38333.1|  sucrose accumulator                                     211   7e-62    
gb|AAX38327.1|  sucrose accumulator                                     211   9e-62    
ref|XP_010473489.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    217   1e-61    
gb|AAL99549.1|  beta-fructofuranosidase MFAI1                           210   1e-61    
ref|XP_010533769.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    217   2e-61    
emb|CAA06839.1|  invertase                                              217   2e-61    
ref|XP_004951208.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose:sucr...    216   4e-61    
ref|XP_008796841.1|  PREDICTED: LOW QUALITY PROTEIN: beta-fructof...    215   6e-61    
gb|AFP72238.1|  sucrose:sucrose 1-fructosyltransferase                  215   9e-61    
dbj|BAJ88350.1|  predicted protein                                      214   3e-60    
dbj|BAJ97223.1|  predicted protein                                      214   3e-60    
emb|CDY03265.1|  BnaC09g10830D                                          213   3e-60    
ref|XP_010919479.1|  PREDICTED: beta-fructofuranosidase 1 isoform X2    213   4e-60    
ref|XP_010430330.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    213   5e-60    
ref|XP_010919478.1|  PREDICTED: beta-fructofuranosidase 1 isoform X1    213   5e-60    
emb|CAH67112.1|  H0502G05.3                                             211   1e-59    
sp|P92916.1|GFT_ALLCE  RecName: Full=Bifunctional 6(G)-fructosylt...    211   1e-59    
emb|CAD41525.3|  OSJNBb0020O11.6                                        211   2e-59    
gb|AAX38344.1|  sucrose accumulator                                     205   2e-59    
gb|EEC77707.1|  hypothetical protein OsI_16783                          211   2e-59    
ref|NP_001053422.1|  Os04g0535600                                       211   2e-59    
gb|EMS55535.1|  Beta-fructofuranosidase 1                               209   2e-59    
emb|CAD98793.2|  sucrose-sucrose-1-fructosyltransferase                 210   5e-59    
gb|AFP72242.1|  vacuolar invertase                                      209   5e-59    
dbj|BAK05319.1|  predicted protein                                      209   5e-59    
dbj|BAJ91277.1|  predicted protein                                      209   1e-58    
ref|XP_008787011.1|  PREDICTED: beta-fructofuranosidase 1               207   4e-58    
gb|AFJ21572.1|  fructan:fructan 6G-fructosyltransferase                 207   6e-58    
gb|AFJ21578.1|  fructan:fructan 6G-fructosyltransferase                 206   9e-58    
gb|EMT14935.1|  Beta-fructofuranosidase 1                               204   1e-57    
gb|AAG24787.1|AF252607_1  sucrose:fructan 6-fructosyltransferase        199   1e-57    
gb|AAS88729.1|  vacuolar invertase1                                     206   2e-57    
gb|AAF87245.1|AF276703_1  vacuolar acid invertase                       205   3e-57    
ref|XP_010228144.1|  PREDICTED: sucrose:sucrose 1-fructosyltransf...    202   5e-57    
dbj|BAB82470.1|  sucrose:sucrose 1-fructosytransferase                  204   6e-57    
ref|XP_010259193.1|  PREDICTED: beta-fructofuranosidase, soluble ...    204   9e-57    
gb|EMT11750.1|  Beta-fructofuranosidase 1                               203   9e-57    
gb|AAL27709.3|AF433643_1  vacuolar invertase                            203   1e-56    
gb|ACL13557.1|  sucrose:sucrose 1-fructosyltransferase                  203   2e-56    
dbj|BAH30252.1|  sucrose: fructan 6-fructosyltransferase                202   3e-56    
gb|ACL13558.1|  sucrose:sucrose 1-fructosyltransferase                  202   3e-56    
emb|CAD58683.1|  putative soluble acid invertase                        200   5e-56    
gb|AAL87233.1|AF481763_1  fructosyltransferase                          202   5e-56    
gb|ACS92722.1|  vacuolar invertase                                      202   5e-56    
gb|ADP38056.1|  putative sucrose:fructan fructosyl transferase          201   5e-56    
gb|AAC36118.1|  soluble acid invertase                                  195   8e-56    
dbj|BAK03249.1|  predicted protein                                      202   8e-56    
dbj|BAJ85557.1|  predicted protein                                      201   8e-56    
dbj|BAJ93214.1|  predicted protein                                      201   8e-56    
gb|EMT23831.1|  hypothetical protein F775_52102                         199   8e-56    
dbj|BAJ87063.1|  predicted protein                                      201   8e-56    
emb|CAF22241.1|  soluble acid invertase                                 201   1e-55    
gb|ACH73192.1|  sucrose:fructan 6-fructosyltransferase                  200   1e-55    
gb|EMT24081.1|  Beta-fructofuranosidase 1                               201   1e-55    
gb|ACL13556.1|  sucrose:sucrose 1-fructosyltransferase                  201   1e-55    
gb|AFP72239.1|  fructan-fructan 1-fructosyltransferase                  201   1e-55    
gb|EMT09010.1|  6(G)-fructosyltransferase                               199   2e-55    
gb|ACH73194.1|  sucrose:fructan 6-fructosyltransferase                  200   2e-55    
gb|AFP72240.1|  sucrose:fructan 6-fructosyltransferase                  200   2e-55    
gb|AAG36767.1|AF192394_1  sucrose:fructan 6-fructosyltransferase        200   2e-55    
gb|EMS56293.1|  Beta-fructofuranosidase 1                               199   2e-55    
pir||JC7905  fructan 6-fructosyltransferase - wheat                     199   2e-55 
dbj|BAB82469.1|  sucrose:fructan 6-fructosyltransferase                 199   2e-55    
gb|ADP38058.1|  putative sucrose:fructan fructosyl transferase 2        199   3e-55    
gb|ACH73195.1|  sucrose:fructan 6-fructosyltransferase                  199   3e-55    
gb|ACH73193.1|  sucrose:fructan 6-fructosyltransferase                  199   3e-55    
gb|ACI43225.3|  sucrose:fructan 6-fructosyltransferase                  199   3e-55    
emb|CAA58235.1|  sucrose:fructan 6-fructosyltransferase                 199   4e-55    
gb|ACN93835.1|  putative sucrose:fructan 6-fructosyltransferase         199   4e-55    
gb|EMT09009.1|  Beta-fructofuranosidase, soluble isoenzyme I            198   6e-55    
gb|AAZ29516.1|  fructosyltransferase-like protein                       199   7e-55    
dbj|BAE19751.1|  fructan:fructan 1-fructosyltransferase                 199   7e-55    
gb|EMT16812.1|  6(G)-fructosyltransferase                               198   9e-55    
gb|AAG24788.1|AF252608_1  sucrose:fructan 6-fructosyltransferase        191   1e-54    
gb|AAO86693.1|  sucrose:sucrose 1-fructosyltransferase                  197   2e-54    
gb|AFK29573.1|  sucrose: fructan 6-fructosyltransferase                 197   2e-54    
dbj|BAF99807.1|  sucrose:sucrose fructosyltransferase                   197   2e-54    
dbj|BAF99808.1|  fructan:fructan 6G-fructosyltransferase 2              197   2e-54    
gb|EMS52383.1|  Beta-fructofuranosidase 1                               196   3e-54    
emb|CAL51273.1|  putative sucrose:sucrose 1-fructosyltransferase        197   3e-54    
gb|EMT19915.1|  Beta-fructofuranosidase 1                               197   3e-54    
gb|ABD72592.1|  fructosyltransferase FTa                                197   3e-54    
sp|Q9FSV7.1|SST_FESAR  RecName: Full=Sucrose:sucrose 1-fructosylt...    197   3e-54    
gb|ADP38057.1|  putative sucrose:fructan fructosyl transferase 1        195   8e-54    
dbj|BAE19752.1|  fructan:fructan 1-fructosyltransferase                 196   8e-54    
gb|ACH73189.1|  fructan:fructan 1-fructosyltransferase                  196   9e-54    
gb|ACL14897.1|  fructan:fructan 1-fructosyltransferase                  195   1e-53    
ref|XP_002451357.1|  hypothetical protein SORBIDRAFT_04g000620          192   2e-53    
gb|ABB77251.1|  vacuolar invertase BObetaFRUCT3                         195   2e-53    
gb|EMT23832.1|  6(G)-fructosyltransferase                               194   2e-53    
gb|ACH73190.1|  fructan:fructan 1-fructosyltransferase                  195   2e-53    
ref|XP_003538727.1|  PREDICTED: acid beta-fructofuranosidase-like       194   2e-53    
gb|ACH73188.1|  fructan:fructan 1-fructosyltransferase                  194   3e-53    
gb|ACY78464.1|  soluble acid invertase                                  193   3e-53    
gb|ACY78467.1|  soluble acid invertase                                  193   3e-53    
gb|EMT29525.1|  6(G)-fructosyltransferase                               192   3e-53    
gb|AAC16655.1|  soluble acid invertase                                  193   4e-53    
gb|AFN66440.1|  soluble acid invertase                                  192   5e-53    
gb|AFN66439.1|  soluble acid invertase                                  192   5e-53    
gb|AAC16654.1|  soluble acid invertase                                  192   6e-53    
gb|AFK29572.1|  sucrose: sucrose-1-fructosyltransferase                 193   9e-53    
gb|ACY78465.1|  soluble acid invertase                                  191   1e-52    
emb|CAL51272.1|  putative fructan:fructan 6G-fructosyltransferase       192   2e-52    
gb|EMT14599.1|  Beta-fructofuranosidase, soluble isoenzyme I            192   2e-52    
dbj|BAD26613.1|  putative fructosyltransferase2                         192   2e-52    
gb|AAM13671.1|AF492836_1  fructan:fructan 6G-fructosyltransferase       192   2e-52    
gb|AGR51646.1|  soluble acid invertase                                  191   2e-52    
gb|AGO03820.1|  soluble acid invertase                                  192   2e-52    
gb|AGO03823.1|  soluble acid invertase                                  192   2e-52    
gb|AFV94468.1|  soluble acid invertase 4                                192   2e-52    
gb|AFV94472.1|  soluble acid invertase 9                                192   2e-52    
gb|AFV94467.1|  soluble acid invertase 5                                192   3e-52    
gb|EMS52931.1|  6(G)-fructosyltransferase                               190   4e-52    
gb|AFV94414.1|  soluble acid invertase 3                                191   4e-52    
gb|AFV94413.1|  soluble acid invertase 2                                191   4e-52    
gb|AFV94412.1|  soluble acid invertase 1                                191   4e-52    
gb|AFV94474.1|  soluble acid invertase 11                               191   5e-52    
emb|CAD91358.1|  vacuolar invertase                                     188   5e-52    
gb|ACH73196.1|  sucrose:sucrose 1-fructosyltransferase                  191   7e-52    
gb|AFH57543.1|  soluble acid invertase                                  191   7e-52    
gb|AFV94475.1|  soluble acid invertase 12                               191   8e-52    
gb|AFV94473.1|  soluble acid invertase 10                               191   9e-52    
gb|AAP59436.1|  soluble acid invertase                                  190   1e-51    
dbj|BAJ94230.1|  predicted protein                                      190   1e-51    
gb|AFP72241.1|  vacuolar invertase                                      190   1e-51    
gb|AGG41117.1|  putative vacuole invertase                              187   1e-51    
gb|AAA74584.1|  invertase                                               187   1e-51    
dbj|BAK04106.1|  predicted protein                                      189   2e-51    
gb|AFV94469.1|  soluble acid invertase 6                                190   2e-51    
gb|EAZ21424.1|  hypothetical protein OsJ_05029                          187   6e-51    
gb|AFV94471.1|  soluble acid invertase 8                                188   6e-51    
ref|XP_003571181.2|  PREDICTED: sucrose:sucrose 1-fructosyltransf...    187   9e-51    
gb|AAF87246.1|AF276704_1  vacuolar acid invertase                       187   1e-50    
ref|NP_001045626.1|  Os02g0106100                                       187   1e-50    
gb|ACH73191.1|  fructan:fructan 1-fructosyltransferase                  187   2e-50    
ref|NP_001292789.1|  invertase2                                         187   2e-50    
gb|AFV94470.1|  soluble acid invertase 7                                187   2e-50    
gb|AAK27319.1|AF211253_1  sucrose:fructan 6-fructosyltransferase        186   2e-50    
gb|AAV28807.1|  vacuolar invertase 1                                    174   2e-50    
gb|EMT19916.1|  Beta-fructofuranosidase 1                               186   3e-50    
gb|EMT19913.1|  Beta-fructofuranosidase 1                               184   1e-49    
gb|EMT19914.1|  Beta-fructofuranosidase 1                               182   2e-49    
ref|XP_006646767.1|  PREDICTED: sucrose:sucrose 1-fructosyltransf...    184   2e-49    
gb|AAL92880.1|  fructosyltransferase                                    183   3e-49    
emb|CAG25609.1|  acid beta-fructofuranosidase precursor                 182   5e-49    
emb|CAD58681.1|  putative soluble acid invertase                        181   2e-48    
gb|AAM14603.1|AF494041_1  fructan 6-fructosyltransferase                176   7e-47    
dbj|BAD35132.1|  putative fructosyltransferase1                         176   8e-47    
emb|CAL51274.1|  putative (sucrose/fructan) 6-fructosyltransferase      176   8e-47    
dbj|BAF99806.1|  putative fructosyltransferase 2                        174   3e-46    
dbj|BAF99809.1|  putative fructosyltransferase 3                        173   8e-46    
emb|CAD58682.1|  putative fructan 6-fructosyltransferase                173   1e-45    
dbj|BAO09621.1|  fructosyltransferase                                   172   3e-45    
ref|XP_001764172.1|  predicted protein                                  167   9e-44    
gb|AAC23502.1|  vacuolar invertase                                      164   5e-43    
gb|ACN29287.1|  unknown                                                 155   8e-43    
gb|EMS57418.1|  Beta-fructofuranosidase, soluble isoenzyme I            165   2e-42    
ref|XP_001778420.1|  predicted protein                                  158   3e-42    
ref|XP_001784437.1|  predicted protein                                  162   5e-42    
gb|AAG49563.1|  acid invertase                                          155   3e-41    
ref|XP_002973210.1|  hypothetical protein SELMODRAFT_98949              154   6e-39    
ref|XP_002976640.1|  hypothetical protein SELMODRAFT_10966              152   1e-38    
ref|XP_001761961.1|  predicted protein                                  149   1e-37    
ref|XP_001755639.1|  predicted protein                                  147   8e-37    
ref|NP_001234618.1|  acid beta-fructofuranosidase precursor             146   2e-36    
gb|KJB37601.1|  hypothetical protein B456_006G212600                    146   3e-36    
emb|CAC37922.1|  fructan 1-exohydrolase IIa                             145   4e-36    
pdb|1ST8|A  Chain A, Crystal Structure Of Fructan 1-Exohydrolase ...    145   6e-36    
pdb|2AEZ|A  Chain A, Crystal Structure Of Fructan 1-Exohydrolase ...    145   6e-36    
emb|CAC37923.1|  fructan 1-exohydrolase IIb                             144   1e-35    
ref|XP_002530338.1|  Beta-fructofuranosidase, insoluble isoenzyme...    144   2e-35    
gb|EMT09008.1|  6(G)-fructosyltransferase                               140   3e-35    
ref|XP_002530337.1|  Beta-fructofuranosidase, insoluble isoenzyme...    142   5e-35    
gb|KDO65257.1|  hypothetical protein CISIN_1g0445341mg                  138   5e-35    
emb|CAA72062.1|  fructosidase                                           142   5e-35    
ref|XP_008444460.1|  PREDICTED: LOW QUALITY PROTEIN: beta-fructof...    142   7e-35    
ref|XP_011094302.1|  PREDICTED: beta-fructofuranosidase, insolubl...    140   2e-34    
gb|EAZ26422.1|  hypothetical protein OsJ_10306                          140   2e-34    
emb|CAH65976.1|  H1005F08.5                                             140   2e-34    
gb|EEC78196.1|  hypothetical protein OsI_17809                          140   3e-34    
gb|AAY85659.1|  cell wall invertase 1                                   140   3e-34    
ref|XP_011094300.1|  PREDICTED: beta-fructofuranosidase, insolubl...    140   3e-34    
ref|XP_010683702.1|  PREDICTED: beta-fructofuranosidase, insolubl...    140   3e-34    
ref|XP_001774490.1|  predicted protein                                  140   3e-34    
gb|AEV40933.1|  putative glycosy1 hydrolase                             140   4e-34    
emb|CAE03581.1|  OSJNBa0087O24.4                                        139   5e-34    
ref|NP_001054173.2|  Os04g0664900                                       139   5e-34    
sp|Q56UD1.3|INV5_ORYSJ  RecName: Full=Beta-fructofuranosidase, in...    139   5e-34    
gb|EYU30505.1|  hypothetical protein MIMGU_mgv1a0199922mg               129   1e-33    
ref|XP_010059629.1|  PREDICTED: beta-fructofuranosidase, insolubl...    139   1e-33    
gb|EYU38654.1|  hypothetical protein MIMGU_mgv1a003581mg                138   1e-33    
gb|AJW31155.1|  fructan 1-exohydrolase                                  138   2e-33    
ref|XP_011094304.1|  PREDICTED: beta-fructofuranosidase, insolubl...    138   2e-33    
ref|XP_011094306.1|  PREDICTED: beta-fructofuranosidase, insolubl...    138   2e-33    
emb|CAJ77148.1|  putative fructan 1-exohydrolase                        137   2e-33    
ref|XP_001783601.1|  predicted protein                                  137   2e-33    
ref|XP_006466029.1|  PREDICTED: beta-fructofuranosidase, insolubl...    137   3e-33    
ref|XP_006426548.1|  hypothetical protein CICLE_v10025243mg             137   3e-33    
gb|EYU24751.1|  hypothetical protein MIMGU_mgv1a0026271mg               127   4e-33    
ref|XP_006466030.1|  PREDICTED: beta-fructofuranosidase, insolubl...    137   4e-33    
ref|XP_006426549.1|  hypothetical protein CICLE_v10025259mg             137   4e-33    
ref|XP_009592423.1|  PREDICTED: beta-fructofuranosidase, insolubl...    137   4e-33    
gb|KCW81699.1|  hypothetical protein EUGRSUZ_C03054                     137   5e-33    
ref|XP_010049203.1|  PREDICTED: beta-fructofuranosidase, insolubl...    137   5e-33    
ref|XP_011649529.1|  PREDICTED: beta-fructofuranosidase, insolubl...    137   5e-33    



>gb|AAK71505.2| soluble acid invertase Ib2FRUCT3 [Ipomoea batatas]
Length=661

 Score =   321 bits (823),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 174/209 (83%), Gaps = 1/209 (0%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            LLQWP+EEV+ LRSGDP +T VNLQPG ++PIH+  + QLDI A FEV N  +   E D 
Sbjct  450  LLQWPVEEVESLRSGDPTLTDVNLQPGSVVPIHVNTSTQLDISAWFEVENTTS-SMEADV  508

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
             YNCSSSGGAV RGALGPFGL+V ADETL+ELTPVYFY+ KG DGK ETHFCTD TRSSE
Sbjct  509  GYNCSSSGGAVTRGALGPFGLLVIADETLSELTPVYFYIAKGTDGKAETHFCTDQTRSSE  568

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVF  280
            +S V KEVYGSTVPV++ E Y+ RILVDHSIVESF QGGRTVITSRIYPTKAIY AARVF
Sbjct  569  SSSVGKEVYGSTVPVLEGETYTTRILVDHSIVESFAQGGRTVITSRIYPTKAIYGAARVF  628

Query  279  LFNNATGTSVKASVKIWQMNSADIKPFPF  193
            LFNNAT  SVKASVKIW+M SADIKPF F
Sbjct  629  LFNNATEASVKASVKIWEMGSADIKPFSF  657



>gb|AAK71504.1| soluble acid invertase FRUCT2 [Ipomoea batatas]
Length=657

 Score =   305 bits (782),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 169/211 (80%), Gaps = 2/211 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEGEG  646
            +LQWP+EEV+ LRSGDPI  + NL+PG ++PIH+    QLDI ASFEV     E      
Sbjct  444  VLQWPVEEVESLRSGDPITAEANLEPGSVVPIHVSEGTQLDITASFEVDETLLETTSESH  503

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  Y+CS+SGGAV RG+LGPFGL+V ADE L+ELTPVYFYV KG DGK +THFC D TRS
Sbjct  504  DSGYDCSNSGGAVTRGSLGPFGLLVVADEKLSELTPVYFYVAKGADGKAKTHFCADQTRS  563

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S ASGV KEVYGS+VPV+D E YSARIL+DHSIVESF QGGRTVITSRIYPTKAI+ AA+
Sbjct  564  SMASGVEKEVYGSSVPVLDGENYSARILIDHSIVESFAQGGRTVITSRIYPTKAIFGAAK  623

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            VFLFNNAT  +V ASVK+WQMNSADIK FP 
Sbjct  624  VFLFNNATKATVTASVKMWQMNSADIKRFPL  654



>ref|XP_009619840.1| PREDICTED: acid beta-fructofuranosidase AIV-18-like [Nicotiana 
tomentosiformis]
 emb|CAC83577.2| vacuolar invertase [Nicotiana tabacum]
Length=643

 Score =   294 bits (753),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 175/211 (83%), Gaps = 3/211 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            +LQWP++E++ LR GDP+V +VNLQPG I  +H+ +AAQLD+ ASFEV ++ A+EG  E 
Sbjct  431  VLQWPVKEIESLRIGDPLVKRVNLQPGSIELVHVDSAAQLDVEASFEV-DKAALEGTIEA  489

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  +NCS+SGGA KRG LGPFG+VV AD+TL+ELTPVYFY+ KG DG+ ET+FC D TRS
Sbjct  490  DVGFNCSTSGGAAKRGILGPFGVVVIADQTLSELTPVYFYIAKGPDGRAETYFCADETRS  549

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            SEA GV K+VYGS+VPV+DDE++S R+LVDHSIVESF QGGRTVITSRIYPTKAI  AAR
Sbjct  550  SEAPGVAKQVYGSSVPVLDDEQHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAINGAAR  609

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +F+FNNAT  SV AS+KIW + SADI+ FP 
Sbjct  610  LFVFNNATRASVTASLKIWSLESADIRSFPL  640



>gb|ADM47340.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46290.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46291.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46292.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46293.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   293 bits (749),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 176/212 (83%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+EE++ LR+GDPIV +VNLQPG I  +H+ +AA+LDI ASFEV ++ A++G  E 
Sbjct  426  LLQWPVEEIESLRAGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEV-DKVALQGIIEA  484

Query  645  DF-RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
            D   ++CS+SGGA  RG LGPFG+VV AD+TL+ELTPVYFY+ KG DG+ ETHFC D TR
Sbjct  485  DHVGFSCSTSGGAASRGILGPFGVVVIADQTLSELTPVYFYISKGADGRAETHFCADQTR  544

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SSEA GV K+VYGS+VPV+D EK+S R+LVDHSIVESF QGGRTVITSRIYPTKA+  AA
Sbjct  545  SSEAPGVAKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGAA  604

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+F+FNNATG+SV ASVKIW + SA+I+ FP 
Sbjct  605  RLFVFNNATGSSVTASVKIWSLESANIQSFPL  636



>gb|AAQ17074.1| acid invertase [Solanum tuberosum]
Length=639

 Score =   290 bits (743),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 175/212 (83%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+EE++ LR+GDPIV +VNLQPG I  +H+ +AA+LDI ASFEV ++ A++G  E 
Sbjct  426  LLQWPVEEIESLRAGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEV-DKVALQGIIEA  484

Query  645  DF-RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
            D   ++CS+SGGA  RG LGPFG+VV AD+TL+ELTPVYF++ KG DG+ ETHFC D TR
Sbjct  485  DHVGFSCSTSGGAASRGILGPFGVVVIADQTLSELTPVYFFISKGADGRAETHFCADQTR  544

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SSEA GV K+VYGS+VPV+D EK+S R+LVDHSIVESF QGGRTVITSRIYPTKA+  AA
Sbjct  545  SSEAPGVAKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGAA  604

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+F+FNNATG SV ASVKIW + SA+I+ FP 
Sbjct  605  RLFVFNNATGASVTASVKIWSLESANIRSFPL  636



>gb|AEV46289.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   290 bits (742),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 174/212 (82%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+EE++ LR+GDPIV +VNLQPG I  +H+ +AA+LDI ASFEV ++ A++G  E 
Sbjct  426  LLQWPVEEIESLRAGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEV-DKVALQGIIEA  484

Query  645  DF-RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
            D   ++CS+SGGA  RG LGPFG+VV AD+ L+ELTPVYFY+ KG DG+ ETHFC D TR
Sbjct  485  DHVGFSCSTSGGAASRGILGPFGVVVIADQKLSELTPVYFYISKGADGRAETHFCADQTR  544

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SSEA GV K+VYGS+VPV+D EK+S R+LVDHSIVESF QGGRTVITSRIYPTKA+  AA
Sbjct  545  SSEAPGVAKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGAA  604

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+F+FNNATG SV ASVKIW + SA+I+ FP 
Sbjct  605  RLFVFNNATGASVTASVKIWSLESANIRSFPL  636



>gb|ABF18956.1| acid invertase [Solanum tuberosum]
Length=639

 Score =   290 bits (741),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 174/212 (82%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+EE++ LR+GDPIV +VNLQPG I  +H+ +AA+LDI ASFEV ++ A++G  E 
Sbjct  426  LLQWPVEEIESLRAGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEV-DKVALQGIIEA  484

Query  645  DF-RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
            D   ++CS+SGGA  RG LGPFG+VV AD+TL+ELTPVYF++ KG DG+ ETHFC D TR
Sbjct  485  DHVGFSCSTSGGAASRGILGPFGVVVIADQTLSELTPVYFFISKGADGRAETHFCADQTR  544

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SSEA GV K VYGS+VPV+D EK+S R+LVDHSIVESF QGGRTVITSRIYPTKA+  AA
Sbjct  545  SSEAPGVAKRVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGAA  604

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+F+FNNATG SV ASVKIW + SA+I+ FP 
Sbjct  605  RLFVFNNATGASVTASVKIWSLESANIRSFPL  636



>gb|AEV46294.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46295.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   290 bits (741),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 174/212 (82%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+EE++ LR+GDPIV +VNLQPG I  +H+ +AA+LDI ASFEV ++ A++G  E 
Sbjct  426  LLQWPVEEIESLRAGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEV-DKVALQGIIEA  484

Query  645  DF-RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
            D   ++CS+SGGA  RG LGPFG+VV AD+TL+ELTPVYF++ KG DG+ ETHFC D TR
Sbjct  485  DHVGFSCSTSGGAASRGILGPFGVVVIADQTLSELTPVYFFISKGADGRAETHFCADQTR  544

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SSEA GV K VYGS+VPV+D EK+S R+LVDHSIVESF QGGRTVITSRIYPTKA+  AA
Sbjct  545  SSEAPGVAKRVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGAA  604

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+F+FNNATG SV ASVKIW + SA+I+ FP 
Sbjct  605  RLFVFNNATGASVTASVKIWSLESANIRSFPL  636



>ref|XP_009794076.1| PREDICTED: acid beta-fructofuranosidase AIV-18 [Nicotiana sylvestris]
Length=643

 Score =   289 bits (740),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 173/211 (82%), Gaps = 3/211 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            +LQWP++E++ LR GDP+V +VNLQPG I  +H+ +AAQLD+ ASFEV ++ A+ G  E 
Sbjct  431  VLQWPVKEIESLRIGDPLVKQVNLQPGSIELVHVDSAAQLDVEASFEV-DKAALAGTIEA  489

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  +NCS+SGGA KRG LGPFG+VV AD+TL+ELTPVYFY+ KG  G+ ET+FC D TRS
Sbjct  490  DVGFNCSTSGGAAKRGILGPFGVVVIADQTLSELTPVYFYIAKGTGGRAETYFCADETRS  549

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            SEA GV K+VYGS+VPV+D E++S R+LVDHSIVESF QGGRTVITSRIYPTKAI  AAR
Sbjct  550  SEAPGVAKQVYGSSVPVLDGEQHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAINGAAR  609

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +F+FNNATG SV AS+KIW + SADI+ FP 
Sbjct  610  LFVFNNATGASVTASLKIWSLKSADIRSFPL  640



>gb|AEV46287.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46288.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   289 bits (739),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 173/212 (82%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+EE++ LR GDPIV +VNLQPG I  +H+ +AA+LDI ASFEV ++ A++G  E 
Sbjct  426  LLQWPVEEIESLRVGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEV-DKVALQGIIEA  484

Query  645  DF-RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
            D   ++CS+SGGA  RG LGPFG+VV AD+ L+ELTPVYFY+ KG DG+ ETHFC D TR
Sbjct  485  DHVGFSCSTSGGAASRGILGPFGVVVIADQKLSELTPVYFYISKGADGRAETHFCADQTR  544

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SSEA GV K+VYGS+VPV+D EK+S R+LVDHSIVESF QGGRTVITSRIYPTKA+  AA
Sbjct  545  SSEAPGVAKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGAA  604

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+F+FNNATG SV ASVKIW + SA+I+ FP 
Sbjct  605  RLFVFNNATGASVTASVKIWSLESANIRSFPL  636



>sp|P93761.1|INV1_CAPAN RecName: Full=Acid beta-fructofuranosidase AIV-18; AltName: Full=Acid 
invertase; AltName: Full=Acid sucrose hydrolase [Capsicum 
annuum]
 gb|AAB48484.1| acid beta-fructosidase [Capsicum annuum]
Length=640

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 167/211 (79%), Gaps = 3/211 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+ E++ LRSGDP V +VNLQPG I  +H+ +AAQ DI ASFEV +   +EG  E 
Sbjct  428  LLQWPVAEIESLRSGDPKVKEVNLQPGSIELLHVDSAAQFDIEASFEV-DRVTLEGIIEA  486

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNCS+SGGA  RG LGPFG+VV AD+TL+ELTPVYFY+ +G DG+ E HFC D TRS
Sbjct  487  DVGYNCSTSGGAASRGILGPFGVVVIADQTLSELTPVYFYISRGADGRAEAHFCADQTRS  546

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            SEA GV K+VYGS+VPV+D EK+  R+LVDHSIVESF QGGRTVITSRIYPTKA+  AAR
Sbjct  547  SEAPGVAKQVYGSSVPVLDGEKHRMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGAAR  606

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +F+FNNATG  V AS+KIW + SADI+ FP 
Sbjct  607  LFVFNNATGAIVTASLKIWSLESADIRSFPL  637



>ref|NP_001274993.1| beta-fructosidase [Solanum tuberosum]
 gb|AEV46297.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 173/212 (82%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+EE++ LR+GDPIV + NLQPG I  +H+ +AA+LDI ASFEV ++ A++G  E 
Sbjct  426  LLQWPVEEIESLRAGDPIVKQANLQPGSIELLHVDSAAELDIEASFEV-DKVALQGIIEA  484

Query  645  DF-RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
            D   ++CS+SGGA  RG LGPFG+VV AD+TL+ELTPVYFY+ KG DG+ ETHFC D TR
Sbjct  485  DHVGFSCSTSGGAASRGILGPFGIVVIADQTLSELTPVYFYISKGADGRAETHFCADQTR  544

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SS A GV K+VYGS+VPV+D EK+S R+LVDHSIVESF QGGRTVITSRIYPTKA+  AA
Sbjct  545  SSVAPGVAKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGAA  604

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+F+FNNATG SV ASVKIW + SA+I+ FP 
Sbjct  605  RLFVFNNATGASVTASVKIWSLESANIRSFPL  636



>gb|ACC93585.1| beta-fructofuranosidase [Solanum tuberosum]
Length=639

 Score =   288 bits (736),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 173/212 (82%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+EE++ LR+GDPIV +VNLQPG I  +H+ +AA+LDI ASFEV ++ A++G  E 
Sbjct  426  LLQWPVEEIESLRAGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEV-DKVALQGIIEA  484

Query  645  DF-RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
            D   ++CS+SGGA  RG LGPFG+VV AD+TL+ELTPVYF++ KG DG+ ETHFC D TR
Sbjct  485  DHVGFSCSTSGGAASRGILGPFGVVVIADQTLSELTPVYFFISKGADGRAETHFCADQTR  544

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SSEA GV K VYGS+VPV+D EK S R+LVDHSIVESF QGGRTVITSRIYPTKA+  AA
Sbjct  545  SSEAPGVAKRVYGSSVPVLDGEKRSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGAA  604

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+F+FNNATG SV ASVKIW + SA+I+ FP 
Sbjct  605  RLFVFNNATGASVTASVKIWSLESANIRSFPL  636



>gb|AEV46296.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   287 bits (735),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 175/218 (80%), Gaps = 4/218 (2%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            ++    LLQWP+EE++ LR+GDPIV + NLQPG I  +H+ +AA+LDI ASFEV ++ A+
Sbjct  420  KKTRTHLLQWPVEEIESLRAGDPIVKQANLQPGSIELLHVDSAAELDIEASFEV-DKVAL  478

Query  657  EG--EGDF-RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHF  487
            +G  E D   ++CS+SGGA  RG LGPFG+VV AD+TL+ELTPVYFY+ KG DG+ +THF
Sbjct  479  QGIIEADHVGFSCSTSGGAASRGILGPFGVVVIADQTLSELTPVYFYISKGADGRAQTHF  538

Query  486  CTDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTK  307
            C D TRSS A GV K+VYGS+VPV+D EK+S R+LVDHSIVESF QGGRTVITSRIYPTK
Sbjct  539  CADQTRSSVAPGVAKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTK  598

Query  306  AIYEAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            A+  AAR+F+FNNATG SV ASVKIW + SA+I+ FP 
Sbjct  599  AVNGAARLFVFNNATGASVTASVKIWSLESANIRSFPL  636



>emb|CAA49831.1| beta-fructofuranosidase [Solanum tuberosum]
Length=634

 Score =   286 bits (732),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 172/212 (81%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+EE++ LR GDPIV +VNLQPG I  +H+ +AA+LDI ASFEV ++ A++G  E 
Sbjct  421  LLQWPVEEIESLRVGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEV-DKVALQGIIEA  479

Query  645  DF-RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
            D   ++CS+SGGA  RG LGPFG+VV AD+ L+ELTPVYFY+ KG DG+ ETHFC D TR
Sbjct  480  DHVGFSCSTSGGAASRGILGPFGVVVIADQKLSELTPVYFYISKGADGRAETHFCADQTR  539

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SSEA GV K+VYGS+VPV+D EK+S R+L DHSIVESF QGGRTVITSRIYPTKA+  AA
Sbjct  540  SSEAPGVAKQVYGSSVPVLDGEKHSMRLLEDHSIVESFAQGGRTVITSRIYPTKAVNGAA  599

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+F+FNNATG SV ASVKIW + SA+I+ FP 
Sbjct  600  RLFVFNNATGASVTASVKIWSLESANIRSFPL  631



>gb|AAA50305.1| beta-fructosidase [Solanum tuberosum]
Length=639

 Score =   284 bits (727),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 172/212 (81%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+EE++ LR GDPIV +VNLQPG I  +H+ +AA+LDI ASFEV ++ A++G  E 
Sbjct  426  LLQWPVEEIESLRGGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEV-DKVALQGIIEA  484

Query  645  DF-RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
            D   ++CS+SGGA  RG LGPFG+VV AD+ L+++TPVYFY+ KG DG+ ETHFC D TR
Sbjct  485  DHVGFSCSTSGGAASRGILGPFGVVVIADQKLSDVTPVYFYISKGADGRAETHFCADQTR  544

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SSEA GV K+VYGS+VPV+D EK+S R+LVDHSIVESF QGGRTVITSRIYPTKA+  AA
Sbjct  545  SSEAPGVAKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGAA  604

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+F+FNN TG SV ASVKIW + SA+I+ FP 
Sbjct  605  RLFVFNNRTGASVTASVKIWSLESANIRSFPL  636



>gb|ACC93584.1| beta-fructofuranosidase, partial [Solanum tuberosum]
Length=635

 Score =   284 bits (727),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 172/212 (81%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+EE++ LR+GDPIV +VNLQPG I  +H+ +AA+LDI ASFEV ++ A++G  E 
Sbjct  422  LLQWPVEEIESLRAGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEV-DKVALQGIIEA  480

Query  645  DF-RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
            D   ++CS+SGGA  RG LGPFG+VV AD+TL+ELTPVYF++ KG DG+ E HFC D TR
Sbjct  481  DHVGFSCSTSGGAASRGILGPFGVVVIADQTLSELTPVYFFISKGADGRAEAHFCADQTR  540

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SSEA GV K VYGS+VPV+D EK+S R+LVDHSIVESF QGGRTVITSRIYPTKA+  AA
Sbjct  541  SSEAPGVAKRVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGAA  600

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+ +FNNATG SV ASVKIW + SA+I+ FP 
Sbjct  601  RLVVFNNATGASVTASVKIWSLESANIQSFPL  632



>sp|P29000.1|INVA_SOLLC RecName: Full=Acid beta-fructofuranosidase; AltName: Full=Acid 
invertase; Short=AI; AltName: Full=Acid sucrose hydrolase; 
AltName: Full=Vacuolar invertase; Flags: Precursor [Solanum 
lycopersicum]
 pir||S31157 beta-fructofuranosidase (EC 3.2.1.26) precursor - currant tomato
 emb|CAA78060.1| vacuolar invertase precursor [Solanum lycopersicum]
 emb|CAA78061.1| vacuolar invertase precursor [Solanum pimpinellifolium]
 emb|CAA78062.1| beta-fructofuranosidase [Solanum lycopersicum]
 emb|CAA78063.1| beta-fructofuranosidase [Solanum pimpinellifolium]
 gb|AAA34132.1| acid invertase [Solanum lycopersicum]
Length=636

 Score =   282 bits (721),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 172/212 (81%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+EE++ LR GDP V +V+LQPG I  + + +AA+LDI ASFEV ++ A++G  E 
Sbjct  423  LLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEV-DKVALQGIIEA  481

Query  645  DF-RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
            D   ++CS+SGGA  RG LGPFG++V AD+TL+ELTPVYFY+ KG DG+ ETHFC D TR
Sbjct  482  DHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETHFCADQTR  541

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SSEA GV K+VYGS+VPV+D EK+S R+LVDHSIVESF QGGRTVITSRIYPTKA+  AA
Sbjct  542  SSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGAA  601

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+F+FNNATG SV ASVKIW + SA+I+ FP 
Sbjct  602  RLFVFNNATGASVTASVKIWSLESANIQSFPL  633



>gb|ADE44160.1| acid invertase [Solanum lycopersicum var. cerasiforme]
Length=636

 Score =   281 bits (720),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 172/212 (81%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+EE++ LR GDP V +V+LQPG I  + + +AA+LDI ASFEV ++ A++G  E 
Sbjct  423  LLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEV-DKVALQGIIEA  481

Query  645  DF-RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
            D   ++CS+SGGA  RG LGPFG++V AD+TL+ELTPVYFY+ KG DG+ ETHFC D TR
Sbjct  482  DHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETHFCADQTR  541

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SSEA GV K+VYGS+VPV+D EK+S R+LVDHSIVESF QGGRTVITSRIYPTKA+  AA
Sbjct  542  SSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGAA  601

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+F+FNNATG SV ASVKIW + SA+I+ FP 
Sbjct  602  RLFVFNNATGASVTASVKIWSLESANIQSFPL  633



>gb|AAL75450.1|AF465613_1 minor allergen beta-fructofuranosidase precursor [Solanum lycopersicum]
Length=636

 Score =   281 bits (720),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 172/212 (81%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+EE++ LR GDP V +V+LQPG I  + + +AA+LDI ASFEV ++ A++G  E 
Sbjct  423  LLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEV-DKVALQGIIEA  481

Query  645  DF-RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
            D   ++CS+SGGA  RG LGPFG++V AD+TL+ELTPVYFY+ KG DG+ ETHFC D TR
Sbjct  482  DHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETHFCADQTR  541

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SSEA GV K+VYGS+VPV+D EK+S R+LVDHSIVESF QGGRTVITSRIYPTKA+  AA
Sbjct  542  SSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGAA  601

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+F+FNNATG SV ASVKIW + SA+I+ FP 
Sbjct  602  RLFVFNNATGASVTASVKIWSLESANIQSFPL  633



>prf||1905419A invertase
Length=635

 Score =   278 bits (711),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 172/212 (81%), Gaps = 5/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+EE++ LR GDP V +V+LQPG I  + + +AA+LDI ASFEV ++ A++G  E 
Sbjct  423  LLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEV-DKVALQGIIEA  481

Query  645  DF-RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
            D   ++CS+SGGA  RG LGPFG+V+A D+TL+ELTPVYFY+ KG DG+ ETHFC D TR
Sbjct  482  DHVGFSCSTSGGAASRGILGPFGIVIA-DQTLSELTPVYFYISKGADGRAETHFCADQTR  540

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SSEA GV K+VYGS+VPV+D EK+S R+LVDHSIVESF QGGRTVITSRIYPTKA+  AA
Sbjct  541  SSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGAA  600

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+F+FNNATG SV ASVKIW + SA+I+ FP 
Sbjct  601  RLFVFNNATGASVTASVKIWSLESANIQSFPL  632



>gb|ADF27779.1| soluble acid invertase 1 [Orobanche ramosa]
Length=661

 Score =   279 bits (713),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 166/212 (78%), Gaps = 3/212 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE---GE  649
            +LQWP+EE++ LRS       V L+PG + P+ + +A+QLD++ASFE+ ++E+VE   GE
Sbjct  447  ILQWPVEEIESLRSDIVEFNDVKLRPGSVTPLKVGSASQLDLVASFEIDHKESVEAIVGE  506

Query  648  GDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
             +  Y+C +SGGA KRG LGPFG+VV ADETL+ELTP+YFY  KG +GK ETHFC D  R
Sbjct  507  AETGYDCPTSGGAAKRGVLGPFGVVVLADETLSELTPIYFYTAKGHNGKTETHFCADGLR  566

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SSEA+ V K VYGS VPV+D EK S R LVDHSI+ESF QGGRTVITSRIYPTKAI  +A
Sbjct  567  SSEAADVDKIVYGSKVPVLDGEKLSIRSLVDHSIIESFAQGGRTVITSRIYPTKAIDGSA  626

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            RVFLFNNATG SV ASVKIW+M SADI+PFP 
Sbjct  627  RVFLFNNATGISVTASVKIWKMESADIRPFPL  658



>ref|NP_001234843.1| acid invertase [Solanum lycopersicum]
 gb|AAB30874.1| acid invertase [Solanum lycopersicum]
Length=636

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 171/212 (81%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+EE++ LR GDP V +V+LQPG I  + + +AA+LDI ASFEV ++ A++G  E 
Sbjct  423  LLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEV-DKVALQGIIEA  481

Query  645  DF-RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
            D   ++CS+SGGA  RG LGPFG++V AD+TL+++TPVYFY+ KG DG+ ETHFC D TR
Sbjct  482  DHVGFSCSTSGGAASRGILGPFGVIVIADQTLSDVTPVYFYISKGADGRAETHFCADQTR  541

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SSEA GV K+VYGS+VPV+D EK+S R+LVDHSIVESF QGGRTVITSRIYPTKA+  AA
Sbjct  542  SSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGAA  601

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+F+FNNATG SV ASVKIW + S +I+ FP 
Sbjct  602  RLFVFNNATGASVTASVKIWSLESVNIQSFPL  633



>gb|ABX55832.1| soluble acid invertase [Cucumis melo]
Length=636

 Score =   276 bits (706),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 169/212 (80%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+EE++ LR GDP V +V+LQ G I  +   +AA+LDI ASFEV ++ A++G  E 
Sbjct  423  LLQWPVEEIESLRVGDPTVKQVDLQSGSIELLRADSAAELDIEASFEV-DKVALQGIIEA  481

Query  645  DF-RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
            D   ++CS+SGGA  RG LGPFG++V AD+TL+ELTPVYFY+ KG DG  ETHFC D TR
Sbjct  482  DHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGHAETHFCADQTR  541

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SSEA GV K+VYGS+VPV+D EK+S R+LVDHSIVESF QGGRTVITSRIYPTKA+  AA
Sbjct  542  SSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGAA  601

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+F+FNNATG SV ASVKIW + SA+I+ FP 
Sbjct  602  RLFVFNNATGASVTASVKIWSLESANIQSFPL  633



>sp|P80065.2|INVB_DAUCA RecName: Full=Beta-fructofuranosidase, soluble isoenzyme I; AltName: 
Full=Invertase; AltName: Full=Saccharase; AltName: Full=Sucrose 
hydrolase; Flags: Precursor [Daucus carota]
 emb|CAA53097.1| beta-fructofuranosidase [Daucus carota]
 emb|CAA77267.1| beta-fructofuranosidase, isoform I [Daucus carota]
Length=661

 Score =   276 bits (706),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 165/211 (78%), Gaps = 3/211 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            +LQWP++EV+ LRS    +  V L+PG ++P+ I +AAQLDI+ASFEV +EEA +G  E 
Sbjct  449  ILQWPVKEVESLRSRSYEIDDVELKPGSLVPLKISSAAQLDIVASFEV-DEEAFKGTYEA  507

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNC++S GA  RG LGPFG++V AD+ L+ELTPVYFY+ KG DG  +T+FC D +RS
Sbjct  508  DASYNCTASEGAAGRGILGPFGILVLADDPLSELTPVYFYIAKGVDGNAKTYFCADQSRS  567

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S AS V KEVYGS VPV+  E  S R+LVDHSIVESF QGGRTVITSR+YPT+AIY AAR
Sbjct  568  STASDVDKEVYGSDVPVLHGESLSMRLLVDHSIVESFAQGGRTVITSRVYPTRAIYSAAR  627

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            VFLFNNATG SV ASVK WQM SA +KPFPF
Sbjct  628  VFLFNNATGVSVTASVKAWQMASATLKPFPF  658



>emb|CAA53099.1| beta-fructofuranosidase [Daucus carota]
Length=661

 Score =   276 bits (706),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 165/211 (78%), Gaps = 3/211 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            +LQWP++EV+ LRS    +  V L+PG ++P+ I +AAQLDI+ASFEV +EEA +G  E 
Sbjct  449  ILQWPVKEVESLRSRSYEINDVELKPGSLVPLKISSAAQLDIVASFEV-DEEAFKGTYEA  507

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNC++S GA  RG LGPFG++V AD+ L+ELTPVYFY+ KG DG  +T+FC D +RS
Sbjct  508  DASYNCTASEGAAGRGILGPFGILVLADDPLSELTPVYFYIAKGVDGNAKTYFCADQSRS  567

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S AS V KEVYGS VPV+  E  S R+LVDHSIVESF QGGRTVITSR+YPT+AIY AAR
Sbjct  568  STASDVDKEVYGSDVPVLPGESLSMRLLVDHSIVESFAQGGRTVITSRVYPTRAIYSAAR  627

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            VFLFNNATG SV ASVK WQM SA +KPFPF
Sbjct  628  VFLFNNATGVSVTASVKAWQMASATLKPFPF  658



>gb|ABI17894.1| vacuolar invertase [Coffea canephora]
Length=586

 Score =   274 bits (701),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 161/210 (77%), Gaps = 3/210 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            +LQWP+EE + LR        V L+PG I P++I +A QLDIIASFEV + EA+E   E 
Sbjct  376  ILQWPVEEAESLRFNATEFDTVKLEPGSIAPLNIGSATQLDIIASFEV-DSEALEATVEA  434

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNC++SGGA  RG LGPFGL+V AD +L+ELTPVYFY+ K  DG  ETHFC+D +RS
Sbjct  435  DVGYNCTTSGGAASRGKLGPFGLLVLADGSLSELTPVYFYISKSTDGSAETHFCSDESRS  494

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A  V K VYGSTVPV+D EK SAR+LVDHS+VESF QGGR VITSR+YPTKAIY AAR
Sbjct  495  SKAPDVGKLVYGSTVPVLDGEKLSARLLVDHSVVESFAQGGRRVITSRVYPTKAIYGAAR  554

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFP  196
            +FLFNNATG SV AS KIW M SADI+ FP
Sbjct  555  LFLFNNATGVSVTASAKIWHMRSADIRTFP  584



>emb|CDP05324.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 161/210 (77%), Gaps = 3/210 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            +LQWP+EE + LR        V L+PG I P++I +A QLDIIASFEV + EA+E   E 
Sbjct  329  ILQWPVEEAESLRFNATEFDTVKLEPGSIAPLNIGSATQLDIIASFEV-DSEALEATVEA  387

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNC++SGGA  RG LGPFGL+V AD +L+ELTPVYFY+ K  DG  ETHFC+D +RS
Sbjct  388  DVGYNCTTSGGAASRGKLGPFGLLVLADGSLSELTPVYFYISKSTDGSAETHFCSDESRS  447

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A  V K VYGSTVPV++ EK SAR+LVDHS+VESF QGGR VITSR+YPTKAIY AAR
Sbjct  448  SKAPDVGKLVYGSTVPVLEGEKLSARLLVDHSVVESFAQGGRRVITSRVYPTKAIYGAAR  507

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFP  196
            +FLFNNATG SV AS KIW M SADI+ FP
Sbjct  508  LFLFNNATGVSVTASAKIWHMRSADIRTFP  537



>gb|AFV59227.2| vacuolar invertase NvINV [Elsholtzia haichowensis]
Length=637

 Score =   274 bits (700),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 166/211 (79%), Gaps = 3/211 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            +LQWP+EEV+ LRS       V L PG I+P+ + + +QLD++A+F++ +E+A EG  EG
Sbjct  425  ILQWPVEEVESLRSESVEFNDVKLAPGSIVPLSVDSPSQLDLVATFDI-DEKAAEGLSEG  483

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  Y+C++SGGA  RG LGPFG+VV AD+TL+ELTP+YFY+ KG +GK++THFC D  RS
Sbjct  484  ESSYDCTTSGGAANRGVLGPFGIVVFADQTLSELTPIYFYIAKGLNGKIQTHFCADELRS  543

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S AS V K VYGSTVPV+D EK S R LVDHSIVESF QGGR VITSRIYPTKAI EA+R
Sbjct  544  SIASDVDKIVYGSTVPVLDGEKLSIRSLVDHSIVESFAQGGRRVITSRIYPTKAINEASR  603

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            + LFNNATG SV AS+KIW+MNSADI PFP 
Sbjct  604  ILLFNNATGASVIASIKIWKMNSADIHPFPL  634



>gb|AFV59228.1| vacuolar invertase CvINV [Elsholtzia haichowensis]
Length=637

 Score =   274 bits (700),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 166/211 (79%), Gaps = 3/211 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            +LQWP+EEV+ LRS       V L PG I+P+ + + +QLD++A+F++ +E+A EG  EG
Sbjct  425  ILQWPVEEVESLRSESVEFNDVKLAPGSIVPLSVDSPSQLDLVATFDI-DEKAAEGLSEG  483

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  Y+C++SGGA  RG LGPFG+VV AD+TL+ELTP+YFY+ KG +GK++THFC D  RS
Sbjct  484  ESSYDCTTSGGAANRGVLGPFGIVVFADQTLSELTPIYFYIAKGLNGKIQTHFCADELRS  543

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S AS V K VYGSTVPV+D EK S R LVDHSIVESF QGGR VITSRIYPTKAI EA+R
Sbjct  544  SIASDVDKIVYGSTVPVLDGEKLSIRSLVDHSIVESFAQGGRRVITSRIYPTKAINEASR  603

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            + LFNNATG SV AS+KIW+MNSADI PFP 
Sbjct  604  ILLFNNATGASVIASIKIWKMNSADIHPFPL  634



>emb|CAA53098.1| beta-fructofuranosidase [Daucus carota]
Length=661

 Score =   273 bits (699),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 164/211 (78%), Gaps = 3/211 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            +LQWP++EV+ LRS    +  V L+PG ++P+ I +AAQLDI+ASFEV +EEA +   E 
Sbjct  449  ILQWPVKEVESLRSRSYEINDVELKPGSLVPLKISSAAQLDIVASFEV-DEEAFKRTYEA  507

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNC++S GA  RG LGPFG++V AD+ L+ELTPVYFY+ KG DG  +T+FC D +RS
Sbjct  508  DASYNCTASEGAAGRGILGPFGILVLADDPLSELTPVYFYIAKGVDGNAKTYFCADQSRS  567

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S AS V KEVYGS VPV+  E  S R+LVDHSIVESF QGGRTVITSR+YPT+AIY AAR
Sbjct  568  STASDVDKEVYGSDVPVLPGESLSMRLLVDHSIVESFAQGGRTVITSRVYPTRAIYSAAR  627

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            VFLFNNATG SV ASVK WQM SA +KPFPF
Sbjct  628  VFLFNNATGVSVTASVKAWQMASATLKPFPF  658



>ref|XP_011076337.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Sesamum indicum]
Length=657

 Score =   271 bits (692),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 161/211 (76%), Gaps = 2/211 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            +LQWP+EEV+ LRS       V L PG ++P+ + +A++LDI+ASFEV  E   E   E 
Sbjct  444  ILQWPVEEVESLRSDSFEFNDVRLGPGSVVPLAVDSASELDIVASFEVHKETVDEATAEA  503

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  Y+C +SGGA  RG LGPFG+VV AD+TL+ELTP+YFY+ KG +GK  THFC D  RS
Sbjct  504  DTGYDCPTSGGAANRGILGPFGIVVLADDTLSELTPIYFYIAKGTNGKAVTHFCADELRS  563

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A+ V K VYGS VP++  EK S R LVDHSIVESF QGGRTVITSR+YPTKAI  AAR
Sbjct  564  SKAADVDKIVYGSKVPLLQHEKLSIRSLVDHSIVESFAQGGRTVITSRVYPTKAIGRAAR  623

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            VFLFNNATG SV ASVKIW+M+SADI+PFPF
Sbjct  624  VFLFNNATGLSVTASVKIWKMDSADIRPFPF  654



>ref|XP_006440371.1| hypothetical protein CICLE_v10019134mg [Citrus clementina]
 gb|ESR53611.1| hypothetical protein CICLE_v10019134mg [Citrus clementina]
Length=508

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 164/210 (78%), Gaps = 3/210 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+EEV  LR       K+ L+PG ++P+ + +A QLDI+A FE +++ A+E   E 
Sbjct  258  LLQWPVEEVDSLRLTSKEFKKIELKPGSVMPLDVGSATQLDIVAEFE-LDKAALEKTAES  316

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++CSSS G+ +RGALGPFGL+V AD++L+E TPVYFY+ KG DG ++T+FCTD +RS
Sbjct  317  NVEFSCSSSEGSAERGALGPFGLLVLADDSLSEQTPVYFYIAKGKDGSLKTYFCTDQSRS  376

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            SEA+ V K  YGS VPV++ EK+S R+LVDHSIVE F QGGRT ITSR+YPTKAIY AAR
Sbjct  377  SEANDVNKSKYGSFVPVLEGEKFSMRVLVDHSIVEGFAQGGRTTITSRVYPTKAIYGAAR  436

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFP  196
            VFLFNNATG SV +S+K WQMNSA I+P+P
Sbjct  437  VFLFNNATGASVTSSLKAWQMNSAFIRPYP  466



>ref|XP_007157332.1| hypothetical protein PHAVU_002G061200g [Phaseolus vulgaris]
 gb|ESW29326.1| hypothetical protein PHAVU_002G061200g [Phaseolus vulgaris]
Length=649

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 162/208 (78%), Gaps = 1/208 (0%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEE-AVEGEGD  643
            LLQWP+ EV+RLR G      + ++PG ++P+ I  AAQLDI+A FE+ N+   + G+ +
Sbjct  434  LLQWPVAEVERLRLGSDEFENLKVKPGSVVPLQIGTAAQLDIVAEFEIDNKALEMTGQSN  493

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              Y CS+SGGA +RGALGPFGL+V AD  L+E TP YFYV KG DG+++T FC+D +RSS
Sbjct  494  MEYECSTSGGAAERGALGPFGLLVLADHDLSEYTPTYFYVVKGSDGQLKTSFCSDQSRSS  553

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
             A+ V K+++GS+VPV+ DEK S RILVDHS+VESF QGGRT +TSR+YPTKAIY AAR+
Sbjct  554  LATDVGKKIFGSSVPVLKDEKLSVRILVDHSVVESFAQGGRTCVTSRVYPTKAIYGAARL  613

Query  282  FLFNNATGTSVKASVKIWQMNSADIKPF  199
            FLFNNAT  +V ASVK+WQMNSA I+PF
Sbjct  614  FLFNNATQVTVTASVKVWQMNSAFIRPF  641



>gb|KJB51890.1| hypothetical protein B456_008G236700 [Gossypium raimondii]
 gb|KJB51891.1| hypothetical protein B456_008G236700 [Gossypium raimondii]
 gb|KJB51892.1| hypothetical protein B456_008G236700 [Gossypium raimondii]
Length=472

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 165/210 (79%), Gaps = 3/210 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGE--G  646
            LLQWP+EE++ LR       +V +Q G ++P+ +  A QLDIIA FE+ ++EA+E     
Sbjct  258  LLQWPVEEIESLRLKSYEFNQVKVQAGSVVPLDVGPATQLDIIAEFEI-DKEALEKTTGS  316

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++CSSSGG ++RGALGPFGL+V AD++L+E TPVYFY+ KG DGK++T FC D +RS
Sbjct  317  NVTFSCSSSGGTIERGALGPFGLLVLADDSLSEQTPVYFYIAKGSDGKLKTFFCNDQSRS  376

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S AS V K++YG+ VPV++ EK S R+LVDHSIVESF QGGRTVITSR+YPTKAIY AA+
Sbjct  377  SVASDVNKQIYGNLVPVLEGEKLSLRVLVDHSIVESFAQGGRTVITSRVYPTKAIYGAAK  436

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFP  196
            +FLFNNAT  SV AS++IWQMNSA I+P+P
Sbjct  437  LFLFNNATEASVSASLRIWQMNSAFIRPYP  466



>dbj|BAP47496.1| invertase [Gentiana triflora]
Length=658

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 160/213 (75%), Gaps = 6/213 (3%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEV------MNEEAV  658
            +LQWP+EE++ LR G      V L PG ++P+ + + AQLDI+ASFEV            
Sbjct  446  ILQWPVEEMESLRQGGNEFNNVKLPPGSVVPLDVGSGAQLDIVASFEVDKVALEEATTEE  505

Query  657  EGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTD  478
            E   +  Y C++SGGA  RG LGPFGL+V AD +L+ELTPVYFY+ KG DGK++THFC+D
Sbjct  506  EEADNTSYQCTTSGGASSRGKLGPFGLIVFADASLSELTPVYFYITKGPDGKIQTHFCSD  565

Query  477  LTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIY  298
             +RSS+A  V+KE+YGSTVPV+  EK S RILVDHSIVESF QGGRTVITSR+YPTKAIY
Sbjct  566  ESRSSQAPDVSKEIYGSTVPVLAGEKLSVRILVDHSIVESFAQGGRTVITSRVYPTKAIY  625

Query  297  EAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
             AAR+FLFNNATG +V AS KIW +NSADI+ +
Sbjct  626  TAARLFLFNNATGVTVSASAKIWHLNSADIRSY  658



>emb|CAH18938.1| 2,1-fructan:2,1-fructan 1-fructosyltransferase precursor [Bellis 
perennis]
Length=522

 Score =   263 bits (671),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 166/217 (76%), Gaps = 4/217 (2%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            R+    LL WP+EE++ LRS +    ++ ++PG  +P+ I +A QLDIIA+FEV +EEA+
Sbjct  307  RKTGTHLLHWPVEEIETLRS-NVREFEIEVKPGSTVPLEIGSATQLDIIATFEV-DEEAL  364

Query  657  EG--EGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            E   E +  Y C++S GA +RG LGPFG+ V ADETL+ELTPVYFY+ K  +G V THFC
Sbjct  365  EATSETNDEYGCTTSSGAAERGRLGPFGVAVLADETLSELTPVYFYIAKNSNGGVTTHFC  424

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD  RS+      ++VYGSTVPV+DDEK + RILVDHS+VE F QGGRTVITSR+YPTKA
Sbjct  425  TDKLRSALDYDNERKVYGSTVPVLDDEKPTMRILVDHSVVEGFAQGGRTVITSRVYPTKA  484

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            IYE A++FLFNNATGTSVKAS+KIWQM +  ++P+PF
Sbjct  485  IYEGAKIFLFNNATGTSVKASLKIWQMATVHVQPYPF  521



>gb|KJB37600.1| hypothetical protein B456_006G212600 [Gossypium raimondii]
 gb|KJB37602.1| hypothetical protein B456_006G212600 [Gossypium raimondii]
Length=469

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 158/210 (75%), Gaps = 2/210 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEGEG  646
            LLQWP+EE+  LR       +V +Q G ++P+ I +A QLDIIA F++ ++  E   G  
Sbjct  258  LLQWPVEEIDSLRLKGKEFNQVRIQAGSVVPLDIDSATQLDIIAEFKIDSDALEKATGSS  317

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  ++C++SGGA +RGALGPFGL+V ADE L E TPVYFY+ KG DG ++T FC D +RS
Sbjct  318  DASFDCATSGGAAERGALGPFGLLVLADERLREQTPVYFYMTKGSDGNLKTFFCNDQSRS  377

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+AS V K +YGS VPV+  E  S RILVDHSI+ESFGQGGRTVITSR+YPTK IY AA+
Sbjct  378  SKASDVDKHIYGSLVPVLRGENLSIRILVDHSIIESFGQGGRTVITSRVYPTKVIYGAAK  437

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFP  196
            VFLFNNAT  +V AS+KIWQMNSA I+P+P
Sbjct  438  VFLFNNATELNVTASLKIWQMNSAFIQPYP  467



>ref|NP_001275813.1| acid beta-fructofuranosidase-like [Citrus sinensis]
 ref|XP_006440372.1| hypothetical protein CICLE_v10019134mg [Citrus clementina]
 dbj|BAF34362.1| beta-fructofuranosidase [Citrus sinensis]
 gb|ESR53612.1| hypothetical protein CICLE_v10019134mg [Citrus clementina]
Length=687

 Score =   266 bits (680),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 164/210 (78%), Gaps = 3/210 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+EEV  LR       K+ L+PG ++P+ + +A QLDI+A FE +++ A+E   E 
Sbjct  437  LLQWPVEEVDSLRLTSKEFKKIELKPGSVMPLDVGSATQLDIVAEFE-LDKAALEKTAES  495

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++CSSS G+ +RGALGPFGL+V AD++L+E TPVYFY+ KG DG ++T+FCTD +RS
Sbjct  496  NVEFSCSSSEGSAERGALGPFGLLVLADDSLSEQTPVYFYIAKGKDGSLKTYFCTDQSRS  555

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            SEA+ V K  YGS VPV++ EK+S R+LVDHSIVE F QGGRT ITSR+YPTKAIY AAR
Sbjct  556  SEANDVNKSKYGSFVPVLEGEKFSMRVLVDHSIVEGFAQGGRTTITSRVYPTKAIYGAAR  615

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFP  196
            VFLFNNATG SV +S+K WQMNSA I+P+P
Sbjct  616  VFLFNNATGASVTSSLKAWQMNSAFIRPYP  645



>dbj|BAB82419.1| acid invertase [Citrus unshiu]
Length=687

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 164/210 (78%), Gaps = 3/210 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+EEV  LR       K+ L+PG ++P+ + +A QLDI+A FE +++ A+E   E 
Sbjct  437  LLQWPVEEVDSLRLTSKEFKKIELKPGSVMPLDVGSATQLDIVAEFE-LDKAALEKTAES  495

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++CSSS G+ +RGALGPFGL+V AD++L+E TPVYFY+ KG DG ++T+FCTD +RS
Sbjct  496  NVEFSCSSSEGSAERGALGPFGLLVLADDSLSEQTPVYFYIAKGKDGSLKTYFCTDQSRS  555

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            SEA+ V K  YGS VPV++ EK+S R+LVDHSIVE F QGGRT ITSR+YPTKAIY AAR
Sbjct  556  SEANDVNKSKYGSFVPVLEGEKFSMRVLVDHSIVEGFAQGGRTTITSRVYPTKAIYGAAR  615

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFP  196
            VFLFNNATG SV +S+K WQMNSA I+P+P
Sbjct  616  VFLFNNATGASVTSSLKAWQMNSAFIRPYP  645



>gb|EYU24965.1| hypothetical protein MIMGU_mgv1a004782mg [Erythranthe guttata]
Length=510

 Score =   259 bits (662),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 157/213 (74%), Gaps = 4/213 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPI-VTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE---G  652
            +LQWP+EEV++LRS   +    V L PG I+PI + + +QLDIIASFEV  +   E    
Sbjct  293  ILQWPVEEVEKLRSHTSVDFNDVKLGPGSIIPIKVDSPSQLDIIASFEVDEDATFETSAN  352

Query  651  EGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLT  472
            E +  Y+C +SGGA  RG LGPFG++V AD+ L+E TP+YFY+ KG +G  ETHFC D  
Sbjct  353  ETESSYDCPTSGGAANRGKLGPFGIIVLADDGLSESTPIYFYIAKGANGTTETHFCADEL  412

Query  471  RSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEA  292
            RSS+A+ V K VYGSTVPV+  EK S R LVDHSIVESF QGGRTVI SRIYPT A   +
Sbjct  413  RSSKAADVDKLVYGSTVPVLHGEKLSIRSLVDHSIVESFAQGGRTVIASRIYPTAANGSS  472

Query  291  ARVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
             RVFLFNNATG SV AS+KIW+M+SADI+PFPF
Sbjct  473  GRVFLFNNATGVSVTASIKIWKMDSADIRPFPF  505



>gb|KJB51893.1| hypothetical protein B456_008G236700 [Gossypium raimondii]
Length=646

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 165/210 (79%), Gaps = 3/210 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGE--G  646
            LLQWP+EE++ LR       +V +Q G ++P+ +  A QLDIIA FE+ ++EA+E     
Sbjct  432  LLQWPVEEIESLRLKSYEFNQVKVQAGSVVPLDVGPATQLDIIAEFEI-DKEALEKTTGS  490

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++CSSSGG ++RGALGPFGL+V AD++L+E TPVYFY+ KG DGK++T FC D +RS
Sbjct  491  NVTFSCSSSGGTIERGALGPFGLLVLADDSLSEQTPVYFYIAKGSDGKLKTFFCNDQSRS  550

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S AS V K++YG+ VPV++ EK S R+LVDHSIVESF QGGRTVITSR+YPTKAIY AA+
Sbjct  551  SVASDVNKQIYGNLVPVLEGEKLSLRVLVDHSIVESFAQGGRTVITSRVYPTKAIYGAAK  610

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFP  196
            +FLFNNAT  SV AS++IWQMNSA I+P+P
Sbjct  611  LFLFNNATEASVSASLRIWQMNSAFIRPYP  640



>gb|KJB51889.1| hypothetical protein B456_008G236700 [Gossypium raimondii]
Length=649

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 165/210 (79%), Gaps = 3/210 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGE--G  646
            LLQWP+EE++ LR       +V +Q G ++P+ +  A QLDIIA FE+ ++EA+E     
Sbjct  435  LLQWPVEEIESLRLKSYEFNQVKVQAGSVVPLDVGPATQLDIIAEFEI-DKEALEKTTGS  493

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++CSSSGG ++RGALGPFGL+V AD++L+E TPVYFY+ KG DGK++T FC D +RS
Sbjct  494  NVTFSCSSSGGTIERGALGPFGLLVLADDSLSEQTPVYFYIAKGSDGKLKTFFCNDQSRS  553

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S AS V K++YG+ VPV++ EK S R+LVDHSIVESF QGGRTVITSR+YPTKAIY AA+
Sbjct  554  SVASDVNKQIYGNLVPVLEGEKLSLRVLVDHSIVESFAQGGRTVITSRVYPTKAIYGAAK  613

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFP  196
            +FLFNNAT  SV AS++IWQMNSA I+P+P
Sbjct  614  LFLFNNATEASVSASLRIWQMNSAFIRPYP  643



>gb|KHG18769.1| Acid beta-fructofuranosidase [Gossypium arboreum]
Length=469

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 158/210 (75%), Gaps = 2/210 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEGEG  646
            LLQWP+EE+  LR       +V +Q G ++P+ I +A QLDIIA F++ ++  +   G  
Sbjct  258  LLQWPVEEIDSLRLKGKEFNQVRIQAGSVVPLDIDSATQLDIIAEFKIDSDALDKATGSS  317

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  ++C +SGGA +RGALGPFGL+V ADE L+E TPVYFY+ KG DG ++T FC D +RS
Sbjct  318  DASFDCVTSGGAAERGALGPFGLLVLADERLSEQTPVYFYMTKGSDGNLKTFFCNDQSRS  377

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+AS V K +YGS VPV+  E  S RILVDHSI+ESFGQGGRTVITSR+YPTKAI+ AA+
Sbjct  378  SKASDVDKHIYGSLVPVLRGENLSIRILVDHSIIESFGQGGRTVITSRVYPTKAIHGAAK  437

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFP  196
            VFLFNNAT  +V AS+K WQMNSA I+P+P
Sbjct  438  VFLFNNATELNVTASLKTWQMNSAFIQPYP  467



>ref|XP_011101120.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Sesamum indicum]
Length=652

 Score =   261 bits (668),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 156/210 (74%), Gaps = 2/210 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEE-AVEGEGD  643
            +LQWP+EEV+ LRS D +     L+PG ++PI + + +QLDI+ASFE+  E   V  E D
Sbjct  441  ILQWPVEEVESLRS-DSLEFNAKLEPGSVVPIEVDSGSQLDIVASFELDKETFEVTTEAD  499

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              Y+C +SGGAV RG LGPFG+VV ADE L ELTP+YFY+ KG  GKVETHFC D  RSS
Sbjct  500  IGYDCPTSGGAVNRGMLGPFGIVVLADENLLELTPIYFYIAKGPHGKVETHFCADELRSS  559

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
             A  V K VYGS VPV+D E  + R LVDHSIVESF QGGR VITSRIYPT AI  AARV
Sbjct  560  VAPDVDKIVYGSKVPVLDGENLTIRSLVDHSIVESFAQGGRRVITSRIYPTTAIGGAARV  619

Query  282  FLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            FLFNNAT  SV AS+KIW+M+SA+I+PFP 
Sbjct  620  FLFNNATRASVNASIKIWKMSSANIRPFPL  649



>gb|KJB37598.1| hypothetical protein B456_006G212600 [Gossypium raimondii]
Length=646

 Score =   260 bits (665),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 158/210 (75%), Gaps = 2/210 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEGEG  646
            LLQWP+EE+  LR       +V +Q G ++P+ I +A QLDIIA F++ ++  E   G  
Sbjct  435  LLQWPVEEIDSLRLKGKEFNQVRIQAGSVVPLDIDSATQLDIIAEFKIDSDALEKATGSS  494

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  ++C++SGGA +RGALGPFGL+V ADE L E TPVYFY+ KG DG ++T FC D +RS
Sbjct  495  DASFDCATSGGAAERGALGPFGLLVLADERLREQTPVYFYMTKGSDGNLKTFFCNDQSRS  554

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+AS V K +YGS VPV+  E  S RILVDHSI+ESFGQGGRTVITSR+YPTK IY AA+
Sbjct  555  SKASDVDKHIYGSLVPVLRGENLSIRILVDHSIIESFGQGGRTVITSRVYPTKVIYGAAK  614

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFP  196
            VFLFNNAT  +V AS+KIWQMNSA I+P+P
Sbjct  615  VFLFNNATELNVTASLKIWQMNSAFIQPYP  644



>pdb|3UGF|A Chain A, Crystal Structure Of A 6-Sst6-Sft From Pachysandra Terminalis
 pdb|3UGF|B Chain B, Crystal Structure Of A 6-Sst6-Sft From Pachysandra Terminalis
 pdb|3UGG|A Chain A, Crystal Structure Of A 6-Sst6-Sft From Pachysandra Terminalis 
In Complex With 1-Kestose
 pdb|3UGG|B Chain B, Crystal Structure Of A 6-Sst6-Sft From Pachysandra Terminalis 
In Complex With 1-Kestose
 pdb|3UGH|A Chain A, Crystal Structure Of A 6-Sst6-Sft From Pachysandra Terminalis 
In Complex With 6-Kestose
 pdb|3UGH|B Chain B, Crystal Structure Of A 6-Sst6-Sft From Pachysandra Terminalis 
In Complex With 6-Kestose
Length=546

 Score =   258 bits (658),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 162/209 (78%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            +L WP+EEV+ LR      +KV    G ++P+ +  A QLDIIA FE+ ++EA+EG  E 
Sbjct  337  VLLWPVEEVESLRLSSKEFSKVKAGAGSVVPLDVGTATQLDIIAEFEI-DKEALEGTIEA  395

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNC++SGGA +RG LGPFGL+V+A E L+E TPVYFY+ KG DG  +T FC D +RS
Sbjct  396  DMGYNCTTSGGAAERGVLGPFGLLVSATENLSEQTPVYFYIAKGTDGNFKTFFCLDESRS  455

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+AS V+K+V G TVPV+D EK++ R+LVDHSIVESF QGGR+ ITSR+YPT+AIY AA+
Sbjct  456  SKASDVSKQVKGFTVPVLDGEKFTMRLLVDHSIVESFAQGGRSCITSRVYPTEAIYGAAK  515

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +FLFNNATG S+ AS+KIW+MNSA I+PF
Sbjct  516  LFLFNNATGASITASLKIWEMNSAFIQPF  544



>gb|AJW82912.1| acid invertase [Dimocarpus longan]
Length=656

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 160/209 (77%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            L+QWP+EEV+ LR        V + PG ++P+ +  A QLDI+A FE ++++AV    E 
Sbjct  443  LIQWPVEEVESLRLTSKNFDNVKVTPGSVVPLDVGTATQLDILAEFE-LDKDAVHNTAET  501

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++C++SGGA +RGALGPFGL+V ADE+L E TPVYFYV KG DGK++T FCTD  RS
Sbjct  502  NGEFSCTASGGAAQRGALGPFGLLVLADESLTERTPVYFYVVKGNDGKLKTSFCTDQKRS  561

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A+ V K +YGS VPV+D EK S RILVDHSIVESF QGGRT ITSR+YPTKA+Y  AR
Sbjct  562  SQANDVNKIIYGSFVPVLDGEKLSLRILVDHSIVESFAQGGRTCITSRVYPTKALYGDAR  621

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            VFLFNNAT TS+  S+K+WQMNSA I+PF
Sbjct  622  VFLFNNATETSITGSLKVWQMNSAFIRPF  650



>gb|AFU25742.1| soluble acid invertase 2 [Rhododendron hybrid cultivar]
Length=643

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 161/207 (78%), Gaps = 3/207 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            +LQWP EEV+RLR        V L PG ++P++I +A QLDI+A+FEV ++ A+E   E 
Sbjct  438  ILQWPAEEVERLRLNVTEFNGVELGPGSVVPLNISSATQLDIVATFEV-DKAALEATTEA  496

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  + CS++GGAV RGALGPFGL+V ADE+L+ELTPVYFY+ K  DG  +T FC+D  RS
Sbjct  497  DAGHTCSTTGGAVSRGALGPFGLLVLADESLSELTPVYFYISKFIDGSYKTFFCSDEMRS  556

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+AS V K V G TVPV++ EKYS R+LVDHSIVESF QGGRTVITSRIYPT+AI  AAR
Sbjct  557  SKASSVNKRVNGGTVPVLEGEKYSMRLLVDHSIVESFAQGGRTVITSRIYPTRAIDGAAR  616

Query  285  VFLFNNATGTSVKASVKIWQMNSADIK  205
            VFLFNNATGT+V AS+KIWQM+SA I 
Sbjct  617  VFLFNNATGTNVTASLKIWQMDSAHIH  643



>gb|ACT21538.1| acid invertase [Vigna radiata]
Length=579

 Score =   256 bits (655),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 161/211 (76%), Gaps = 3/211 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP++EV+ LR        +  +PG ++ + I  A QLD++A FE+ + E++E   E 
Sbjct  364  LLQWPVDEVESLRLRSDEFKSLKAKPGSVVSLDIETATQLDVVAEFEI-DTESLEKTAES  422

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  + CSSSGGA +RGALGPFGL+V ADE L+E TPVYFYV KG +G + T FC+D +RS
Sbjct  423  NEEFTCSSSGGAAQRGALGPFGLLVLADEGLSEYTPVYFYVIKGRNGNLRTSFCSDQSRS  482

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A+ V K+++GS VPV+  EK+S R+LVDHSIVESF QGGRT +TSR+YPTKAIY AAR
Sbjct  483  SQANDVRKQIFGSVVPVLKGEKFSLRMLVDHSIVESFAQGGRTCVTSRVYPTKAIYGAAR  542

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +FLFNNAT  +V AS+K+WQMNSA I+PFPF
Sbjct  543  LFLFNNATEATVTASLKVWQMNSAFIRPFPF  573



>emb|CAA08811.1| 1,2-beta-fructan 1F-fructosyltransferase [Helianthus tuberosus]
Length=615

 Score =   257 bits (657),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 158/217 (73%), Gaps = 3/217 (1%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            R+    LL WP+EEV+ LR       ++ L+PG I+P+ I  A QLDI+A+FEV ++ A+
Sbjct  400  RKTGTHLLHWPVEEVESLRYNGQEFKEIKLEPGSIIPLDIGTATQLDIVATFEV-DQAAL  458

Query  657  EG--EGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
                E D  Y C++S GA +RG+LGPFGL V AD TL+ELTPVYFY+ K  DG V THFC
Sbjct  459  NATSETDDIYGCTTSLGAAQRGSLGPFGLAVLADGTLSELTPVYFYIAKKADGGVSTHFC  518

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD  RSS      + VYG TVPV+DDE+ + R+LVDHSIVE F QGGRTVITSR YPTKA
Sbjct  519  TDKLRSSLDYDGERVVYGGTVPVLDDEELTMRLLVDHSIVEGFAQGGRTVITSRAYPTKA  578

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            IYE A++FLFNNATGTSVKAS+KIWQM SA I  +PF
Sbjct  579  IYEQAKLFLFNNATGTSVKASLKIWQMASAPIHQYPF  615



>ref|NP_001284386.1| acid beta-fructofuranosidase-like [Cucumis melo]
 gb|ACS94417.1| acid invertase 1 [Cucumis melo]
Length=680

 Score =   258 bits (660),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 159/208 (76%), Gaps = 1/208 (0%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG-EGD  643
            LLQWP+EE++ LR        + +QPG ++P+ I +++QLDI A FE+  E A +  E D
Sbjct  442  LLQWPVEEIESLRQRSHAFNNLVIQPGSVVPLEIGSSSQLDIFAEFELDKEAAAKAIETD  501

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              ++C + GGA  RGALGPFGL+V ADE+L+E TPVYFYV KG +G ++T FCTD +RSS
Sbjct  502  VEFSCQTRGGAANRGALGPFGLLVLADESLSEHTPVYFYVAKGQNGTLKTFFCTDESRSS  561

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
            EA+ V K +YGS VPV++DEK+S RILVDHS+VESF QGGRT ITSR+YPTKAIY AAR+
Sbjct  562  EANDVFKPIYGSYVPVLEDEKFSLRILVDHSVVESFAQGGRTCITSRVYPTKAIYGAARL  621

Query  282  FLFNNATGTSVKASVKIWQMNSADIKPF  199
            F+FNNA  T++ AS+ IWQMN A I+P+
Sbjct  622  FVFNNAKDTNITASLTIWQMNPAFIRPY  649



>emb|CBM41476.2| sucrose:(sucrose/fructan) 6-fructosyltransferase precursor [Pachysandra 
terminalis]
Length=655

 Score =   258 bits (659),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 162/209 (78%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            +L WP+EEV+ LR      +KV    G ++P+ +  A QLDIIA FE+ ++EA+EG  E 
Sbjct  446  VLLWPVEEVESLRLSSKEFSKVKAGAGSVVPLDVGTATQLDIIAEFEI-DKEALEGTIEA  504

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNC++SGGA +RG LGPFGL+V+A E L+E TPVYFY+ KG DG  +T FC D +RS
Sbjct  505  DMGYNCTTSGGAAERGVLGPFGLLVSATENLSEQTPVYFYIAKGTDGNFKTFFCLDESRS  564

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+AS V+K+V G TVPV+D EK++ R+LVDHSIVESF QGGR+ ITSR+YPT+AIY AA+
Sbjct  565  SKASDVSKQVKGFTVPVLDGEKFTMRLLVDHSIVESFAQGGRSCITSRVYPTEAIYGAAK  624

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +FLFNNATG S+ AS+KIW+MNSA I+PF
Sbjct  625  LFLFNNATGASITASLKIWEMNSAFIQPF  653



>gb|KHN34956.1| Acid beta-fructofuranosidase [Glycine soja]
Length=667

 Score =   258 bits (659),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 162/209 (78%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+ EV+ LR        + + PG ++P+ I  AAQLDI+A FE+ ++EA+E  G+ 
Sbjct  452  LLQWPVAEVESLRLRSEEFQNLKVTPGSVVPLEIGTAAQLDIVAEFEI-DKEALEKTGQS  510

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  Y CS+SGGA +RGA+GPFGL+V AD+ L+E TP YFYV KG  G+++T FC+D +RS
Sbjct  511  NKEYKCSTSGGATERGAIGPFGLLVLADDDLSEYTPTYFYVVKGSHGQLKTSFCSDQSRS  570

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V+K+++GS VPV+ DEK S RILVDHSIVESF QGGRT +TSR+YPTKAIY AAR
Sbjct  571  SLATDVSKKIFGSFVPVLKDEKLSVRILVDHSIVESFAQGGRTCVTSRVYPTKAIYGAAR  630

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +FLFNNAT  +V ASVK+WQMNSA I+PF
Sbjct  631  LFLFNNATEATVTASVKVWQMNSAFIRPF  659



>emb|CDP09916.1| unnamed protein product [Coffea canephora]
Length=682

 Score =   258 bits (659),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 159/208 (76%), Gaps = 3/208 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEGEG  646
            LLQWP+EEV++LR        V ++PG ++P+ + +AAQLD++A FE+  E  E V G  
Sbjct  446  LLQWPVEEVEKLRLNGKSFDGVEVKPGSVIPLDVGSAAQLDVVAEFEIDKEAKEMVNGT-  504

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  Y CS+SGGA +RGALGPFGL+V AD   +E TPVYFY+ KG DG  +T FC+DL+RS
Sbjct  505  DAEYVCSTSGGAAERGALGPFGLLVLADNDQSEQTPVYFYIAKGTDGNFKTSFCSDLSRS  564

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A+ V K VYGSTVPV++ EK S R+LVDHSIVESFGQGGRT ITSR+YPT +++E AR
Sbjct  565  SKATDVRKGVYGSTVPVLEGEKLSMRVLVDHSIVESFGQGGRTCITSRVYPTNSVHENAR  624

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKP  202
            +FLFNNAT   VKAS++ WQMNSA+I P
Sbjct  625  LFLFNNATDAKVKASIRAWQMNSANIYP  652



>gb|AAD10239.1| invertase [Oryza sativa Japonica Group]
Length=654

 Score =   258 bits (658),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 151/211 (72%), Gaps = 3/211 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEGEG  646
            +LQ P EEV+   SGDPI  +   +PG ++PIH+  A QLDI ASFEV     E      
Sbjct  439  VLQRPEEEVESWSSGDPITQRRIFEPGSVVPIHVSGATQLDITASFEVDETLLETTSESH  498

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  Y+CS+SGGA  RG+LGPFGL+V ADE L+ELTPVY YV KGGDGK + H C   TRS
Sbjct  499  DAGYDCSNSGGAGTRGSLGPFGLLVVADEKLSELTPVYLYVAKGGDGKAKAHLCAYQTRS  558

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S ASGV KEVYGS VPV+D E YSARIL+DHSIVESF Q GRT + SR YPTK IY AAR
Sbjct  559  SMASGVEKEVYGSAVPVLDGENYSARILIDHSIVESFAQAGRTCVRSRDYPTKDIYGAAR  618

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
             F FNNAT  SV+AS+K WQM S  I+P+PF
Sbjct  619  CFFFNNATEASVRASLKAWQMKSF-IRPYPF  648



>emb|CAA04120.2| fructan fructan 1-fructosyltransferase [Cynara cardunculus var. 
scolymus]
Length=617

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 162/217 (75%), Gaps = 3/217 (1%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            R+    LLQWP+EE++ LRS       + L+PG I+P+ + +A QLDI+A+FEV ++EA+
Sbjct  402  RKTGTHLLQWPVEEIESLRSNGHEFKNITLEPGSIIPLDVGSATQLDIVATFEV-DQEAL  460

Query  657  EGEGDFR--YNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            +   D    Y C++S GA +RG+ GPFG+ V A  TL+ELTPVYFY+ K   G V+THFC
Sbjct  461  KATSDTNDEYGCTTSSGAAQRGSFGPFGIAVLAHGTLSELTPVYFYIAKNTKGGVDTHFC  520

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD  RSS      K VYGSTVPV+D E+++ RILVDHS+VE F QGGRTVITSR+YPTKA
Sbjct  521  TDKLRSSYDYDGEKVVYGSTVPVLDGEEFTMRILVDHSVVEGFAQGGRTVITSRVYPTKA  580

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            IYEAA++F+FNNAT TSVKA++K+WQM+ A +K +PF
Sbjct  581  IYEAAKLFVFNNATTTSVKATLKVWQMSQAFVKAYPF  617



>emb|CAH18892.1| 2,1-fructan:2,1-fructan 1-fructosyltransferase precursor [Viguiera 
discolor]
Length=609

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 159/217 (73%), Gaps = 3/217 (1%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            R+    LL WP+EEV+ LR       ++ L+PG I+P+ I  A QLDI+A+FEV ++ A+
Sbjct  394  RKTGTHLLHWPVEEVETLRYNGREFKEIELEPGSIVPLDIGTATQLDIVATFEV-DQAAL  452

Query  657  EG--EGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
                E D  Y C++S GA +RG+LGPFGLVV AD TL+ELTPVYFY+ K  DG V TH+C
Sbjct  453  NATSETDDTYGCTTSLGATERGSLGPFGLVVLADGTLSELTPVYFYIAKKADGGVSTHYC  512

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD  RSS      K VYGSTVPV+DDE+ + R+LVDHS++E F QGGR  ITSR+YPTKA
Sbjct  513  TDKLRSSLDYDDEKVVYGSTVPVLDDEELTMRLLVDHSVLEGFAQGGRIAITSRVYPTKA  572

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            IYE A++FLFNNATGTSVKAS+KIWQM +A I  +PF
Sbjct  573  IYEEAKLFLFNNATGTSVKASLKIWQMAAAQIHQYPF  609



>sp|P29001.1|INVA_VIGRR RecName: Full=Acid beta-fructofuranosidase; AltName: Full=Acid 
invertase; Short=AI; AltName: Full=Acid sucrose hydrolase; 
AltName: Full=Vacuolar invertase; Contains: RecName: Full=Acid 
beta-fructofuranosidase 30 kDa subunit; Contains: RecName: 
Full=Acid beta-fructofuranosidase 38 kDa subunit; Flags: 
Precursor [Vigna radiata var. radiata]
 dbj|BAA01107.1| invertase [Vigna radiata]
 prf||1905412A acid invertase
Length=649

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 161/211 (76%), Gaps = 3/211 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP++EV+ LR        +  +PG ++ + I  A QLD++A FE+ + E++E   E 
Sbjct  434  LLQWPVDEVESLRLRSDEFKSLKAKPGSVVSLDIETATQLDVVAEFEI-DTESLEKTAES  492

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  + CSSSGGA +RGALGPFGL+V ADE L+E TPVYFYV KG +G + T FC+D +RS
Sbjct  493  NEEFTCSSSGGAAQRGALGPFGLLVLADEGLSEYTPVYFYVIKGRNGNLRTSFCSDQSRS  552

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A+ V K+++GS VPV+  EK+S R+LVDHSIVESF QGGRT +TSR+YPTKAIY AAR
Sbjct  553  SQANDVRKQIFGSVVPVLKGEKFSLRMLVDHSIVESFAQGGRTCVTSRVYPTKAIYGAAR  612

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +FLFNNAT  +V AS+K+WQMNSA I+PFPF
Sbjct  613  LFLFNNATEATVTASLKVWQMNSAFIRPFPF  643



>gb|KEH31660.1| soluble acid invertase FRUCT2 [Medicago truncatula]
Length=531

 Score =   253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 157/209 (75%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+ EV+ LR        + ++PG ++ + I  A QLDI+A FE+  +EA+E     
Sbjct  318  LLQWPVAEVESLRLKSDEFKNLKVKPGSVVSLDIDTATQLDILAEFEI-EKEALEKTAHS  376

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  Y CS+SGGA KRGALGPFGL V AD  L+E TPVYFYV KG DGK++T FC+D +RS
Sbjct  377  NVEYECSNSGGASKRGALGPFGLYVLADGALSEYTPVYFYVVKGSDGKLKTSFCSDQSRS  436

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K++YGS VPV++ EK S RILVDHSIVESF QGGRT ITSR+YPT+AIY AAR
Sbjct  437  SLANDVHKQIYGSVVPVLEGEKLSLRILVDHSIVESFAQGGRTCITSRVYPTRAIYGAAR  496

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +FLFNNA  T+V AS+K+WQMNSA I+P+
Sbjct  497  LFLFNNAIETNVTASLKVWQMNSAFIRPY  525



>gb|AFB83199.1| fructan-fructan 1-fructosyltransferase [Cichorium intybus]
Length=622

 Score =   255 bits (652),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 157/217 (72%), Gaps = 3/217 (1%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            R+    LL WP+EE++ LR       ++ L PG I+P+ I  A QLDI+A+FEV  +E  
Sbjct  407  RKTGTHLLHWPVEEIESLRYDGREFKEIELAPGSIMPLDIGPATQLDIVATFEV-EQEMF  465

Query  657  EGEGDFR--YNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
             G+ D    Y C++S GA +RG+LGPFG+ V AD TL+ELTPVYFY+ K  DG V THFC
Sbjct  466  MGKSDTNGEYGCTTSAGATERGSLGPFGIAVLADGTLSELTPVYFYISKKTDGSVATHFC  525

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD  RSS      + VYGSTVPV+D E+ + R+LVDHS+VE F  GGRTV+TSR+YPTKA
Sbjct  526  TDKLRSSLDYDGERVVYGSTVPVLDGEELTMRLLVDHSVVEGFAMGGRTVMTSRVYPTKA  585

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            IYE A++FLFNNAT TSVKAS+KIWQM SA I+P+PF
Sbjct  586  IYEGAKIFLFNNATHTSVKASLKIWQMGSARIQPYPF  622



>ref|XP_008238615.1| PREDICTED: acid beta-fructofuranosidase-like [Prunus mume]
Length=686

 Score =   256 bits (655),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 162/209 (78%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+EE+++LR       KV ++ G ++P+ +  A QLDIIA FE ++++ +E   E 
Sbjct  447  LLQWPVEEIEKLRLSSKDFNKVEVKAGSVVPLQVGTATQLDIIAEFE-LDKKVLESVAES  505

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++C++SGGA KRGALGPFGL+V ADE+L+E TPVYFYV KG  G V+T FC D TRS
Sbjct  506  NEAFSCNTSGGAAKRGALGPFGLLVLADESLSEQTPVYFYVAKGPGGIVDTFFCADQTRS  565

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V KE+ GS +PV+ DEK S RILVDHSIVESF QGGRT IT+RIYPTKAIY AAR
Sbjct  566  SVANDVRKEITGSYIPVLKDEKLSVRILVDHSIVESFAQGGRTTITNRIYPTKAIYGAAR  625

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +F+FNNAT TSV AS+K+WQ+NSA I+P+
Sbjct  626  LFVFNNATETSVTASIKVWQLNSAFIRPY  654



>ref|XP_002532576.1| Acid beta-fructofuranosidase precursor, putative [Ricinus communis]
 gb|EEF29810.1| Acid beta-fructofuranosidase precursor, putative [Ricinus communis]
Length=649

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 159/209 (76%), Gaps = 1/209 (0%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE-EAVEGEGD  643
            LLQWP+EEV+ LR       K+ ++PG ++P+HI AA QLDI+A FE+  +  A   E +
Sbjct  438  LLQWPVEEVESLRLRSNEFEKLEVKPGSVVPLHIDAATQLDIVAEFELDKKVLANAAESN  497

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              ++C +S GA  R ALGPFGL+V ADE+LAE TPVYFYV KG +G ++T FCTD  RSS
Sbjct  498  EEFSCKTSRGAAHRNALGPFGLLVLADESLAEQTPVYFYVAKGKNGTLKTFFCTDQKRSS  557

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
             A+ V K++YG+ VPV++ EK+S RILVDHSI+ESF QGGRT ITSR+YPT+AIY AA++
Sbjct  558  AANDVNKQIYGNFVPVLEGEKFSVRILVDHSIIESFAQGGRTCITSRVYPTRAIYGAAKL  617

Query  282  FLFNNATGTSVKASVKIWQMNSADIKPFP  196
            FLFNNA   +V AS+KIWQMNSA I+P+P
Sbjct  618  FLFNNALEANVTASLKIWQMNSAFIRPYP  646



>gb|AEM00023.1| vacuolar acid invertase [Manihot esculenta]
Length=502

 Score =   252 bits (643),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 159/209 (76%), Gaps = 1/209 (0%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE-GEGD  643
            LLQWP+EEV+ LR       KV ++PG ++P+ + AA QLDI+A FE+  +  ++  E  
Sbjct  291  LLQWPVEEVENLRLRAREFKKVEVEPGSVVPLDLDAATQLDIVAEFELDKDALMKTAEST  350

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              ++C +S GA  R ALGPFGL+V AD++LAE TPVYFY+ KG +G  +T FCTD +RSS
Sbjct  351  EEFSCKTSRGAAHRSALGPFGLLVLADDSLAEQTPVYFYINKGSNGTFKTFFCTDQSRSS  410

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
             A+ V K++YG+ VPV++ EK++ RILVDHSI+ESF QGGRT ITSR+YPT+AIY +A+V
Sbjct  411  AANDVNKQIYGNFVPVLEGEKFTLRILVDHSIIESFAQGGRTTITSRVYPTRAIYGSAKV  470

Query  282  FLFNNATGTSVKASVKIWQMNSADIKPFP  196
            FLFNNA  T+V AS+KIWQMNSA I+P+P
Sbjct  471  FLFNNAIETNVTASLKIWQMNSAFIRPYP  499



>ref|XP_011101190.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Sesamum indicum]
Length=621

 Score =   254 bits (648),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 161/218 (74%), Gaps = 11/218 (5%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            +LQWP+EEV+ LRS D     V L+PG ++PI + + +QLDI+ASFE +++EA E   E 
Sbjct  401  ILQWPVEEVESLRS-DSFEFNVKLEPGSVVPIEVDSGSQLDIVASFE-LDKEAFEETTEA  458

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  Y+C +SGG+V RG LGPFG+++ ADE L ELTP+YFY+ KG + KVETHFC D  RS
Sbjct  459  DVGYDCPTSGGSVNRGMLGPFGIIILADENLLELTPIYFYIAKGHNRKVETHFCADELRS  518

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K VYGS VPV+D E  + R LVDHSIVESF QGGR VITSRIYPTKAI   AR
Sbjct  519  SVAADVDKIVYGSKVPVLDGENLTIRSLVDHSIVESFAQGGRRVITSRIYPTKAIDGEAR  578

Query  285  VFLFNNATG-------TSVKASVKIWQMNSADIKPFPF  193
            +FLFNN+TG       T V ASVKIW+M+SA+I+PFP 
Sbjct  579  IFLFNNSTGASVAAVETRVTASVKIWKMSSANIRPFPL  616



>emb|CAH25486.1| 1,2-beta-fructan 1F-fructosyltransferase [Taraxacum officinale]
Length=618

 Score =   254 bits (648),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 159/217 (73%), Gaps = 3/217 (1%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            R+    LL WP+EE++ LRS      ++ L PG ILP+ I  A QLDI+A+F+V + EA+
Sbjct  403  RKTGTHLLHWPVEEIESLRSNAHEFHEIELVPGSILPLDIGMATQLDIVATFKV-DPEAL  461

Query  657  EGEGDFR--YNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
              + D    Y C++S GA +RG+LGPFG+VV AD  L+ELTPVYFY+ K  DG + THFC
Sbjct  462  MAKSDINSEYGCTTSSGATQRGSLGPFGIVVLADVALSELTPVYFYIAKNIDGGLVTHFC  521

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD  RSS      + VYGSTVPV+D E+ + R+LVDHS+VE F QGGRTV+TSR+YPTKA
Sbjct  522  TDKLRSSLDYDGERVVYGSTVPVLDGEELTMRLLVDHSVVEGFAQGGRTVMTSRVYPTKA  581

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            IYE A++FLFNNATG SVKAS+KIWQM SA I+ +PF
Sbjct  582  IYEEAKIFLFNNATGASVKASLKIWQMGSASIQAYPF  618



>gb|ACJ04701.1| invertase 1 [Cucumis melo]
Length=665

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 157/208 (75%), Gaps = 1/208 (0%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG-EGD  643
            LLQWP+EE++ LR        + +QPG ++P+ I +++QLDI A FE+  E   +  E D
Sbjct  427  LLQWPVEEIESLRQRSHAFNNLVIQPGSVVPLEIGSSSQLDIFAEFELDKEAVAKAIETD  486

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              ++C + GGA  RGALGPFGL+V ADE+L+E TPVYFYV KG +G ++T FCTD +RSS
Sbjct  487  VEFSCQTRGGAANRGALGPFGLLVLADESLSEHTPVYFYVAKGQNGTLKTFFCTDESRSS  546

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
            EA+ V K +YGS VPV++D K+S RILVDHS+VESF QGGRT ITSR+YPTKAIY AAR+
Sbjct  547  EANDVFKPIYGSYVPVLEDAKFSLRILVDHSVVESFAQGGRTCITSRVYPTKAIYGAARL  606

Query  282  FLFNNATGTSVKASVKIWQMNSADIKPF  199
            F+FNNA  T++ AS+ IWQMN A I+P+
Sbjct  607  FVFNNAKDTNITASLTIWQMNPAFIRPY  634



>dbj|BAJ24841.1| fructan:fructan 1-fructosyltransferase [Arctium lappa]
Length=617

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 162/217 (75%), Gaps = 3/217 (1%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            R+    LLQWP+EE++ LRS      ++ L+PG I+P+ I +A QLDIIA+FEV ++EA+
Sbjct  402  RKTGTHLLQWPVEELESLRSNVREFKEMTLEPGSIVPLDIGSATQLDIIATFEV-DQEAL  460

Query  657  EGEGDFR--YNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            +   D    Y C++S GA +RG+ GPFG+ V AD TL+ELTPVYFY+ K   G V+THFC
Sbjct  461  KATSDANDEYACTTSSGAAERGSFGPFGIAVLADGTLSELTPVYFYIAKNTKGGVDTHFC  520

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD  RSS      K VYGST+PV+D E+ + R+LVDHS+VE F QGGRTVITSR+YPTKA
Sbjct  521  TDKLRSSLDYDSEKVVYGSTIPVLDGEQITMRVLVDHSVVEGFAQGGRTVITSRVYPTKA  580

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            IYE A++F+FNNAT T+VKA++ +WQM+ A I+P+PF
Sbjct  581  IYEGAKLFVFNNATTTNVKATLNVWQMSHALIQPYPF  617



>ref|XP_003608758.1| Acid beta-fructofuranosidase [Medicago truncatula]
Length=640

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 157/209 (75%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+ EV+ LR        + ++PG ++ + I  A QLDI+A FE+  +EA+E     
Sbjct  427  LLQWPVAEVESLRLKSDEFKNLKVKPGSVVSLDIDTATQLDILAEFEI-EKEALEKTAHS  485

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  Y CS+SGGA KRGALGPFGL V AD  L+E TPVYFYV KG DGK++T FC+D +RS
Sbjct  486  NVEYECSNSGGASKRGALGPFGLYVLADGALSEYTPVYFYVVKGSDGKLKTSFCSDQSRS  545

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K++YGS VPV++ EK S RILVDHSIVESF QGGRT ITSR+YPT+AIY AAR
Sbjct  546  SLANDVHKQIYGSVVPVLEGEKLSLRILVDHSIVESFAQGGRTCITSRVYPTRAIYGAAR  605

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +FLFNNA  T+V AS+K+WQMNSA I+P+
Sbjct  606  LFLFNNAIETNVTASLKVWQMNSAFIRPY  634



>gb|AES90955.2| soluble acid invertase FRUCT2 [Medicago truncatula]
Length=643

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 157/209 (75%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+ EV+ LR        + ++PG ++ + I  A QLDI+A FE+  +EA+E     
Sbjct  430  LLQWPVAEVESLRLKSDEFKNLKVKPGSVVSLDIDTATQLDILAEFEI-EKEALEKTAHS  488

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  Y CS+SGGA KRGALGPFGL V AD  L+E TPVYFYV KG DGK++T FC+D +RS
Sbjct  489  NVEYECSNSGGASKRGALGPFGLYVLADGALSEYTPVYFYVVKGSDGKLKTSFCSDQSRS  548

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K++YGS VPV++ EK S RILVDHSIVESF QGGRT ITSR+YPT+AIY AAR
Sbjct  549  SLANDVHKQIYGSVVPVLEGEKLSLRILVDHSIVESFAQGGRTCITSRVYPTRAIYGAAR  608

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +FLFNNA  T+V AS+K+WQMNSA I+P+
Sbjct  609  LFLFNNAIETNVTASLKVWQMNSAFIRPY  637



>ref|XP_008373808.1| PREDICTED: acid beta-fructofuranosidase [Malus domestica]
Length=681

 Score =   254 bits (648),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 159/209 (76%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+EEV++LR       KV ++ G +LP+ +  A QLDI+A FE ++++ +E   E 
Sbjct  442  LLQWPVEEVEKLRLSITDFDKVEVKAGSVLPLQVGTATQLDIVAEFE-LDKKVLESVAES  500

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++C++S GA  RGALGPFGL+V ADETL+E TPVYFYV KG  G  +T FC D TRS
Sbjct  501  NEVFSCNTSAGASHRGALGPFGLLVLADETLSEQTPVYFYVAKGPGGNFDTFFCADQTRS  560

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K+V GS VPV+ DEK SARILVDHSIVESF QGGRT ITSR+YPTKAIY AAR
Sbjct  561  SVANDVKKKVTGSYVPVLKDEKLSARILVDHSIVESFAQGGRTTITSRVYPTKAIYGAAR  620

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            + LFNNAT TSV AS+K+WQMNSA I+P+
Sbjct  621  LILFNNATETSVTASLKVWQMNSAFIRPY  649



>gb|KHN42709.1| Acid beta-fructofuranosidase [Glycine soja]
Length=675

 Score =   253 bits (647),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 162/209 (78%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            L+QWP+ EV+ LR        + ++PG ++P+ I  AAQLDI+A FE+ +++A+E  G+ 
Sbjct  460  LIQWPVAEVESLRLRSDEFQNLKVKPGSVVPLEIGTAAQLDIVAEFEI-DKKALEKTGQS  518

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  Y CS+SGG+ +RG +GPFGL+V AD+ L+E TP YFYV KG  G+++T FC+D +RS
Sbjct  519  NKEYKCSTSGGSTERGTIGPFGLLVLADDDLSEYTPTYFYVVKGSHGQLKTSFCSDQSRS  578

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V+K+++GS VPV+ DEK S RILVDHSIVESF QGGRT +TSR+YPTKAIY AAR
Sbjct  579  SLATDVSKKIFGSFVPVLKDEKLSVRILVDHSIVESFAQGGRTCVTSRVYPTKAIYGAAR  638

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +FLFNNAT  +V ASVK+WQMNSA I+PF
Sbjct  639  LFLFNNATEATVTASVKVWQMNSAFIRPF  667



>ref|XP_006573732.1| PREDICTED: acid beta-fructofuranosidase-like [Glycine max]
Length=675

 Score =   253 bits (647),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 162/209 (78%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            L+QWP+ EV+ LR        + ++PG ++P+ I  AAQLDI+A FE+ +++A+E  G+ 
Sbjct  460  LIQWPVAEVESLRLRSDEFQNLKVKPGSVVPLEIGTAAQLDIVAEFEI-DKKALEKTGQS  518

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  Y CS+SGG+ +RG +GPFGL+V AD+ L+E TP YFYV KG  G+++T FC+D +RS
Sbjct  519  NKEYKCSTSGGSTERGTIGPFGLLVLADDDLSEYTPTYFYVVKGSHGQLKTSFCSDQSRS  578

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V+K+++GS VPV+ DEK S RILVDHSIVESF QGGRT +TSR+YPTKAIY AAR
Sbjct  579  SLATDVSKKIFGSFVPVLKDEKLSVRILVDHSIVESFAQGGRTCVTSRVYPTKAIYGAAR  638

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +FLFNNAT  +V ASVK+WQMNSA I+PF
Sbjct  639  LFLFNNATEATVTASVKVWQMNSAFIRPF  667



>ref|XP_007039920.1| Glycosyl hydrolases family 32 protein [Theobroma cacao]
 gb|EOY24421.1| Glycosyl hydrolases family 32 protein [Theobroma cacao]
Length=766

 Score =   254 bits (650),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 160/210 (76%), Gaps = 3/210 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGE--G  646
            LLQWP+EE + LR       +V LQ G ++P+ + +A QLDI+A F V+++EA+E     
Sbjct  553  LLQWPVEETESLRLKSNEFNQVTLQAGTVVPLDVGSATQLDIMAEF-VIDKEALEKATGS  611

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++C +SGGA +RGALGPFGL+  ADE+L+E TPVYFY+ KG DG ++T FC D +RS
Sbjct  612  NETFSCGTSGGAAERGALGPFGLLALADESLSEKTPVYFYIAKGSDGNLKTFFCNDQSRS  671

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S AS V K +YGS VPV++ E  S R+LVDHSI+ESF QGGRTVITSR+YPTKAIY AA+
Sbjct  672  SAASDVNKLIYGSFVPVLEGENLSLRMLVDHSIIESFAQGGRTVITSRVYPTKAIYGAAK  731

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFP  196
            VFLFNNAT  SV AS+KIWQMNSA I+P+P
Sbjct  732  VFLFNNATEASVTASLKIWQMNSAFIRPYP  761



>ref|XP_012087134.1| PREDICTED: acid beta-fructofuranosidase-like [Jatropha curcas]
 gb|KDP25630.1| hypothetical protein JCGZ_20786 [Jatropha curcas]
Length=659

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 159/210 (76%), Gaps = 3/210 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+EEV+ LR        V ++PG ++P+ + AA QLDI A FE+ ++  +E   E 
Sbjct  448  LLQWPVEEVENLRLRSKEFKNVEVKPGSVVPLDLEAATQLDIFAEFEI-DKNVLENIAET  506

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  ++CS+S GA    ALGPFGL+V ADE+LAE TPVYFYV KG +G ++T FCTD TRS
Sbjct  507  DEEFSCSTSNGAAHHSALGPFGLLVLADESLAEQTPVYFYVTKGFNGTLKTFFCTDQTRS  566

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K++YG+ VPV++ EK++ R LVDHSI+ESF QGGRT ITSR+YPT+AIY AA+
Sbjct  567  SVANDVNKQIYGNFVPVLEGEKFTLRTLVDHSIIESFAQGGRTCITSRVYPTRAIYGAAK  626

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFP  196
            +FLFNNA  T+V AS+KIWQMNSA I+P+P
Sbjct  627  LFLFNNAIETNVTASLKIWQMNSAFIRPYP  656



>gb|AFR69121.1| vacuolar invertase [Manihot esculenta]
Length=653

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 159/209 (76%), Gaps = 1/209 (0%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE-GEGD  643
            LLQWP+EEV+ LR       KV ++PG ++P+ + AA QLDI+A FE+  +  ++  E  
Sbjct  442  LLQWPVEEVENLRLRAREFKKVEVEPGSVVPLDLDAATQLDIVAEFELDKDALMKTAEST  501

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              ++C +S GA  R ALGPFGL+V AD++LAE TPVYFY+ KG +G  +T FCTD +RSS
Sbjct  502  EEFSCKTSRGAAHRSALGPFGLLVLADDSLAEQTPVYFYINKGSNGTFKTFFCTDQSRSS  561

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
             A+ V K++YG+ VPV++ EK++ RILVDHSI+ESF QGGRT ITSR+YPT+AIY +A+V
Sbjct  562  AANDVNKQIYGNFVPVLEGEKFTLRILVDHSIIESFAQGGRTTITSRVYPTRAIYGSAKV  621

Query  282  FLFNNATGTSVKASVKIWQMNSADIKPFP  196
            FLFNNA  T+V AS+KIWQMNSA I+P+P
Sbjct  622  FLFNNAIETNVTASLKIWQMNSAFIRPYP  650



>emb|CAH18891.1| 2,1-fructan:2,1-fructan 1-fructosyltransferase precursor [Echinops 
ritro]
Length=608

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 160/218 (73%), Gaps = 5/218 (2%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            R+    LLQWP+EE++ LRS      ++ LQPG I+P+ + +  QLDI+A+FEV N++A 
Sbjct  393  RKTGTNLLQWPVEEIESLRSKVHEFNEIELQPGSIIPLEVGSTTQLDIVATFEV-NKDAF  451

Query  657  EGEGDFRYN---CSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHF  487
            E E +  YN   C+SS GA +RG LGPFG++V AD  L ELTPVYFY+ K  DG + THF
Sbjct  452  E-ETNVNYNEYGCTSSKGASQRGRLGPFGIIVLADGNLLELTPVYFYIAKNNDGSLTTHF  510

Query  486  CTDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTK  307
            CTD  RSS      K VYGSTVPV++ EK + R++VDHSI+E F QGGRTVITSR+YPTK
Sbjct  511  CTDKLRSSFDYDDEKVVYGSTVPVLEGEKLTIRLMVDHSIIEGFAQGGRTVITSRVYPTK  570

Query  306  AIYEAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            AIY+ A++FLFNNAT  +VKAS+K+W M SA+I+ +PF
Sbjct  571  AIYDTAKLFLFNNATDITVKASLKVWHMASANIQMYPF  608



>ref|XP_009350311.1| PREDICTED: acid beta-fructofuranosidase-like [Pyrus x bretschneideri]
Length=680

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 158/209 (76%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+EEV++LR       KV ++ G +LP+ +  A QLDI+A FE ++++ +E   E 
Sbjct  442  LLQWPVEEVEKLRLSITDFDKVEVKAGSVLPLQVVTATQLDIVAEFE-LDKKVLESVAES  500

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++C++S G   RGALGPFGL+V ADETL+E TPVYFYV KG  G  +T FC D TRS
Sbjct  501  NEVFSCNTSAGGSHRGALGPFGLLVLADETLSEQTPVYFYVAKGPGGNFDTFFCADQTRS  560

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K+V GS VPV+ DEK S RILVDHSIVESF QGGRT IT+R+YPTKAIY AAR
Sbjct  561  SVANDVKKKVTGSYVPVLKDEKLSVRILVDHSIVESFAQGGRTTITTRVYPTKAIYGAAR  620

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +FLFNNAT TSV AS+K+WQMNSA I+P+
Sbjct  621  LFLFNNATDTSVTASLKVWQMNSAFIRPY  649



>ref|XP_007155629.1| hypothetical protein PHAVU_003G217900g [Phaseolus vulgaris]
 gb|ESW27623.1| hypothetical protein PHAVU_003G217900g [Phaseolus vulgaris]
Length=651

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 162/211 (77%), Gaps = 3/211 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+ EV+ LR        +  +PG ++ + I  A QLD++A F V++ E+++   + 
Sbjct  436  LLQWPVAEVESLRLRSDEFKSLKAKPGSVVSLDIETATQLDVVAEF-VIDAESLQKTAQS  494

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  + CS+SGGA +RGALGPFGL+V ADE L+E TPVYFYV KG +G ++T FC+D +RS
Sbjct  495  NEEFTCSTSGGAAQRGALGPFGLLVLADEGLSEYTPVYFYVIKGRNGNLKTSFCSDQSRS  554

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A+ V K+++G+ VPV++ EK+S R+LVDHSIVESF QGGRT +TSR+YPTKAIY AAR
Sbjct  555  SQANDVRKQIFGNIVPVLEGEKFSLRMLVDHSIVESFAQGGRTCVTSRVYPTKAIYGAAR  614

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +FLFNNAT  +V AS+KIWQMNSA I+PFPF
Sbjct  615  LFLFNNATEATVTASLKIWQMNSAFIRPFPF  645



>ref|XP_007210314.1| hypothetical protein PRUPE_ppa002334mg [Prunus persica]
 gb|EMJ11513.1| hypothetical protein PRUPE_ppa002334mg [Prunus persica]
Length=686

 Score =   252 bits (643),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 160/209 (77%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+EE+++LR       KV ++ G + P+ +  A QLDI+A FE ++++ +E   E 
Sbjct  447  LLQWPVEEIEKLRLSSKDFNKVEVKAGSVEPLQVGTATQLDIVAEFE-LDKKVLESVAES  505

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++C++SGGA KRGALGPFGL+V ADE+L+E TPVYFYV KG  G V+T FC D TRS
Sbjct  506  NEAFSCNTSGGAAKRGALGPFGLLVLADESLSEQTPVYFYVAKGPGGIVDTFFCADQTRS  565

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V KE+ GS +PV+ DEK S RILVDHSIVESF QGGRT IT+RIYPTKAIY AAR
Sbjct  566  SVANDVRKEITGSYIPVLKDEKLSVRILVDHSIVESFAQGGRTTITNRIYPTKAIYGAAR  625

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +F+FNNAT  SV AS+K+WQ+NSA I+P+
Sbjct  626  LFVFNNATEISVTASIKVWQLNSAFIRPY  654



>gb|AJO70155.1| invertase 5 [Camellia sinensis]
Length=645

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 165/217 (76%), Gaps = 4/217 (2%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHI-PAAAQLDIIASFEVMNEEA  661
            R+    +LQWP+ EV++LR+     + V +QPG +LP+ +    +QLDI+A FE +++EA
Sbjct  425  RKTGSNVLQWPVVEVEKLRTKSWQFSNVVVQPGSVLPLDVGKKTSQLDIMAEFE-LDQEA  483

Query  660  VE--GEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHF  487
            +    E D  ++CS++GGA  RGALGPFGL+V ADE+L+E TP+YFYV KG +GK++T F
Sbjct  484  LNRVNETDEMFSCSTAGGAANRGALGPFGLLVLADESLSEQTPIYFYVAKGAEGKLKTFF  543

Query  486  CTDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTK  307
            C D +RSS+A+ V K +YGSTVPV+  EK+S RILVDHSIVESF Q GRT ITSRIYPTK
Sbjct  544  CADESRSSKATDVMKPIYGSTVPVLKGEKFSMRILVDHSIVESFAQRGRTCITSRIYPTK  603

Query  306  AIYEAARVFLFNNATGTSVKASVKIWQMNSADIKPFP  196
            AIYE A++FLFNNAT  ++ AS+KIWQM+SA I  +P
Sbjct  604  AIYEDAKIFLFNNATEANIIASLKIWQMDSAYIHSYP  640



>sp|O24509.1|INVA_PHAVU RecName: Full=Acid beta-fructofuranosidase; AltName: Full=Acid 
invertase; Short=AI; AltName: Full=Acid sucrose hydrolase; 
AltName: Full=Vacuolar invertase; Flags: Precursor [Phaseolus 
vulgaris]
 gb|AAB68679.1| soluble acid invertase [Phaseolus vulgaris]
Length=651

 Score =   251 bits (640),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 158/210 (75%), Gaps = 1/210 (0%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE-GEGD  643
            LLQWP+ EV+ LR        +  +PG ++ + I  A QLD++A FE+  E   +  + +
Sbjct  436  LLQWPVAEVESLRLRSDEFKSLKAKPGSVVSLDIETATQLDVVAEFEIDAESLQKTAQSN  495

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              + CS+SGGA +RGALGPFGL+V ADE L+E TPVYFYV KG +G ++T FC+D +RSS
Sbjct  496  EEFTCSTSGGAAQRGALGPFGLLVLADEGLSEYTPVYFYVIKGRNGNLKTSFCSDQSRSS  555

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
            + + V K+++G+ VPV++ EK+S R+LVDHSIVESF QGGRT +TSR+YPTKAIY AAR+
Sbjct  556  QPNDVRKQIFGNIVPVLEGEKFSLRMLVDHSIVESFAQGGRTCVTSRVYPTKAIYGAARL  615

Query  282  FLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            FLFNNAT  +V AS+KIWQMNSA I+PFPF
Sbjct  616  FLFNNATEATVTASLKIWQMNSAFIRPFPF  645



>ref|XP_002303584.2| hypothetical protein POPTR_0003s12640g [Populus trichocarpa]
 gb|EEE78563.2| hypothetical protein POPTR_0003s12640g [Populus trichocarpa]
Length=612

 Score =   250 bits (638),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 160/209 (77%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+EEV+RLR        + ++ G ++P+ +  A QLDI A FE ++++A+E   E 
Sbjct  401  LLQWPVEEVERLRLKGKEFNNIEVKTGSVMPLELDGATQLDIAAEFE-LDKKALESTAES  459

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++CS+SGGA +RGALGPFGL+V AD++LAE T VYFYV KG +G  +T FCTD +RS
Sbjct  460  NVDFSCSTSGGAAQRGALGPFGLLVLADDSLAEHTSVYFYVAKGNNGTHKTFFCTDQSRS  519

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V KE+YGS VPV++ EK S RILVDHSIVESF QGGRTVITSR+YPT+AIY AAR
Sbjct  520  SVANDVKKEIYGSYVPVLEGEKLSVRILVDHSIVESFAQGGRTVITSRVYPTRAIYGAAR  579

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +FLFNNA   +V +S+KIWQMNSA I+ +
Sbjct  580  LFLFNNAIEATVTSSLKIWQMNSAFIRRY  608



>ref|XP_004511663.1| PREDICTED: acid beta-fructofuranosidase-like [Cicer arietinum]
Length=646

 Score =   249 bits (637),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 157/209 (75%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+EEV+ LR        +   PG ++ + I  A QLDI+A FE+ ++EA+E   + 
Sbjct  433  LLQWPVEEVESLRLKSNKFENLKAMPGSVVSLDIETATQLDIVAEFEI-DKEAIEKTDQT  491

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  YNC +SGGA  RGALGPFGL+V A++ L+E TP+YFYV KG DG ++T FC+D +RS
Sbjct  492  NEEYNCKTSGGAAHRGALGPFGLLVLANDGLSEYTPIYFYVVKGNDGNLKTSFCSDQSRS  551

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K V+GS VPV+++EK S RILVDHSIVESF QGGRT +TSR+YPT+AIY  A+
Sbjct  552  SLATDVDKSVFGSFVPVLENEKLSLRILVDHSIVESFAQGGRTTVTSRVYPTRAIYGDAK  611

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +FLFNNAT  +V AS+K+WQMNSA IKPF
Sbjct  612  LFLFNNATEATVTASLKVWQMNSAFIKPF  640



>ref|XP_004515737.1| PREDICTED: acid beta-fructofuranosidase-like [Cicer arietinum]
Length=658

 Score =   250 bits (638),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 156/209 (75%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+ EV+ LR        +  +PG ++ + I  A QLDI+A FE+ ++EA+E     
Sbjct  445  LLQWPVAEVESLRLKSNEFKNLKAKPGTVMSLDIETATQLDILAEFEI-DKEALEKTAHT  503

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  Y CS SGGA +RGALGPFGL+V AD+ L+E TPVYFYV KG +G ++T FC+D +RS
Sbjct  504  NLEYECSISGGASQRGALGPFGLLVLADDGLSEYTPVYFYVVKGSNGNLKTSFCSDQSRS  563

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A+ V K+++GS VPV+  EK S RILVDHSIVESF QGGRT +TSR+YPT+AIY AAR
Sbjct  564  SQANDVHKQIFGSVVPVLKGEKLSLRILVDHSIVESFAQGGRTCVTSRVYPTRAIYGAAR  623

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +FLFNNAT  +V AS+KIWQMNSA I PF
Sbjct  624  LFLFNNATEATVTASLKIWQMNSAFIHPF  652



>gb|AEY79730.1| vacuolar invertase isoform 2 [Rosa hybrid cultivar]
Length=640

 Score =   249 bits (637),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 158/209 (76%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+EE+++LR       KV ++ G ++P+ +  A QLDI+A F+ ++++ VE   E 
Sbjct  400  LLQWPVEEIEKLRLNKKNFDKVQVKAGSVVPLDVGTATQLDIVAEFQ-LDQKVVESAAET  458

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++C +SGGA KRGALGPFGL+V AD++L+E TPVYFYV KG  G V T+FC D TRS
Sbjct  459  NEEFSCQTSGGAAKRGALGPFGLLVLADDSLSERTPVYFYVVKGSGGTVNTYFCADQTRS  518

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K+V GS VPV+  E  S RILVDHSI+ESF QGGRT IT+R+YPT+AIY AAR
Sbjct  519  SVATDVVKQVSGSYVPVLKGETLSLRILVDHSIIESFAQGGRTTITTRVYPTQAIYGAAR  578

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +FLFNNAT TS  AS++IWQMNSA I+PF
Sbjct  579  LFLFNNATDTSFTASLQIWQMNSAFIRPF  607



>ref|XP_011022761.1| PREDICTED: acid beta-fructofuranosidase-like [Populus euphratica]
Length=648

 Score =   249 bits (637),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 159/209 (76%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+EEV+RLR        + ++ G ++P+ +  A QLDI A FE ++++A+E   E 
Sbjct  437  LLQWPVEEVERLRLKGKEFNNIEVKAGSVMPLELDGATQLDIAAEFE-LDKKALESTAES  495

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++CS+SGGA +RGALGPFGL+V AD +LAE T VYFYV KG +G  +T FCTD +RS
Sbjct  496  NVDFSCSTSGGAAQRGALGPFGLLVLADNSLAEHTSVYFYVAKGNNGTHKTFFCTDQSRS  555

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V KE+YGS VPV++ EK S RILVDHSIVESF QGGRTV+TSR+YP +AIY AAR
Sbjct  556  SVANDVKKEIYGSYVPVLEGEKLSVRILVDHSIVESFAQGGRTVVTSRVYPIRAIYGAAR  615

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +FLFNNA   +V +S+KIWQMNSA I+P+
Sbjct  616  LFLFNNAIEATVTSSLKIWQMNSAFIRPY  644



>gb|AAD00558.1| fructan-fructan 1-fructosyltransferase [Cichorium intybus]
Length=617

 Score =   249 bits (635),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 154/216 (71%), Gaps = 1/216 (0%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            R+    LL WP EE++ LR       ++ L PG I+P+ I  A QLDI+A+FEV  E  +
Sbjct  402  RKTGTHLLHWPAEEIESLRYDGREFKEIELAPGSIMPLDIGPATQLDIVATFEVEQETFM  461

Query  657  E-GEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCT  481
               + +  Y C++S GA +RG+LGPFG+ V AD TL+ELTPVYFY+ K  DG V THFCT
Sbjct  462  RTSDTNGEYGCTTSAGATERGSLGPFGIAVLADGTLSELTPVYFYISKKTDGSVATHFCT  521

Query  480  DLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAI  301
            D  RSS      + VYGSTVPV+D E+ + R+LVDHS+VE F  GGRTV+TSR+YPTKAI
Sbjct  522  DKLRSSLDYDGERVVYGSTVPVLDGEELTMRLLVDHSVVEGFAMGGRTVMTSRVYPTKAI  581

Query  300  YEAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            YE A++FLFNNAT TSVKAS+KIWQ+ S  I+P+PF
Sbjct  582  YEGAKIFLFNNATHTSVKASLKIWQIASVRIQPYPF  617



>sp|Q43857.1|INVA_VICFA RecName: Full=Acid beta-fructofuranosidase; AltName: Full=Acid 
invertase; Short=AI; AltName: Full=Acid sucrose hydrolase; 
AltName: Full=Vacuolar invertase; Flags: Precursor [Vicia faba]
 emb|CAA89992.1| vacuolar invertase; beta-fructofuranosidase [Vicia faba var. 
minor]
Length=642

 Score =   249 bits (637),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 158/209 (76%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+ EV+ LR        + ++PG ++ + I  A QLDI+A FE+ ++EA+E   + 
Sbjct  426  LLQWPVAEVESLRLRSDEFQNLKVKPGAVVSVDIETATQLDIVAEFEI-DKEALEKTAQS  484

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  Y C++SGGA +RGALGPFGL V AD  L+E TPVYFYV KG +GK+ T FC+D +RS
Sbjct  485  NVEYECNTSGGASRRGALGPFGLYVLADNGLSEYTPVYFYVVKGINGKLHTSFCSDQSRS  544

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K++YGS VPV++ EK S RILVDHSIVESF QGGRT ITSR+YPT+AIY AAR
Sbjct  545  SLANDVHKQIYGSVVPVLEGEKLSLRILVDHSIVESFAQGGRTCITSRVYPTRAIYGAAR  604

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +FLFNNA  T+V AS+K+WQMNSA I+P+
Sbjct  605  LFLFNNAIETNVTASLKVWQMNSAFIRPY  633



>ref|XP_011033927.1| PREDICTED: acid beta-fructofuranosidase [Populus euphratica]
Length=661

 Score =   249 bits (637),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 157/209 (75%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+EEV+ LR        + ++ G ++P+ +  A QLDI+A FE ++ +A+E   E 
Sbjct  449  LLQWPVEEVESLRLKSKNFNNIEVKAGSVVPLELDGATQLDIVAEFE-LDRKAIERTAES  507

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++CS++GGA  RGALGPFGL+V AD+ L E TPVYF+V KG +G ++T FCTD +RS
Sbjct  508  NVEFSCSTNGGASHRGALGPFGLLVLADDDLTEYTPVYFFVAKGNNGSLKTFFCTDQSRS  567

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K +YGS VPV++ EK S RILVDHSI+ESF QGGRT ITSR+YPT+AIY AAR
Sbjct  568  SVANDVRKGIYGSNVPVLEGEKLSVRILVDHSIIESFAQGGRTCITSRVYPTRAIYGAAR  627

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +FLFNNAT T V +S+KIW MNSA I+PF
Sbjct  628  LFLFNNATETGVTSSLKIWNMNSAFIRPF  656



>gb|AFO84092.1| vacuolar invertase [Actinidia chinensis]
Length=632

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 156/211 (74%), Gaps = 4/211 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            +LQWP+EEV+ LR        V L PG I+P++I +A QLDI A+FEV ++EA+EG  E 
Sbjct  421  ILQWPVEEVEELRRNSIEFNGVELAPGSIVPLNIRSATQLDITATFEV-DKEALEGVLEV  479

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNCS++G  V RGALGPFGL+V AD +L ELTPVYFY+ K   G  +T FC D  RS
Sbjct  480  DVGYNCSTAGAGV-RGALGPFGLIVLADHSLFELTPVYFYISKDVGGGYKTFFCADEIRS  538

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A  V K+V+G  VPV+D EK + R+LVDHSIVESF QGGRTVITSRIYPTKA+  AAR
Sbjct  539  SLALEVNKKVHGGMVPVLDGEKLTMRLLVDHSIVESFAQGGRTVITSRIYPTKAVDGAAR  598

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
             FLFNNATG SV AS+ +W+M SA IKP+PF
Sbjct  599  AFLFNNATGVSVTASLTVWEMKSAYIKPYPF  629



>ref|XP_004147588.1| PREDICTED: acid beta-fructofuranosidase-like [Cucumis sativus]
 gb|KGN50220.1| hypothetical protein Csa_5G160230 [Cucumis sativus]
Length=685

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 155/208 (75%), Gaps = 1/208 (0%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG-EGD  643
            LLQWP+EE++ LR        + + PG ++P+ + ++ QLDI A FE+  E   +  E +
Sbjct  442  LLQWPVEEIENLRQRSHAFHNLVIHPGSVVPLEVGSSTQLDIFAEFELDKEAVAKAIETN  501

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              ++C   GGA  RGALGPFGL+V ADETL+E TPVYFYV KG +G ++T FCTD +RSS
Sbjct  502  VEFSCQRRGGAAIRGALGPFGLLVLADETLSEHTPVYFYVAKGQNGTLKTFFCTDESRSS  561

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
            EA+ V K +YGS+VPV++ EK+S RILVDHS+VESF QGGRT ITSR+YPTKAIY AAR+
Sbjct  562  EANDVYKPIYGSSVPVLEGEKFSLRILVDHSVVESFAQGGRTCITSRVYPTKAIYGAARL  621

Query  282  FLFNNATGTSVKASVKIWQMNSADIKPF  199
            F+FNNA  T++ AS+ IWQMN A I+P+
Sbjct  622  FVFNNAKDTNITASLTIWQMNPAFIRPY  649



>emb|CAH18937.1| 2,1-fructan:2,1-fructan 1-fructosyltransferase precursor [Doronicum 
pardalianches]
Length=617

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 160/217 (74%), Gaps = 3/217 (1%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            R+    LL WP+EE++ LRS      ++ L+PG ++P+ I +A QLDI+A+F+V +E+ +
Sbjct  402  RKTGTHLLHWPVEEIESLRSNGREFEEIELEPGSVIPLDIGSATQLDIVATFKV-DEDTL  460

Query  657  EG--EGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            +   E + +Y C++S GA +RG+ GPFG+ V AD TL+ELTPVYFY+ K  DG V THFC
Sbjct  461  KATSETNDQYGCTTSSGAAERGSFGPFGVAVLADGTLSELTPVYFYIAKNKDGGVTTHFC  520

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD  RSS      + VYGS++ V+D E+ + R+LVDHS++E F QGGRTVITSR+YPTKA
Sbjct  521  TDKLRSSLDYDGERVVYGSSITVLDGEELTMRVLVDHSVIEGFAQGGRTVITSRVYPTKA  580

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            IY+ A++FLFNNAT T+VKAS+ IWQM  A IKP+PF
Sbjct  581  IYDGAKLFLFNNATATTVKASINIWQMGLAQIKPYPF  617



>gb|KHN04338.1| Acid beta-fructofuranosidase [Glycine soja]
Length=555

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 159/215 (74%), Gaps = 3/215 (1%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            R+    LLQWP+ E++ LR        +  +PG ++ + I  A QLDI+A FE+ ++E +
Sbjct  336  RKTGSNLLQWPVAEIESLRLRSDEFKNLKAKPGSVVSVDIETATQLDIVAEFEI-DKETL  394

Query  657  EG--EGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            +   + +  Y CS+SGG+ +RGALGPFGL+V ADE L+E TP YFYV KG +G ++T FC
Sbjct  395  DKIPQSNEEYTCSTSGGSKQRGALGPFGLLVLADEGLSEYTPQYFYVIKGSNGNLKTSFC  454

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
             D +RSS+A+ V K++ GS VPV+  EK+S RILVDHSIVESF QGGRTV+TSR+YPTKA
Sbjct  455  ADQSRSSQANDVRKQIVGSAVPVLKGEKFSLRILVDHSIVESFAQGGRTVVTSRVYPTKA  514

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            IY AAR+FLFNNAT  +V AS+K+WQMNSA I+PF
Sbjct  515  IYGAARLFLFNNATEATVTASLKVWQMNSAFIRPF  549



>ref|XP_009343902.1| PREDICTED: acid beta-fructofuranosidase-like [Pyrus x bretschneideri]
 ref|XP_009343903.1| PREDICTED: acid beta-fructofuranosidase-like [Pyrus x bretschneideri]
Length=681

 Score =   249 bits (635),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 157/209 (75%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            L+QWP+EEV++LR       KV ++ G +LP+ +  A QLDI+A FE ++++ +E   E 
Sbjct  442  LIQWPVEEVEKLRLSITDFDKVEVKAGSVLPLQVVTATQLDIVAEFE-LDKKVLESVAES  500

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++C++S G   RGALGPFGL+V ADETL+E TPVYFYV KG  G  +T FC D TRS
Sbjct  501  NEVFSCNTSAGGSHRGALGPFGLLVLADETLSEQTPVYFYVAKGPGGNFDTFFCADQTRS  560

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K+V GS VPV+ DEK S RILVDHSIVESF QGGRT IT+R+YPTKAIY AAR
Sbjct  561  SVANDVKKKVTGSYVPVLKDEKLSVRILVDHSIVESFAQGGRTTITTRVYPTKAIYGAAR  620

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +FLFNNAT  SV AS+K+WQMNSA I+P+
Sbjct  621  LFLFNNATEISVTASLKVWQMNSAFIRPY  649



>gb|KHN09790.1| Acid beta-fructofuranosidase [Glycine soja]
Length=619

 Score =   247 bits (631),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 157/215 (73%), Gaps = 3/215 (1%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            R+    LLQWP+ EV+ LR        +  +PG ++ I I  A QLDI+A FE+ ++E +
Sbjct  400  RKTGSNLLQWPVAEVESLRLRSDEFKNLKAKPGSVVSIDIETATQLDIVAEFEI-DKETL  458

Query  657  EG--EGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            E   E +  Y C +SGG+ +RGALGPFGL+V ADE L E TP YFYV KG +G ++T FC
Sbjct  459  EKTPESNEEYTCGNSGGSKQRGALGPFGLLVLADEGLFEYTPQYFYVIKGSNGNLKTSFC  518

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
             D +RSS+A+ V K++ GS VPV+ DEK+S RILVDHSIVESF QGGRTV+TSR+YPTKA
Sbjct  519  ADQSRSSQANDVRKQIVGSAVPVLKDEKFSLRILVDHSIVESFAQGGRTVVTSRVYPTKA  578

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            IY AAR+FLFNNAT  +V AS+ +WQMNSA I+PF
Sbjct  579  IYGAARLFLFNNATEATVTASLNVWQMNSAFIRPF  613



>ref|XP_011010942.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like, 
partial [Populus euphratica]
Length=520

 Score =   244 bits (624),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 154/209 (74%), Gaps = 5/209 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            +LQWP+EE++ LR      T++ + PG ++P+ I  A QLDI A FE+   E +      
Sbjct  314  ILQWPVEEIESLRLRSTDFTEIVVGPGSVVPLDIGQATQLDIFAEFEI---EIISETKHE  370

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
            +Y CS  GGAV R ALGPFGL+V AD+TL+ELTPV+F      +G VET+FC D TRSS+
Sbjct  371  KYGCS--GGAVDRSALGPFGLLVIADQTLSELTPVFFRPVNTTEGIVETYFCADETRSSK  428

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVF  280
            AS V K+VYGSTVPV  DEK+  R+LVDHSIVESF QGGR VITSRIYPTKAIY  AR+F
Sbjct  429  ASDVYKQVYGSTVPVFTDEKFQMRVLVDHSIVESFAQGGRRVITSRIYPTKAIYGDARLF  488

Query  279  LFNNATGTSVKASVKIWQMNSADIKPFPF  193
            LFNNATG +VKA++KIW++NSA I PF F
Sbjct  489  LFNNATGVNVKATLKIWELNSAFIHPFLF  517



>ref|XP_010053435.1| PREDICTED: acid beta-fructofuranosidase-like [Eucalyptus grandis]
 gb|KCW77732.1| hypothetical protein EUGRSUZ_D02029 [Eucalyptus grandis]
Length=653

 Score =   248 bits (632),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 159/209 (76%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+EEV  LR        V ++ G ++P+ +  A Q+DI+A FE ++++A+E   E 
Sbjct  443  LLQWPVEEVDSLRLSSKEFDSVEVEAGTVVPLDVETATQVDIVAEFE-LDKQALEAAPEA  501

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  Y CS+SGGA +R ALGPFGL+V AD+ L+E TPVYFYV KG +G ++T  CTD +RS
Sbjct  502  DADYVCSASGGASQRSALGPFGLLVLADDDLSEQTPVYFYVVKGPNGTLKTSICTDQSRS  561

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K+VYGS VPV++ EK S RILVDHSIVE+F QGGR+ IT+R+YPTKAIY AAR
Sbjct  562  SVATDVHKQVYGSFVPVLEGEKLSLRILVDHSIVETFAQGGRSCITARVYPTKAIYGAAR  621

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            VFLFNNAT  +VKAS+KIWQMNSA I+P+
Sbjct  622  VFLFNNATEANVKASLKIWQMNSAFIRPY  650



>ref|XP_010093687.1| Acid beta-fructofuranosidase [Morus notabilis]
 gb|EXB54467.1| Acid beta-fructofuranosidase [Morus notabilis]
Length=662

 Score =   248 bits (633),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 155/210 (74%), Gaps = 4/210 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            LLQWP+EEV+ LR        V + PG ++P+ I  A QLDI+A FE M+++A+E     
Sbjct  445  LLQWPVEEVESLRLTSSEFNDVQVTPGSVVPLDIGTATQLDIVAEFE-MDKKALEETAKA  503

Query  639  RY---NCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
             Y   +CS SGGA +RGALGPFGL+V AD+  +E TPVYFY+ KG DG ++T FCTD +R
Sbjct  504  NYTEFSCSISGGAWQRGALGPFGLLVLADDIRSEQTPVYFYIVKGSDGNLKTFFCTDQSR  563

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SS AS V K++YGS V V++ EK S RILVDHSIVESF QGGR  ITSR+YPT+AIY AA
Sbjct  564  SSVASDVNKQIYGSFVSVLEGEKLSVRILVDHSIVESFAQGGRACITSRVYPTRAIYGAA  623

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            R+F+FNNAT  +V  S+KIWQMNSA I+PF
Sbjct  624  RIFVFNNATEATVTTSLKIWQMNSAFIRPF  653



>gb|ABX90020.1| fructan:fructan 1-fructosyltransferase [Lactuca sativa]
Length=622

 Score =   247 bits (630),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 155/216 (72%), Gaps = 1/216 (0%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEE-A  661
            R+    LL WP+EE++ LRS      ++ L+PG I+P+ I  A QLDI+A+FEV  +  +
Sbjct  407  RKTGTHLLHWPVEEIETLRSDVREFKEIGLEPGSIVPLDIGHATQLDIVATFEVDPKSLS  466

Query  660  VEGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCT  481
            +  + +  Y C++S GA  RG LGPFG+ V ADE  +ELTPVYFY+ K  DG V THFCT
Sbjct  467  LTSDTNGEYGCTTSSGATDRGILGPFGIAVLADEARSELTPVYFYIAKSNDGGVTTHFCT  526

Query  480  DLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAI  301
            D  RSS      + VYGS+VPV+D E+ + R+LVDHS+VE F  GGR V+TSR+YPTKAI
Sbjct  527  DKLRSSLDYDGERVVYGSSVPVLDGEELTMRLLVDHSVVEGFAMGGRIVMTSRVYPTKAI  586

Query  300  YEAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            Y+ A++FLFNNATGTSVKAS+KIWQM  A ++P+PF
Sbjct  587  YDGAKIFLFNNATGTSVKASLKIWQMGYARVQPYPF  622



>ref|XP_003549902.1| PREDICTED: acid beta-fructofuranosidase-like isoform 1 [Glycine 
max]
Length=645

 Score =   247 bits (631),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 157/215 (73%), Gaps = 3/215 (1%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            R+    LLQWP+ EV+ LR        +  +PG ++ I I  A QLDI+A FE+ ++E +
Sbjct  426  RKTGSNLLQWPVAEVESLRLRSDEFKNLKAKPGSVVSIDIETATQLDIVAEFEI-DKETL  484

Query  657  EG--EGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            E   E +  Y C +SGG+ +RGALGPFGL+V ADE L E TP YFYV KG +G ++T FC
Sbjct  485  EKTPESNEEYTCGNSGGSKQRGALGPFGLLVLADEGLFEYTPQYFYVIKGSNGNLKTSFC  544

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
             D +RSS+A+ V K++ GS VPV+ DEK+S RILVDHSIVESF QGGRTV+TSR+YPTKA
Sbjct  545  ADQSRSSQANDVRKQIVGSAVPVLKDEKFSLRILVDHSIVESFAQGGRTVVTSRVYPTKA  604

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            IY AAR+FLFNNAT  +V AS+ +WQMNSA I+PF
Sbjct  605  IYGAARLFLFNNATEATVTASLNVWQMNSAFIRPF  639



>gb|AFD62255.1| acid invertase [Kummerowia stipulacea]
Length=644

 Score =   247 bits (631),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 157/208 (75%), Gaps = 1/208 (0%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE-GEGD  643
            LLQWP+ EV+ LR        +  +PG ++ + I AA QLDI+A FE+ NE   +  E +
Sbjct  431  LLQWPVAEVEGLRLRSDEFQSLKAKPGSVVSLDIEAATQLDIVAEFEIDNETLEKIPESN  490

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              Y CS+SGG+ +RGALGPFGL+V AD+ L+E TPVYFYV KG +G ++T FC+D +RSS
Sbjct  491  EEYTCSTSGGSAQRGALGPFGLLVLADDGLSEYTPVYFYVIKGTNGTLKTSFCSDQSRSS  550

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
             A+ V K++YGS VPV++ EK+S RILVDHSIVES+ QGGRTV+TSR+YPTKAIY AAR+
Sbjct  551  VANDVHKQIYGSVVPVLNGEKFSLRILVDHSIVESYAQGGRTVVTSRVYPTKAIYGAARL  610

Query  282  FLFNNATGTSVKASVKIWQMNSADIKPF  199
            F FNNAT  +V  S+++WQMNSA I+P+
Sbjct  611  FFFNNATEATVTTSLEVWQMNSAFIRPY  638



>gb|ABX90019.1| sucrose:sucrose 1-fructosyltransferase [Lactuca sativa]
Length=639

 Score =   247 bits (630),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 159/212 (75%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTK-VNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--E  649
            L+QWPIEEV++LRS      K V L+PG ++P+ I  A QLDI A+FE+ +E+ +E   E
Sbjct  424  LIQWPIEEVEKLRSKKYDEFKDVELRPGSLIPLEIGTATQLDISATFEI-DEKMLESTLE  482

Query  648  GDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
             D  +NC++S G+V RG LGPFG+VV AD + +E  PVYFY+ K  DG  +T+FC D +R
Sbjct  483  ADVLFNCTTSEGSVGRGVLGPFGVVVLADASRSEQLPVYFYIAKDTDGTSKTYFCADESR  542

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SS+   + K VYGS+VPV++ EKY+ R+LVDHSIVE F QGGRTV+TSR+YPTKAIY AA
Sbjct  543  SSKDKSIGKWVYGSSVPVLEGEKYNMRLLVDHSIVEGFAQGGRTVVTSRVYPTKAIYGAA  602

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            ++FLFNNATG SVKAS+KIW+M  A + PFP 
Sbjct  603  KLFLFNNATGISVKASIKIWKMGEAQLDPFPL  634



>ref|XP_009401797.1| PREDICTED: beta-fructofuranosidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=667

 Score =   248 bits (632),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 152/210 (72%), Gaps = 4/210 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGE--G  646
            LLQWP+EEV+ LR      + +++  G ++P+ I  A QLDI+A F V +E A+ G    
Sbjct  445  LLQWPVEEVESLRLSSQEFSNISITAGSVVPLDIGKATQLDIVAEFSV-DEAALAGAIGA  503

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNCS+S GA +RG +GPFGL+V ADE L+E T VYFYV +  DG + THFC D  RS
Sbjct  504  DVGYNCSTSRGAAQRGVIGPFGLLVLADEDLSEQTAVYFYVARATDGSLSTHFCHDELRS  563

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            SEA+ + K VYGS VPV+D E +S RILVDHSIVESF QGGRT ITSR+YPTKAI+  AR
Sbjct  564  SEANDLVKRVYGSLVPVLDGETFSLRILVDHSIVESFAQGGRTCITSRVYPTKAIFSRAR  623

Query  285  VFLFNNATGTSVKA-SVKIWQMNSADIKPF  199
            +FL NNATG  V A SVKIWQMNSA I+PF
Sbjct  624  LFLLNNATGVDVTATSVKIWQMNSAFIRPF  653



>gb|KJB51453.1| hypothetical protein B456_008G216800 [Gossypium raimondii]
Length=476

 Score =   243 bits (619),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 161/226 (71%), Gaps = 17/226 (8%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFE----VMN--EEAV  658
            LLQWP+EEV+ LR    +   V ++ G ++P+ I  A QLDI+A FE    V+N  E+ V
Sbjct  259  LLQWPVEEVESLRLNATVFKDVVVEAGSVVPLDIGTATQLDILAEFEIETLVLNSTEDEV  318

Query  657  EGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTD  478
               GD         GAV R   GPFG++V AD++L+ELTP+YF      DG +ET+FC D
Sbjct  319  SDCGD---------GAVDRSTYGPFGVLVIADDSLSELTPIYFRPLNTSDGSLETYFCAD  369

Query  477  LTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIY  298
             TRSS+A  VTK VYG  +PV+DDE Y+ R+LVDHS+VESFG+GGRTVITSR+YPT+AIY
Sbjct  370  ETRSSKAPDVTKRVYGGKIPVLDDENYNMRVLVDHSVVESFGEGGRTVITSRVYPTEAIY  429

Query  297  EAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF*SIL--ELFAS  166
             AAR+FLFNNA+G +VKA++KIW+MNSA I+PFPF   L  E+ AS
Sbjct  430  GAARLFLFNNASGVNVKATLKIWEMNSAFIRPFPFEETLFQEMVAS  475



>dbj|BAF35859.1| soluble acid invertase [Pyrus pyrifolia var. culta]
 dbj|BAG30920.1| soluble acid invertase [Pyrus pyrifolia]
Length=681

 Score =   248 bits (632),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 156/209 (75%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            L+QWP+EEV+ LR       KV ++ G +LP+ +  A QLDI+A FE ++++ +E   E 
Sbjct  442  LIQWPVEEVENLRLSITDFDKVEVKAGSVLPLQVVTATQLDIVAEFE-LDKKVLESVAES  500

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++C++S G   RGALGPFGL+V ADETL+E TPVYFYV KG  G  +T FC D TRS
Sbjct  501  NEVFSCNTSAGGSHRGALGPFGLLVLADETLSEQTPVYFYVAKGPGGNFDTFFCADQTRS  560

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K+V GS VPV+ DEK S RILVDHSIVESF QGGRT IT+R+YPTKAIY AAR
Sbjct  561  SVANDVKKKVTGSYVPVLKDEKLSVRILVDHSIVESFAQGGRTTITTRVYPTKAIYGAAR  620

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +FLFNNAT  SV AS+K+WQMNSA I+P+
Sbjct  621  LFLFNNATEISVTASLKVWQMNSAFIRPY  649



>gb|KJB25624.1| hypothetical protein B456_004G200800 [Gossypium raimondii]
Length=702

 Score =   248 bits (632),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 156/208 (75%), Gaps = 1/208 (0%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEG-D  643
            LLQWP+EE++ LR       KV ++ G ++P+ +   +QLDIIA FE+  E   +  G +
Sbjct  452  LLQWPVEEIESLRLNSTEFEKVEVKAGSVVPLDVGPGSQLDIIAEFEMDKEALKKATGSN  511

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              ++C + GGA K GALGPFG++V ADE+L+E TPVYFY+ K  DG ++T FCTDL+RSS
Sbjct  512  ITFSCQTGGGAAKSGALGPFGILVLADESLSEQTPVYFYIAKDSDGDLKTFFCTDLSRSS  571

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
            +A  V K+++GS VPV+ DE  S R+LVDHSIVESF QGGRTVITSRIYPT+AI  A+RV
Sbjct  572  KAPDVDKQIFGSYVPVLKDENLSLRVLVDHSIVESFAQGGRTVITSRIYPTEAINGASRV  631

Query  282  FLFNNATGTSVKASVKIWQMNSADIKPF  199
            FLFNNAT T V ASVKIWQM+SA I+P+
Sbjct  632  FLFNNATETCVIASVKIWQMDSAFIRPY  659



>ref|XP_010259020.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
isoform X1 [Nelumbo nucifera]
Length=664

 Score =   246 bits (629),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 154/209 (74%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            L+QWP+EEV+ LR       KV +  G ++P+ +  A QLDI A FE+ + E +EG  E 
Sbjct  451  LVQWPVEEVESLRLTSTEFDKVVVGAGSVVPLDVGTATQLDITAEFEI-DSETLEGTIEA  509

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNC++SGGA  RG LGPFGL+V A+++LAE TPVYFY+ K  DG   T FC D +RS
Sbjct  510  DIGYNCTTSGGAAGRGTLGPFGLLVLAEDSLAEQTPVYFYIAKDTDGDYRTFFCADESRS  569

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K VYGS VPV++ EK   R+LVDHSIVESF QGGRTV+TSR+YPT+AIY AAR
Sbjct  570  SLANDVVKYVYGSYVPVLEGEKLIMRLLVDHSIVESFAQGGRTVVTSRVYPTQAIYGAAR  629

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            VFLFNNAT  +V AS+KIWQMNSA I+P+
Sbjct  630  VFLFNNATAANVTASLKIWQMNSAFIRPY  658



>gb|ACZ05614.1| vacuolar invertase 2 [Gossypium hirsutum]
Length=618

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 155/209 (74%), Gaps = 4/209 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            LLQWP+EEV+ LR    +  +V ++PG ++P+ I    QLDI+A FE+  E  +    + 
Sbjct  409  LLQWPVEEVESLRLNSTMFKEVLVEPGSVVPLDIGTTTQLDILAEFEI--EPLIPSTTNE  466

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
              NC    GAV R   GPFGL+V AD +L+ELTP+YF      DG ++T+FC+D TRSS+
Sbjct  467  IDNCGD--GAVDRSTYGPFGLLVIADASLSELTPIYFRPLNASDGSLKTYFCSDETRSSK  524

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVF  280
            AS V K+VYG  VPV+DDE Y+ R+LVDHSIVESF QGGRTVI+SRIYPT+AIY AAR+F
Sbjct  525  ASDVFKQVYGGKVPVLDDENYNMRVLVDHSIVESFAQGGRTVISSRIYPTEAIYGAARLF  584

Query  279  LFNNATGTSVKASVKIWQMNSADIKPFPF  193
            LFNNATG +VKA++KIW++NSA I+PFPF
Sbjct  585  LFNNATGVNVKATLKIWELNSAFIRPFPF  613



>emb|CBI31885.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   242 bits (617),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 154/209 (74%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            +LQWP+ E+K LR       K+ + PG ++ + +  A Q+DI A FE+ ++EA++  GE 
Sbjct  258  ILQWPVAEIKSLRKSSKKFDKLEVGPGSVVTLEVEKATQMDITAEFEI-DKEALKRIGES  316

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  Y+C +SGG+ +RG LGPFGL++ ADE   E TPVYFYV KG DG+++T FCTD +RS
Sbjct  317  DVEYSCGTSGGSAQRGELGPFGLLLLADEGRCEQTPVYFYVAKGTDGQLKTFFCTDESRS  376

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K ++GSTVPVI  EK S RILVDHSI+ESF QGGRT ITSR+YPTKAIY AA+
Sbjct  377  SLANDVDKRIFGSTVPVIKGEKLSMRILVDHSIIESFAQGGRTCITSRVYPTKAIYGAAQ  436

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +++FNNAT  S+ AS++ W M SA I+P+
Sbjct  437  LYVFNNATSASITASIQTWAMKSAYIRPY  465



>ref|XP_003525803.1| PREDICTED: acid beta-fructofuranosidase-like [Glycine max]
Length=645

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 159/215 (74%), Gaps = 3/215 (1%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            R+    LLQWP+ E++ LR        +  +PG ++ + I  A QLDI+A FE+ ++E +
Sbjct  426  RKTGSNLLQWPVAEIESLRLRSDEFKNLKAKPGSVVSVDIETATQLDIVAEFEI-DKETL  484

Query  657  EG--EGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            +   + +  Y CS+SGG+ +RGALGPFGL+V ADE L+E TP YFYV KG +G ++T FC
Sbjct  485  DKIPQSNEEYTCSTSGGSKQRGALGPFGLLVLADEGLSEYTPQYFYVIKGSNGNLKTSFC  544

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
             D +RSS+A+ V K++ GS VPV+  EK+S RILVDHSIVESF QGGRTV+TSR+YPTKA
Sbjct  545  ADQSRSSQANDVRKQIVGSAVPVLKGEKFSLRILVDHSIVESFAQGGRTVVTSRVYPTKA  604

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            IY AAR+FLFNNAT  +V AS+K+WQMNSA I+PF
Sbjct  605  IYGAARLFLFNNATEATVTASLKVWQMNSAFIRPF  639



>gb|AFD62256.1| acid invertase [Kummerowia stipulacea]
Length=644

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 157/208 (75%), Gaps = 1/208 (0%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE-GEGD  643
            LLQWP+ EV+ LR        +  +PG ++ + I AA QLDI+A FE+ NE   +  E +
Sbjct  431  LLQWPVAEVEGLRLRSDEFQSLKAKPGSVVSLDIEAATQLDIVAEFEIDNETLEKIPESN  490

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              Y CS+SGG+ +RGALGPFGL+V AD+ L+E TPVYFYV KG +G ++T FC+D +RSS
Sbjct  491  EEYTCSTSGGSAQRGALGPFGLLVLADDGLSEYTPVYFYVIKGTNGTLKTSFCSDQSRSS  550

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
             A+ V K++YGS VPV++ EK+S RILVDHS+VES+ QGGRTV+TSR+YPTKAIY AAR+
Sbjct  551  VANDVHKQIYGSVVPVLNGEKFSLRILVDHSMVESYAQGGRTVVTSRVYPTKAIYGAARL  610

Query  282  FLFNNATGTSVKASVKIWQMNSADIKPF  199
            F FNNAT  +V  S+++WQMNSA I+P+
Sbjct  611  FFFNNATEATVTTSLEVWQMNSAFIRPY  638



>ref|NP_001169591.1| uncharacterized protein LOC100383472 [Zea mays]
 gb|ACN34201.1| unknown [Zea mays]
Length=485

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 151/210 (72%), Gaps = 2/210 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEV-MNEEAVEGEGD  643
            LLQWP+ EV+ LR        V L  G ++P+ +  A QLDI A FEV  ++ A   E D
Sbjct  270  LLQWPVVEVENLRMSGKSFDGVALDRGSVVPLDVGKATQLDIEAVFEVDASDAAAVTEAD  329

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              +NCS+S GA  RG LGPFGL+V AD+ L+E T VYFY+ KG DG ++T FC D  R+S
Sbjct  330  VTFNCSTSAGAAGRGLLGPFGLLVLADDDLSEQTAVYFYLLKGTDGSLQTFFCQDELRAS  389

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
            +A+ + K VYGS VPV+D E  S RILVDHSIVESF QGGRT ITSR+YPT+AIY++ARV
Sbjct  390  KANDLVKRVYGSLVPVLDGENLSVRILVDHSIVESFAQGGRTCITSRVYPTRAIYDSARV  449

Query  282  FLFNNATGTSVKA-SVKIWQMNSADIKPFP  196
            FLFNNAT   VKA SVKIWQ+NSA I+P+P
Sbjct  450  FLFNNATHAHVKAKSVKIWQLNSAYIRPYP  479



>emb|CBI24585.3| unnamed protein product [Vitis vinifera]
Length=542

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 162/212 (76%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEGEG  646
            LL WPIEEV+ LR+       V L+PG ++P+ I +A+QLDI+A FEV NE  EA+  E 
Sbjct  329  LLLWPIEEVESLRTNSTEFEDVLLEPGSVVPLDIGSASQLDIVAEFEVDNETLEAMV-EA  387

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNCS+S GA  RGALGPFG++V AD+TL+ELTP+YFY+ K  DG  +T FCTDL+RS
Sbjct  388  DVIYNCSTSAGAAGRGALGPFGILVLADDTLSELTPIYFYIAKDTDGSYKTFFCTDLSRS  447

Query  465  SEA-SGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            S A   V + +YGS VPV+DDEK + R+LVDHSIVE F QGGR+ IT+R+YPT+AIY AA
Sbjct  448  SLAVDDVDQRIYGSIVPVLDDEKPTMRVLVDHSIVEGFSQGGRSCITTRVYPTEAIYGAA  507

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+FLFNNATG +V AS+KIW+M SADI P+P 
Sbjct  508  RLFLFNNATGVNVTASIKIWEMASADIHPYPL  539



>emb|CAA54480.1| acid invertase [Solanum lycopersicum]
Length=163

 Score =   231 bits (590),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -1

Query  636  YNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSEA  457
            ++CS+SGGA  RG LGPFG++V AD+TL+ELTPVYFY+ KG DG+ ETHFC D TRSSEA
Sbjct  13   FSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETHFCADQTRSSEA  72

Query  456  SGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVFL  277
             GV K+VYGS+VPV+D EK+S R+LVDHSIVESF QGGRTVITSRIYPTKA+  AAR+F+
Sbjct  73   PGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGAARLFV  132

Query  276  FNNATGTSVKASVKIWQMNSADIKPFPF  193
            FNNATG SV ASVKIW + SA+I+ FP 
Sbjct  133  FNNATGASVTASVKIWSLESANIQSFPL  160



>ref|XP_002303519.1| vacuolar invertase family protein [Populus trichocarpa]
 gb|EEE78498.1| vacuolar invertase family protein [Populus trichocarpa]
Length=662

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 156/209 (75%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+EEV+ LR        + ++ G  +P+ +  A QLDI+A FE ++ +A+E   E 
Sbjct  450  LLQWPVEEVESLRLKSKNFNNIEVKAGSAVPLELDGATQLDIVAEFE-LDRKAIERTAES  508

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++CS++GGA  RGALGPFGL+V AD+ L E TPVYF+V KG +G ++T FCTD +RS
Sbjct  509  NVEFSCSTNGGASHRGALGPFGLLVLADDDLTEYTPVYFFVAKGNNGSLKTFFCTDQSRS  568

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V KE+YGS VPV++ EK S RILVDHSI+ESF QGGRT ITSR+YPT+AIY +AR
Sbjct  569  SVANDVRKEIYGSYVPVLEGEKLSVRILVDHSIIESFAQGGRTCITSRVYPTRAIYGSAR  628

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +FLFNNAT   V +S+KIW MNSA I+P+
Sbjct  629  LFLFNNATEAGVTSSLKIWNMNSAFIRPY  657



>gb|KJB19681.1| hypothetical protein B456_003G114000 [Gossypium raimondii]
Length=618

 Score =   245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 155/209 (74%), Gaps = 4/209 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            LLQWP+EEV+ LR    +  +V ++PG ++P+ I    QLDI+A FE+  E  +    + 
Sbjct  409  LLQWPVEEVESLRLNSTMFKEVLVEPGSVVPLDIGTTTQLDILAEFEI--EPLIPSTTNE  466

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
              +C    GAV R   GPFGL+V AD +L+ELTP+YF      DG ++T+FCTD TRSS+
Sbjct  467  IDDCGD--GAVDRSTYGPFGLLVIADASLSELTPIYFRPLNASDGSLKTYFCTDETRSSK  524

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVF  280
            AS V K+VYG  VPV+DDE Y+ R+LVDHSIVESF QGGRTVI+SRIYPT+AIY AAR+F
Sbjct  525  ASDVFKQVYGGKVPVLDDENYNMRVLVDHSIVESFAQGGRTVISSRIYPTEAIYGAARLF  584

Query  279  LFNNATGTSVKASVKIWQMNSADIKPFPF  193
            LFNNATG +VKA++KIW++NSA I+PFPF
Sbjct  585  LFNNATGVNVKATLKIWELNSAFIRPFPF  613



>ref|XP_002321831.2| hypothetical protein POPTR_0015s14790g [Populus trichocarpa]
 gb|EEF05958.2| hypothetical protein POPTR_0015s14790g [Populus trichocarpa]
Length=636

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 157/211 (74%), Gaps = 9/211 (4%)
 Frame = -1

Query  819  LLQWPIEEVK--RLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEG  646
            +LQWP+EE++  RLRS D   T++ + PG ++P+ I  A QLDI A FE+   E +    
Sbjct  430  ILQWPVEEIEGLRLRSTD--FTEIVVGPGSVVPLDIGQATQLDIFAEFEI---EIISETK  484

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
              +Y CS  GGAV R ALGPFGL+V AD+TL+ELTP++F      +G VET+FC D TRS
Sbjct  485  HEKYGCS--GGAVDRSALGPFGLLVVADQTLSELTPIFFRPVNTTEGIVETYFCADETRS  542

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+AS V K+VYGSTVPV  DEK+  R+LVDHSIVESF QGGR VITSRIYPTKAIY  AR
Sbjct  543  SKASDVYKQVYGSTVPVFTDEKFQMRVLVDHSIVESFAQGGRRVITSRIYPTKAIYGDAR  602

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +FLFNNATG +VKA++KIW++NSA I PF F
Sbjct  603  LFLFNNATGVNVKATLKIWELNSAFIHPFLF  633



>ref|XP_011000150.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Populus euphratica]
 ref|XP_011000151.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Populus euphratica]
Length=642

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 154/209 (74%), Gaps = 5/209 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            +LQWP+EE++ LR      T++ + PG ++P+ I  A QLDI A FE+   E +      
Sbjct  436  ILQWPVEEIESLRLRSTDFTEIVVGPGSVVPLDIGQATQLDIFAEFEI---EIISETKHE  492

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
            +Y CS  GGAV R ALGPFGL+V AD+TL+ELTPV+F      +G VET+FC D TRSS+
Sbjct  493  KYGCS--GGAVDRSALGPFGLLVIADQTLSELTPVFFRPVNTTEGIVETYFCADETRSSK  550

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVF  280
            AS V K+VYGSTVPV  DEK+  R+LVDHSIVESF QGGR VITSRIYPTKAIY  AR+F
Sbjct  551  ASDVYKQVYGSTVPVFTDEKFQMRVLVDHSIVESFAQGGRRVITSRIYPTKAIYGDARLF  610

Query  279  LFNNATGTSVKASVKIWQMNSADIKPFPF  193
            LFNNATG +VKA++KIW++NSA I PF F
Sbjct  611  LFNNATGVNVKATLKIWELNSAFIHPFLF  639



>ref|XP_007218855.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
 gb|EMJ20054.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
Length=513

 Score =   242 bits (617),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 149/211 (71%), Gaps = 6/211 (3%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFE--VMNEEAVEGEG  646
            LLQWP+EE++ LR      + V ++ G ++P+ I  A QLDI+  FE  V+  E V G G
Sbjct  304  LLQWPVEEIEDLRLNTTEFSDVLVEAGTVVPLDIGTATQLDILVDFEIQVLETECVNGNG  363

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
                +     GA  R  LGPFG++V ADETL+ELTPVYF V    DG V T+FC D TRS
Sbjct  364  ----SVGCGDGATDRSTLGPFGILVLADETLSELTPVYFRVSNSTDGDVTTYFCADETRS  419

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A  V K VYG  VPV+D E YSAR+LVDHSIVESF QGGRTVI SRIYPT+AIY AAR
Sbjct  420  SKAPEVYKTVYGGQVPVLDGETYSARVLVDHSIVESFAQGGRTVIASRIYPTEAIYGAAR  479

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +FLFNNATG +VKA++KIW++NSA I PFP 
Sbjct  480  LFLFNNATGVNVKATLKIWELNSAFIHPFPL  510



>gb|AAL05427.2| vacuolar acid invertase [Prunus cerasus]
Length=636

 Score =   244 bits (624),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 149/211 (71%), Gaps = 8/211 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFE--VMNEEAVEGEG  646
            LLQWP+EE++ LR      + V ++ G ++P+ I  A QLDI   FE  V+  E+V G  
Sbjct  429  LLQWPVEEIEDLRLTSTEFSDVLVEAGTVVPLDIGTATQLDIFVDFEIEVLETESVNG--  486

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
                +    GGA  R  LGPFG++V ADETL+ELTPVYF V    DG + THFC D TRS
Sbjct  487  ----SVGCGGGATDRSTLGPFGILVIADETLSELTPVYFRVSNSTDGDITTHFCADETRS  542

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A  V K VYG  VPV+D E YSAR+LVDHSIVESF QGGRTVI SRIYPT+AIY AAR
Sbjct  543  SKAPEVYKTVYGDQVPVLDGETYSARVLVDHSIVESFAQGGRTVIASRIYPTEAIYGAAR  602

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +FLFNNATG +VKA++KIWQ+NSA I PFP 
Sbjct  603  LFLFNNATGVNVKATLKIWQLNSAFIHPFPL  633



>gb|KHG09862.1| Beta-fructofuranosidase, soluble isoenzyme I [Gossypium arboreum]
Length=523

 Score =   241 bits (616),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 158/220 (72%), Gaps = 5/220 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            LLQWP+EEV+ LR    +   V ++ G ++P+ I  A QLDI+A FE+    +   E + 
Sbjct  306  LLQWPVEEVESLRLNATVFKDVVVEAGSVVPLDIGTATQLDILAEFEIETLVSNSTEDEV  365

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
              +C    GAV R   GPFG++V AD++L+ELTP+YF      DG +ET+FC D TRSS+
Sbjct  366  S-DCGD--GAVDRSTYGPFGVLVIADDSLSELTPIYFRPLNISDGSLETYFCADETRSSK  422

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVF  280
            A  VTK VYG  VPV+DDE Y  R+LVDHS+VESFG+GGRTVITSR+YPT+AIY AAR+F
Sbjct  423  APDVTKRVYGGKVPVLDDENYKMRVLVDHSVVESFGEGGRTVITSRVYPTEAIYGAARLF  482

Query  279  LFNNATGTSVKASVKIWQMNSADIKPFPF*SIL--ELFAS  166
            LFNNA+G +VKA++KIW+MNSA I+PFPF   L  E+ AS
Sbjct  483  LFNNASGVNVKATLKIWEMNSAFIRPFPFEETLFQEMVAS  522



>ref|XP_002510944.1| Beta-fructofuranosidase, soluble isoenzyme I precursor, putative 
[Ricinus communis]
 gb|EEF51546.1| Beta-fructofuranosidase, soluble isoenzyme I precursor, putative 
[Ricinus communis]
Length=639

 Score =   244 bits (623),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 156/211 (74%), Gaps = 9/211 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFE--VMNEEAVEGEG  646
            LLQWP+EE++ LR       ++ + PG ++P+ I  A QLDI A FE  +++E + E   
Sbjct  433  LLQWPVEEIESLRVNSTDFQEIVIAPGSVVPLEIGTATQLDIFAEFETELISESSTE---  489

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
               Y CS  GGAV R +LGPFGL+V ADE+L+ELTPV+F      D  ++T+FC D TRS
Sbjct  490  --EYGCS--GGAVDRSSLGPFGLLVLADESLSELTPVFFRPVNSTDDTLKTYFCADETRS  545

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A  V K+VYGSTVPV+DDEK   R+LVDHSIVESF QGGRTVITSRIYPT+AIY AAR
Sbjct  546  SKAPEVFKQVYGSTVPVLDDEKLRMRVLVDHSIVESFAQGGRTVITSRIYPTEAIYGAAR  605

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +FLFNNAT  +VKA++KIW++ SA I+PFPF
Sbjct  606  LFLFNNATDVNVKATLKIWELTSAFIRPFPF  636



>ref|XP_004298661.1| PREDICTED: acid beta-fructofuranosidase-like [Fragaria vesca 
subsp. vesca]
Length=694

 Score =   245 bits (625),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 157/209 (75%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+EE+++LR       +V ++ G ++P+ +  A QLDI+A FE +++  +E   E 
Sbjct  454  LLQWPVEEIEKLRLNMNNFDRVQVKAGSVVPLDVGTATQLDIVAEFE-LDQTVLESTAES  512

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++C +SGGA KRGALGPFGL+V AD+ L E TPVYFYV KG  G V T+FC D TRS
Sbjct  513  NEEFSCQTSGGAGKRGALGPFGLLVLADDGLTERTPVYFYVVKGSGGTVNTYFCADQTRS  572

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            + A+ V K+V GS VPV+  EK S RILVDHSI++SF QGGRT IT+R+YPT+AIY AAR
Sbjct  573  TVANDVVKQVSGSYVPVLKGEKLSVRILVDHSIIDSFAQGGRTTITTRVYPTQAIYGAAR  632

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +FLFNNAT TSV AS+++WQMNSA I+PF
Sbjct  633  LFLFNNATETSVTASLQVWQMNSAFIRPF  661



>gb|AFH77957.1| vacuolar invertase [Manihot esculenta]
Length=660

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 162/210 (77%), Gaps = 4/210 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+EEV+ LR       KV ++PG ++P+ + AA QLDI+A FE ++++A+E   E 
Sbjct  450  LLQWPVEEVESLRLRSNEFNKVEVKPGSVVPLDLDAATQLDIVAEFE-LDKKALEKTAES  508

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  ++C++S GA  R ALGPFGL+V AD++L E TPVYFYVQK  +G ++T FCTD +RS
Sbjct  509  NEEFSCTTSHGARHRNALGPFGLLVLADDSLVEQTPVYFYVQKS-NGTLKTFFCTDQSRS  567

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K++YG+ VPV++ EK++ R+LVDHSI+ESF QGGRT I+SR+YPT+AIY +A+
Sbjct  568  SAANDVNKQIYGNFVPVLEGEKFTLRVLVDHSIIESFAQGGRTTISSRVYPTRAIYGSAK  627

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFP  196
            +FLFNNA    V AS+KIWQMNSA I+P+P
Sbjct  628  LFLFNNAIEADVTASLKIWQMNSAFIRPYP  657



>gb|AAL65643.1| beta-fructosidase, partial [Arabidopsis thaliana]
 gb|AAL65644.1| beta-fructosidase, partial [Arabidopsis thaliana]
 gb|AAL65653.1| beta-fructosidase, partial [Arabidopsis thaliana]
 gb|AAL65654.1| beta-fructosidase, partial [Arabidopsis thaliana]
 gb|AAL65658.1| beta-fructosidase, partial [Arabidopsis thaliana]
 gb|AAL65659.1| beta-fructosidase, partial [Arabidopsis thaliana]
Length=229

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 148/214 (69%), Gaps = 8/214 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEGEG  646
            L+QWP+EE+K LR        + + PG ++P+ + +AAQLDI A FE+  E  E + G  
Sbjct  6    LVQWPVEEIKSLRLSSKQF-DLEVGPGSVVPVDVGSAAQLDIEAEFEINKESLEKILGNA  64

Query  645  DF-----RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCT  481
                    ++C  SGG+  RGALGPFG  V A E+L+E TPVYFYV KG D +++T FCT
Sbjct  65   SVVAEAEEFSCEKSGGSTVRGALGPFGFSVLATESLSEQTPVYFYVAKGTDSELKTFFCT  124

Query  480  DLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAI  301
            D +RSS A+ V K +YGS VPV+  EK + RILVDHSIVE+FGQGGRT ITSR+YPT AI
Sbjct  125  DTSRSSVANDVVKPIYGSIVPVLKGEKLTMRILVDHSIVEAFGQGGRTCITSRVYPTTAI  184

Query  300  YEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            Y AA++FLFNNA   +V AS  +WQMNSA I P+
Sbjct  185  YGAAKLFLFNNALDATVTASFTVWQMNSAFIHPY  218



>gb|AAB47171.1| vacuolar invertase 1, GIN1 [Vitis vinifera=grape berries, Sultana, 
berries, Peptide, 642 aa]
Length=642

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 161/212 (76%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEGEG  646
            LL WPIEEV+ LR+       V L+PG I+P+ I +A+QLDI+A FEV NE  EA+  E 
Sbjct  429  LLLWPIEEVESLRTNSTEFEDVLLEPGSIVPLDIGSASQLDIVAEFEVDNETLEAMV-EA  487

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNCS+S GA  RGALGPFGL+V AD+TL+ELTP+YFY+ K  DG  +T FCTDL+RS
Sbjct  488  DVIYNCSTSAGAAGRGALGPFGLLVLADDTLSELTPIYFYIAKDTDGSYKTFFCTDLSRS  547

Query  465  SEA-SGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            S A   V + +YGS VP +DDEK + R+LVDHSIVE F QGGR+ IT+R+YPT+AIY AA
Sbjct  548  SLAVDDVDQRIYGSIVPALDDEKPTMRVLVDHSIVEGFSQGGRSCITTRVYPTEAIYGAA  607

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+FLFNNATG +V AS+KIW+M SADI P+P 
Sbjct  608  RLFLFNNATGVNVTASIKIWEMASADIHPYPL  639



>ref|XP_002265534.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Vitis vinifera]
Length=649

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 162/212 (76%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEGEG  646
            LL WPIEEV+ LR+       V L+PG ++P+ I +A+QLDI+A FEV NE  EA+  E 
Sbjct  436  LLLWPIEEVESLRTNSTEFEDVLLEPGSVVPLDIGSASQLDIVAEFEVDNETLEAMV-EA  494

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNCS+S GA  RGALGPFG++V AD+TL+ELTP+YFY+ K  DG  +T FCTDL+RS
Sbjct  495  DVIYNCSTSAGAAGRGALGPFGILVLADDTLSELTPIYFYIAKDTDGSYKTFFCTDLSRS  554

Query  465  SEA-SGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            S A   V + +YGS VPV+DDEK + R+LVDHSIVE F QGGR+ IT+R+YPT+AIY AA
Sbjct  555  SLAVDDVDQRIYGSIVPVLDDEKPTMRVLVDHSIVEGFSQGGRSCITTRVYPTEAIYGAA  614

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+FLFNNATG +V AS+KIW+M SADI P+P 
Sbjct  615  RLFLFNNATGVNVTASIKIWEMASADIHPYPL  646



>gb|AGU12782.1| vacuolar invertase 2a [Gossypium hirsutum]
Length=618

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 154/209 (74%), Gaps = 4/209 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            LLQWP+EEV+ LR    +  +V ++PG ++P+ I    QLDI+A FE+  E  +    + 
Sbjct  409  LLQWPVEEVESLRLNSTMFKEVLVEPGSVVPLDIGTTTQLDILAEFEI--EPLISSTTNE  466

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
              NC    GAV R   GPFGL+V AD +L+ELTP+YF       G ++T+FCTD TRSS+
Sbjct  467  IGNCGD--GAVDRSTYGPFGLLVIADASLSELTPIYFRPLNASGGTLKTYFCTDETRSSK  524

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVF  280
            AS V K+VYG  VPV+DDE Y+ R+LVDHSIVESF QGGRTVI+SRIYPT+AIY AAR+F
Sbjct  525  ASDVFKQVYGGKVPVLDDENYNMRVLVDHSIVESFAQGGRTVISSRIYPTEAIYGAARLF  584

Query  279  LFNNATGTSVKASVKIWQMNSADIKPFPF  193
            LFNNATG +V+A++KIW++NSA I+PFPF
Sbjct  585  LFNNATGVNVRATLKIWELNSAFIRPFPF  613



>gb|AAL65660.1| beta-fructosidase [Arabidopsis lyrata]
Length=229

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 149/215 (69%), Gaps = 10/215 (5%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEE--------  664
            L+QWP+EE+K LR        + + PG ++P+ + +AAQLDI A FE+  E         
Sbjct  6    LVQWPVEEIKSLRLSSKQF-DIKVGPGSVVPVDVGSAAQLDIEAEFEINKESLDKILGNA  64

Query  663  AVEGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            +V  E +  ++C  SGG+  RGALGPFG  V A E+L+E TPVYFYV KG D +++T FC
Sbjct  65   SVMAEAE-EFSCEKSGGSTVRGALGPFGFSVLATESLSEQTPVYFYVAKGKDSELKTFFC  123

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
             D +RSS A+ V K +YGS VPV+  EK + RILVDHSIVE+FGQGGRT ITSR+YPT A
Sbjct  124  IDTSRSSVANDVVKLIYGSVVPVLKGEKLTMRILVDHSIVEAFGQGGRTCITSRVYPTSA  183

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            IY AA++FLFNNA   +V AS ++WQMNSA I P+
Sbjct  184  IYGAAKLFLFNNALDATVTASFRVWQMNSAFIHPY  218



>emb|CAB60153.1| sucrose:sucrose 1-fructosyl transferase [Taraxacum officinale]
Length=632

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 157/212 (74%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTK-VNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--E  649
            L+QWPI+EV+ LRS      K V L+PG I+P+ I +A QLDI+A+FE+ +E+ +E   E
Sbjct  417  LIQWPIDEVENLRSKKYDEFKDVELRPGSIIPLEIGSATQLDIMATFEI-DEKMLESTLE  475

Query  648  GDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
             D  +NC++S G+V RG LGPFG+VV AD   +E  PVYFY+ K  DG  +T+FC D +R
Sbjct  476  ADVLFNCTTSEGSVGRGVLGPFGIVVLADAKRSEQLPVYFYIAKNTDGSSKTYFCADESR  535

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SS    V K VYG +VPV++ EK++ R+LVDHSIVE F QGGRTV+TSR+YPTKAIY AA
Sbjct  536  SSMDKSVGKWVYGDSVPVLEGEKHNMRLLVDHSIVEGFAQGGRTVVTSRVYPTKAIYGAA  595

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            ++FLFNNATG SVKAS+KIW+M  A + PFP 
Sbjct  596  KLFLFNNATGISVKASLKIWKMAEAQLDPFPL  627



>gb|AFB83198.1| sucrose:sucrose 1-fructosyl transferase [Cichorium intybus]
Length=640

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 157/217 (72%), Gaps = 4/217 (2%)
 Frame = -1

Query  834  RQEVILLQWPIEEVKRLRSGDPIVTK-VNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            + E  L+QWPIEEV++LRS      K V L+PG ++P+ I  A QLDI A+FE+ +E+ +
Sbjct  420  QTETNLIQWPIEEVEKLRSKKYDEFKDVELRPGSLIPLEIGTATQLDISATFEI-DEKKL  478

Query  657  EG--EGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            E   E D  +NC++S G+V RG LGPFG+VV AD   +E  PVYFY+ K  DG   T+FC
Sbjct  479  ESTLEADVLFNCTTSEGSVGRGVLGPFGIVVLADANRSEQLPVYFYIAKDTDGTSRTYFC  538

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
             D +RSS+   V K VYGS+VPV++ E Y+ R+LVDHSIVE F QGGRTV+TSR+YPT A
Sbjct  539  ADESRSSKDKDVGKWVYGSSVPVLEGENYNMRLLVDHSIVEGFAQGGRTVVTSRVYPTMA  598

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            IY AA++FLFNNATG SVKAS+KIW+M  A + PFP 
Sbjct  599  IYGAAKIFLFNNATGISVKASLKIWKMAEAQLDPFPL  635



>gb|AAL65650.1| beta-fructosidase, partial [Arabidopsis thaliana]
 gb|AAL65651.1| beta-fructosidase, partial [Arabidopsis thaliana]
 gb|AAL65652.1| beta-fructosidase, partial [Arabidopsis thaliana]
 gb|AAL65655.1| beta-fructosidase, partial [Arabidopsis thaliana]
 gb|AAL65656.1| beta-fructosidase, partial [Arabidopsis thaliana]
 gb|AAL65657.1| beta-fructosidase, partial [Arabidopsis thaliana]
Length=229

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 149/215 (69%), Gaps = 10/215 (5%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEE--------  664
            L+QWP+EE+K LR        + + PG ++P+ + +AAQLDI A FE+  E         
Sbjct  6    LVQWPVEEIKSLRLSSKQF-DLEVGPGSVVPVDVGSAAQLDIEAEFEINKESLDKILGNA  64

Query  663  AVEGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            +V  E +  ++C  SGG+  RGALGPFG  V A E+L+E TPVYFYV KG D +++T FC
Sbjct  65   SVVAEAE-EFSCEKSGGSTVRGALGPFGFSVLATESLSEQTPVYFYVAKGKDSELKTFFC  123

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD +RSS A+ V K +YGS VPV+  EK + RILVDHSIVE+FGQGGRT ITSR+YPT A
Sbjct  124  TDTSRSSVANDVVKPIYGSVVPVLKGEKLTMRILVDHSIVEAFGQGGRTCITSRVYPTTA  183

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            IY AA++FLFNNA   +V AS  +WQMNSA I P+
Sbjct  184  IYGAAKLFLFNNALDATVTASFTVWQMNSAFIHPY  218



>gb|AAL65639.1| beta-fructosidase, partial [Arabidopsis thaliana]
 gb|AAL65649.1| beta-fructosidase, partial [Arabidopsis thaliana]
Length=229

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 149/215 (69%), Gaps = 10/215 (5%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEE--------  664
            L+QWP+EE+K LR        + + PG ++P+ + +AAQLDI A FE+  E         
Sbjct  6    LVQWPVEEIKSLRLSSKQF-DLEVGPGSVVPVDVGSAAQLDIEAEFEINKESLDKIIGNA  64

Query  663  AVEGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            +V  E +  ++C  SGG+  RGALGPFG  V A E+L+E TPVYFYV KG D +++T FC
Sbjct  65   SVVAEAE-EFSCEKSGGSTVRGALGPFGFSVLATESLSEQTPVYFYVAKGKDSELKTFFC  123

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD +RSS A+ V K +YGS VPV+  EK + RILVDHSIVE+FGQGGRT ITSR+YPT A
Sbjct  124  TDTSRSSVANDVVKPIYGSVVPVLKGEKLTMRILVDHSIVEAFGQGGRTCITSRVYPTTA  183

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            IY AA++FLFNNA   +V AS  +WQMNSA I P+
Sbjct  184  IYGAAKLFLFNNALDATVTASFTVWQMNSAFIHPY  218



>pir||S49256 beta-fructofuranosidase (EC 3.2.1.26) - red goosefoot  (fragment)
Length=513

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 157/211 (74%), Gaps = 6/211 (3%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGE--G  646
            ++QWP++EV+ LR+   +   + LQPG I+ ++I +AAQLD+ A F +M++EA++     
Sbjct  307  VIQWPVKEVESLRTDSIVYDNLVLQPGSIINLNITSAAQLDVSAEF-MMDQEALKSTVGD  365

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D   NCS+   A  R ALGPFG++V AD +L+E TPVYFY+ K  DG V+  FCTD +RS
Sbjct  366  DVINNCSA---AAIRQALGPFGVLVLADGSLSEFTPVYFYIAKTSDGTVKNWFCTDQSRS  422

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+AS V K+VYG  VPV++ EKYS R+LVDHSIVE+FGQGGRT ITSRIYPTKAI   AR
Sbjct  423  SKASSVDKQVYGGPVPVLEGEKYSMRLLVDHSIVEAFGQGGRTCITSRIYPTKAINGEAR  482

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            VFLFNNAT  SV ASVKIW++ SADI P+ F
Sbjct  483  VFLFNNATDLSVTASVKIWKLKSADISPYKF  513



>gb|AAL65648.1| beta-fructosidase, partial [Arabidopsis thaliana]
Length=229

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 148/214 (69%), Gaps = 8/214 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEGEG  646
            L+QWP+EE+K LR        + + PG ++P+ + +AAQLDI A FE+  E  + + G  
Sbjct  6    LVQWPVEEIKSLRLSSKQF-DLEVGPGSVVPVDVGSAAQLDIEAEFEINKESLDKILGNA  64

Query  645  DF-----RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCT  481
                    ++C  SGG+  RGALGPFG  V A E+L+E TPVYFYV KG D +++T FCT
Sbjct  65   SVVAKAEEFSCEKSGGSTVRGALGPFGFSVLATESLSEQTPVYFYVAKGKDSELKTFFCT  124

Query  480  DLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAI  301
            D +RSS A+ V K +YGS VPV+  EK + RILVDHSIVE+FGQGGRT ITSR+YPT AI
Sbjct  125  DTSRSSVANDVVKPIYGSVVPVLKGEKLTMRILVDHSIVEAFGQGGRTCITSRVYPTTAI  184

Query  300  YEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            Y AA++FLFNNA   +V AS  +WQMNSA I P+
Sbjct  185  YGAAKLFLFNNALDATVTASFTVWQMNSAFIHPY  218



>gb|KJB51452.1| hypothetical protein B456_008G216800 [Gossypium raimondii]
Length=648

 Score =   242 bits (618),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 161/226 (71%), Gaps = 17/226 (8%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFE----VMN--EEAV  658
            LLQWP+EEV+ LR    +   V ++ G ++P+ I  A QLDI+A FE    V+N  E+ V
Sbjct  431  LLQWPVEEVESLRLNATVFKDVVVEAGSVVPLDIGTATQLDILAEFEIETLVLNSTEDEV  490

Query  657  EGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTD  478
               GD         GAV R   GPFG++V AD++L+ELTP+YF      DG +ET+FC D
Sbjct  491  SDCGD---------GAVDRSTYGPFGVLVIADDSLSELTPIYFRPLNTSDGSLETYFCAD  541

Query  477  LTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIY  298
             TRSS+A  VTK VYG  +PV+DDE Y+ R+LVDHS+VESFG+GGRTVITSR+YPT+AIY
Sbjct  542  ETRSSKAPDVTKRVYGGKIPVLDDENYNMRVLVDHSVVESFGEGGRTVITSRVYPTEAIY  601

Query  297  EAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF*SIL--ELFAS  166
             AAR+FLFNNA+G +VKA++KIW+MNSA I+PFPF   L  E+ AS
Sbjct  602  GAARLFLFNNASGVNVKATLKIWEMNSAFIRPFPFEETLFQEMVAS  647



>gb|AAL65642.1| beta-fructosidase, partial [Arabidopsis thaliana]
 gb|AAL65646.1| beta-fructosidase, partial [Arabidopsis thaliana]
Length=229

 Score =   230 bits (587),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 148/215 (69%), Gaps = 10/215 (5%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEE--------  664
            L+QWP+EE+K LR        + + PG ++P+ + +AAQLDI A FE+  E         
Sbjct  6    LVQWPVEEIKSLRLSSKQF-DLEVGPGSVVPVDVGSAAQLDIEAEFEINKESLDKILGNA  64

Query  663  AVEGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            +V  E +  ++C  SGG+  RGALGPFG  V A E+L+E TPVYFYV KG D +++T FC
Sbjct  65   SVVAEAE-EFSCEKSGGSTVRGALGPFGFSVLATESLSEQTPVYFYVAKGKDSELKTFFC  123

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD +RSS A+ V K  YGS VPV+  EK + RILVDHSIVE+FGQGGRT ITSR+YPT A
Sbjct  124  TDTSRSSVANDVVKPTYGSVVPVLKGEKLTMRILVDHSIVEAFGQGGRTCITSRVYPTTA  183

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            IY AA++FLFNNA   +V AS  +WQMNSA I P+
Sbjct  184  IYGAAKLFLFNNALDATVTASFTVWQMNSAFIHPY  218



>ref|XP_002446857.1| hypothetical protein SORBIDRAFT_06g023760 [Sorghum bicolor]
 gb|EES11185.1| hypothetical protein SORBIDRAFT_06g023760 [Sorghum bicolor]
Length=679

 Score =   243 bits (619),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 152/210 (72%), Gaps = 4/210 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+ EV+ LR        V L  G ++P+ +  A QLDI A FEV +  AVEG  E 
Sbjct  466  LLQWPVVEVENLRMSGKRFDDVALHRGSVVPLDVGKATQLDIEAVFEV-DAAAVEGVTEA  524

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  +NCS+S GA  RG LGPFGL+V ADE L+E T VYFY+ KG DG ++T FC D  R+
Sbjct  525  DVTFNCSTSAGAAGRGLLGPFGLLVLADEDLSEQTAVYFYLVKGTDGSLQTFFCQDELRA  584

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A+ + K VYGS VPV+D E  S RILVDHSIVESF QGGRT ITSR+YPT+AIY++AR
Sbjct  585  SKANDLVKRVYGSLVPVLDGENLSVRILVDHSIVESFAQGGRTCITSRVYPTRAIYDSAR  644

Query  285  VFLFNNATGTSVKA-SVKIWQMNSADIKPF  199
            VFLFNNAT   VKA SVKIWQ+NSA I+P+
Sbjct  645  VFLFNNATDVHVKAKSVKIWQLNSAYIRPY  674



>gb|AFP23357.1| soluble acid invertase [Litchi chinensis]
Length=643

 Score =   242 bits (617),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 156/210 (74%), Gaps = 6/210 (3%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEV-MNEEAVEGEGD  643
            ++QWP++EV+ LR        V ++PG I+P+ I  A QLDI A FE  + E A E EG 
Sbjct  439  IVQWPVQEVESLRQRSIEFEDVLIEPGSIVPLDIGTATQLDIFAEFETELLESAGEEEG-  497

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              Y+C   GGA+ R  LGPFGL+V AD++L+ELTPV+F      +G ++T+FCTD TRS+
Sbjct  498  --YSCK--GGAINRNKLGPFGLLVIADDSLSELTPVFFRPTNTTNGTLDTYFCTDETRST  553

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
             A  V K +YGSTVPV++ E+Y+ R+LVDHSIVESF QGGRTVITSRIYPT+AIY +AR+
Sbjct  554  LAPEVQKHIYGSTVPVLEGERYAMRVLVDHSIVESFAQGGRTVITSRIYPTEAIYGSARL  613

Query  282  FLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            FLFNNATG +VKA++KIWQMNSA I PFP 
Sbjct  614  FLFNNATGVNVKATLKIWQMNSAFIHPFPL  643



>gb|AAL65640.1| beta-fructosidase, partial [Arabidopsis thaliana]
 gb|AAL65645.1| beta-fructosidase, partial [Arabidopsis thaliana]
Length=229

 Score =   230 bits (586),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 147/214 (69%), Gaps = 8/214 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEGEG  646
            L+QWP+EE+K LR        + + PG ++P+ + +AAQLDI   FE+  E  E + G  
Sbjct  6    LVQWPVEEIKSLRLSSKQF-DLEVGPGSVVPVDVGSAAQLDIEVEFEINKESLEKILGNA  64

Query  645  DF-----RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCT  481
                    ++C  SGG+  RGALGPFG  V A E+L+E TPVYFYV KG D +++T FCT
Sbjct  65   SVVAEAEEFSCEKSGGSTVRGALGPFGFSVLATESLSEQTPVYFYVAKGTDSELKTFFCT  124

Query  480  DLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAI  301
            D +RSS A+ V K +YGS VPV+  EK + RILVDHSIVE+FGQGGRT ITSR+YPT AI
Sbjct  125  DTSRSSVANDVVKPIYGSIVPVLKGEKLTMRILVDHSIVEAFGQGGRTCITSRVYPTTAI  184

Query  300  YEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            Y AA++FLFNNA   +V AS  +WQMNSA I P+
Sbjct  185  YGAAKLFLFNNALDATVTASFTVWQMNSAFIHPY  218



>gb|KJB51451.1| hypothetical protein B456_008G216800 [Gossypium raimondii]
Length=681

 Score =   243 bits (619),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 161/226 (71%), Gaps = 17/226 (8%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFE----VMN--EEAV  658
            LLQWP+EEV+ LR    +   V ++ G ++P+ I  A QLDI+A FE    V+N  E+ V
Sbjct  464  LLQWPVEEVESLRLNATVFKDVVVEAGSVVPLDIGTATQLDILAEFEIETLVLNSTEDEV  523

Query  657  EGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTD  478
               GD         GAV R   GPFG++V AD++L+ELTP+YF      DG +ET+FC D
Sbjct  524  SDCGD---------GAVDRSTYGPFGVLVIADDSLSELTPIYFRPLNTSDGSLETYFCAD  574

Query  477  LTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIY  298
             TRSS+A  VTK VYG  +PV+DDE Y+ R+LVDHS+VESFG+GGRTVITSR+YPT+AIY
Sbjct  575  ETRSSKAPDVTKRVYGGKIPVLDDENYNMRVLVDHSVVESFGEGGRTVITSRVYPTEAIY  634

Query  297  EAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF*SIL--ELFAS  166
             AAR+FLFNNA+G +VKA++KIW+MNSA I+PFPF   L  E+ AS
Sbjct  635  GAARLFLFNNASGVNVKATLKIWEMNSAFIRPFPFEETLFQEMVAS  680



>ref|XP_007218853.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
 ref|XP_007218854.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
 gb|EMJ20052.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
 gb|EMJ20053.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
Length=639

 Score =   241 bits (616),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 149/211 (71%), Gaps = 6/211 (3%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFE--VMNEEAVEGEG  646
            LLQWP+EE++ LR      + V ++ G ++P+ I  A QLDI+  FE  V+  E V G G
Sbjct  430  LLQWPVEEIEDLRLNTTEFSDVLVEAGTVVPLDIGTATQLDILVDFEIQVLETECVNGNG  489

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
                +     GA  R  LGPFG++V ADETL+ELTPVYF V    DG V T+FC D TRS
Sbjct  490  ----SVGCGDGATDRSTLGPFGILVLADETLSELTPVYFRVSNSTDGDVTTYFCADETRS  545

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A  V K VYG  VPV+D E YSAR+LVDHSIVESF QGGRTVI SRIYPT+AIY AAR
Sbjct  546  SKAPEVYKTVYGGQVPVLDGETYSARVLVDHSIVESFAQGGRTVIASRIYPTEAIYGAAR  605

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +FLFNNATG +VKA++KIW++NSA I PFP 
Sbjct  606  LFLFNNATGVNVKATLKIWELNSAFIHPFPL  636



>emb|CAA08812.1| sucrose 1F-fructosyltransferase [Helianthus tuberosus]
Length=630

 Score =   241 bits (616),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 154/212 (73%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTK-VNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--E  649
            L+QWPIEE + LRS      K V L+PG ++P+ I  A QLDI+A+FE+ +++ +E   E
Sbjct  413  LIQWPIEETENLRSKKYDEFKDVELRPGALVPLEIGTATQLDIVATFEI-DQKMLESTLE  471

Query  648  GDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
             D  +NC++S G+V R  LGPFG+VV AD   +E  PVYFY+ K  DG   T+FC D TR
Sbjct  472  ADVLFNCTTSEGSVARSVLGPFGVVVLADAQRSEQLPVYFYIAKDIDGTSRTYFCADETR  531

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SS+   V K VYGS+VPV+  EKY+ R+LVDHSIVE F Q GRTV+TSR+YPTKAIY AA
Sbjct  532  SSKDVSVGKWVYGSSVPVLPGEKYNMRLLVDHSIVEGFAQNGRTVVTSRVYPTKAIYNAA  591

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +VFLFNNATG SVKAS+KIW+M  A++ PFP 
Sbjct  592  KVFLFNNATGISVKASIKIWKMGEAELNPFPL  623



>emb|CAH25487.1| 1,2-beta-fructan 1F-fructosyltransferase [Taraxacum officinale]
Length=618

 Score =   241 bits (615),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 157/217 (72%), Gaps = 3/217 (1%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            R+    LL WP++E++ LRS      ++ L  G  +P+ I  A QLDI+A+F+V ++EA+
Sbjct  403  RKTGTHLLHWPVKEIESLRSDVSEFNEIELVSGSTIPLDIGMATQLDIVATFKV-DKEAL  461

Query  657  EGEGDF--RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            +   D    Y C++S GA + G+LGPFG+ V AD +L+ELTPVYFY+ K  DG + THFC
Sbjct  462  KLSSDIDGEYGCTTSAGATEGGSLGPFGIAVLADLSLSELTPVYFYIVKNIDGGLVTHFC  521

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD  RSS      K VYGSTVPV+D E+ + R+LVDHS+VE F  GGRTV+TSR+YPTK+
Sbjct  522  TDKLRSSLDYDGEKVVYGSTVPVLDGEELTMRLLVDHSVVEGFAMGGRTVMTSRVYPTKS  581

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            IYE A++FLFNNATG SVKAS+K+WQM SA ++P+PF
Sbjct  582  IYEGAKIFLFNNATGASVKASLKVWQMGSAQVQPYPF  618



>ref|NP_001234069.1| invertase [Solanum lycopersicum]
 emb|CAJ19056.1| invertase [Solanum lycopersicum]
Length=652

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 149/206 (72%), Gaps = 1/206 (0%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEG-D  643
            L+ WP+ EV  LRS +    KV ++PG I+P+ + +A QLDI+A FEV      + +G +
Sbjct  445  LITWPVAEVDNLRSNNNEFNKVVVKPGSIVPLEVGSATQLDIMAEFEVDQNMLKKVDGSN  504

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              Y+C  SGG+ +RGALGPFGL+V  D +L+E TP+YFY+ K   G   T FC DLTRS 
Sbjct  505  ATYDCIKSGGSGERGALGPFGLLVLTDNSLSEQTPIYFYIAKDLTGNFNTFFCNDLTRSF  564

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
            EAS V K +YGSTVPV+  EK S R LVDHSIVESF Q GRT ITSR+YPTKAIYE A++
Sbjct  565  EASDVRKLIYGSTVPVLQGEKLSLRTLVDHSIVESFAQNGRTAITSRVYPTKAIYENAKI  624

Query  282  FLFNNATGTSVKASVKIWQMNSADIK  205
            +LFNNAT  SV A++KIWQMNSA+IK
Sbjct  625  YLFNNATDISVTATIKIWQMNSANIK  650



>ref|XP_006355490.1| PREDICTED: acid beta-fructofuranosidase-like [Solanum tuberosum]
Length=653

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 151/206 (73%), Gaps = 1/206 (0%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEG-D  643
            ++ WP+ EV+ LRS +    KV ++PG I+P+ + +A QLDI+A FE+      + +G +
Sbjct  446  IITWPVAEVENLRSNNNEFNKVVVKPGSIVPLEVGSATQLDIMAEFEIDQNVLKKVDGSN  505

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              Y+C  SGG+ +RGALGPFGL+V  D +L+E TP+YFY+ K   G   T FC DLTRSS
Sbjct  506  ATYDCIKSGGSGERGALGPFGLLVLTDNSLSEQTPIYFYIAKDLTGNFNTFFCNDLTRSS  565

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
            EA+ V K +YGSTVPV+  EK S R LVDHSIVESF Q GRT ITSR+YPTKAIYE A++
Sbjct  566  EATDVRKLIYGSTVPVLQGEKLSLRTLVDHSIVESFAQNGRTAITSRVYPTKAIYENAKI  625

Query  282  FLFNNATGTSVKASVKIWQMNSADIK  205
            +LFNNAT  SV A++KIWQMNSA+IK
Sbjct  626  YLFNNATDISVTATIKIWQMNSANIK  651



>gb|ADP08983.1| vacuolar invertase 1 [Gossypium hirsutum]
Length=648

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 160/226 (71%), Gaps = 17/226 (8%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFE----VMN--EEAV  658
            LLQWP+EEV+ LR    +   V ++ G ++P+ I  A QLDI+A FE    V+N  E+ V
Sbjct  431  LLQWPVEEVESLRLNATVFKDVVVEAGSVVPLDIGTATQLDILAEFEIETLVLNSTEDEV  490

Query  657  EGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTD  478
               GD         GAV R   GPFG++V AD++L+ELTP+YF      DG +ET+FC D
Sbjct  491  SDCGD---------GAVDRSTYGPFGVLVIADDSLSELTPIYFRPLNTSDGSLETYFCAD  541

Query  477  LTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIY  298
             TRSS+A  VTK VYG  +PV+DDE Y+ R+LVDHS+VESFG GGRTVITSR+YPT+AIY
Sbjct  542  ETRSSKAPDVTKRVYGGKIPVLDDENYNMRVLVDHSVVESFGGGGRTVITSRVYPTEAIY  601

Query  297  EAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF*SIL--ELFAS  166
             AAR+FLFNNA+G +VKA++KIW+MNSA I+PFPF   L  E+ AS
Sbjct  602  GAARLFLFNNASGVNVKATLKIWEMNSAFIRPFPFEETLFQEMVAS  647



>gb|AAK72492.2| soluble acid invertase bfruct2 [Oryza sativa Japonica Group]
Length=665

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 147/211 (70%), Gaps = 3/211 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEGEG  646
            +LQ P EEV+   +       ++ +PG ++PIH+  A QLDI ASFEV     E      
Sbjct  450  VLQRPEEEVESWSTRSKTFHDISFEPGSVVPIHVTGATQLDITASFEVDETLLETTSESH  509

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  Y+CS+SGGA  RG+LGPFGL+V ADE L+ELTPVY YV KGG+GK + H CT  TRS
Sbjct  510  DAGYDCSNSGGAGTRGSLGPFGLLVVADEKLSELTPVYLYVAKGGEGKAKAHLCTYQTRS  569

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S ASGV K+VYGS VPV+D E YSARIL DHSIVESF Q GRT + SR YPTK IY AAR
Sbjct  570  SMASGVEKDVYGSAVPVLDGENYSARILTDHSIVESFAQAGRTSVRSRDYPTKDIYGAAR  629

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
             F FNNAT  SV+AS+K WQ  S  I+P+PF
Sbjct  630  SFFFNNATEASVRASLKAWQTKSF-IRPYPF  659



>ref|XP_008668436.1| PREDICTED: uncharacterized protein LOC100383472 isoform X1 [Zea 
mays]
 tpg|DAA36680.1| TPA: invertase1 [Zea mays]
Length=670

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 151/210 (72%), Gaps = 2/210 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEV-MNEEAVEGEGD  643
            LLQWP+ EV+ LR        V L  G ++P+ +  A QLDI A FEV  ++ A   E D
Sbjct  455  LLQWPVVEVENLRMSGKSFDGVALDRGSVVPLDVGKATQLDIEAVFEVDASDAAAVTEAD  514

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              +NCS+S GA  RG LGPFGL+V AD+ L+E T VYFY+ KG DG ++T FC D  R+S
Sbjct  515  VTFNCSTSAGAAGRGLLGPFGLLVLADDDLSEQTAVYFYLLKGTDGSLQTFFCQDELRAS  574

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
            +A+ + K VYGS VPV+D E  S RILVDHSIVESF QGGRT ITSR+YPT+AIY++ARV
Sbjct  575  KANDLVKRVYGSLVPVLDGENLSVRILVDHSIVESFAQGGRTCITSRVYPTRAIYDSARV  634

Query  282  FLFNNATGTSVKA-SVKIWQMNSADIKPFP  196
            FLFNNAT   VKA SVKIWQ+NSA I+P+P
Sbjct  635  FLFNNATHAHVKAKSVKIWQLNSAYIRPYP  664



>gb|AAL65641.1| beta-fructosidase, partial [Arabidopsis thaliana]
 gb|AAL65647.1| beta-fructosidase, partial [Arabidopsis thaliana]
Length=229

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 148/215 (69%), Gaps = 10/215 (5%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEE--------  664
            L+QWP+EE+K LR        + + PG ++P+ + +AAQLDI A FE+  E         
Sbjct  6    LVQWPVEEIKSLRLSSKQF-DLEVGPGSVVPVDVGSAAQLDIEAEFEINKESLDKILGNA  64

Query  663  AVEGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            +V  E +  ++C  SGG+  RGALGPFG  V A E+L+E TPVYFYV KG D +++T FC
Sbjct  65   SVVAEAE-EFSCEKSGGSTVRGALGPFGFSVLATESLSEQTPVYFYVAKGKDSELKTFFC  123

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD +RSS A+ V K +YGS VPV+  EK + RILVDHSIVE+FGQGGRT IT R+YPT A
Sbjct  124  TDTSRSSVANDVVKPIYGSVVPVLKGEKLTMRILVDHSIVEAFGQGGRTCITLRVYPTTA  183

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            IY AA++FLFNNA   +V AS  +WQMNSA I P+
Sbjct  184  IYGAAKLFLFNNALDATVTASFTVWQMNSAFIHPY  218



>ref|XP_002272809.3| PREDICTED: acid beta-fructofuranosidase-like [Vitis vinifera]
Length=661

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 154/209 (74%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            +LQWP+ E+K LR       K+ + PG ++ + +  A Q+DI A FE+ ++EA++  GE 
Sbjct  448  ILQWPVAEIKSLRKSSKKFDKLEVGPGSVVTLEVEKATQMDITAEFEI-DKEALKRIGES  506

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  Y+C +SGG+ +RG LGPFGL++ ADE   E TPVYFYV KG DG+++T FCTD +RS
Sbjct  507  DVEYSCGTSGGSAQRGELGPFGLLLLADEGRCEQTPVYFYVAKGTDGQLKTFFCTDESRS  566

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K ++GSTVPVI  EK S RILVDHSI+ESF QGGRT ITSR+YPTKAIY AA+
Sbjct  567  SLANDVDKRIFGSTVPVIKGEKLSMRILVDHSIIESFAQGGRTCITSRVYPTKAIYGAAQ  626

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +++FNNAT  S+ AS++ W M SA I+P+
Sbjct  627  LYVFNNATSASITASIQTWAMKSAYIRPY  655



>gb|AAB47172.1| vacuolar invertase 2, GIN2 [Vitis vinifera=grape berries, Sultana, 
berries, Peptide, 664 aa]
Length=664

 Score =   241 bits (614),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 154/209 (74%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            +LQWP+ E+K LR       K+ + PG ++ + +  A Q+DI A FE+ ++EA++  GE 
Sbjct  451  ILQWPVAEIKSLRKSSKKFDKLEVGPGSVVTLEVEKATQMDITAEFEI-DKEALKRIGES  509

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  Y+C +SGG+ +RG LGPFGL++ ADE   E TPVYFYV KG DG+++T FCTD +RS
Sbjct  510  DVEYSCRTSGGSAQRGELGPFGLLLLADEGRCEQTPVYFYVAKGTDGQLKTFFCTDESRS  569

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K ++GSTVPVI  EK S RILVDHSI+ESF QGGRT ITSR+YPTKAIY AA+
Sbjct  570  SLANDVDKRIFGSTVPVIKGEKLSMRILVDHSIIESFAQGGRTCITSRVYPTKAIYGAAQ  629

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPF  199
            +++FNNAT  S+ AS++ W M SA I+P+
Sbjct  630  LYVFNNATSASITASIQTWAMKSAYIRPY  658



>ref|XP_007038395.1| Glycosyl hydrolases family 32 protein isoform 1 [Theobroma cacao]
 gb|EOY22896.1| Glycosyl hydrolases family 32 protein isoform 1 [Theobroma cacao]
Length=646

 Score =   240 bits (613),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 156/209 (75%), Gaps = 4/209 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            LLQWP++EV+ LR    +  +V ++ G I+P+ I  A QLDI+A FE+ + E+     D 
Sbjct  438  LLQWPVKEVESLRLNSTVFEEVLVEAGSIVPLDIGPATQLDILAEFEIESLES--NTTDE  495

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
              +C    GA+ R   GPFG++V AD++L+ELTPV+F      DG ++T+FC D TRSS+
Sbjct  496  VSDCGD--GAIDRSTFGPFGILVIADDSLSELTPVFFRPVNTSDGSLKTYFCADETRSSK  553

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVF  280
            A+ V K+VYG  VPV+DDE Y+ R+LVDHSIVESF QGGRTVI+SRIYPT+AIY AAR+F
Sbjct  554  ANDVFKQVYGGKVPVLDDENYNMRVLVDHSIVESFAQGGRTVISSRIYPTEAIYGAARLF  613

Query  279  LFNNATGTSVKASVKIWQMNSADIKPFPF  193
            LFNNATG +VKA++KIW+MNSA I+PFPF
Sbjct  614  LFNNATGVNVKATLKIWEMNSAFIRPFPF  642



>ref|XP_009630517.1| PREDICTED: acid beta-fructofuranosidase-like [Nicotiana tomentosiformis]
Length=652

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 149/207 (72%), Gaps = 3/207 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEGEG  646
            ++ WP+ EV+ LR       KV ++PG + P+ +  A QLDI+A FEV  +  E +EG  
Sbjct  445  IITWPVAEVENLRLNSKEFDKVEVKPGSVFPLEVGTATQLDIMAEFEVDPKVLERLEGN-  503

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  Y C SSGG+ +RGALGPFGL+V  D+ L+E TP+YFY+ K   G   T FC DLTRS
Sbjct  504  NATYECRSSGGSAERGALGPFGLLVLTDKGLSEQTPIYFYIAKDAAGNFTTFFCNDLTRS  563

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            SEA+ V K +YGSTVPV+  EK S R LVDHSIVESF Q GRT ITSR+YPTKAIYE A+
Sbjct  564  SEATDVRKLIYGSTVPVLQGEKLSLRTLVDHSIVESFAQSGRTAITSRVYPTKAIYEDAK  623

Query  285  VFLFNNATGTSVKASVKIWQMNSADIK  205
            ++LFNNAT  S+ AS+KIWQMNSA+I+
Sbjct  624  LYLFNNATDVSITASLKIWQMNSANIQ  650



>emb|CAD12104.1| beta-fructofuranosidase [Cichorium intybus]
Length=646

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 154/212 (73%), Gaps = 3/212 (1%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            ++ +  ++QWP+EE+  LR+   +   V ++ G ++P+++P+A+QLDI+A FEV +++ V
Sbjct  436  KKTQSNIIQWPVEEINLLRTNLTVFKTVVVESGSLVPLNLPSASQLDIVAEFEV-DKKTV  494

Query  657  E--GEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            E     D  Y+C+ +GGA +RGALGPFG  V A E LAE TPVYFYV KG DG ++T FC
Sbjct  495  ERLNGADIAYDCAKNGGAAQRGALGPFGFSVLAHEGLAEHTPVYFYVAKGVDGNLQTFFC  554

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
             D +RSS A+ V K +YGS VPV+  EK + RILVDHSIVESF Q GRT ITSR+YPTKA
Sbjct  555  ADQSRSSNANDVDKSIYGSIVPVLKGEKLAMRILVDHSIVESFAQEGRTCITSRVYPTKA  614

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADI  208
            I   A++FLFNNAT T V ASV +WQMNSA +
Sbjct  615  INNNAQLFLFNNATATKVTASVNVWQMNSAHV  646



>gb|KJB51450.1| hypothetical protein B456_008G216800 [Gossypium raimondii]
Length=630

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 160/225 (71%), Gaps = 17/225 (8%)
 Frame = -1

Query  816  LQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFE----VMN--EEAVE  655
            +QWP+EEV+ LR    +   V ++ G ++P+ I  A QLDI+A FE    V+N  E+ V 
Sbjct  414  IQWPVEEVESLRLNATVFKDVVVEAGSVVPLDIGTATQLDILAEFEIETLVLNSTEDEVS  473

Query  654  GEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDL  475
              GD         GAV R   GPFG++V AD++L+ELTP+YF      DG +ET+FC D 
Sbjct  474  DCGD---------GAVDRSTYGPFGVLVIADDSLSELTPIYFRPLNTSDGSLETYFCADE  524

Query  474  TRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYE  295
            TRSS+A  VTK VYG  +PV+DDE Y+ R+LVDHS+VESFG+GGRTVITSR+YPT+AIY 
Sbjct  525  TRSSKAPDVTKRVYGGKIPVLDDENYNMRVLVDHSVVESFGEGGRTVITSRVYPTEAIYG  584

Query  294  AARVFLFNNATGTSVKASVKIWQMNSADIKPFPF*SIL--ELFAS  166
            AAR+FLFNNA+G +VKA++KIW+MNSA I+PFPF   L  E+ AS
Sbjct  585  AARLFLFNNASGVNVKATLKIWEMNSAFIRPFPFEETLFQEMVAS  629



>gb|AFH77956.1| vacuolar invertase [Manihot esculenta]
Length=639

 Score =   239 bits (611),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 156/211 (74%), Gaps = 9/211 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFE--VMNEEAVEGEG  646
            LLQWP+EE++ LR       ++ + PG ++P+ I  A QLDI A FE  ++++  VE   
Sbjct  436  LLQWPVEEIESLRLNSTDFEEILIGPGSVVPLDIGVATQLDIFAEFETELISDSVVE---  492

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
               Y+CS  GGAV R  LGPFG++V AD+TL+ELTPV+F      DG ++T+FC D TRS
Sbjct  493  --EYDCS--GGAVDRSPLGPFGILVIADQTLSELTPVFFRPVNSTDGTLKTYFCADETRS  548

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A  V K+VYGSTVPV++ EK   R+LVDHSIVESF QGGRTV+TSR+YPT+AIY AAR
Sbjct  549  SKAPDVFKQVYGSTVPVLEGEKLGMRVLVDHSIVESFAQGGRTVMTSRVYPTEAIYGAAR  608

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +FLFNNAT  +VKA++KIWQ+NSA I+PFP 
Sbjct  609  LFLFNNATSVNVKATLKIWQLNSAFIRPFPL  639



>sp|P49175.1|INV1_MAIZE RecName: Full=Beta-fructofuranosidase 1; AltName: Full=Invertase 
1; AltName: Full=Sucrose 1; Flags: Precursor [Zea mays]
 gb|AAA83439.1| invertase [Zea mays]
Length=670

 Score =   240 bits (613),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 150/210 (71%), Gaps = 2/210 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE-GEGD  643
            LLQWP+ EV+ LR        V L  G ++P+ +  A QLDI A FEV   +A    E D
Sbjct  455  LLQWPVVEVENLRMSGKSFDGVALDRGSVVPLDVGKATQLDIEAVFEVDASDAAGVTEAD  514

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              +NCS+S GA  RG LGPFGL+V AD+ L+E T VYFY+ KG DG ++T FC D  R+S
Sbjct  515  VTFNCSTSAGAAGRGLLGPFGLLVLADDDLSEQTAVYFYLLKGTDGSLQTFFCQDELRAS  574

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
            +A+ + K VYGS VPV+D E  S RILVDHSIVESF QGGRT ITSR+YPT+AIY++ARV
Sbjct  575  KANDLVKRVYGSLVPVLDGENLSVRILVDHSIVESFAQGGRTCITSRVYPTRAIYDSARV  634

Query  282  FLFNNATGTSVKA-SVKIWQMNSADIKPFP  196
            FLFNNAT   VKA SVKIWQ+NSA I+P+P
Sbjct  635  FLFNNATHAHVKAKSVKIWQLNSAYIRPYP  664



>gb|AEX15265.1| vacuolar invertase [Musa acuminata AAA Group]
Length=645

 Score =   239 bits (611),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 152/216 (70%), Gaps = 4/216 (2%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            ++ E  LLQWP+++V+ LRSG    + +++  G ++P+ +  A Q+DI+A F V N+ A+
Sbjct  422  QKTESNLLQWPVDDVETLRSGSQEFSNISIPAGSVVPLDVGTATQVDIVAEFGV-NKSAL  480

Query  657  EGEGD--FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
             G  D    YNCS+SGGA  RG LGPFGL+V AD+ L+E T VYFY  +  DG + THFC
Sbjct  481  AGAVDAAVGYNCSTSGGAAGRGVLGPFGLLVLADDDLSEQTAVYFYFVRSTDGSISTHFC  540

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
             D  RSSEA+ + K VYGS VPV+D E  S RILVDHS++ESF QGGRT ITSR+YPT A
Sbjct  541  HDELRSSEAADIVKRVYGSLVPVLDGETLSVRILVDHSVIESFAQGGRTCITSRVYPTSA  600

Query  303  IYEAARVFLFNNATGTSVKA-SVKIWQMNSADIKPF  199
             Y   R+FLFNNATG  V A S+KIWQM SA I+PF
Sbjct  601  TYGGGRLFLFNNATGVDVTAKSLKIWQMGSAFIRPF  636



>gb|ACQ82802.1| vacuolar invertase [Gossypium hirsutum]
Length=645

 Score =   239 bits (610),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 158/226 (70%), Gaps = 17/226 (8%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEV------MNEEAV  658
            LLQWP+EEV+ LR    +   V ++ G ++P+ I  A QLDI+A FE+        E+ V
Sbjct  428  LLQWPVEEVESLRLNATVFKDVVVEAGSVVPLDIGTATQLDILAEFEIETLVSNSTEDEV  487

Query  657  EGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTD  478
               GD         GAV R   GPFG++V AD++L+ELTP+YF      DG +ET+FC D
Sbjct  488  SDCGD---------GAVDRNTYGPFGVLVIADDSLSELTPIYFRPLNISDGSLETYFCAD  538

Query  477  LTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIY  298
             TRSS+A  VTK VYG  VPV+DDE Y+ R+LVDHS+VESFG+GGRTVITSR+YPT+AIY
Sbjct  539  ETRSSKAPNVTKRVYGGKVPVLDDENYNMRVLVDHSVVESFGEGGRTVITSRVYPTEAIY  598

Query  297  EAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF*SIL--ELFAS  166
             AAR+FLFNNA+  +VKA++KIW+MNSA I+PFPF   L  E+ AS
Sbjct  599  GAARLFLFNNASRVNVKATLKIWEMNSAFIRPFPFEETLFQEMVAS  644



>ref|XP_003580229.1| PREDICTED: beta-fructofuranosidase 1-like [Brachypodium distachyon]
Length=679

 Score =   239 bits (611),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 153/211 (73%), Gaps = 3/211 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+ EV+ LR        + + PG ++P+ +  A+QLDI A+F+V  + +V G  EG
Sbjct  466  LLQWPVVEVENLRMRGKSFDGLAVPPGSVVPLDVGKASQLDIEAAFQVHLDSSVAGGAEG  525

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
               YNCS+S GA  RG LGPFGL+V ADE L+E T VYFY+ K  +GK  T FC D  RS
Sbjct  526  AESYNCSASAGAAGRGVLGPFGLLVLADEGLSEQTAVYFYLVKDANGKFTTFFCQDALRS  585

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A+ + K+VYGS VPV+D E  S RILVDHSIVESF QGGRT ITSR YPTKAIY++AR
Sbjct  586  SKANDLDKKVYGSLVPVLDGENLSVRILVDHSIVESFAQGGRTCITSRAYPTKAIYDSAR  645

Query  285  VFLFNNATGTSVKA-SVKIWQMNSADIKPFP  196
            VFLFNNAT  ++ A S+KIW+MNSA I+P+P
Sbjct  646  VFLFNNATNVNITAKSLKIWEMNSAYIRPYP  676



>gb|EPS61897.1| soluble acid invertase 1, partial [Genlisea aurea]
Length=561

 Score =   237 bits (604),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 149/208 (72%), Gaps = 2/208 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            +LQWP+EEV+ LR        V L+PG ++P+ I + +QLDI A FEV N     G  D 
Sbjct  351  ILQWPVEEVESLRRESFEFNGVKLEPGSVVPVEIDSTSQLDIEAWFEVDNSTGDVGGSD-  409

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
             YNCS+SGGA  RG LGPFG+V+ ADE L ELTP+YFY+     G ++ HFCTD+ RSS 
Sbjct  410  GYNCSTSGGAAGRGILGPFGIVLLADEKLTELTPIYFYIAGKPGGVLDYHFCTDVLRSST  469

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEA-ARV  283
            AS V K VYGS+VPV+D EK + R+LVDHSIVESF QGGR VITSR+YPTK+   A +RV
Sbjct  470  ASDVHKLVYGSSVPVLDGEKLTLRLLVDHSIVESFAQGGRRVITSRVYPTKSTRGAESRV  529

Query  282  FLFNNATGTSVKASVKIWQMNSADIKPF  199
             LFNNAT   V AS+K+W+M+SA I+PF
Sbjct  530  LLFNNATAAGVTASIKVWKMDSAHIRPF  557



>gb|AAB58909.1| sucrose:sucrose 1-fructosyl transferase [Cichorium intybus]
Length=640

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 154/212 (73%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTK-VNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--E  649
            L+QWPIEEV++LRS      K V L+PG ++P+ I  A QLDI A+FE+ +++ ++   E
Sbjct  425  LIQWPIEEVEKLRSTKYDEFKDVELRPGSLVPLEIGTATQLDISATFEI-DQKKLQSTLE  483

Query  648  GDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
             D  +NC++S G+V RG LGPFG+VV AD   +E  PVYFY+ K  DG  +T+FC D +R
Sbjct  484  ADVLFNCTTSEGSVGRGVLGPFGIVVLADANRSEQLPVYFYIAKDTDGTSKTYFCADESR  543

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SS    V K VYGS+VPV+  E Y+ R+LVDHSIVE F QGGRTV+TSR+YPTKAIY AA
Sbjct  544  SSTDKDVGKWVYGSSVPVLGGENYNMRLLVDHSIVEGFAQGGRTVVTSRVYPTKAIYGAA  603

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            ++FLFNNATG SVK S+KIW+M  A + PFP 
Sbjct  604  KIFLFNNATGISVKVSLKIWKMAEAQLDPFPL  635



>ref|XP_006307369.1| hypothetical protein CARUB_v10008995mg [Capsella rubella]
 gb|EOA40267.1| hypothetical protein CARUB_v10008995mg [Capsella rubella]
Length=483

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 150/216 (69%), Gaps = 12/216 (6%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQ--PGEILPIHIPAAAQLDIIASFEVMNEEAVEGEG  646
            L+QWP+EE+K LR       K +L+  PG ++P+ +  A QLDI A FE+  E   +  G
Sbjct  260  LVQWPVEEIKSLRLSS---KKFDLEVSPGSVVPVDVGTATQLDIEAEFEIKKESLEKILG  316

Query  645  DF-------RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHF  487
            D         ++C  SGG+  RGALGPFG  V A E+L+E TPVYFY+ KG D K++T F
Sbjct  317  DSSVVAEAEEFSCEKSGGSTVRGALGPFGFSVLATESLSEQTPVYFYIAKGKDSKLKTFF  376

Query  486  CTDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTK  307
            CTD +RSS A+ V K +YGS VPV+  EK + RILVDHSIVE+FGQGGRT ITSR+YPT 
Sbjct  377  CTDTSRSSVANDVIKPIYGSVVPVLKGEKLTMRILVDHSIVEAFGQGGRTCITSRVYPTT  436

Query  306  AIYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            AIY AA++FLFNNA  T+V AS K+WQMNSA I P+
Sbjct  437  AIYGAAKLFLFNNALDTTVTASFKVWQMNSAFIHPY  472



>dbj|BAJ95733.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=541

 Score =   236 bits (602),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 152/214 (71%), Gaps = 5/214 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            LLQWP+ EV+ LR        +++ PG ++P+ +  A QLD+ A F+V       G    
Sbjct  326  LLQWPVVEVENLRMRGKRFDGLDMPPGSVVPLDVGRATQLDVEAVFQVQAGAPAAGSAAA  385

Query  639  R----YNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLT  472
                 YNCS+S G+  RG LGPFGL+V AD+ L+E T VYFY+ +G DGK+ THFC D  
Sbjct  386  GAEAPYNCSASAGSAGRGLLGPFGLLVLADDGLSEQTAVYFYLVRGADGKLSTHFCQDAF  445

Query  471  RSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEA  292
            RSS+A+ + K VYGS+VPV+D E  S RILVDHSIVESF QGGRT ITSR+YPTKAIY++
Sbjct  446  RSSKANDLVKAVYGSSVPVLDGEDLSVRILVDHSIVESFAQGGRTCITSRVYPTKAIYDS  505

Query  291  ARVFLFNNATGTSVKA-SVKIWQMNSADIKPFPF  193
            ARVFLFNNAT  +V A S+KIW++NSA I+P+P+
Sbjct  506  ARVFLFNNATNLNVTAKSIKIWELNSAYIRPYPY  539



>ref|XP_008234397.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Prunus mume]
Length=637

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 148/211 (70%), Gaps = 8/211 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEV--MNEEAVEGEG  646
            LLQWP+EE++ LR      + V ++ G ++P+ I  A QLDI   FE+  +  E+V G  
Sbjct  430  LLQWPVEEIEDLRLNSTEFSDVLVEAGTVVPLDIGTATQLDIFVVFEIEELETESVNG--  487

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
                +     GA  R  LGPFG++V ADETL+ELTPVYF V    DG V T+FC D TRS
Sbjct  488  ----SVGCGDGATDRSTLGPFGILVLADETLSELTPVYFRVSNSTDGDVTTYFCADETRS  543

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A  V K VYG  VPV+D E YSAR+LVDHSIVESF QGGRTVI SR+YPT+AIY AAR
Sbjct  544  SKAPEVYKTVYGGQVPVLDGETYSARVLVDHSIVESFAQGGRTVIASRVYPTEAIYGAAR  603

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +FLFNNATG +VKA++KIWQ+NSA I PFP 
Sbjct  604  LFLFNNATGVNVKATLKIWQLNSAFIHPFPL  634



>ref|XP_009384549.1| PREDICTED: beta-fructofuranosidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=645

 Score =   238 bits (607),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 149/210 (71%), Gaps = 4/210 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGD-  643
            LLQWP+++V+ LRSG    + +++  G ++P+ +  A Q+DI+A F V N+ A+ G  D 
Sbjct  428  LLQWPVDDVETLRSGSQEFSNISIPAGSVVPLDVGTATQVDIVAEFGV-NKSALAGAVDA  486

Query  642  -FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
               YNCS+SGGA  RG LGPFGL+V AD+ L+E T VYFY  +  DG + THFC D  RS
Sbjct  487  AVGYNCSTSGGAAGRGVLGPFGLLVLADDDLSEQTAVYFYFVRSTDGSISTHFCHDELRS  546

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            SEA+ + K VYGS VPV+D E  S RILVDHS++ESF QGGRT ITSR+YPT A Y   R
Sbjct  547  SEAADIVKRVYGSLVPVLDGETLSVRILVDHSVIESFAQGGRTCITSRVYPTSATYGGGR  606

Query  285  VFLFNNATGTSVKA-SVKIWQMNSADIKPF  199
            +FLFNNATG  V A S+KIWQM SA I+PF
Sbjct  607  LFLFNNATGVDVTAKSLKIWQMGSAFIRPF  636



>ref|XP_008778382.1| PREDICTED: beta-fructofuranosidase 1-like [Phoenix dactylifera]
Length=544

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 145/209 (69%), Gaps = 2/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG-EGD  643
            LLQWP+EEV++LR       ++ +  G + P+ +  A QLDI A FE+  E  +   E D
Sbjct  332  LLQWPVEEVEKLRMSSKDFGRITIDTGSVFPLDVTGAIQLDIEAEFEIEKEALMMAVEAD  391

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              YNCS+SGGA KRG LGPFGL+V A++ L+E T VYFY+ +G DG + THFC D   SS
Sbjct  392  VGYNCSTSGGATKRGMLGPFGLLVLANDRLSEKTAVYFYIARGTDGNLRTHFCHDELESS  451

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
             AS + K V GSTVPV+D E  S RILVDHSIVESF QGGRT ITSR+YPT+AIY AA+V
Sbjct  452  RASDIVKRVVGSTVPVLDGETLSVRILVDHSIVESFAQGGRTCITSRVYPTEAIYNAAKV  511

Query  282  FLFNNATGTSVKA-SVKIWQMNSADIKPF  199
            FLFNNAT  SV   S+ IW+M+S    P+
Sbjct  512  FLFNNATSASVTVKSLTIWKMDSTFSHPY  540



>gb|AAD01606.1| beta-fructofuranosidase [Ipomoea batatas]
Length=656

 Score =   238 bits (606),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 139/185 (75%), Gaps = 4/185 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEGEG  646
            +LQWP++EV+ LRSGDPI  + NL+PG ++PIH+    QLDI ASFEV     E      
Sbjct  452  VLQWPVDEVESLRSGDPITAEANLEPGSVVPIHVSEGTQLDITASFEVDETLLETTSESH  511

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  Y+CS+SGGAV RG+LGPFGL+V ADE L+ELTPVYFYV KG DGK + HFC D TRS
Sbjct  512  DAGYDCSNSGGAVTRGSLGPFGLLVVADEKLSELTPVYFYVAKGADGKAKAHFCADQTRS  571

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA-  289
            S ASGV KEVYGS VPV+D E YSARIL+DHSIVESF QGGRTV T R+YPT  I + + 
Sbjct  572  SMASGVEKEVYGSAVPVLDGENYSARILIDHSIVESFAQGGRTV-TERVYPTSFILQGSL  630

Query  288  RVFLF  274
            RV LF
Sbjct  631  RVSLF  635



>emb|CAA70855.1| sucrose sucrose 1-fructosyltransferase [Cynara cardunculus var. 
scolymus]
Length=637

 Score =   237 bits (605),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 152/212 (72%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTK-VNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--E  649
            L+QWPI EV+ LRS      K V L+PG ++P+ I  A QLDI A+FEV ++  +E   E
Sbjct  422  LIQWPIAEVENLRSNKYNEFKDVELKPGSLIPLEIGTATQLDITATFEV-DQTMLESTLE  480

Query  648  GDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
             D  +NC++S G+  RG LGPFGLVV AD   +E  PVYFY+ K  DG  +T+FC D +R
Sbjct  481  ADVLFNCTTSEGSAGRGVLGPFGLVVLADAERSEQLPVYFYIAKDTDGSSKTYFCADESR  540

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SS    + K VYGS+VPV++ EK++ R+LVDHSIVE F QGGRTV+TSR+YP KAIY AA
Sbjct  541  SSNDVDIGKWVYGSSVPVLEGEKFNMRLLVDHSIVEGFAQGGRTVVTSRVYPAKAIYGAA  600

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            ++FLFNNATG SVKAS+KIW+M  A + PFP 
Sbjct  601  KLFLFNNATGISVKASLKIWKMKEAQLDPFPL  632



>ref|XP_008376436.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Malus domestica]
Length=645

 Score =   237 bits (605),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 149/209 (71%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            LLQWP+EE++ LR      T V ++ G ++P+ I  A QLDI   FE+   E ++ E   
Sbjct  437  LLQWPVEEIEDLRLNSTEFTDVLVEAGTVVPLDIGTATQLDIFVDFEI---ELLDTEESV  493

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
              +     GAV R   GPFG++V ADE+L+ELTPVYF V    DG V T+FC D +RSS+
Sbjct  494  NGSSGCGDGAVDRSTFGPFGILVIADESLSELTPVYFRVTNSTDGDVTTYFCADESRSSK  553

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVF  280
            A  V K+VYG  VPV+D E YSAR+LVDHSIVES+ QGGRTVI+SR+YPT+AIY AAR+F
Sbjct  554  APEVFKQVYGGEVPVLDGETYSARVLVDHSIVESYAQGGRTVISSRVYPTEAIYGAARLF  613

Query  279  LFNNATGTSVKASVKIWQMNSADIKPFPF  193
            LFNNATG +VKA++KIWQ+NSA I PFP 
Sbjct  614  LFNNATGVNVKATLKIWQLNSAFIHPFPL  642



>gb|KFK40573.1| hypothetical protein AALP_AA2G014000 [Arabis alpina]
Length=354

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 152/215 (71%), Gaps = 11/215 (5%)
 Frame = -1

Query  819  LLQWPIEEVK--RLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEG  652
            LLQWPI+E++  RLRS       + ++PG ++P+ +  A+QLDI A F +  +  E + G
Sbjct  131  LLQWPIKEIESLRLRSKK---FHMKVRPGTVVPVDVGPASQLDIEAEFTIKKDHFEVILG  187

Query  651  ----EGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
                E D  ++C  SGG+  RG  GPFG  V AD++L+E TPVYFYV KG D K++T FC
Sbjct  188  NDSMEADKEFSCKKSGGSTVRGVFGPFGFSVLADQSLSEQTPVYFYVTKGKDSKLKTFFC  247

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD +RSS+A+ V K +YG+ VPV+  EK + RI+VDHSIVE+FGQGGRT ITSR+YPTKA
Sbjct  248  TDTSRSSKANDVVKPIYGNFVPVLKGEKLTMRIIVDHSIVEAFGQGGRTCITSRVYPTKA  307

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            I  A ++FLFNNAT  +V AS K+WQMNSA I PF
Sbjct  308  IGGATKLFLFNNATDATVTASFKVWQMNSAYIHPF  342



>gb|KHN32440.1| Beta-fructofuranosidase, soluble isoenzyme I [Glycine soja]
Length=579

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 153/216 (71%), Gaps = 4/216 (2%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            ++    L+ WP+EEV+ LR G      V ++PG ++P+ I  A QLD+ A FE+   E +
Sbjct  363  KKTRTNLVHWPVEEVESLRLGSSEFEGVVVKPGSVVPLDIGPATQLDVFAEFEI---EFL  419

Query  657  EGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKG-GDGKVETHFCT  481
              +G  + N     GAV R ALGPFG++  AD+ L+ELTP+YF++     DG   T FC 
Sbjct  420  ASKGSGKDNIGCGNGAVDRSALGPFGILAIADDHLSELTPIYFHLSSTTKDGSSTTSFCV  479

Query  480  DLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAI  301
            D TRSS+A  V+K V+GS VPV+ DEK S R+LVDHSI+ESF QGGRTVI+SR+YPT+AI
Sbjct  480  DETRSSKAPDVSKLVFGSKVPVLSDEKLSMRVLVDHSIIESFAQGGRTVISSRVYPTEAI  539

Query  300  YEAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            Y AAR+FLFNNAT  ++KAS+KIWQ+NSA I+PFPF
Sbjct  540  YGAARLFLFNNATDINIKASLKIWQLNSAFIRPFPF  575



>ref|XP_009775767.1| PREDICTED: acid beta-fructofuranosidase-like [Nicotiana sylvestris]
Length=652

 Score =   236 bits (603),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 150/207 (72%), Gaps = 3/207 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEGEG  646
            ++ WP+ EV+ LR       KV ++PG ++P+ +  A QLDI+A FEV  +  E +EG  
Sbjct  445  IITWPVAEVENLRFNSKEFDKVEVKPGNVVPLEVGTATQLDIMAEFEVDPKVLEKLEGS-  503

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  Y C SSGG+ +RGALGPFGL+V  D+ L+E TP+YFY+ K   G   T FC DLTRS
Sbjct  504  NATYECRSSGGSAERGALGPFGLLVLTDKGLSEQTPIYFYIAKDAAGNFTTFFCNDLTRS  563

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            SEA+ V K +YGSTVPV+  EK S R LVDHSIVESF Q GRT ITSR+YPTKAIYE A+
Sbjct  564  SEATDVRKLIYGSTVPVLQGEKLSLRTLVDHSIVESFAQNGRTAITSRVYPTKAIYEDAK  623

Query  285  VFLFNNATGTSVKASVKIWQMNSADIK  205
            ++LFNNAT  ++ ASVKIWQ++SA+I+
Sbjct  624  LYLFNNATDVTITASVKIWQIHSANIQ  650



>ref|XP_009374489.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Pyrus x bretschneideri]
Length=646

 Score =   236 bits (603),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 147/211 (70%), Gaps = 8/211 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEV--MNEEAVEGEG  646
            LLQWP+EE++ LR      T V ++ G  +P+ I  A QLDI   FE+  ++ E+V G  
Sbjct  439  LLQWPVEEIEELRLNSTEFTDVLVEAGTTVPLDIGTATQLDIFVDFEIELLDTESVNGSS  498

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
                 C    GA  R   GPFG++  ADETL+ELTPVYF V    DG V T+FC D +RS
Sbjct  499  ----GCGD--GAADRSTFGPFGILALADETLSELTPVYFRVTNSTDGDVTTYFCADESRS  552

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            SEA  V K VYG  VPV+D E YSAR+LVDHSIVES+ QGGRTVI+SR+YPT+AIY AAR
Sbjct  553  SEAPEVFKHVYGGEVPVLDGETYSARVLVDHSIVESYAQGGRTVISSRVYPTEAIYGAAR  612

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +FLFNNATG +VKA++KIWQ+NSA I PFP 
Sbjct  613  LFLFNNATGVNVKATLKIWQLNSAFIHPFPL  643



>emb|CAA47636.1| soluble beta-fructosidase [Daucus carota]
 emb|CAA77266.1| beta-fructofuranosidase, isoform II [Daucus carota]
Length=650

 Score =   236 bits (603),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 149/204 (73%), Gaps = 3/204 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+EEV +LR    +   V +  G +LP+ I + +QLDI A FEV ++E++E   E 
Sbjct  437  LLQWPVEEVNKLRLNKTVFENVEINTGAVLPLEIGSGSQLDITAEFEV-DKESLERVQET  495

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  Y+C ++GG+  RGALGPFGL++ AD+ L+E TPVYFY+ KG  G + T FC D +RS
Sbjct  496  NEVYDCKNNGGSSGRGALGPFGLLILADKDLSEQTPVYFYIAKGSGGNLRTFFCADHSRS  555

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A  V KE+YGS VPV+  EK + RILVDHSIVESF QGGRT ITSR+YPTKAIY  A+
Sbjct  556  SKAVDVDKEIYGSVVPVLRGEKLTMRILVDHSIVESFSQGGRTCITSRVYPTKAIYNNAK  615

Query  285  VFLFNNATGTSVKASVKIWQMNSA  214
            VFLFNNAT   + AS+ IWQMN+A
Sbjct  616  VFLFNNATEARIIASLNIWQMNTA  639



>ref|XP_011623822.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I [Amborella 
trichopoda]
Length=642

 Score =   236 bits (602),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 148/207 (71%), Gaps = 2/207 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            L+QWPIEEV+ LR+ +  +  + + PG ++ + I   AQLD+ A FEV  E     E D 
Sbjct  434  LVQWPIEEVESLRTSNVSLDNIKVDPGSVVHVDI-NGAQLDVNAVFEVSKEAIKNTEADV  492

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
             YNCS+SGGA  RG LGPFGL+V A+E+L+E T VYFY+ KG DG ++T FC D TRSS+
Sbjct  493  LYNCSTSGGAAGRGVLGPFGLLVLAEESLSEQTAVYFYIAKGVDGNLQTFFCHDETRSSK  552

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVF  280
            A+ + + VYGSTVPV+  EK S RILVDHSIVESF QGGRT ITSR+YPT+AIY   R+F
Sbjct  553  ATDLVERVYGSTVPVLSGEKLSVRILVDHSIVESFAQGGRTCITSRVYPTRAIY-GPRLF  611

Query  279  LFNNATGTSVKASVKIWQMNSADIKPF  199
            LFNNA+ +    S+ IWQM SA I PF
Sbjct  612  LFNNASTSVTVTSLNIWQMTSALIHPF  638



>gb|ERM94735.1| hypothetical protein AMTR_s00011p00252750 [Amborella trichopoda]
Length=640

 Score =   236 bits (602),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 148/207 (71%), Gaps = 2/207 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            L+QWPIEEV+ LR+ +  +  + + PG ++ + I   AQLD+ A FEV  E     E D 
Sbjct  432  LVQWPIEEVESLRTSNVSLDNIKVDPGSVVHVDI-NGAQLDVNAVFEVSKEAIKNTEADV  490

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
             YNCS+SGGA  RG LGPFGL+V A+E+L+E T VYFY+ KG DG ++T FC D TRSS+
Sbjct  491  LYNCSTSGGAAGRGVLGPFGLLVLAEESLSEQTAVYFYIAKGVDGNLQTFFCHDETRSSK  550

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVF  280
            A+ + + VYGSTVPV+  EK S RILVDHSIVESF QGGRT ITSR+YPT+AIY   R+F
Sbjct  551  ATDLVERVYGSTVPVLSGEKLSVRILVDHSIVESFAQGGRTCITSRVYPTRAIY-GPRLF  609

Query  279  LFNNATGTSVKASVKIWQMNSADIKPF  199
            LFNNA+ +    S+ IWQM SA I PF
Sbjct  610  LFNNASTSVTVTSLNIWQMTSALIHPF  636



>gb|AHK05786.1| vacuolar invertase [Eriobotrya japonica]
Length=646

 Score =   236 bits (602),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 147/209 (70%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            LLQWP+EE++ LR      T+V ++ G  +P+ I  A QLDI   FE+   E ++ E   
Sbjct  438  LLQWPVEEIEDLRLNSNEFTEVLVEAGTTVPLDIGTATQLDIFVDFEI---ELLDTEESV  494

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
              +     GA  R   GPFG++  ADETL+ELTPVYF V    DG V T+FCTD +RSS+
Sbjct  495  NGSSGCGDGAADRSTFGPFGILALADETLSELTPVYFRVTNSTDGDVTTYFCTDESRSSK  554

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVF  280
            A  V K VYG  VPV+D E YSAR+LVDHSIVES+ QGGRTVI+SR+YPT+AIY AAR+F
Sbjct  555  APEVFKHVYGGEVPVLDGETYSARVLVDHSIVESYAQGGRTVISSRVYPTEAIYGAARLF  614

Query  279  LFNNATGTSVKASVKIWQMNSADIKPFPF  193
            LFNNATG +VKA++KIWQ+NSA I PFP 
Sbjct  615  LFNNATGVNVKATLKIWQLNSAFIHPFPL  643



>ref|XP_009340588.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Pyrus x bretschneideri]
Length=645

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 147/211 (70%), Gaps = 8/211 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEV--MNEEAVEGEG  646
            LLQWP+EE++ LR      T V ++ G  +P+ I  A QLDI   FE+  ++ E+V G  
Sbjct  438  LLQWPVEEIEDLRLNSTEFTDVLVEAGTTVPLDIGTATQLDIFVDFEIELLDTESVNGSS  497

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
                 C    GA  R   GPFG++  ADETL+ELTPVYF V    DG V T+FC D +RS
Sbjct  498  ----GCGD--GAADRSTFGPFGILALADETLSELTPVYFRVTNSTDGDVTTYFCADESRS  551

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            SEA  V K VYG  VPV+D E YSAR+LVDHSIVES+ QGGRTVI+SR+YPT+AIY AAR
Sbjct  552  SEAPEVFKHVYGGEVPVLDGETYSARVLVDHSIVESYAQGGRTVISSRVYPTEAIYGAAR  611

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +FLFNNATG +VKA++KIWQ+NSA I PFP 
Sbjct  612  LFLFNNATGVNVKATLKIWQLNSAFIHPFPL  642



>ref|XP_010906620.1| PREDICTED: beta-fructofuranosidase 1-like [Elaeis guineensis]
Length=653

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 144/209 (69%), Gaps = 2/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEE-AVEGEGD  643
            LLQWP+EEV++LR      + + +  G + PI+I    QLDI A FE+     A   E D
Sbjct  441  LLQWPVEEVEKLRMSSKNFSMITIDAGSVFPINITGGTQLDIEAEFEIEKAALATAVEAD  500

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              YNCS+S GA  RG LGPFGL+V A+  L+E T VYFY+ +G DG + THFC D  RSS
Sbjct  501  VGYNCSTSSGATDRGMLGPFGLLVLANGRLSEKTAVYFYIARGTDGNLHTHFCHDELRSS  560

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
             AS + K V GSTVPV+D E+ S RILVDHSIVESF QGGRT ITSR+YPT+AIY AA+V
Sbjct  561  SASDIVKRVVGSTVPVLDGERLSVRILVDHSIVESFAQGGRTCITSRVYPTEAIYNAAKV  620

Query  282  FLFNNATGTSVKA-SVKIWQMNSADIKPF  199
            FLFNNAT  SV A S+ IW+MNS    P+
Sbjct  621  FLFNNATSASVTAKSLTIWKMNSTFSDPY  649



>ref|XP_010430328.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like isoform 
X1 [Camelina sativa]
 ref|XP_010430329.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like isoform 
X2 [Camelina sativa]
Length=648

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 154/216 (71%), Gaps = 11/216 (5%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEV--------MNEE  664
            L+QWP+EE+K LR  +     + + PG ++PI + +AAQLDI A F++        + E+
Sbjct  432  LVQWPVEEIKSLRLSNKKF-HMKVGPGTVVPIDVGSAAQLDIEAEFKIKKDDLEIILGED  490

Query  663  AVEGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            +VE + +F  +C + GG+  RGALGPFG  V AD++L+E TPVYFYV KG D K++T FC
Sbjct  491  SVEADEEF--SCQNGGGSTVRGALGPFGFSVLADQSLSEHTPVYFYVTKGKDSKLKTFFC  548

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD +RS+ A+ V K VYGS VPV+ +EK + RILVDHSIVE F QGGRT ITSR+YPTKA
Sbjct  549  TDTSRSTMANDVVKPVYGSFVPVLKEEKLTMRILVDHSIVEGFAQGGRTCITSRVYPTKA  608

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPFP  196
            IY A ++FLFNNA   +V AS K+WQMN A I P+P
Sbjct  609  IYGATKLFLFNNAIDATVTASFKVWQMNGAFIHPYP  644



>ref|XP_006300839.1| hypothetical protein CARUB_v10019930mg [Capsella rubella]
 gb|EOA33737.1| hypothetical protein CARUB_v10019930mg [Capsella rubella]
Length=648

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 154/214 (72%), Gaps = 9/214 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLR-SGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEG-  652
            L+QWP+EE+K LR S      KV   PG ++P+ + +AAQLDI A F++  +  E + G 
Sbjct  432  LVQWPVEEIKSLRLSSKKFHMKVG--PGTMVPVDVGSAAQLDIEAEFKIKKDDLEIIFGD  489

Query  651  ---EGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCT  481
               EGD  ++C +SGG+  RGALGPFG  V AD++L+E TPVYFYV KG D K++++FCT
Sbjct  490  DSVEGDKEFSCQNSGGSTVRGALGPFGFSVLADQSLSEHTPVYFYVTKGKDSKLKSYFCT  549

Query  480  DLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAI  301
            D +RS+ A+ V K VYGS VPV+  EK + RILVDHSIVE F QGGRT ITSR+YPTKAI
Sbjct  550  DTSRSTMANDVVKPVYGSFVPVLKGEKLTMRILVDHSIVEGFAQGGRTCITSRVYPTKAI  609

Query  300  YEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            Y A ++FLFNNA   ++ AS K+WQMNSA I P+
Sbjct  610  YGATKLFLFNNAIDATITASFKVWQMNSAFIHPY  643



>ref|XP_006417255.1| hypothetical protein EUTSA_v10007016mg [Eutrema salsugineum]
 gb|ESQ35608.1| hypothetical protein EUTSA_v10007016mg [Eutrema salsugineum]
Length=660

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 150/215 (70%), Gaps = 10/215 (5%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEE--------  664
            L+QWP+EE+K LR        + + PG ++PI + +AAQLDI A FE+  E         
Sbjct  437  LVQWPVEEIKSLRLSSKKF-DMEVSPGSMIPIDVGSAAQLDIEAEFEIKKESIDKILGNA  495

Query  663  AVEGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            +V  E +  ++C +SGG+  RGALGPFG  V ADE L+E TP+YFYV KG D K++T FC
Sbjct  496  SVVAEAE-EFSCQNSGGSTVRGALGPFGFSVLADEKLSEQTPIYFYVAKGKDSKLKTFFC  554

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD +RSS A+ V K +YGS VPV+  EK + RILVDHSIVE FGQGGRT ITSR+YPTKA
Sbjct  555  TDTSRSSFANDVIKPIYGSVVPVLKGEKLTMRILVDHSIVEGFGQGGRTCITSRVYPTKA  614

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            IY AA++FLFNNA   +V AS  +WQMNSA I P+
Sbjct  615  IYGAAKLFLFNNAIDATVTASFTVWQMNSAFIHPY  649



>ref|XP_011070162.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Sesamum indicum]
Length=652

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 147/205 (72%), Gaps = 3/205 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIP-AAAQLDIIASFEV--MNEEAVEGE  649
            +LQWP+EEV+RLR    +  KV  +PG I+P+H+  A +QLDI+A FEV  +  E++   
Sbjct  444  ILQWPVEEVERLRMSKKVFDKVEAKPGSIVPLHVGFATSQLDIVAEFEVDKVALESINDT  503

Query  648  GDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
                Y+C +S GA +RGALGPFGL+V  D    E TPVYFY+ K  +G  +T FC D +R
Sbjct  504  DHTTYSCPTSHGAAQRGALGPFGLLVHTDNHQTEQTPVYFYISKDTEGNFKTFFCADHSR  563

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SSEA  V K +YGSTVPV++ EK S RILVDHSI+ESF QGGRT ITSRIYP +A+YE A
Sbjct  564  SSEAIDVDKAIYGSTVPVLEGEKLSMRILVDHSIIESFAQGGRTCITSRIYPMRAVYENA  623

Query  288  RVFLFNNATGTSVKASVKIWQMNSA  214
             +FLFNNAT  ++ AS+ IWQM+SA
Sbjct  624  GIFLFNNATDATITASLHIWQMSSA  648



>gb|AGW23637.1| soluble acid invertase [Lilium davidii]
Length=635

 Score =   235 bits (599),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 148/213 (69%), Gaps = 4/213 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG-EGD  643
            LLQWP+EEV+ LR        +N+  G ++P++I  A QLDI+A FE+  +      E D
Sbjct  421  LLQWPVEEVESLRLSSRDFKNINIGIGSVVPLNISRATQLDIVAEFEIEGKSLTATVEAD  480

Query  642  FRYNCSSSGGAVK--RGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
              YNCS+S GA    RG LGPFG +V +D+ L+E T VYFYV +  DG++ET FC D  R
Sbjct  481  IGYNCSTSRGAAAAGRGVLGPFGFLVLSDQDLSEQTAVYFYVARNVDGELETFFCQDELR  540

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SS+A  + K VYGSTVPV+  E  + RILVDHSIVESF QGGRT ITSRIYPTKAI  AA
Sbjct  541  SSKADDIVKRVYGSTVPVLSGEILTVRILVDHSIVESFAQGGRTCITSRIYPTKAIDAAA  600

Query  288  RVFLFNNATGTSVKA-SVKIWQMNSADIKPFPF  193
            ++FLFNN TG  V A S+KIWQMNSA I+PFP 
Sbjct  601  KLFLFNNGTGAMVTAKSIKIWQMNSAFIRPFPL  633



>ref|XP_009370474.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Pyrus x bretschneideri]
 ref|XP_009372889.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Pyrus x bretschneideri]
Length=645

 Score =   235 bits (599),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 150/209 (72%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            LLQWP+EE++ LR      T V ++ G I+P+ I  A QLDI   F++   E+++ E   
Sbjct  437  LLQWPVEEIEDLRLNSTEFTDVLVEAGTIVPLDIGTATQLDISVDFKI---ESLDTEESV  493

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
              +     GAV R   GPFG++V ADE+L+ELTPVYF V    DG V T+FC D +RSS+
Sbjct  494  NGSSGCGDGAVDRSTFGPFGILVIADESLSELTPVYFRVTNSTDGDVTTYFCADESRSSK  553

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVF  280
            A  V K+VYG  VPV+D E YSAR+LVDHSIVES+ QGGRTVI+SR+YPT+AIY AAR+F
Sbjct  554  APEVFKQVYGGKVPVLDGETYSARVLVDHSIVESYAQGGRTVISSRVYPTEAIYGAARLF  613

Query  279  LFNNATGTSVKASVKIWQMNSADIKPFPF  193
            LFNNATG +VKA++KIW++NSA I PFP 
Sbjct  614  LFNNATGVNVKATLKIWRLNSAFIHPFPL  642



>gb|KHN11662.1| Beta-fructofuranosidase, soluble isoenzyme I [Glycine soja]
Length=534

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 152/216 (70%), Gaps = 4/216 (2%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            ++    LL WP++EV+ LR  +     V ++PG ++P+ I  A QLDI A FE+   E +
Sbjct  318  KKTRTNLLHWPVKEVESLRLSNSEFEGVVVKPGSVVPLDIGPATQLDIFAEFEI---EDL  374

Query  657  EGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKG-GDGKVETHFCT  481
              +G  + N     GAV R A GPFG++  AD+ L+ELTP+YF++     DG + T FC 
Sbjct  375  ASKGIGKDNVDCGNGAVDRSAFGPFGILAIADDQLSELTPIYFHLSSTTKDGSLTTSFCV  434

Query  480  DLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAI  301
            D TRSS+A  V+K ++GS  PV+ DEK S R+LVDHSI+ESF QGGRTVITSR+YPT+AI
Sbjct  435  DETRSSKAPDVSKLIFGSKAPVLSDEKLSMRVLVDHSIIESFAQGGRTVITSRVYPTEAI  494

Query  300  YEAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            Y AAR+FLFNNAT  ++KAS+KIWQ+NSA I+PFPF
Sbjct  495  YGAARLFLFNNATDINIKASLKIWQLNSAFIRPFPF  530



>ref|XP_010106222.1| hypothetical protein L484_003380 [Morus notabilis]
 gb|EXC08928.1| hypothetical protein L484_003380 [Morus notabilis]
Length=648

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 149/209 (71%), Gaps = 4/209 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            +LQWP+EE++ LR      T+V ++PG ++P+ +  A QLDI   FEV + E+ E   D 
Sbjct  440  ILQWPVEEIESLRLSSNNFTEVVVEPGTVVPLDVGTATQLDIFVDFEVESSESKETGNDI  499

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
               C    GAV R  LGPFG++V AD+ L+ELTP+YF       G  +T+FC D TRSS+
Sbjct  500  S-GCGD--GAVDRNKLGPFGILVLADDELSELTPIYFR-PSNSHGNAKTYFCADETRSSK  555

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVF  280
            A+ V K VYGS VPV+D EK S R+LVDHSIVESF QGGR VITSRIYPTKAIY AAR+F
Sbjct  556  ATDVFKLVYGSPVPVLDGEKLSMRVLVDHSIVESFAQGGRRVITSRIYPTKAIYGAARLF  615

Query  279  LFNNATGTSVKASVKIWQMNSADIKPFPF  193
            LFNNATG +VKA++KIWQ+NSA I PFP 
Sbjct  616  LFNNATGATVKATLKIWQLNSAFIHPFPL  644



>ref|XP_009113064.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar [Brassica 
rapa]
Length=654

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 152/213 (71%), Gaps = 7/213 (3%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEG--  652
            L+QWP++E++ LR G      + ++PG ++P+ +  AAQLDI A F++  +  E V G  
Sbjct  432  LVQWPVKEIESLRLGRKKF-HMKVEPGTVVPVDVGPAAQLDIEAEFKIKKDDLEVVFGDD  490

Query  651  --EGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTD  478
              E D  ++C +SGGA  RGALGPFG  V AD++L+E T VYFYV KG D K++T FCTD
Sbjct  491  SVEDDKEFSCETSGGATVRGALGPFGFSVLADQSLSEQTQVYFYVTKGKDSKLKTFFCTD  550

Query  477  LTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIY  298
             +RS+ A+ V K VYGS VPV+  EK + RILVDHSI+E FGQGGRT ITSR+YPTKAIY
Sbjct  551  TSRSTMANDVVKPVYGSFVPVLKGEKLTMRILVDHSIIEGFGQGGRTCITSRVYPTKAIY  610

Query  297  EAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
             A R+FLFNNA   ++ AS K+WQMNSA I PF
Sbjct  611  GATRLFLFNNAIDATITASFKVWQMNSAFIHPF  643



>gb|KDO65461.1| hypothetical protein CISIN_1g006523mg [Citrus sinensis]
Length=464

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 154/211 (73%), Gaps = 9/211 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFE--VMNEEAVEGEG  646
            ++QWP+EE++ LR    +  +V ++PG ++P+ I  A QLDI A FE  ++   A+E EG
Sbjct  258  VVQWPVEEIESLRQNSTVFEEVVVEPGSVVPLDIGVATQLDISAEFETELLGSGAME-EG  316

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
               Y CS  GGA+ R A+GPFGL+V A ++L+ELTP++F       G   T+FC D TRS
Sbjct  317  ---YGCS--GGAIDRSAMGPFGLLVNAHDSLSELTPIFFRSSNTTKG-TNTYFCADETRS  370

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A  V K+V+GS VPV+  EK S RILVDHSIVESFGQGGRTVITSRIYPTKAIY AAR
Sbjct  371  SLAPDVFKQVHGSKVPVLQGEKLSMRILVDHSIVESFGQGGRTVITSRIYPTKAIYGAAR  430

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +FLFNNATG +VKA++KIW++NSA I PFP 
Sbjct  431  LFLFNNATGVNVKATLKIWRLNSAFIHPFPL  461



>ref|XP_010264216.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Nelumbo nucifera]
Length=660

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 159/211 (75%), Gaps = 5/211 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG----  652
            +LQWP++E + LR       KV +  G ++P+++  A QLDIIA F V++  ++EG    
Sbjct  445  ILQWPVKETESLRLSSDEFDKVEVPAGSVVPLNVSTATQLDIIAEF-VVDNASLEGTGTI  503

Query  651  EGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLT  472
            E D  Y+CS+SGGA  RGALGPFGL+V AD++LAE TPVYFY+ K  DG ++T FC D +
Sbjct  504  EADGGYDCSTSGGAAGRGALGPFGLLVLADKSLAEQTPVYFYIAKDIDGHLKTFFCADES  563

Query  471  RSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEA  292
            RSS A+ V K VYGS VPV+D EK + R+LVDHSIVESF QGGRTVITSR+YPT+AIY A
Sbjct  564  RSSLANDVGKHVYGSLVPVLDGEKLTMRLLVDHSIVESFAQGGRTVITSRVYPTEAIYGA  623

Query  291  ARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            ARVFLFNNATG SV AS+KIWQMNSA I P+
Sbjct  624  ARVFLFNNATGASVTASLKIWQMNSAFIHPY  654



>ref|XP_012090431.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Jatropha curcas]
 gb|KDP22418.1| hypothetical protein JCGZ_26249 [Jatropha curcas]
Length=627

 Score =   234 bits (597),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 151/211 (72%), Gaps = 9/211 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFE--VMNEEAVEGEG  646
            LLQWP+EE++ LR       ++ + PG I+P+ I  A QLDI A FE  +++   VE   
Sbjct  421  LLQWPVEEIESLRLNSTDFEEIVVGPGSIVPLEIGVATQLDIFAEFETELISNSVVE---  477

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
               Y C+  GGAV R +LGPFGL+V ADETL+ELTPV+F      DG  +T+FC+D  RS
Sbjct  478  --EYGCN--GGAVNRSSLGPFGLLVLADETLSELTPVFFRPVNSTDGSFKTYFCSDEKRS  533

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A  V K+VYGSTVPV+DDEK   R+LVDHSIVESF QGGRTVITSRIYPT+AI   AR
Sbjct  534  SKAPDVCKQVYGSTVPVLDDEKLRMRVLVDHSIVESFAQGGRTVITSRIYPTEAIDGNAR  593

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +FLFNNAT  +VKA++KIW++  A I+PFP 
Sbjct  594  LFLFNNATSVNVKATLKIWELMPAFIRPFPL  624



>ref|XP_003533514.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Glycine max]
Length=630

 Score =   234 bits (597),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 152/216 (70%), Gaps = 4/216 (2%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            ++    LL WP+EEV+ LR  +     V ++PG ++P+ I  A QLDI A FE+   E +
Sbjct  414  KKTRTNLLHWPVEEVESLRLSNSEFEGVVVKPGSVVPLDIGPATQLDIFAEFEI---EDL  470

Query  657  EGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKG-GDGKVETHFCT  481
              +G  + N     GAV R A GPFG++  AD+ L+ELTP+YF++     DG + T FC 
Sbjct  471  ASKGIGKDNVDCGNGAVDRSAFGPFGILAIADDQLSELTPIYFHLSSTTKDGSLTTSFCV  530

Query  480  DLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAI  301
            D TRSS+A  V+K ++GS  PV+ DEK S R+LVDHSI+ESF QGGRTVITSR+YPT+AI
Sbjct  531  DETRSSKAPDVSKLIFGSKAPVLSDEKLSMRVLVDHSIIESFAQGGRTVITSRVYPTEAI  590

Query  300  YEAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            Y AAR+FLFNNAT  ++KAS+KIWQ+NSA I+PFPF
Sbjct  591  YGAARLFLFNNATDINIKASLKIWQLNSAFIRPFPF  626



>gb|KHN42772.1| Beta-fructofuranosidase, soluble isoenzyme I [Glycine soja]
Length=534

 Score =   232 bits (591),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 149/209 (71%), Gaps = 2/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            LL WP+EEV+ LR        V ++PG ++P++I  A QLD+ A FE+   E+ +  G  
Sbjct  324  LLLWPVEEVESLRLSSDEFEGVVVKPGSVVPLNISLATQLDMFAEFEIETLES-KSIGKN  382

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
               C S GGA  R A GPFGL+  AD+TL+E TP+YF +     G   T FC D TRSS+
Sbjct  383  NIGCGS-GGATNRSAFGPFGLLAIADDTLSEQTPIYFRLSNTTLGSSTTFFCVDETRSSK  441

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVF  280
            A+ V K +YGS VPV+ DEK S R+LVDHSI+ESF QGGRTVITSR+YPT+AIY AAR+F
Sbjct  442  AADVAKPIYGSKVPVLSDEKLSMRVLVDHSIIESFAQGGRTVITSRVYPTEAIYGAARLF  501

Query  279  LFNNATGTSVKASVKIWQMNSADIKPFPF  193
            LFNNATG ++KA++KIWQ++SA I+PFPF
Sbjct  502  LFNNATGINIKATLKIWQLSSAFIRPFPF  530



>emb|CDY46906.1| BnaA09g12880D [Brassica napus]
Length=654

 Score =   234 bits (598),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 152/213 (71%), Gaps = 7/213 (3%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEG--  652
            L+QWP++E++ LR G      + ++PG ++P+ +  AAQLDI A F++  +  E V G  
Sbjct  432  LVQWPVKEIESLRLGRKKF-HMKVEPGTVVPVDVGPAAQLDIEAEFKIKKDDLEVVFGDD  490

Query  651  --EGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTD  478
              E D  ++C +SGGA  RGALGPFG  V AD++L+E T VYFYV KG D K++T FCTD
Sbjct  491  SVEDDKEFSCETSGGATVRGALGPFGFSVLADQSLSEQTQVYFYVTKGKDSKLKTFFCTD  550

Query  477  LTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIY  298
             +RS+ A+ V K VYGS VPV+  EK + RILVDHSI+E FGQGGRT ITSR+YPTKAIY
Sbjct  551  TSRSTMANDVVKPVYGSFVPVLRGEKLTMRILVDHSIIEGFGQGGRTCITSRVYPTKAIY  610

Query  297  EAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
             A R+FLFNNA   ++ AS K+WQMNSA I PF
Sbjct  611  GATRLFLFNNAIDATITASFKVWQMNSAFIHPF  643



>ref|XP_010672026.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Beta vulgaris subsp. vulgaris]
Length=645

 Score =   234 bits (597),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 159/212 (75%), Gaps = 8/212 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE---GE  649
            +LQWP++EV+ LR+       + LQPG I+ + I + AQLDI A F V+++EA++   G+
Sbjct  439  ILQWPVKEVESLRTDSREYDNLLLQPGSIINLDIASGAQLDISAEF-VVDQEALKLTVGD  497

Query  648  GDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
             D   NCS+   A  R ALGPFGL+V ADE+L+ELTP+YFY+ K  DG V+  FCTD +R
Sbjct  498  -DVINNCSA---AAVRQALGPFGLLVLADESLSELTPIYFYIAKASDGTVKNWFCTDQSR  553

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SS+AS V K++YG  VPV++ EKYS R+LVDHSI+E+FGQGGRT ITSRIYPTKAI   A
Sbjct  554  SSKASSVDKQIYGGPVPVLEGEKYSMRLLVDHSIIEAFGQGGRTCITSRIYPTKAINGNA  613

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +VF+FNNAT +SV ASVKIW+++S ++ P+ F
Sbjct  614  KVFIFNNATDSSVTASVKIWELDSINLSPYIF  645



>ref|XP_003540575.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Glycine max]
Length=614

 Score =   233 bits (594),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 152/216 (70%), Gaps = 4/216 (2%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            ++    L+ WP+EEV+ LR G      V ++PG ++P+ I  A QLD+ A FE+   E +
Sbjct  398  KKTRTNLVHWPVEEVESLRLGSSEFEGVVVKPGSVVPLDIGPATQLDVFAEFEI---EFL  454

Query  657  EGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKG-GDGKVETHFCT  481
              +G  + N     GAV R ALGPFG++  AD+ L+ELTP+YF++     DG   T FC 
Sbjct  455  ASKGSGKDNIGCGNGAVDRSALGPFGILAIADDHLSELTPIYFHLSSTTKDGSSTTSFCV  514

Query  480  DLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAI  301
            D TRSS+A  V+K V+GS VPV+ DEK S R+LVDHSI+ESF QGGRTVI+SR+YPT+AI
Sbjct  515  DETRSSKAPDVSKLVFGSKVPVLSDEKLSMRVLVDHSIIESFAQGGRTVISSRVYPTEAI  574

Query  300  YEAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            Y AAR+FLFNNAT  ++K S+KIWQ+NSA I+PFPF
Sbjct  575  YGAARLFLFNNATDINIKVSLKIWQLNSAFIRPFPF  610



>ref|XP_006421676.1| hypothetical protein CICLE_v10004465mg [Citrus clementina]
 gb|ESR34916.1| hypothetical protein CICLE_v10004465mg [Citrus clementina]
Length=685

 Score =   234 bits (597),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 152/209 (73%), Gaps = 5/209 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            ++QWP+EE++ LR    +  +V ++PG ++P+ I  A QLDI A FE   E    G  + 
Sbjct  479  VVQWPVEEIESLRQNSTVFEEVVVEPGSVVPLDIGVATQLDISAEFET--ELLGSGATEE  536

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
             Y CS  GGAV R A+GPFGL+V A ++L+ELTP++F      +G   T+FCTD TRSS 
Sbjct  537  GYGCS--GGAVDRSAMGPFGLLVNAHDSLSELTPIFFRSSNTTNG-TNTYFCTDETRSSL  593

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVF  280
            A  V K+V+GS VPV+  EK S RILVDHSIVESFGQGGRTVITSRIYPTKAIY AAR+F
Sbjct  594  APDVFKQVHGSKVPVLQGEKLSMRILVDHSIVESFGQGGRTVITSRIYPTKAIYGAARLF  653

Query  279  LFNNATGTSVKASVKIWQMNSADIKPFPF  193
            LFNNATG +VKA++KIW++NSA I PFP 
Sbjct  654  LFNNATGVNVKATLKIWRLNSAFIHPFPL  682



>gb|KDO65460.1| hypothetical protein CISIN_1g006523mg [Citrus sinensis]
Length=528

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 154/211 (73%), Gaps = 9/211 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFE--VMNEEAVEGEG  646
            ++QWP+EE++ LR    +  +V ++PG ++P+ I  A QLDI A FE  ++   A+E EG
Sbjct  322  VVQWPVEEIESLRQNSTVFEEVVVEPGSVVPLDIGVATQLDISAEFETELLGSGAME-EG  380

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
               Y CS  GGA+ R A+GPFGL+V A ++L+ELTP++F       G   T+FC D TRS
Sbjct  381  ---YGCS--GGAIDRSAMGPFGLLVNAHDSLSELTPIFFRSSNTTKG-TNTYFCADETRS  434

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A  V K+V+GS VPV+  EK S RILVDHSIVESFGQGGRTVITSRIYPTKAIY AAR
Sbjct  435  SLAPDVFKQVHGSKVPVLQGEKLSMRILVDHSIVESFGQGGRTVITSRIYPTKAIYGAAR  494

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +FLFNNATG +VKA++KIW++NSA I PFP 
Sbjct  495  LFLFNNATGVNVKATLKIWRLNSAFIHPFPL  525



>dbj|BAF35858.1| Soluble acid invertase [Pyrus pyrifolia var. culta]
Length=645

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 149/209 (71%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            LLQWP+EE++ LR      T V ++ G I+P+ I  A QLDI   F++   E+++ E   
Sbjct  437  LLQWPVEEIEDLRLNSTEFTDVLVEAGTIVPLDIGTATQLDISVDFKI---ESLDTEESV  493

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
              +     GAV R   GPFG++V ADE+L+ELTPVYF V    DG V T+FC D +RSS+
Sbjct  494  NGSSGCGDGAVDRSTFGPFGILVIADESLSELTPVYFRVTNSTDGDVTTYFCADESRSSK  553

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVF  280
            A  V K+VYG  VPV+D E YSAR+LVDHSIVES+ QGGR VI+SR+YPT+AIY AAR+F
Sbjct  554  APEVFKQVYGGKVPVLDGETYSARVLVDHSIVESYAQGGRMVISSRVYPTEAIYGAARLF  613

Query  279  LFNNATGTSVKASVKIWQMNSADIKPFPF  193
            LFNNATG +VKA++KIW++NSA I PFP 
Sbjct  614  LFNNATGVNVKATLKIWRLNSAFIHPFPL  642



>dbj|BAG30919.1| soluble acid invertase [Pyrus pyrifolia]
Length=645

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 149/209 (71%), Gaps = 3/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            LLQWP+EE++ LR      T V ++ G I+P+ I  A QLDI   F++   E+++ E   
Sbjct  437  LLQWPVEEIEDLRLNSTEFTDVLVEAGTIVPLDIGTATQLDISVDFKI---ESLDTEESV  493

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
              +     GAV R   GPFG++V ADE+L+ELTPVYF V    DG V T+FC D +RSS+
Sbjct  494  NGSSGCGDGAVDRSTFGPFGILVIADESLSELTPVYFRVTNSTDGDVTTYFCADESRSSK  553

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVF  280
            A  V K+VYG  VPV+D E YSAR+LVDHSIVES+ QGGR VI+SR+YPT+AIY AAR+F
Sbjct  554  APEVFKQVYGGKVPVLDGETYSARVLVDHSIVESYAQGGRMVISSRVYPTEAIYGAARLF  613

Query  279  LFNNATGTSVKASVKIWQMNSADIKPFPF  193
            LFNNATG +VKA++KIW++NSA I PFP 
Sbjct  614  LFNNATGVNVKATLKIWRLNSAFIHPFPL  642



>ref|XP_003526374.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Glycine max]
Length=646

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 149/209 (71%), Gaps = 2/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            LL WP+EEV+ LR        V ++PG ++P++I  A QLD+ A FE+   E+ +  G  
Sbjct  436  LLLWPVEEVESLRLSSDEFEGVVVKPGSVVPLNISLATQLDMFAEFEIETLES-KSIGKN  494

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
               C S GGA  R A GPFGL+  AD+TL+E TP+YF +     G   T FC D TRSS+
Sbjct  495  NIGCGS-GGATNRSAFGPFGLLAIADDTLSEQTPIYFRLSNTTLGSSTTFFCVDETRSSK  553

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVF  280
            A+ V K +YGS VPV+ DEK S R+LVDHSI+ESF QGGRTVITSR+YPT+AIY AAR+F
Sbjct  554  AADVAKPIYGSKVPVLSDEKLSMRVLVDHSIIESFAQGGRTVITSRVYPTEAIYGAARLF  613

Query  279  LFNNATGTSVKASVKIWQMNSADIKPFPF  193
            LFNNATG ++KA++KIWQ++SA I+PFPF
Sbjct  614  LFNNATGINIKATLKIWQLSSAFIRPFPF  642



>gb|AAM52062.1| vacuolar acid invertase PsI-1 [Pisum sativum]
Length=647

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 151/210 (72%), Gaps = 3/210 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE--GEG  646
            LLQWP+ EV+ LR        + ++PG ++ + I  A QLDI A FE+ ++EA+E   + 
Sbjct  430  LLQWPVAEVESLRLKSDEFKNLKVKPGAVVSLDIETATQLDIDAEFEI-DKEALEKTAQS  488

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  Y CS+SGGA +RGALGPFGL V AD+ L+E TPVYFYV KG +GK+ T FC+D +RS
Sbjct  489  NVEYECSTSGGASRRGALGPFGLYVLADKGLSEYTPVYFYVVKGSNGKLNTPFCSDQSRS  548

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K++YGS VPV++ EK S RILVDHSIVESF QGGRT ITSR+YPT+AIY AAR
Sbjct  549  SLANDVHKQIYGSVVPVLEGEKLSLRILVDHSIVESFAQGGRTCITSRVYPTRAIYGAAR  608

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFP  196
            +FLFN+A  T+V AS+K+W        P P
Sbjct  609  LFLFNHAIETNVTASLKVWANEFCIYTPIP  638



>emb|CDY30056.1| BnaC05g09640D [Brassica napus]
Length=659

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 149/211 (71%), Gaps = 5/211 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            L+QWP+EEVK LR        + + PG ++ I + +AAQLDI A FE+  E   +  GD 
Sbjct  439  LVQWPVEEVKSLRLSSKKF-DMEVGPGSLVHIDVGSAAQLDIEAEFEIKKESLDKILGDA  497

Query  639  ----RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLT  472
                 ++C  SGG+  RGALGPFG  V A E+L+E TPVYFYV KG D K+ T FC D +
Sbjct  498  SATEEFSCQKSGGSTVRGALGPFGFSVLAHESLSEQTPVYFYVAKGKDSKLTTFFCADSS  557

Query  471  RSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEA  292
            RSS A+ V K +YGS+VPV+  EK + RILVDHSIVE+FGQGGRT ITSR+YPTKAIY A
Sbjct  558  RSSFANDVVKPIYGSSVPVLKGEKLTMRILVDHSIVEAFGQGGRTCITSRVYPTKAIYGA  617

Query  291  ARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            A++FLFNNA   ++ AS K+WQMNSA I+P+
Sbjct  618  AKLFLFNNAIDATITASFKVWQMNSAFIQPY  648



>gb|AFU56882.1| vacuolar invertase [Malus domestica]
Length=645

 Score =   232 bits (592),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 145/212 (68%), Gaps = 9/212 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVM---NEEAVEGE  649
            LLQWP+EE++ LR      T V ++ G  +P+ I  A QLDI+  FE+     EE+V G 
Sbjct  437  LLQWPVEEIEDLRLNSTEFTDVLVEAGTTVPLDIGTATQLDILVDFEIELLGTEESVNGS  496

Query  648  GDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
                  C    GA  R   GPFG++  ADETL+E TPVYF V    DG V T+FC D  R
Sbjct  497  S----GCGD--GAADRSTFGPFGILALADETLSEFTPVYFRVTNSTDGDVTTYFCADELR  550

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAA  289
            SS A  V K+VYG  VPV+D E YSAR+LVDHSIVES+ QGGRTVI+SR+YPT+AIY AA
Sbjct  551  SSRAPEVFKQVYGGEVPVLDGETYSARVLVDHSIVESYAQGGRTVISSRVYPTEAIYGAA  610

Query  288  RVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            R+FLFNNATG +VKA++KIWQ+NSA I PFP 
Sbjct  611  RLFLFNNATGVNVKATLKIWQLNSAFIHPFPL  642



>gb|AFJ21571.1| sucrose:sucrose 1-fructosyltransferase [Agave tequilana]
 gb|AFJ21577.1| sucrose:sucrose 1-fructosyltransferase [Agave tequilana]
Length=621

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 147/211 (70%), Gaps = 4/211 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            L+ WP+EEV+ LR+ +     V L PG    + +  A QLDI+A FEV +E+ +E   E 
Sbjct  407  LILWPVEEVESLRTINRNFNSVALNPGSTFQLDVGEATQLDILAEFEV-DEKVIEAATEA  465

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNCS+SGGA  RG +GPFGL+V A++ L E T  YFYV +G DG + THFC D  RS
Sbjct  466  DVTYNCSTSGGAANRGMIGPFGLLVLANQDLTEQTATYFYVSRGIDGHLRTHFCQDELRS  525

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A G+TK V G+TVPV++ E ++ RILVDHSIVESF QGGR V TSR+YPT+AIY +AR
Sbjct  526  SKAGGITKRVVGNTVPVLNGETWALRILVDHSIVESFAQGGRAVATSRVYPTEAIYSSAR  585

Query  285  VFLFNNATGTSVKA-SVKIWQMNSADIKPFP  196
            VFLFNNAT  +V A +V +W MNS     FP
Sbjct  586  VFLFNNATDAAVTARTVTVWHMNSTYNHVFP  616



>gb|AAG36943.1|AF274299_1 acid invertase [Brassica oleracea]
Length=662

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 150/214 (70%), Gaps = 8/214 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            L+QWP+EEVK LR        + + PG ++ I + +AAQLDI A FE+  E   +  GD 
Sbjct  439  LVQWPVEEVKSLRLSSKKF-DMEVGPGSLVHIDVGSAAQLDIEAEFEIKKESLEKILGDA  497

Query  639  R-------YNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCT  481
                    ++C  SGG+  RGALGPFG  V A E+L+E TPVYFYV KG D K+ T FCT
Sbjct  498  SAAAEAEEFSCQKSGGSTVRGALGPFGFSVLAHESLSEKTPVYFYVAKGKDSKLITFFCT  557

Query  480  DLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAI  301
            D +RSS A+ V K +YGS+VPV+  EK + RILVDHSIVE+FGQGGRT ITSR+YPTKAI
Sbjct  558  DSSRSSFANDVVKPIYGSSVPVLKGEKLTMRILVDHSIVEAFGQGGRTCITSRVYPTKAI  617

Query  300  YEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            Y AA++FLFNNA   ++ AS K+WQMNSA I+P+
Sbjct  618  YGAAKLFLFNNAIDATITASFKVWQMNSAFIQPY  651



>emb|CAA66237.1| invertase 5 [Tulipa gesneriana]
Length=628

 Score =   232 bits (591),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 149/212 (70%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LL WP+EEV+RLR+       +++  G ++P+ I  A QLDI+A FE+ +   +E   E 
Sbjct  416  LLLWPVEEVERLRTSRQDFENIDIGIGAVVPLDIGKAIQLDIVAEFEI-DGATLEASVEA  474

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNCS+S GA  RG LGPFG +V +DE L+E T +YFYV +  DG + T FC D  RS
Sbjct  475  DLGYNCSTSDGAFGRGVLGPFGFLVLSDEDLSEQTAIYFYVGRKMDGALHTFFCQDELRS  534

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A+ + K V+GS VPV+  E ++ RIL+DHSIVESF QGGRT ITSRIYPTKA   AAR
Sbjct  535  SKANDLVKRVFGSIVPVLHGETFTMRILLDHSIVESFAQGGRTCITSRIYPTKAFDGAAR  594

Query  285  VFLFNNATGTSVKA-SVKIWQMNSADIKPFPF  193
            VF+FNNATG  V A S+KIWQMNSA I P+PF
Sbjct  595  VFIFNNATGAKVTAKSIKIWQMNSASIIPYPF  626



>ref|XP_010418267.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like [Camelina 
sativa]
Length=648

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 151/213 (71%), Gaps = 7/213 (3%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEGE-  649
            L+QWP+EE++ LR  +     + + PG ++PI + +AAQLDI A F++  E  E + GE 
Sbjct  432  LVQWPVEEIESLRLSNKKF-HMKVGPGTVVPIDVGSAAQLDIEAEFKIKKEDLEIIFGED  490

Query  648  ---GDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTD  478
                D  ++C + GG+  RGALGPFG  V AD++L+E TPVYFYV KG D K++T FCTD
Sbjct  491  SVEADEEFSCQNGGGSTVRGALGPFGFSVLADQSLSEHTPVYFYVTKGKDSKLKTFFCTD  550

Query  477  LTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIY  298
             +RS+ A+ V K VYGS VPV+  EK + RILVDHSIVE F QGGRT ITSR+YPTKAIY
Sbjct  551  TSRSTMANDVVKPVYGSFVPVLKGEKLTMRILVDHSIVEGFAQGGRTCITSRVYPTKAIY  610

Query  297  EAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
             A ++FLFNNA   ++ AS K+WQMNSA I P+
Sbjct  611  GATKLFLFNNAIDATITASFKVWQMNSAFIHPY  643



>ref|XP_002888009.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64268.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=654

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 149/218 (68%), Gaps = 7/218 (3%)
 Frame = -1

Query  834  RQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV-  658
            R    L+QWP+EE+K LR        + + PG ++P+ + +A QLDI A FE+  E+   
Sbjct  427  RTRKNLVQWPVEEIKSLRLSSNKF-DMTIGPGTVVPVDVGSATQLDIEAEFEIKTEDLEL  485

Query  657  -----EGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVET  493
                   E D +++C +SGG+  RGALGPFG  V ADE+L+E TPVYFYV KG   K++T
Sbjct  486  FFDDDSVEADKKFSCETSGGSTARGALGPFGFSVLADESLSEQTPVYFYVTKGKHSKLKT  545

Query  492  HFCTDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYP  313
             FCTD +RS+ A+ V K +YGS VPV+  EK + RILVDHSIVE F QGGRT ITSR+YP
Sbjct  546  VFCTDTSRSTMANDVVKPIYGSFVPVLKGEKLTMRILVDHSIVEGFAQGGRTCITSRVYP  605

Query  312  TKAIYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            TKAIY A ++FLFNNA   +V AS K+WQMNSA I P+
Sbjct  606  TKAIYGATKLFLFNNAIDATVTASFKVWQMNSAFIHPY  643



>ref|XP_009406946.1| PREDICTED: beta-fructofuranosidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=551

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 153/221 (69%), Gaps = 4/221 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            L+QWP+EEV+ LR      + + + PG ++P+ + +A QLDI A F V++E A+    E 
Sbjct  331  LIQWPVEEVESLRMSSRNFSGITVAPGSVIPLDVGSATQLDIEAEF-VIDEAALMATTEA  389

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNCS+SGGA  RG LGPFGL+V AD+ L+E T VYFYV +  DG++  HFC D +RS
Sbjct  390  DVGYNCSTSGGAAARGMLGPFGLLVLADKALSEQTAVYFYVARRRDGRLRAHFCQDESRS  449

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A+ + K V GSTVPV+D EK S RILVDHSIVESF Q GRT ITSR+YPT+AIY  AR
Sbjct  450  SKANDIVKRVVGSTVPVLDGEKLSLRILVDHSIVESFAQKGRTCITSRVYPTEAIYGDAR  509

Query  285  VFLFNNATGTSVKA-SVKIWQMNSADIKPFPF*SILELFAS  166
            VFLFNNAT  +V A S+  WQ+NS    P+       LF++
Sbjct  510  VFLFNNATNCNVVAKSLTTWQLNSTYNHPYSSSKGFSLFST  550



>ref|XP_008794813.1| PREDICTED: beta-fructofuranosidase 1-like [Phoenix dactylifera]
Length=664

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 147/209 (70%), Gaps = 2/209 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEE-AVEGEGD  643
            LLQWP+EEV+RLR      + + +  G +L ++I  A QLDI A FE+  E  A+  E D
Sbjct  452  LLQWPVEEVERLRMSSKNFSGIVIDSGSVLSLNITRATQLDIEAVFEIEGEALAMTVEAD  511

Query  642  FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSS  463
              YNCS+SGGA +RG LGPFGL+V A+E L+E T VYFY+ +G DG + TH C D  RSS
Sbjct  512  VGYNCSTSGGAAERGMLGPFGLLVLANERLSEQTAVYFYIARGTDGNLRTHICHDELRSS  571

Query  462  EASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARV  283
             A+ + K V GSTVPV+D E+ S RILVDHSIVESF QGGRT ITSR+YPT+AIY A + 
Sbjct  572  RANDIIKRVVGSTVPVLDGERLSVRILVDHSIVESFAQGGRTCITSRVYPTEAIYSATKA  631

Query  282  FLFNNATGTSVKA-SVKIWQMNSADIKPF  199
            FLFNN TG SV A S+ IW+M+S    P+
Sbjct  632  FLFNNGTGASVIARSLTIWEMDSTFDHPY  660



>ref|XP_009112697.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like [Brassica 
rapa]
Length=655

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 152/215 (71%), Gaps = 11/215 (5%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEE--------  664
            L+QWP++E++ LR       K  + PG ++P+ +  A Q+DI A F++ NE+        
Sbjct  432  LIQWPVKEIESLRLRSKKFHK-KIGPGTVVPVDVGPADQIDIEAEFKLKNEDLEVIFGDD  490

Query  663  AVEGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            +VE + DF  +C +SGGA  RGALGPFG  V AD++L+E T VYFYV KG D K++T FC
Sbjct  491  SVEDDKDF--SCETSGGATLRGALGPFGFSVLADQSLSEQTLVYFYVTKGKDSKLKTFFC  548

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD ++S+ A+ V K VYGS VPV+  EK + RILVDHSIVE FGQGGRT ITSR+YPTKA
Sbjct  549  TDTSKSTMANDVVKPVYGSFVPVLKGEKLTMRILVDHSIVEGFGQGGRTCITSRVYPTKA  608

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            IY A ++FLFNNAT  +V AS K+WQMNSA I PF
Sbjct  609  IYGATKLFLFNNATDATVTASFKVWQMNSAFIHPF  643



>emb|CDY31826.1| BnaC09g13230D [Brassica napus]
Length=654

 Score =   232 bits (591),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 152/215 (71%), Gaps = 11/215 (5%)
 Frame = -1

Query  819  LLQWPIEEVK--RLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEG  652
            L+QWP++E++  RLRS       + ++PG ++P+ +  AAQLDI A F++  E  E V  
Sbjct  432  LVQWPVKEIESLRLRSKK---FHMKVEPGTVVPVDVGPAAQLDIEAEFKIKKEDLEVVFA  488

Query  651  ----EGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
                E D  ++C +SGGA  RGALGPFG  V AD++L+E T VYFYV KG D K++T FC
Sbjct  489  DDSVEDDKEFSCETSGGATVRGALGPFGFSVLADQSLSEQTQVYFYVTKGKDSKLKTFFC  548

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD +RS+ A+ V K VYGS VPV+  EK + RILVDHSI+E FGQGGRT ITSR+YPTKA
Sbjct  549  TDTSRSTMANDVVKPVYGSFVPVLKGEKLTMRILVDHSIIEGFGQGGRTCITSRVYPTKA  608

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            IY A R+FLFNNA   ++ AS K+WQMNSA I PF
Sbjct  609  IYGATRLFLFNNANDAAITASFKVWQMNSAFIHPF  643



>emb|CAD19321.1| acid vacuolar invertase [Beta vulgaris]
Length=675

 Score =   232 bits (592),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 153/207 (74%), Gaps = 3/207 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGE--G  646
            L+QWP+EEV+ LR  +    KV +  G ++P+ + AA ++DIIA F++ ++EA+E     
Sbjct  461  LVQWPVEEVETLRQNNKDFDKVEVPAGSVVPLDVSAATEIDIIAEFDI-DKEALENLPVS  519

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  Y+C +S GA +RGALGPFGL+V A+  LAE TPVYFYV K   G  +T FCTDL+RS
Sbjct  520  EEHYSCPASKGAAQRGALGPFGLLVLANNDLAEQTPVYFYVIKTLSGSFKTFFCTDLSRS  579

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K +YGSTVPV+  EK S RILVDHSIVE+F QGGRT ITSR+YPTKAIY+  +
Sbjct  580  SAATDVFKNIYGSTVPVLKGEKLSMRILVDHSIVEAFAQGGRTCITSRVYPTKAIYKETK  639

Query  285  VFLFNNATGTSVKASVKIWQMNSADIK  205
            +++FNNAT  +V AS+K WQM+SA ++
Sbjct  640  LYVFNNATTATVTASIKTWQMSSARLQ  666



>ref|XP_010676175.1| PREDICTED: acid beta-fructofuranosidase-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=677

 Score =   232 bits (591),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 153/207 (74%), Gaps = 3/207 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGE--G  646
            L+QWP+EEV+ LR  +    KV +  G ++P+ + AA ++DIIA F++ ++EA+E     
Sbjct  463  LVQWPVEEVETLRQNNKDFDKVEVPAGSVVPLDVSAATEIDIIAEFDI-DKEALENLPVS  521

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  Y+C +S GA +RGALGPFGL+V A+  LAE TPVYFYV K   G  +T FCTDL+RS
Sbjct  522  EEHYSCPASKGAAQRGALGPFGLLVLANNDLAEQTPVYFYVIKTLSGSFKTFFCTDLSRS  581

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K +YGSTVPV+  EK S RILVDHSIVE+F QGGRT ITSR+YPTKAIY+  +
Sbjct  582  SAATDVFKNIYGSTVPVLKGEKLSMRILVDHSIVEAFAQGGRTCITSRVYPTKAIYKETK  641

Query  285  VFLFNNATGTSVKASVKIWQMNSADIK  205
            +++FNNAT  +V AS+K WQM+SA ++
Sbjct  642  LYVFNNATTATVTASIKTWQMSSARLQ  668



>gb|KDO65459.1| hypothetical protein CISIN_1g006523mg [Citrus sinensis]
Length=642

 Score =   231 bits (589),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 154/211 (73%), Gaps = 9/211 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFE--VMNEEAVEGEG  646
            ++QWP+EE++ LR    +  +V ++PG ++P+ I  A QLDI A FE  ++   A+E EG
Sbjct  436  VVQWPVEEIESLRQNSTVFEEVVVEPGSVVPLDIGVATQLDISAEFETELLGSGAME-EG  494

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
               Y CS  GGA+ R A+GPFGL+V A ++L+ELTP++F       G   T+FC D TRS
Sbjct  495  ---YGCS--GGAIDRSAMGPFGLLVNAHDSLSELTPIFFRSSNTTKG-TNTYFCADETRS  548

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A  V K+V+GS VPV+  EK S RILVDHSIVESFGQGGRTVITSRIYPTKAIY AAR
Sbjct  549  SLAPDVFKQVHGSKVPVLQGEKLSMRILVDHSIVESFGQGGRTVITSRIYPTKAIYGAAR  608

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +FLFNNATG +VKA++KIW++NSA I PFP 
Sbjct  609  LFLFNNATGVNVKATLKIWRLNSAFIHPFPL  639



>ref|XP_010676174.1| PREDICTED: acid beta-fructofuranosidase-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
 emb|CAC81825.1| beta-fructofuranosidase [Beta vulgaris]
Length=691

 Score =   231 bits (590),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 151/204 (74%), Gaps = 3/204 (1%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGE--G  646
            L+QWP+EEV+ LR  +    KV +  G ++P+ + AA ++DIIA F++ ++EA+E     
Sbjct  463  LVQWPVEEVETLRQNNKDFDKVEVPAGSVVPLDVSAATEIDIIAEFDI-DKEALENLPVS  521

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +  Y+C +S GA +RGALGPFGL+V A+  LAE TPVYFYV K   G  +T FCTDL+RS
Sbjct  522  EEHYSCPASKGAAQRGALGPFGLLVLANNDLAEQTPVYFYVIKTLSGSFKTFFCTDLSRS  581

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A+ V K +YGSTVPV+  EK S RILVDHSIVE+F QGGRT ITSR+YPTKAIY+  +
Sbjct  582  SAATDVFKNIYGSTVPVLKGEKLSMRILVDHSIVEAFAQGGRTCITSRVYPTKAIYKETK  641

Query  285  VFLFNNATGTSVKASVKIWQMNSA  214
            +++FNNAT  +V AS+K WQM+SA
Sbjct  642  LYVFNNATTATVTASIKTWQMSSA  665



>sp|Q5FC15.1|GFT_ASPOF RecName: Full=6(G)-fructosyltransferase; AltName: Full=6G-FFT; 
Short=6GFT; AltName: Full=6G-fructosyltransferase; AltName: 
Full=AoFT1 [Asparagus officinalis]
 dbj|BAD89564.1| 6G-fructosyltransferase [Asparagus officinalis]
Length=610

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 146/212 (69%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            +L WPIEEV+ LR      + + +  G  + +H+  A QLDI A FE M+++A+E   E 
Sbjct  396  VLTWPIEEVESLRMTRKDFSDIVVNKGSTVELHVGDANQLDIEAEFE-MDKDALETAIEA  454

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNCSSSGGAV RG LGPFGL V A++ L ELT  YFYV +  DG + TH C D  RS
Sbjct  455  DIGYNCSSSGGAVSRGVLGPFGLFVLANQDLTELTATYFYVSRATDGSLHTHLCHDEMRS  514

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A+ + K V G T  V+D E  S RILVDHSIVESF QGGRT  TSR+YPT+AIYE AR
Sbjct  515  SKANDIVKRVVGGTFTVLDGELLSLRILVDHSIVESFAQGGRTSATSRVYPTEAIYERAR  574

Query  285  VFLFNNATGTSVKA-SVKIWQMNSADIKPFPF  193
            VFLFNNATG ++ A +VK+WQMNS   + +PF
Sbjct  575  VFLFNNATGATITAKAVKVWQMNSTSNQYYPF  606



>ref|XP_009118103.1| PREDICTED: acid beta-fructofuranosidase 4, vacuolar [Brassica 
rapa]
Length=663

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 148/214 (69%), Gaps = 8/214 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            L+QWP+EE+K LR        + + PG ++P+ +  A QLDI A FE+  E   +  GD 
Sbjct  440  LVQWPVEEIKSLRLSSKQF-DMEVGPGSVVPVDVNTATQLDIEAEFEIKKETLDKILGDS  498

Query  639  -------RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCT  481
                    ++C  SGG+  RGALGPFG  V AD++L+E TPVYFYV KG D K++  FCT
Sbjct  499  SVVAEAEEFSCQKSGGSTVRGALGPFGFSVLADKSLSEQTPVYFYVAKGKDSKLKAFFCT  558

Query  480  DLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAI  301
            D +RS+ A+ V K +YGS+VPV++ EK + RILVDHSIVE F QGGRT ITSR+YPTKAI
Sbjct  559  DTSRSTFANDVVKPIYGSSVPVLEGEKLTMRILVDHSIVEGFAQGGRTCITSRVYPTKAI  618

Query  300  YEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            Y AA++F+FNNA   +V AS K+WQMNSA I P+
Sbjct  619  YGAAKLFVFNNAIDATVTASFKVWQMNSAFIHPY  652



>emb|CDY26548.1| BnaA09g47290D [Brassica napus]
Length=663

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 148/214 (69%), Gaps = 8/214 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            L+QWP+EE+K LR        + + PG ++P+ +  A QLDI A FE+  E   +  GD 
Sbjct  440  LVQWPVEEIKSLRLSSKQF-DMEVGPGSVVPVDVNTATQLDIEAEFEIKKETLDKILGDS  498

Query  639  -------RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCT  481
                    ++C  SGG+  RGALGPFG  V AD++L+E TPVYFYV KG D K++  FCT
Sbjct  499  SVVAEAEEFSCQKSGGSTVRGALGPFGFSVLADKSLSEQTPVYFYVAKGKDSKLKAFFCT  558

Query  480  DLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAI  301
            D +RS+ A+ V K +YGS+VPV++ EK + RILVDHSIVE F QGGRT ITSR+YPTKAI
Sbjct  559  DTSRSTFANDVVKPIYGSSVPVLEGEKLTMRILVDHSIVEGFAQGGRTCITSRVYPTKAI  618

Query  300  YEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            Y AA++F+FNNA   +V AS K+WQMNSA I P+
Sbjct  619  YGAAKLFVFNNAIDATVTASFKVWQMNSAFIHPY  652



>gb|AAG36942.1|AF274298_1 acid invertase [Brassica oleracea]
Length=663

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 149/214 (70%), Gaps = 8/214 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            L+QWP+EE+K LR        + + PG ++P+ + +AAQLDI A FE+  E   +  GD 
Sbjct  440  LVQWPVEEIKSLRLSSKQF-DMEVGPGSVVPVDVDSAAQLDIEAEFEINKESLDKILGDA  498

Query  639  -------RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCT  481
                    ++C  SGGA  RGALGPFG  V AD++L+E TPVYFYV KG D K++T FCT
Sbjct  499  SVVVEAEEFSCQKSGGASVRGALGPFGFSVLADKSLSEQTPVYFYVAKGKDSKLKTFFCT  558

Query  480  DLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAI  301
            D +RS+ A+ V K +YGS+VPV+  EK + RILVDHSIVE F Q GRT I+SR+YPTKAI
Sbjct  559  DTSRSTFANDVVKPIYGSSVPVLKGEKLTMRILVDHSIVEGFAQAGRTCISSRVYPTKAI  618

Query  300  YEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            Y AA++F+FNNA   ++ AS K+WQMNSA I P+
Sbjct  619  YGAAKLFVFNNAIDATITASFKVWQMNSAFIHPY  652



>emb|CDX98080.1| BnaA06g08310D [Brassica napus]
Length=662

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 148/214 (69%), Gaps = 8/214 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            L+QWP++EVK LR        + + PG  + I + +AAQLDI A FE+  E   +  GD 
Sbjct  439  LVQWPVDEVKSLRLSSKKF-DMEVGPGSFVNIDVGSAAQLDIEAEFEIKKESLDKILGDA  497

Query  639  R-------YNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCT  481
                    ++C  SGG+  RGALGPFG  V A E+L+E TPVYFYV KG D K++T FCT
Sbjct  498  SAAAEAEEFSCQKSGGSTVRGALGPFGFSVLAHESLSEQTPVYFYVAKGKDSKLKTFFCT  557

Query  480  DLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAI  301
            D +RSS A+ V K +YGS+VPV+  EK + RILVDHSIVE+FGQGGRT ITSR+YPTKAI
Sbjct  558  DSSRSSFANDVVKPIYGSSVPVMKGEKLTMRILVDHSIVEAFGQGGRTCITSRVYPTKAI  617

Query  300  YEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            Y AA++FLFNNA   ++ AS  +WQMNSA I P+
Sbjct  618  YGAAKLFLFNNAIDATITASFNVWQMNSAFIHPY  651



>emb|CDY15984.1| BnaC08g41390D [Brassica napus]
Length=680

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 148/212 (70%), Gaps = 6/212 (3%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            L+QWP+EE+K LR        + + PG ++P+ + +AAQLDI A FE+  E   +  GD 
Sbjct  459  LVQWPVEEIKSLRLSSKQF-DMEVGPGSVVPVDVDSAAQLDIEAEFEINKESLDKILGDA  517

Query  639  -----RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDL  475
                  ++C  SGGA  RGALGPFG  V AD++L+E TPVYFYV KG D K++T FC D 
Sbjct  518  SVVAEEFSCQKSGGASVRGALGPFGFSVLADKSLSEQTPVYFYVAKGKDSKLKTFFCIDT  577

Query  474  TRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYE  295
            +RS+ A+ V K +YGS+VPV+  EK + RILVDHSIVE F Q GRT ITSR+YPTKAIY 
Sbjct  578  SRSTFANDVVKPIYGSSVPVLKGEKLTMRILVDHSIVEGFAQAGRTCITSRVYPTKAIYG  637

Query  294  AARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            AA++F+FNNA   ++ AS K+WQMNSA I P+
Sbjct  638  AAKLFVFNNAIDATITASFKVWQMNSAFIHPY  669



>ref|NP_001275874.1| beta-fructofuranosidase, soluble isoenzyme I-like [Citrus sinensis]
 dbj|BAF34363.1| beta-fructofuranosidase [Citrus sinensis]
Length=642

 Score =   229 bits (584),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 153/211 (73%), Gaps = 9/211 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFE--VMNEEAVEGEG  646
            ++QWP+EE++ LR    +  +V ++PG ++P+ I  A QLDI A FE  ++   A+E EG
Sbjct  436  VVQWPVEEIESLRQNSTVFEEVVVEPGSVVPLDIGVATQLDISAEFETELLGSGAME-EG  494

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
               Y CS  GGA+ R A+GPFGL+V A ++L+ELTP++F       G   T+FC D TRS
Sbjct  495  ---YGCS--GGAIDRSAMGPFGLLVNAHDSLSELTPIFFRSSNTTKG-TNTYFCADETRS  548

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S A  V K+V GS VPV+  EK S RILVDHSIVESFGQGGRTVITSRIYPTKAIY AAR
Sbjct  549  SLAPDVFKQVRGSKVPVLQGEKLSMRILVDHSIVESFGQGGRTVITSRIYPTKAIYGAAR  608

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +FLFNNATG +VKA++KIW++NSA I PFP 
Sbjct  609  LFLFNNATGVNVKATLKIWRLNSAFIHPFPL  639



>ref|XP_010473488.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar [Camelina 
sativa]
Length=648

 Score =   229 bits (584),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 151/215 (70%), Gaps = 11/215 (5%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEV--------MNEE  664
            L+QWP+EE+K LR  +     + + PG ++P+ + +AAQLDI A F +        + E+
Sbjct  432  LVQWPVEEIKSLRLSNKKF-HMKVGPGTVVPVDVGSAAQLDIEAEFTIKKDDLEIILGED  490

Query  663  AVEGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            +VE + +F  +C + GG+  RGALGPFG  V AD++L+E TPVYFYV KG D K++T FC
Sbjct  491  SVEADEEF--SCQNGGGSTVRGALGPFGFSVLADQSLSEHTPVYFYVTKGKDSKLKTFFC  548

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD +RS+ A+ V K VYGS VPV+  EK + RILVDHSIVE F QGG+T ITSR+YPTKA
Sbjct  549  TDTSRSTMANDVVKPVYGSFVPVLKGEKLTMRILVDHSIVEGFAQGGKTCITSRVYPTKA  608

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            IY A ++FLFNNA   +V AS K+WQMN A I P+
Sbjct  609  IYGATKLFLFNNAIDATVTASFKVWQMNGAFIHPY  643



>ref|XP_011081205.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I [Sesamum 
indicum]
Length=655

 Score =   229 bits (584),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 150/209 (72%), Gaps = 5/209 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVE----G  652
            +LQWP++EV+RLR    +  KV +  G ++P+ + + +QLDI+A F+V +EEA++     
Sbjct  448  ILQWPVKEVERLRRNRIVFDKVEVTAGSVVPLDVVSTSQLDIVAEFKV-DEEALKRMNVN  506

Query  651  EGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLT  472
              D  Y+C  SGGA +RGALGPFGL+V A + L E TP+YFY+ K   G  +T FC D +
Sbjct  507  GSDSSYSCQKSGGAAERGALGPFGLLVLASKHLIEQTPIYFYISKDTKGNFKTFFCADHS  566

Query  471  RSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEA  292
            RSS+A+ V KE+YGSTVPV+ DE  S RILVD SIVESFGQGGR+ ITSR+YPT+   E 
Sbjct  567  RSSQANDVDKEIYGSTVPVLKDETLSMRILVDRSIVESFGQGGRSCITSRVYPTRVACED  626

Query  291  ARVFLFNNATGTSVKASVKIWQMNSADIK  205
             ++FLFNNAT   + AS++IWQM+SA I+
Sbjct  627  VKIFLFNNATDARITASLQIWQMSSASIQ  655



>ref|XP_009148607.1| PREDICTED: acid beta-fructofuranosidase 4, vacuolar-like [Brassica 
rapa]
Length=662

 Score =   229 bits (584),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 148/214 (69%), Gaps = 8/214 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            L+QWP++EVK LR        + + PG  + I + +AAQLDI A FE+  E   +  GD 
Sbjct  439  LVQWPVDEVKSLRLSSKKF-DMEVGPGSFVNIDVGSAAQLDIEAEFEIKKESLDKILGDA  497

Query  639  R-------YNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCT  481
                    ++C  SGG+  RGALGPFG  V A E+L+E TPVYFYV KG D K++T FCT
Sbjct  498  SAAAEAEEFSCQKSGGSTVRGALGPFGFSVLAHESLSEQTPVYFYVAKGKDSKLKTFFCT  557

Query  480  DLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAI  301
            D +RSS A+ V K VYGS+VPV++ EK + RILVDHSIVE+FGQGGRT  TSR+YPTKAI
Sbjct  558  DSSRSSFANDVVKPVYGSSVPVLEGEKLTMRILVDHSIVEAFGQGGRTCTTSRVYPTKAI  617

Query  300  YEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            Y AA++FLFNNA   ++ AS  +WQMNSA I P+
Sbjct  618  YGAAKLFLFNNAIDATITASFNVWQMNSAFIHPY  651



>ref|XP_007131343.1| hypothetical protein PHAVU_011G005900g [Phaseolus vulgaris]
 gb|ESW03337.1| hypothetical protein PHAVU_011G005900g [Phaseolus vulgaris]
Length=627

 Score =   228 bits (582),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 154/215 (72%), Gaps = 8/215 (4%)
 Frame = -1

Query  837  RRQEVILLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAV  658
            ++ E  LLQWP+EE++ LR       +V ++PG ++P+ I  A QLDI A FE+    A 
Sbjct  420  KKTETHLLQWPVEEIESLRLRSYEFEEVVVKPGSVVPLDIGPATQLDIFAEFEI-EYLAS  478

Query  657  EGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTD  478
            +G G  + N     GA  R +LGPFG++  AD+ L+ELTP+YF++         + FC D
Sbjct  479  KGTGK-KENVGCGNGAFDRSSLGPFGILAIADDKLSELTPIYFHLSN------TSFFCVD  531

Query  477  LTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIY  298
             TRSS+AS V+K V+GS VPV+ DE+ S R+LVDHSI+ESF QGGRTVI+SR+YPT+AIY
Sbjct  532  ETRSSKASDVSKLVFGSEVPVVGDERLSMRVLVDHSIIESFAQGGRTVISSRVYPTEAIY  591

Query  297  EAARVFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            EAAR+F+FNNAT  ++KAS+KIWQ+NSA I+PFPF
Sbjct  592  EAARLFVFNNATDINIKASLKIWQLNSAFIRPFPF  626



>emb|CAA06838.1| sucrose sucrose 1-fructosyltransferase [Allium cepa]
Length=623

 Score =   228 bits (581),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 144/211 (68%), Gaps = 4/211 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LL WP+EE+  LR+       V ++PG    + +  A QLDI A FE+ N+EAV+   E 
Sbjct  409  LLVWPVEELDALRTSGKEFNGVVVEPGSTYHLDVGTATQLDIEAEFEI-NKEAVDAVVEA  467

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNCS+S GA  RG LGPFGL+V A+E + E T  YFYV +  DG ++THFC D  RS
Sbjct  468  DVTYNCSTSDGAAHRGLLGPFGLLVLANEKMTEKTATYFYVSRNVDGGLQTHFCQDELRS  527

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A+ +TK V G TVPV+  E +S RILVDHSIVESF Q GR V TSR+YPT+AIY++ R
Sbjct  528  SKANDITKRVVGHTVPVLHGETFSLRILVDHSIVESFAQKGRAVATSRVYPTEAIYDSTR  587

Query  285  VFLFNNATGTSVKA-SVKIWQMNSADIKPFP  196
            VFLFNNAT  +V A SVKIW MNS    PFP
Sbjct  588  VFLFNNATSATVTAKSVKIWHMNSTHNHPFP  618



>emb|CDY39805.1| BnaA09g10570D [Brassica napus]
Length=606

 Score =   228 bits (580),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 150/216 (69%), Gaps = 13/216 (6%)
 Frame = -1

Query  819  LLQWPIEEVKRLR-SGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--------  667
            L+QWP+EEVK LR S      KV  +P  ++ + + + AQLDI A FE+  E        
Sbjct  383  LVQWPVEEVKSLRLSSKKFDMKV--KPETVVQVDVSSTAQLDIEAEFEINKEDLKKITGD  440

Query  666  EAVEGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHF  487
            E+VE E DF  +C +SGG+   GALGPFG  V  DE+L+E T VYFYV KG D K++T F
Sbjct  441  ESVEAEEDF--SCETSGGSTVSGALGPFGFSVLTDESLSEQTTVYFYVTKGKDSKLKTFF  498

Query  486  CTDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTK  307
            CTD  RS+ A+ V K VYGS VPV+ +EK + RILVDHSI+E FGQGGRT ITSR+YPT+
Sbjct  499  CTDTLRSTMANDVVKSVYGSFVPVLKEEKLTMRILVDHSIIEGFGQGGRTCITSRVYPTE  558

Query  306  AIYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            A Y AA++FLFNNA   ++ AS ++WQMNSA I+P+
Sbjct  559  ATYGAAKLFLFNNAFNATITASFEVWQMNSAFIRPY  594



>gb|ABG00265.1| sucrose:sucrose 1-fructosyltransferase [Agave tequilana]
Length=621

 Score =   228 bits (581),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 145/211 (69%), Gaps = 4/211 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            L+ WP+EEV+ LR+ +     + L PG    + +  A QLDI+A FEV +E+A+E   E 
Sbjct  407  LILWPVEEVESLRTINKNFNSIPLYPGSTYQLDVGEATQLDIVAEFEV-DEKAIEATAEA  465

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNCS+SGGA  RG LGPFGL+V A++ L+E T  YFYV +G DG + THFC D  RS
Sbjct  466  DVTYNCSTSGGAANRGVLGPFGLLVLANQELSEQTATYFYVSRGIDGNLRTHFCQDELRS  525

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A  +TK V GSTVPV+  E ++ RILVDHSIVESF Q GR V TSR+YPT+AIY +AR
Sbjct  526  SKAGAITKRVVGSTVPVLHGETWALRILVDHSIVESFAQRGRAVATSRVYPTEAIYSSAR  585

Query  285  VFLFNNATGTSVKA-SVKIWQMNSADIKPFP  196
            VFLFNNAT   V A +V +W MNS     FP
Sbjct  586  VFLFNNATDAIVTAKTVNVWHMNSTYNHVFP  616



>ref|XP_006300852.1| hypothetical protein CARUB_v10019944mg [Capsella rubella]
 gb|EOA33750.1| hypothetical protein CARUB_v10019944mg [Capsella rubella]
Length=640

 Score =   228 bits (581),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 147/214 (69%), Gaps = 8/214 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGD-  643
            L+ WP+EE++ LR        + + PG ++P+ + +A+QLDI A F +M ++     GD 
Sbjct  423  LILWPVEEIESLRLNSKKY-HMTVGPGTVIPVDVGSASQLDIEAEFTIMKDDLEIILGDD  481

Query  642  ------FRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCT  481
                    Y+C ++GG+  RGALGPFG  V AD+TL+E TPVYFYV KG D K++T FCT
Sbjct  482  PVVADGKDYSCETNGGSTVRGALGPFGFSVLADQTLSEHTPVYFYVTKGKDSKLKTFFCT  541

Query  480  DLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAI  301
            D  RSS A+ V K VYGS VPV+  EK + RILVDHSI+E FGQGGRT ITSR YPTKAI
Sbjct  542  DNLRSSMANDVVKSVYGSLVPVLKGEKLTMRILVDHSIIEGFGQGGRTCITSRAYPTKAI  601

Query  300  YEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            Y A ++FLFNNA   +V AS K+WQMNSA I P+
Sbjct  602  YGATKLFLFNNAIDANVTASFKVWQMNSAFIHPY  635



>dbj|BAM66575.1| sucrose:sucrose 1-fructosyltransferase [Asparagus officinalis]
Length=628

 Score =   228 bits (580),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 143/211 (68%), Gaps = 4/211 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            L+ WP+EEV+ LR+   I   + +  G  + + I AA+QLDI A FE+ N  A++G  E 
Sbjct  411  LIIWPVEEVEDLRTDGNIFNDIKIGAGSSVQLDIGAASQLDIEAEFELDNS-ALDGAIEA  469

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNCS+SGGA  RG LGPFGL+V A++ L E T  YFYV +G DG + THFC D  RS
Sbjct  470  DVTYNCSTSGGAANRGLLGPFGLLVLANQDLTEQTATYFYVSRGTDGDLRTHFCQDELRS  529

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A  + K V GS VPV+  E +S RILVDHSI+ESF Q GR V TSR+YPT+AIY  AR
Sbjct  530  SKAGDIVKRVVGSVVPVLHGETWSLRILVDHSIIESFAQRGRAVATSRVYPTEAIYNKAR  589

Query  285  VFLFNNATGTSVKA-SVKIWQMNSADIKPFP  196
            +FLFNNAT   V A SVKIW MNS    PFP
Sbjct  590  LFLFNNATDAKVTAKSVKIWHMNSTHNHPFP  620



>emb|CAA66238.1| invertase 6 [Tulipa gesneriana]
Length=625

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 147/212 (69%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LL WP+EEV+RLR        +++  G ++P+ I  A QLDI+A FE+ +   +E   E 
Sbjct  413  LLLWPVEEVERLRFNRQDFENIDIGIGAVVPLDIGRAIQLDIVAEFEI-DGATLEASVEA  471

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNCS+SGG   RG LGPFG +V +DE L+E T +YFYV +  DG ++T FC D  RS
Sbjct  472  DLGYNCSTSGGTFGRGVLGPFGFLVLSDEDLSEQTAIYFYVGRKVDGALQTFFCQDELRS  531

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A+ + K V+GS VPV+  E  + RIL+DHSIVESF QGGRT ITSRIYPTKA   AAR
Sbjct  532  SKANDLVKRVFGSIVPVLHGEILTMRILLDHSIVESFAQGGRTCITSRIYPTKAFDGAAR  591

Query  285  VFLFNNATGTSVKA-SVKIWQMNSADIKPFPF  193
            VF+FNNATG  V A S+KIWQM SA I P+PF
Sbjct  592  VFVFNNATGAKVTAKSIKIWQMKSASITPYPF  623



>ref|NP_563901.1| acid beta-fructofuranosidase 4 [Arabidopsis thaliana]
 sp|Q39041.2|INVA4_ARATH RecName: Full=Acid beta-fructofuranosidase 4, vacuolar; Short=At 
beta fruct4; Short=AtBETAFRUCT4; AltName: Full=Acid invertase 
4; Short=AI 4; AltName: Full=Acid sucrose hydrolase 4; 
AltName: Full=Vacuolar invertase 4; Short=Inv-V4; Short=VAC-INV 
4; Short=VI 4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG12569.1|AC022522_2 beta-fructosidase [Arabidopsis thaliana]
 emb|CAA72321.1| beta-fructosidase [Arabidopsis thaliana]
 gb|AAK76683.1| putative beta-fructosidase [Arabidopsis thaliana]
 gb|AAN13204.1| putative beta-fructosidase [Arabidopsis thaliana]
 gb|AEE28855.1| acid beta-fructofuranosidase 4 [Arabidopsis thaliana]
Length=664

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 149/215 (69%), Gaps = 10/215 (5%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEE--------  664
            L+QWP+EE+K LR        + + PG ++P+ + +AAQLDI A FE+  E         
Sbjct  441  LVQWPVEEIKSLRLSSKQF-DLEVGPGSVVPVDVGSAAQLDIEAEFEINKESLDKIIGNA  499

Query  663  AVEGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            +V  E +  ++C  SGG+  RGALGPFG  V A E+L+E TPVYFYV KG D +++T FC
Sbjct  500  SVVAEAE-EFSCEKSGGSTVRGALGPFGFSVLATESLSEQTPVYFYVAKGKDSELKTFFC  558

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD +RSS A+ V K +YGS VPV+  EK + RILVDHSIVE+FGQGGRT ITSR+YPT A
Sbjct  559  TDTSRSSVANDVVKPIYGSVVPVLKGEKLTMRILVDHSIVEAFGQGGRTCITSRVYPTTA  618

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            IY AA++FLFNNA   +V AS  +WQMNSA I P+
Sbjct  619  IYGAAKLFLFNNALDATVTASFTVWQMNSAFIHPY  653



>gb|AAZ85379.1| vacuolar invertase [Solanum ochranthum]
Length=370

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 135/165 (82%), Gaps = 4/165 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LLQWP+EE++ LR+GDPIV +VNLQPG I  +H+ +AA+LDI ASFEV ++  ++G  E 
Sbjct  207  LLQWPVEEIESLRAGDPIVKQVNLQPGSIELLHVDSAAELDIEASFEV-DKVTLQGIIEA  265

Query  645  DF-RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTR  469
            D   ++CS+SGGA  RG LGPFG+VV AD+TL+ELTPVYFY+ KG DG+ ETHFC D TR
Sbjct  266  DHVGFSCSTSGGAASRGILGPFGVVVIADQTLSELTPVYFYISKGADGRAETHFCADQTR  325

Query  468  SSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTV  334
            SSEA GV K+VYGS+VPV+D EK+S R+LVDHSIVESF QGGRTV
Sbjct  326  SSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTV  370



>gb|AFJ21579.1| fructan:fructan 6G-fructosyltransferase [Agave tequilana]
Length=622

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 141/204 (69%), Gaps = 4/204 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LL WPI+EV+ LR        + ++ G    + +P A Q+DI A F+V N+E +E   E 
Sbjct  406  LLTWPIKEVETLRMTSTNFCDITVEKGTTFELIVPDANQIDIEAEFQV-NKEELEAAIEA  464

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNCS+SGGA  RG LGPFGL+V A+E L+E T  YFYV +G DG + TH C D  RS
Sbjct  465  DIGYNCSTSGGATNRGQLGPFGLLVLANEDLSEQTATYFYVSRGTDGSLHTHLCQDEMRS  524

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A  + K V G T  V+D E  S RILVDHSIVESF QGGRT  TSR+YPT+AIYEAAR
Sbjct  525  SKAHNIVKRVVGGTFAVLDGELLSLRILVDHSIVESFAQGGRTSTTSRVYPTEAIYEAAR  584

Query  285  VFLFNNATGTSVKA-SVKIWQMNS  217
            VFLFNNATG +V A SVKIWQMNS
Sbjct  585  VFLFNNATGVTVTAKSVKIWQMNS  608



>emb|CAA66330.1| beta-fructosidase [Arabidopsis thaliana]
Length=660

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 149/215 (69%), Gaps = 10/215 (5%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEE--------  664
            L+QWP+EE+K LR        + + PG ++P+ + +AAQLDI A FE+  E         
Sbjct  437  LVQWPVEEIKSLRLSSKQF-DLEVGPGSVVPVDVGSAAQLDIEAEFEINKESLDKIIGNA  495

Query  663  AVEGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            +V  E +  ++C  SGG+  RGALGPFG  V A E+L+E TPVYFYV KG D +++T FC
Sbjct  496  SVVAEAE-EFSCEKSGGSTVRGALGPFGFSVLATESLSEQTPVYFYVAKGKDSELKTFFC  554

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
            TD +RSS A+ V K +YGS VPV+  EK + RILVDHSIVE+FGQGGRT ITSR+YPT A
Sbjct  555  TDTSRSSVANDVVKPIYGSVVPVLKGEKLTMRILVDHSIVEAFGQGGRTCITSRVYPTTA  614

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            IY AA++FLFNNA   +V AS  +WQMNSA I P+
Sbjct  615  IYGAAKLFLFNNALDATVTASFTVWQMNSAFIHPY  649



>emb|CAA64953.1| invertase [Tulipa gesneriana]
Length=628

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 146/212 (69%), Gaps = 4/212 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LL WP+EEV+RLR        +++  G ++P+ I  A QLDI+A FE+ +   +E   E 
Sbjct  416  LLLWPVEEVERLRFNRQDFENIDIGIGAVVPLDIGRAIQLDIVAEFEI-DGATLEASVEA  474

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNCS+SGG   RG LGPFG +V +DE L+E T +YFYV +  DG ++T FC D  RS
Sbjct  475  DLGYNCSTSGGTFGRGVLGPFGFLVLSDEDLSEQTAIYFYVGRKVDGALQTFFCQDELRS  534

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A  + K V+GS VPV+  E  + RIL+DHSIVESF QGGRT ITSRIYPTKA   AAR
Sbjct  535  SKADDLVKRVFGSIVPVLHGEILTMRILLDHSIVESFAQGGRTCITSRIYPTKAFDGAAR  594

Query  285  VFLFNNATGTSVKA-SVKIWQMNSADIKPFPF  193
            VF+FNNATG  V A S+KIWQM SA I P+PF
Sbjct  595  VFVFNNATGAKVTAKSIKIWQMKSASISPYPF  626



>ref|XP_002889923.1| beta-fructosidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66182.1| beta-fructosidase [Arabidopsis lyrata subsp. lyrata]
Length=663

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 149/215 (69%), Gaps = 10/215 (5%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEE--------  664
            L+QWP+EE+K LR        + + PG ++P+ + +AAQLDI A FE+  E         
Sbjct  440  LVQWPVEEIKSLRLSSKQF-DIKVGPGSVVPVDVGSAAQLDIEAEFEINKESLDKILGNA  498

Query  663  AVEGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFC  484
            +V  E +  ++C  SGG+  RGALGPFG  V A E+L+E TPVYFYV KG D +++T FC
Sbjct  499  SVMAEAE-EFSCEKSGGSTVRGALGPFGFSVLATESLSEQTPVYFYVAKGKDSELKTFFC  557

Query  483  TDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKA  304
             D +RSS A+ V K +YGS VPV+  EK + RILVDHSIVE+FGQGGRT ITSR+YPT A
Sbjct  558  IDTSRSSVANDVVKLIYGSVVPVLKGEKLTMRILVDHSIVEAFGQGGRTCITSRVYPTSA  617

Query  303  IYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            IY AA++FLFNNA   ++ AS ++WQMNSA I P+
Sbjct  618  IYGAAKLFLFNNALDATITASFRVWQMNSAFIHPY  652



>gb|AFJ21573.1| fructan:fructan 6G-fructosyltransferase [Agave tequilana]
Length=622

 Score =   226 bits (576),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 141/204 (69%), Gaps = 4/204 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            LL WPI+EV+ LR        + ++ G    + +P A Q+DI A F+V N+E +E   E 
Sbjct  406  LLTWPIKEVETLRMTSTNFCDITVEKGTTFELIVPDANQIDIEAEFQV-NKEELEAAIEA  464

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNCS+SGGA  RG LGPFGL+V A+E L+E T  YFYV +G DG + TH C D  RS
Sbjct  465  DIGYNCSTSGGATNRGQLGPFGLLVLANEDLSEQTATYFYVSRGTDGSLHTHLCQDEMRS  524

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A  + K V G T  V+D E  S RILVDHSIVESF QGGRT  TSR+YPT+AIY+AAR
Sbjct  525  SKAHNIVKRVVGGTFAVLDGELLSLRILVDHSIVESFAQGGRTSTTSRVYPTEAIYDAAR  584

Query  285  VFLFNNATGTSVKA-SVKIWQMNS  217
            VFLFNNATG +V A SVKIWQMNS
Sbjct  585  VFLFNNATGVTVTAKSVKIWQMNS  608



>gb|AFJ21570.1| sucrose:sucrose 1-fructosyltransferase [Agave tequilana]
Length=621

 Score =   226 bits (575),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 145/211 (69%), Gaps = 4/211 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            L+ WP+EEV+ LR+ +     + L PG    + +  A QLDI+A FEV +E+A+E   E 
Sbjct  407  LILWPVEEVESLRTINKNFNSIPLYPGSTYQLDVGEATQLDIVAEFEV-DEKAIEATAEA  465

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNCS+SGGA  RG LGPFGL+V A++ L+E T  YFYV +G DG + THFC D  RS
Sbjct  466  DVTYNCSTSGGAANRGVLGPFGLLVLANQELSEQTATYFYVSRGIDGNLRTHFCQDELRS  525

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A  +TK V GSTVPV+  E ++ RILVDHSIVESF Q GR V TSR+YPT+AIY +AR
Sbjct  526  SKAGAITKRVVGSTVPVLHGETWALRILVDHSIVESFAQRGRAVATSRVYPTEAIYSSAR  585

Query  285  VFLFNNATGTSVKA-SVKIWQMNSADIKPFP  196
            VFLFNNAT   V A +V +W +NS     FP
Sbjct  586  VFLFNNATDAIVTAKTVNVWHINSTYNHVFP  616



>ref|XP_004307805.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Fragaria vesca subsp. vesca]
Length=644

 Score =   226 bits (576),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 148/209 (71%), Gaps = 4/209 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGEGDF  640
            L+QWP+EE++ LR      + V ++ G ++ + I  A QLDI   FE+   E++ G    
Sbjct  436  LIQWPVEEIEELRLNSTDFSDVLVEAGAVVELDIGTATQLDIFVEFEI---ESL-GSETL  491

Query  639  RYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRSSE  460
              +    GGA  R + GPFG++V ADE L+ELTP+YF +    +G V T+FC D  RSS+
Sbjct  492  NSSVGCGGGATDRTSFGPFGILVIADEILSELTPIYFNIANSTEGDVTTYFCADERRSSK  551

Query  459  ASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAARVF  280
            A  V K+VYGS VPV++ EK+ AR+LVDHSIVESF QGGRTVITSRIYPT+AIY AA++F
Sbjct  552  APDVFKQVYGSEVPVLEGEKHFARVLVDHSIVESFAQGGRTVITSRIYPTEAIYGAAKLF  611

Query  279  LFNNATGTSVKASVKIWQMNSADIKPFPF  193
            LFNNATG +VKA++KIWQ+NSA I PFP 
Sbjct  612  LFNNATGLNVKATLKIWQLNSAFIHPFPL  640



>gb|AFJ21576.1| sucrose:sucrose 1-fructosyltransferase [Agave tequilana]
Length=621

 Score =   225 bits (574),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 145/211 (69%), Gaps = 4/211 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEG--EG  646
            L+ WP+EEV+ LR+ +     + L PG    + +  A QLDI+A FEV +E+A+E   E 
Sbjct  407  LILWPVEEVESLRTINKNFNSIPLYPGSTYQLDVGEATQLDIVAEFEV-DEKAIEATAEA  465

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            D  YNCS+SGGA  RG LGPFGL+V A++ L+E T  YFYV +G DG + THFC D  RS
Sbjct  466  DVTYNCSTSGGAANRGVLGPFGLLVLANQELSEQTATYFYVSRGIDGNLRTHFCQDELRS  525

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+A  +TK V GSTVPV+  E ++ RILVDHSIVESF Q GR V TSR+YPT+AIY +AR
Sbjct  526  SKAGAITKRVVGSTVPVLHGETWALRILVDHSIVESFAQRGRAVATSRVYPTEAIYSSAR  585

Query  285  VFLFNNATGTSVKA-SVKIWQMNSADIKPFP  196
            VFLFNNAT   V A +V +W +NS     FP
Sbjct  586  VFLFNNATDAIVTAKTVNVWHINSTYNHVFP  616



>emb|CDY03264.1| BnaC09g10840D [Brassica napus]
Length=606

 Score =   225 bits (573),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 150/216 (69%), Gaps = 13/216 (6%)
 Frame = -1

Query  819  LLQWPIEEVKRLR-SGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--------  667
            LLQWP+EEVK LR S      KV  +P  ++ + + + AQLDI A FE+  E        
Sbjct  383  LLQWPVEEVKSLRLSSKKFDMKV--KPETVVQVDVSSTAQLDIEAEFEINKEDLKKITGD  440

Query  666  EAVEGEGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHF  487
            E+VE E DF  +C +SGG+   GALGPFG  V  DE+L+E T VYFYV KG + +++T F
Sbjct  441  ESVEAEEDF--SCETSGGSTVSGALGPFGFSVLTDESLSEQTTVYFYVTKGKNSELKTFF  498

Query  486  CTDLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTK  307
            CTD  RS+ A+ V K VYGS VPV+ +EK + RILVDHSI+E FGQGGRT ITSR+YPT+
Sbjct  499  CTDTLRSTMANDVVKSVYGSFVPVLKEEKLTMRILVDHSIIEGFGQGGRTCITSRVYPTE  558

Query  306  AIYEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            A Y AA++FLFNNA   ++ AS ++WQMNSA I+P+
Sbjct  559  ATYGAAKLFLFNNAFNATITASFEVWQMNSAFIRPY  594



>ref|XP_010062212.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Eucalyptus grandis]
 gb|KCW90831.1| hypothetical protein EUGRSUZ_A02888 [Eucalyptus grandis]
Length=654

 Score =   226 bits (575),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 153/211 (73%), Gaps = 5/211 (2%)
 Frame = -1

Query  819  LLQWPIEEVKRLRSGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNEEAVEGE--G  646
            +L+WP+EEV+ LR        + ++ G ++ ++I +A QLDI   FE+   +A+E     
Sbjct  436  ILEWPVEEVESLRLDSTEFDDILVEAGSVVALNISSATQLDISVEFEIEGSDALEALEVP  495

Query  645  DFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCTDLTRS  466
            +    C+++     R  LGPFGL+V ADE+L+ELTP+YF++ K  +G + T FC D TRS
Sbjct  496  EAIIECATTQ---NRSTLGPFGLLVLADESLSELTPIYFHIAKSTNGSLTTLFCADETRS  552

Query  465  SEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAIYEAAR  286
            S+AS + K+VYG  VPV++DEK++ R+LVDHSI+ESF QGGRTVITSR+YPT+AIY AA+
Sbjct  553  SKASEIFKKVYGGPVPVLNDEKFTMRLLVDHSIIESFAQGGRTVITSRVYPTEAIYGAAK  612

Query  285  VFLFNNATGTSVKASVKIWQMNSADIKPFPF  193
            +FLFNNATG +V AS++IWQMNSA I PFP 
Sbjct  613  LFLFNNATGVNVTASLEIWQMNSAFIHPFPL  643



>ref|XP_006391837.1| hypothetical protein EUTSA_v10023331mg [Eutrema salsugineum]
 gb|ESQ29123.1| hypothetical protein EUTSA_v10023331mg [Eutrema salsugineum]
Length=655

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 150/214 (70%), Gaps = 9/214 (4%)
 Frame = -1

Query  819  LLQWPIEEVKRLR-SGDPIVTKVNLQPGEILPIHIPAAAQLDIIASFEVMNE--EAVEG-  652
            L+QWP++E++ LR S      KV  +PG ++P+ +  AAQLDI A F++  +  E + G 
Sbjct  433  LVQWPVKEIESLRLSSKKFHMKV--EPGTVVPVDVGPAAQLDIEAEFKIKKDDLEVILGD  490

Query  651  ---EGDFRYNCSSSGGAVKRGALGPFGLVVAADETLAELTPVYFYVQKGGDGKVETHFCT  481
               E D  ++C +SG +  RGALGPFG  V AD++L+E TPVYFYV KG D K+    CT
Sbjct  491  DSVEDDKEFSCQTSGLSTVRGALGPFGFSVLADQSLSEQTPVYFYVTKGKDSKLRAFLCT  550

Query  480  DLTRSSEASGVTKEVYGSTVPVIDDEKYSARILVDHSIVESFGQGGRTVITSRIYPTKAI  301
            D +RS++A+ V K VYGS VPV+  EK + RILVDHSIVE+FGQGGRT ITSR+YPTKAI
Sbjct  551  DTSRSTKANDVVKPVYGSFVPVLKGEKLTMRILVDHSIVEAFGQGGRTCITSRVYPTKAI  610

Query  300  YEAARVFLFNNATGTSVKASVKIWQMNSADIKPF  199
            Y A ++FLFNNA   +V  S K+WQMNSA I P+
Sbjct  611  YGATKLFLFNNAIDATVTVSFKVWQMNSAFIHPY  644



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1867489308488