BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8243

Length=799
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011080124.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    369   5e-123   Sesamum indicum [beniseed]
ref|XP_007050148.1|  NAD(P)-binding Rossmann-fold superfamily pro...    359   1e-120   
gb|KJB42336.1|  hypothetical protein B456_007G150200                    360   1e-120   Gossypium raimondii
gb|KHG08643.1|  hypothetical protein F383_12346                         361   1e-120   Gossypium arboreum [tree cotton]
gb|KJB42339.1|  hypothetical protein B456_007G150200                    360   2e-120   Gossypium raimondii
emb|CDP03802.1|  unnamed protein product                                362   2e-120   Coffea canephora [robusta coffee]
gb|KJB42335.1|  hypothetical protein B456_007G150200                    361   4e-120   Gossypium raimondii
ref|XP_007050147.1|  NAD(P)-binding Rossmann-fold superfamily pro...    360   1e-119   
ref|XP_007050145.1|  NAD(P)-binding Rossmann-fold superfamily pro...    360   2e-119   
ref|XP_010264829.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    359   2e-119   Nelumbo nucifera [Indian lotus]
ref|XP_007144408.1|  hypothetical protein PHAVU_007G153700g             359   2e-119   Phaseolus vulgaris [French bean]
gb|ACJ84721.1|  unknown                                                 358   6e-119   Medicago truncatula
ref|XP_003542442.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    358   8e-119   Glycine max [soybeans]
ref|XP_010548735.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    357   2e-118   Tarenaya hassleriana [spider flower]
gb|AFK48198.1|  unknown                                                 356   4e-118   Lotus japonicus
ref|XP_010936110.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    355   6e-118   Elaeis guineensis
ref|XP_010540921.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    355   9e-118   Tarenaya hassleriana [spider flower]
ref|XP_002271401.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    355   1e-117   Vitis vinifera
ref|XP_009395307.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    355   1e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004247128.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    354   2e-117   
ref|XP_011024495.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    354   3e-117   Populus euphratica
ref|XP_006355892.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    353   5e-117   Solanum tuberosum [potatoes]
gb|ABK94679.1|  unknown                                                 352   1e-116   Populus trichocarpa [western balsam poplar]
gb|ACU23211.1|  unknown                                                 352   1e-116   Glycine max [soybeans]
ref|XP_004495054.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    352   1e-116   Cicer arietinum [garbanzo]
ref|XP_002301843.1|  hypothetical protein POPTR_0002s25720g             352   1e-116   Populus trichocarpa [western balsam poplar]
ref|XP_008459972.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    352   2e-116   Cucumis melo [Oriental melon]
gb|EYU46388.1|  hypothetical protein MIMGU_mgv1a007681mg                352   2e-116   Erythranthe guttata [common monkey flower]
ref|XP_007201067.1|  hypothetical protein PRUPE_ppa006705mg             351   3e-116   
ref|XP_011656761.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    350   1e-115   Cucumis sativus [cucumbers]
ref|XP_008372401.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    349   2e-115   Malus domestica [apple tree]
gb|EPS69627.1|  hypothetical protein M569_05135                         348   2e-115   Genlisea aurea
ref|XP_009335235.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    348   6e-115   Pyrus x bretschneideri [bai li]
ref|XP_010036149.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    347   8e-115   Eucalyptus grandis [rose gum]
ref|XP_008382707.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    345   3e-113   
ref|XP_009370595.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    343   4e-113   Pyrus x bretschneideri [bai li]
dbj|BAG95473.1|  unnamed protein product                                340   5e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004954373.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    343   5e-113   Setaria italica
ref|XP_006648113.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    340   2e-112   
ref|XP_006854436.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    341   2e-112   Amborella trichopoda
ref|NP_001048516.1|  Os02g0816800                                       341   5e-112   
gb|EEC74241.1|  hypothetical protein OsI_09443                          341   5e-112   Oryza sativa Indica Group [Indian rice]
ref|XP_002453037.1|  hypothetical protein SORBIDRAFT_04g037200          340   8e-112   Sorghum bicolor [broomcorn]
ref|XP_011458045.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    340   9e-112   Fragaria vesca subsp. vesca
ref|XP_012085214.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    340   1e-111   Jatropha curcas
gb|ACF85773.1|  unknown                                                 339   3e-111   Zea mays [maize]
ref|XP_009370589.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    338   6e-111   Pyrus x bretschneideri [bai li]
ref|XP_010940664.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    337   9e-111   
ref|XP_009586626.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    337   2e-110   Nicotiana tomentosiformis
gb|AFW74028.1|  NADH-ubiquinone oxidoreductase subunit                  338   3e-110   
ref|XP_003570393.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    336   4e-110   
ref|NP_001149069.1|  LOC100282690                                       335   6e-110   
ref|XP_008789505.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    335   7e-110   Phoenix dactylifera
ref|XP_002526534.1|  NADH-ubiquinone oxidoreductase 39 kD subunit...    332   1e-108   
gb|EMT17104.1|  putative NADH dehydrogenase (ubiquinone) 1 alpha ...    326   2e-107   
gb|EMS47161.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    326   2e-107   Triticum urartu
dbj|BAH20309.1|  AT2G20360                                              324   1e-106   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ86608.1|  predicted protein                                      327   1e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_565469.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomp...    326   3e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010489051.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    324   1e-105   Camelina sativa [gold-of-pleasure]
ref|XP_010415893.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    323   2e-105   Camelina sativa [gold-of-pleasure]
ref|XP_002884196.1|  catalytic/ coenzyme binding protein                323   4e-105   Arabidopsis lyrata subsp. lyrata
ref|XP_010467837.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    322   8e-105   Camelina sativa [gold-of-pleasure]
emb|CDY13877.1|  BnaA09g43790D                                          321   3e-104   Brassica napus [oilseed rape]
emb|CDX81965.1|  BnaC08g36360D                                          320   6e-104   
gb|KJB42340.1|  hypothetical protein B456_007G150200                    319   8e-104   Gossypium raimondii
emb|CDY31970.1|  BnaA07g00250D                                          319   9e-104   Brassica napus [oilseed rape]
emb|CDY39772.1|  BnaA09g10240D                                          318   2e-103   Brassica napus [oilseed rape]
ref|XP_009112664.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    318   2e-103   Brassica rapa
ref|XP_009117495.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    317   5e-103   Brassica rapa
ref|XP_010091822.1|  hypothetical protein L484_015891                   316   2e-102   Morus notabilis
emb|CDY05746.1|  BnaC07g00570D                                          315   4e-102   
ref|XP_010684864.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    314   1e-101   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006408954.1|  hypothetical protein EUTSA_v10002002mg             313   2e-101   Eutrema salsugineum [saltwater cress]
ref|XP_006443722.1|  hypothetical protein CICLE_v10020464mg             313   2e-101   
emb|CDY03308.1|  BnaC09g10400D                                          313   3e-101   
ref|XP_002321296.2|  hypothetical protein POPTR_0014s18680g             312   4e-101   
ref|XP_009102039.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    312   8e-101   Brassica rapa
ref|XP_008235764.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    307   4e-99    Prunus mume [ume]
gb|KFK40412.1|  hypothetical protein AALP_AA3G370500                    298   2e-95    Arabis alpina [alpine rockcress]
gb|KDO37085.1|  hypothetical protein CISIN_1g047628mg                   291   7e-94    Citrus sinensis [apfelsine]
gb|ABK24353.1|  unknown                                                 285   2e-90    Picea sitchensis
gb|KJB42337.1|  hypothetical protein B456_007G150200                    273   4e-86    Gossypium raimondii
gb|KJB42338.1|  hypothetical protein B456_007G150200                    273   6e-86    Gossypium raimondii
gb|EEE58042.1|  hypothetical protein OsJ_08874                          250   5e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009763970.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    191   5e-55    Nicotiana sylvestris
ref|XP_001765756.1|  predicted protein                                  189   4e-53    
ref|XP_002976090.1|  hypothetical protein SELMODRAFT_104564             183   1e-51    
ref|XP_002968287.1|  hypothetical protein SELMODRAFT_89106              183   3e-51    
ref|XP_001757609.1|  predicted protein                                  179   1e-49    
ref|XP_005651289.1|  NAD(P)-binding protein                             168   1e-45    Coccomyxa subellipsoidea C-169
gb|EEC74184.1|  hypothetical protein OsI_09314                          164   4e-44    Oryza sativa Indica Group [Indian rice]
emb|CEF99374.1|  NAD(P)-binding domain                                  155   1e-40    Ostreococcus tauri
ref|XP_009803384.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    148   2e-40    Nicotiana sylvestris
ref|XP_001420142.1|  predicted protein                                  152   2e-39    Ostreococcus lucimarinus CCE9901
ref|XP_006296717.1|  hypothetical protein CARUB_v10014190mg             147   5e-38    
ref|XP_003059930.1|  predicted protein                                  147   1e-37    Micromonas pusilla CCMP1545
ref|WP_026986147.1|  3-beta hydroxysteroid dehydrogenase                143   8e-37    Fodinicurvata fenggangensis
ref|XP_002504449.1|  predicted protein                                  144   2e-36    Micromonas commoda
ref|XP_007510295.1|  predicted protein                                  144   3e-36    Bathycoccus prasinos
ref|WP_022729668.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      142   3e-36    Fodinicurvata sediminis
gb|KJB42341.1|  hypothetical protein B456_007G150200                    138   8e-35    Gossypium raimondii
ref|XP_005850526.1|  hypothetical protein CHLNCDRAFT_34039              139   2e-34    Chlorella variabilis
ref|WP_045446206.1|  3-beta hydroxysteroid dehydrogenase                135   1e-33    Tepidicaulis marinus
ref|WP_024512948.1|  3-beta hydroxysteroid dehydrogenase                134   3e-33    Bradyrhizobium sp. ARR65
ref|WP_027287982.1|  3-beta hydroxysteroid dehydrogenase                134   3e-33    Rhodovibrio salinarum
ref|WP_029621248.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    132   1e-32    Rhizobium/Agrobacterium group
ref|WP_036555293.1|  3-beta hydroxysteroid dehydrogenase                131   3e-32    Nisaea denitrificans
gb|EKE10168.1|  NADH dehydrogenase (Ubiquinone) 1 alpha subcomple...    131   3e-32    uncultured bacterium
ref|WP_038036038.1|  3-beta hydroxysteroid dehydrogenase                130   4e-32    
ref|WP_045581478.1|  3-beta hydroxysteroid dehydrogenase                130   6e-32    Azospirillum thiophilum
ref|WP_035694954.1|  3-beta hydroxysteroid dehydrogenase                130   1e-31    Aurantimonas coralicida
ref|WP_029585516.1|  3-beta hydroxysteroid dehydrogenase                129   1e-31    Bradyrhizobium sp. URHD0069
ref|WP_041345268.1|  3-beta hydroxysteroid dehydrogenase                129   1e-31    Nitrobacter winogradskyi
ref|WP_040326025.1|  3-beta hydroxysteroid dehydrogenase                129   2e-31    
ref|WP_035569694.1|  3-beta hydroxysteroid dehydrogenase                129   2e-31    Hyphomonas adhaerens
ref|WP_024514903.1|  3-beta hydroxysteroid dehydrogenase                129   2e-31    Bradyrhizobium sp. Tv2a-2
gb|EAS48786.1|  NADH-ubiquinone oxidoreductase                          129   3e-31    Aurantimonas manganoxydans SI85-9A1
gb|ABA03434.1|  NAD-dependent epimerase/dehydratase                     129   3e-31    Nitrobacter winogradskyi Nb-255
ref|WP_041768854.1|  3-beta hydroxysteroid dehydrogenase                128   5e-31    
ref|WP_041801299.1|  3-beta hydroxysteroid dehydrogenase                128   5e-31    Rhodopseudomonas palustris
gb|AEV35208.1|  NADH dehydrogenase (ubiquinone)                         128   5e-31    Pseudovibrio sp. FO-BEG1
ref|WP_035693857.1|  3-beta hydroxysteroid dehydrogenase                127   7e-31    
sp|Q0DWQ7.1|CCB12_ORYSJ  RecName: Full=Cyclin-B1-2; AltName: Full...    129   7e-31    Oryza sativa Japonica Group [Japonica rice]
gb|ABD86012.1|  NAD-dependent epimerase/dehydratase                     128   7e-31    Rhodopseudomonas palustris BisB18
gb|EEA95143.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomple...    127   9e-31    Pseudovibrio sp. JE062
ref|WP_027845124.1|  3-beta hydroxysteroid dehydrogenase                127   1e-30    
ref|WP_011661958.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      127   1e-30    Rhodopseudomonas palustris
ref|WP_037036496.1|  3-beta hydroxysteroid dehydrogenase                127   1e-30    
ref|WP_038279873.1|  3-beta hydroxysteroid dehydrogenase                127   1e-30    alpha proteobacterium Mf 1.05b.01
ref|WP_039195170.1|  3-beta hydroxysteroid dehydrogenase                127   1e-30    Aureimonas altamirensis
ref|WP_014249039.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      125   3e-30    Azospirillum lipoferum
ref|WP_020043898.1|  hypothetical protein                               125   4e-30    
ref|WP_008943960.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      125   4e-30    Oceanibaculum indicum
emb|CCF21999.1|  putative NADH dehydrogenase/NADH dehydrogenase (...    125   4e-30    Rhizobium sp. NT-26
ref|WP_043948096.1|  3-beta hydroxysteroid dehydrogenase                125   6e-30    Candidatus Phaeomarinobacter ectocarpi
ref|WP_023512751.1|  putative nucleoside-diphosphate-sugar epimerase    125   8e-30    Shinella sp. DD12
ref|WP_042689500.1|  3-beta hydroxysteroid dehydrogenase                125   8e-30    Azospirillum sp. B506
ref|XP_011401632.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    125   1e-29    Auxenochlorella protothecoides
ref|WP_020042805.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      124   1e-29    Salipiger mucosus
ref|WP_009449172.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      124   2e-29    Nitratireductor indicus
ref|WP_011508790.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      124   2e-29    Nitrobacter hamburgensis
ref|WP_039540296.1|  3-beta hydroxysteroid dehydrogenase                124   2e-29    Ruegeria sp. ANG-R
ref|WP_038592623.1|  3-beta hydroxysteroid dehydrogenase                123   2e-29    Neorhizobium galegae
ref|WP_028793393.1|  3-beta hydroxysteroid dehydrogenase                123   3e-29    Thalassobaculum salexigens
ref|WP_044427727.1|  3-beta hydroxysteroid dehydrogenase                123   3e-29    Skermanella aerolata
ref|WP_027297804.1|  3-beta hydroxysteroid dehydrogenase                122   4e-29    Rhodospirillales bacterium URHD0088
ref|WP_037197314.1|  3-beta hydroxysteroid dehydrogenase                123   4e-29    Rhizobium
ref|WP_009757683.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      122   4e-29    Ahrensia sp. R2A130
ref|WP_008596326.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      122   4e-29    Nitratireductor pacificus
ref|WP_008972707.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      122   5e-29    Bradyrhizobium sp. STM 3843
ref|WP_038548505.1|  3-beta hydroxysteroid dehydrogenase                122   5e-29    Neorhizobium galegae
ref|WP_037079590.1|  3-beta hydroxysteroid dehydrogenase                122   6e-29    Rhizobium vignae
ref|WP_037457841.1|  3-beta hydroxysteroid dehydrogenase                122   7e-29    Skermanella stibiiresistens
ref|WP_028034557.1|  3-beta hydroxysteroid dehydrogenase                122   8e-29    Chelativorans sp. J32
gb|KIE04291.1|  NADH dehydrogenase (Ubiquinone) 1 alpha subcomple...    121   9e-29    Candidatus Jidaibacter acanthamoeba
ref|WP_029057708.1|  3-beta hydroxysteroid dehydrogenase                122   9e-29    Stappia stellulata
ref|WP_039459013.1|  hypothetical protein                               121   1e-28    
ref|WP_025425609.1|  3-beta hydroxysteroid dehydrogenase                121   1e-28    Ensifer
ref|WP_006310143.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      121   1e-28    Agrobacterium sp. ATCC 31749
ref|WP_002717736.1|  hypothetical protein                               121   1e-28    Afipia felis
ref|WP_037065538.1|  3-beta hydroxysteroid dehydrogenase                121   2e-28    Rhizobium leguminosarum
ref|WP_007529376.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      121   2e-28    Rhizobium mesoamericanum
ref|WP_011642056.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      121   2e-28    Maricaulis maris
ref|WP_040489901.1|  3-beta hydroxysteroid dehydrogenase                121   2e-28    
ref|WP_025029733.1|  3-beta hydroxysteroid dehydrogenase                118   2e-28    Nitratireductor aquibiodomus
ref|WP_037115283.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    121   2e-28    Rhizobium
ref|WP_007813453.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      121   2e-28    Rhizobium sp. CF142
ref|WP_008127552.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      120   2e-28    Phyllobacterium sp. YR531
ref|WP_034804481.1|  3-beta hydroxysteroid dehydrogenase                120   2e-28    Ensifer
ref|WP_037100746.1|  3-beta hydroxysteroid dehydrogenase                120   2e-28    Rhizobium alamii
ref|WP_019199324.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      120   2e-28    Bradyrhizobiaceae
ref|WP_037159370.1|  3-beta hydroxysteroid dehydrogenase                120   3e-28    Rhizobium sp. YS-1r
ref|WP_009796496.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      120   3e-28    Nitrobacter sp. Nb-311A
ref|WP_017269127.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      118   3e-28    
gb|EAU41592.1|  putative oxidoreductase protein                         120   3e-28    Fulvimarina pelagi HTCC2506
ref|WP_003493425.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      120   3e-28    Agrobacterium tumefaciens
ref|WP_016735020.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      120   3e-28    Rhizobium phaseoli
ref|WP_012482360.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      120   3e-28    Rhizobium etli
ref|WP_025602653.1|  3-beta hydroxysteroid dehydrogenase                120   3e-28    
ref|WP_007598696.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      120   4e-28    Rhizobium sp. PDO1-076
ref|WP_009604313.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      120   5e-28    SAR116 cluster alpha proteobacterium HIMB100
gb|EGE59004.1|  putative NADH dehydrogenase/NADH dehydrogenase (u...    120   5e-28    Rhizobium etli CNPAF512
ref|WP_010970802.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    119   6e-28    Agrobacterium tumefaciens complex
ref|WP_037314823.1|  3-beta hydroxysteroid dehydrogenase                119   8e-28    Ruegeria halocynthiae
ref|WP_038686352.1|  3-beta hydroxysteroid dehydrogenase                119   1e-27    Rhizobium
ref|WP_034514069.1|  3-beta hydroxysteroid dehydrogenase                119   1e-27    Agrobacterium rhizogenes
ref|WP_035069164.1|  3-beta hydroxysteroid dehydrogenase                119   1e-27    
ref|WP_043140566.1|  3-beta hydroxysteroid dehydrogenase                119   1e-27    Mameliella alba
ref|WP_007007136.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      119   1e-27    Nitratireductor
ref|WP_015241008.1|  putative nucleoside-diphosphate-sugar epimerase    119   1e-27    Sinorhizobium meliloti
ref|WP_007763297.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      119   1e-27    Rhizobium sp. CF080
ref|WP_036515289.1|  3-beta hydroxysteroid dehydrogenase                118   1e-27    
gb|AIL13087.1|  hypothetical protein IM40_05525                         118   1e-27    Candidatus Paracaedimonas acanthamoebae
ref|WP_017966662.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      119   1e-27    Rhizobium leguminosarum
ref|WP_045018279.1|  3-beta hydroxysteroid dehydrogenase                119   1e-27    Rhizobium nepotum
ref|WP_022713397.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      118   2e-27    Rhizobium mongolense
ref|WP_020011099.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    118   2e-27    Agrobacterium
ref|WP_029011978.1|  3-beta hydroxysteroid dehydrogenase                118   2e-27    Niveispirillum irakense
ref|WP_043773282.1|  3-beta hydroxysteroid dehydrogenase                118   2e-27    Roseivivax isoporae
gb|EWM25568.1|  nadh dehydrogenase                                      117   2e-27    Nannochloropsis gaditana
ref|WP_028750945.1|  3-beta hydroxysteroid dehydrogenase                118   2e-27    Rhizobium leucaenae
ref|WP_043615439.1|  3-beta hydroxysteroid dehydrogenase                118   2e-27    Ensifer sp. ZNC0028
ref|WP_037104352.1|  3-beta hydroxysteroid dehydrogenase                118   2e-27    Rhizobium sp. OK665
ref|WP_039846586.1|  3-beta hydroxysteroid dehydrogenase                118   2e-27    
ref|WP_007799503.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      118   2e-27    Rhizobium sp. CF122
ref|WP_013845015.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      118   2e-27    Rhizobiales
ref|WP_038328123.1|  hypothetical protein                               117   2e-27    
ref|WP_015338537.1|  NADH dehydrogenase                                 118   2e-27    Rhizobium tropici
ref|WP_026613537.1|  3-beta hydroxysteroid dehydrogenase                118   3e-27    Sinorhizobium/Ensifer group
ref|WP_038378462.1|  3-beta hydroxysteroid dehydrogenase                117   3e-27    Bradyrhizobium elkanii
ref|WP_009502685.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      118   3e-27    Rhodobacteraceae
ref|WP_034489081.1|  3-beta hydroxysteroid dehydrogenase                117   3e-27    Agrobacterium rhizogenes
ref|WP_018323842.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      117   4e-27    Rhizobium giardinii
ref|WP_028096083.1|  3-beta hydroxysteroid dehydrogenase                117   4e-27    Dongia sp. URHE0060
ref|WP_018093937.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      117   4e-27    Sinorhizobium/Ensifer group
ref|WP_022702351.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      117   4e-27    Pseudorhodobacter ferrugineus
gb|AIF81505.1|  NADH dehydrogenase (ubiquinone)                         117   4e-27    endosymbiont of Acanthamoeba sp. UWC8
ref|WP_012067733.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    117   4e-27    Sinorhizobium
ref|WP_036306739.1|  3-beta hydroxysteroid dehydrogenase                117   5e-27    Methylopila sp. 73B
ref|WP_003544730.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      117   5e-27    Rhizobium leguminosarum
ref|WP_003589083.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      117   5e-27    Rhizobium leguminosarum
ref|WP_038541460.1|  hypothetical protein                               117   5e-27    
ref|WP_003529781.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      117   5e-27    Sinorhizobium meliloti
ref|WP_012589203.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      117   5e-27    Methylocella silvestris
ref|WP_024317749.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    117   5e-27    Rhizobium favelukesii
ref|WP_018269295.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      117   5e-27    Bradyrhizobium elkanii
ref|WP_015663304.1|  hypothetical protein                               117   6e-27    Bradyrhizobium oligotrophicum
ref|WP_010968509.1|  oxidoreductase                                     117   6e-27    Sinorhizobium meliloti
ref|WP_027989547.1|  3-beta hydroxysteroid dehydrogenase                117   6e-27    Sinorhizobium meliloti
ref|XP_005971320.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    117   7e-27    Pantholops hodgsonii [Tibetan antelope]
ref|WP_037188156.1|  3-beta hydroxysteroid dehydrogenase                117   7e-27    Rhizobium sp. YR519
ref|WP_029959614.1|  3-beta hydroxysteroid dehydrogenase                117   7e-27    Ensifer sp. USDA 6670
ref|WP_028002286.1|  3-beta hydroxysteroid dehydrogenase                117   7e-27    Sinorhizobium arboris
ref|WP_026756898.1|  3-beta hydroxysteroid dehydrogenase                117   7e-27    Sediminimonas qiaohouensis
ref|WP_026622062.1|  3-beta hydroxysteroid dehydrogenase                116   8e-27    Ensifer sp. WSM1721
ref|WP_029873971.1|  3-beta hydroxysteroid dehydrogenase                116   8e-27    Rhizobium leguminosarum
ref|WP_033181246.1|  3-beta hydroxysteroid dehydrogenase                116   8e-27    Rhizobium leguminosarum
ref|WP_018485276.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      116   9e-27    Rhizobium leguminosarum
ref|WP_027674017.1|  3-beta hydroxysteroid dehydrogenase                116   9e-27    Agrobacterium larrymoorei
ref|WP_023431376.1|  NAD-dependent epimerase/dehydratase                116   9e-27    Lutibaculum baratangense
ref|WP_037125547.1|  3-beta hydroxysteroid dehydrogenase                116   9e-27    Rhizobium sp. CF097
ref|WP_021102609.1|  NAD-dependent epimerase/dehydratase                116   1e-26    Litoreibacter arenae
ref|WP_045657033.1|  3-beta hydroxysteroid dehydrogenase                116   1e-26    
ref|WP_012180246.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      116   1e-26    Dinoroseobacter shibae
ref|WP_024322235.1|  3-beta hydroxysteroid dehydrogenase                116   1e-26    Rhizobium leguminosarum
ref|WP_044564275.1|  3-beta hydroxysteroid dehydrogenase                116   1e-26    Azospirillum sp. B4
ref|WP_011049451.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      116   1e-26    Ruegeria pomeroyi
ref|WP_029061954.1|  3-beta hydroxysteroid dehydrogenase                116   1e-26    Labrenzia sp. DG1229
ref|WP_020052566.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      116   1e-26    Rhizobium leguminosarum
ref|WP_028164836.1|  3-beta hydroxysteroid dehydrogenase                116   1e-26    Bradyrhizobium elkanii
ref|WP_018899326.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      116   1e-26    Rhizobium sp. 2MFCol3.1
ref|WP_034992883.1|  3-beta hydroxysteroid dehydrogenase                116   1e-26    Beijerinckia mobilis
ref|WP_025063871.1|  3-beta hydroxysteroid dehydrogenase                116   1e-26    Sulfitobacter guttiformis
ref|WP_027682062.1|  3-beta hydroxysteroid dehydrogenase                115   1e-26    Rhizobium leguminosarum
ref|WP_018495693.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      115   1e-26    Rhizobium leguminosarum
ref|WP_025396797.1|  3-beta hydroxysteroid dehydrogenase                115   1e-26    Rhizobium leguminosarum
ref|WP_008235576.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      115   1e-26    Roseobacter sp. CCS2
ref|WP_028758381.1|  3-beta hydroxysteroid dehydrogenase                115   2e-26    Rhizobium
ref|WP_028745342.1|  3-beta hydroxysteroid dehydrogenase                115   2e-26    Rhizobium mesoamericanum
ref|XP_005706979.1|  NADH dehydrogenase                                 115   2e-26    Galdieria sulphuraria
ref|WP_006933761.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      115   2e-26    Labrenzia aggregata
ref|WP_034739428.1|  3-beta hydroxysteroid dehydrogenase                115   2e-26    Hyphomonas chukchiensis
ref|WP_037114878.1|  3-beta hydroxysteroid dehydrogenase                115   2e-26    Rhizobium
ref|WP_028011551.1|  3-beta hydroxysteroid dehydrogenase                115   2e-26    Sinorhizobium/Ensifer group
ref|WP_018069993.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      115   2e-26    Rhizobium leguminosarum
ref|WP_018447885.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      115   2e-26    Rhizobium
ref|WP_010442913.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      115   2e-26    Ruegeria conchae
ref|WP_004108248.1|  putative NADH dehydrogenase/NADH dehydrogena...    115   2e-26    Rhizobium freirei
dbj|BAL73348.1|  oxidoreductase                                         114   2e-26    Bradyrhizobium sp. S23321
ref|WP_036484855.1|  3-beta hydroxysteroid dehydrogenase                115   2e-26    Nitratireductor basaltis
ref|WP_037089422.1|  3-beta hydroxysteroid dehydrogenase                115   2e-26    Rhizobium/Agrobacterium group
ref|WP_035206671.1|  3-beta hydroxysteroid dehydrogenase                115   2e-26    Rhizobium/Agrobacterium group
gb|KCZ50818.1|  hypothetical protein HY2_13305                          115   2e-26    Hyphomonas sp. T16B2
ref|WP_045532999.1|  3-beta hydroxysteroid dehydrogenase                115   2e-26    Rhizobium/Agrobacterium group
ref|WP_034826583.1|  3-beta hydroxysteroid dehydrogenase                115   2e-26    Hyphomonas
ref|WP_009028277.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      115   2e-26    Bradyrhizobium sp. ORS 375
ref|WP_027669269.1|  3-beta hydroxysteroid dehydrogenase                115   2e-26    Rhizobium leguminosarum
ref|WP_007702838.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    115   2e-26    Rhizobium/Agrobacterium group
ref|WP_011423696.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      115   3e-26    
ref|WP_037157381.1|  3-beta hydroxysteroid dehydrogenase                115   3e-26    
ref|WP_028286897.1|  3-beta hydroxysteroid dehydrogenase                115   3e-26    
ref|WP_028738716.1|  3-beta hydroxysteroid dehydrogenase                115   3e-26    
ref|WP_028731730.1|  3-beta hydroxysteroid dehydrogenase                115   3e-26    
ref|WP_017962916.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      115   3e-26    
ref|WP_018116836.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    115   3e-26    
ref|WP_011650133.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      115   3e-26    
ref|WP_018855187.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      115   3e-26    
ref|WP_018244432.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      115   3e-26    
ref|WP_011909724.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      115   3e-26    
ref|WP_037482058.1|  3-beta hydroxysteroid dehydrogenase                114   3e-26    
ref|WP_011923395.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      114   4e-26    
ref|WP_007633889.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      114   4e-26    
ref|WP_024846278.1|  3-beta hydroxysteroid dehydrogenase                114   4e-26    
ref|WP_017990036.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      114   4e-26    
ref|WP_025417572.1|  3-beta hydroxysteroid dehydrogenase                114   4e-26    
ref|WP_005979714.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      114   4e-26    
ref|WP_013635346.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      114   4e-26    
ref|WP_037377954.1|  3-beta hydroxysteroid dehydrogenase                114   4e-26    
ref|WP_008524875.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      114   4e-26    
ref|WP_003570910.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      114   4e-26    
ref|WP_037247334.1|  3-beta hydroxysteroid dehydrogenase                114   4e-26    
gb|AHC74005.1|  NADH dehydrogenase (Ubiquinone) 1 alpha subcomplex 9    114   5e-26    
ref|WP_003514695.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      114   5e-26    
ref|WP_044214941.1|  3-beta hydroxysteroid dehydrogenase                114   5e-26    
ref|WP_041747949.1|  3-beta hydroxysteroid dehydrogenase                114   6e-26    
ref|WP_043231919.1|  3-beta hydroxysteroid dehydrogenase                114   6e-26    
ref|WP_017995781.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      114   6e-26    
ref|WP_027235881.1|  3-beta hydroxysteroid dehydrogenase                114   6e-26    
ref|WP_007206117.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      114   6e-26    
ref|WP_037267370.1|  3-beta hydroxysteroid dehydrogenase                114   6e-26    
ref|WP_037130671.1|  3-beta hydroxysteroid dehydrogenase                114   7e-26    
ref|WP_011540134.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      114   7e-26    
gb|KFC75616.1|  Dehydrogenase                                           114   7e-26    
ref|WP_029206735.1|  hypothetical protein                               112   7e-26    
ref|WP_011582912.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      114   8e-26    
ref|WP_002713828.1|  hypothetical protein                               114   8e-26    
ref|WP_009338703.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      114   8e-26    
ref|WP_031269610.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    114   8e-26    
ref|WP_038005934.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    114   9e-26    
ref|WP_027528261.1|  3-beta hydroxysteroid dehydrogenase                113   9e-26    
ref|WP_003503853.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      114   9e-26    
ref|WP_023786056.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      114   9e-26    
ref|WP_004439463.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    113   9e-26    
gb|ERP88260.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase           114   1e-25    
ref|WP_012493885.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      113   1e-25    
ref|WP_027510598.1|  3-beta hydroxysteroid dehydrogenase                113   1e-25    
emb|CFX18508.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase          113   1e-25    
ref|WP_028337947.1|  3-beta hydroxysteroid dehydrogenase                113   1e-25    
ref|WP_018389387.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      113   1e-25    
ref|WP_033315105.1|  3-beta hydroxysteroid dehydrogenase                113   1e-25    
ref|WP_015089185.1|  short chain dehydrogenase family protein           113   1e-25    
ref|WP_019564453.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      113   1e-25    
ref|WP_037420965.1|  3-beta hydroxysteroid dehydrogenase                113   1e-25    
ref|WP_006725017.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      113   1e-25    
ref|WP_023663859.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      113   1e-25    
ref|WP_020809817.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      113   1e-25    
ref|WP_024587909.1|  3-beta hydroxysteroid dehydrogenase                113   1e-25    
ref|WP_012759831.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      113   2e-25    
ref|WP_016552421.1|  NAD-dependent epimerase/dehydratase                113   2e-25    
ref|WP_012091433.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      112   2e-25    
ref|WP_027581325.1|  3-beta hydroxysteroid dehydrogenase                112   2e-25    
ref|WP_021237045.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      112   2e-25    
ref|WP_012520729.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      112   2e-25    
ref|WP_043844369.1|  3-beta hydroxysteroid dehydrogenase                112   2e-25    
ref|WP_025055104.1|  3-beta hydroxysteroid dehydrogenase                112   2e-25    
ref|WP_036260034.1|  3-beta hydroxysteroid dehydrogenase                112   2e-25    
ref|WP_010659406.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      112   2e-25    
ref|WP_021587114.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      112   2e-25    
ref|WP_009362855.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    112   2e-25    
ref|WP_029929346.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    112   2e-25    
gb|EEZ33718.1|  NAD-dependent epimerase/dehydratase                     112   3e-25    
ref|WP_026381421.1|  3-beta hydroxysteroid dehydrogenase                112   3e-25    
ref|WP_037436452.1|  3-beta hydroxysteroid dehydrogenase                110   3e-25    
ref|WP_031554361.1|  3-beta hydroxysteroid dehydrogenase                112   3e-25    
ref|WP_029077220.1|  3-beta hydroxysteroid dehydrogenase                112   3e-25    
ref|WP_045015281.1|  3-beta hydroxysteroid dehydrogenase                112   3e-25    
ref|WP_003583713.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      112   3e-25    
ref|WP_014876487.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      112   3e-25    
ref|WP_007674128.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      112   4e-25    
ref|WP_035219308.1|  3-beta hydroxysteroid dehydrogenase                112   4e-25    
ref|WP_014766773.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      112   4e-25    
ref|WP_022712465.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      112   4e-25    
ref|WP_012384305.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      112   4e-25    
ref|WP_037470301.1|  3-beta hydroxysteroid dehydrogenase                112   4e-25    
ref|WP_045685926.1|  3-beta hydroxysteroid dehydrogenase                112   4e-25    
ref|WP_043924186.1|  3-beta hydroxysteroid dehydrogenase                112   4e-25    
ref|WP_009466772.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      112   4e-25    
ref|WP_018235129.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      112   4e-25    
ref|WP_007118555.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      112   4e-25    
ref|WP_040850050.1|  3-beta hydroxysteroid dehydrogenase                111   4e-25    
ref|WP_011995111.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      112   4e-25    
ref|WP_028092804.1|  3-beta hydroxysteroid dehydrogenase                112   4e-25    
gb|EGP09699.1|  NAD-dependent epimerase/dehydratase                     112   4e-25    
gb|EEQ96501.1|  NAD-dependent epimerase/dehydratase                     112   5e-25    
ref|WP_037205228.1|  3-beta hydroxysteroid dehydrogenase                111   5e-25    
ref|WP_006472285.1|  NAD-dependent epimerase/dehydratase                111   5e-25    
ref|WP_043871301.1|  3-beta hydroxysteroid dehydrogenase                111   5e-25    
ref|WP_003520119.1|  NADH-ubiquinone oxidoreductase 39 kd subunit       111   5e-25    
ref|WP_007876424.1|  NAD-dependent epimerase/dehydratase                111   6e-25    
ref|WP_040651183.1|  3-beta hydroxysteroid dehydrogenase                111   8e-25    
ref|WP_025090796.1|  3-beta hydroxysteroid dehydrogenase                111   8e-25    
ref|WP_018304478.1|  hypothetical protein                               111   8e-25    
ref|WP_011155616.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      110   8e-25    
ref|WP_008195775.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      110   8e-25    
ref|WP_027151497.1|  3-beta hydroxysteroid dehydrogenase                110   9e-25    
ref|WP_008757424.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      110   9e-25    
ref|WP_012654759.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      110   9e-25    
ref|WP_027550096.1|  3-beta hydroxysteroid dehydrogenase                110   9e-25    
gb|EAQ24510.1|  NADH ubiquinone oxidoreductase, putative                110   9e-25    
ref|WP_020084027.1|  hypothetical protein                               110   9e-25    
ref|WP_012710133.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      110   1e-24    
ref|WP_034766843.1|  3-beta hydroxysteroid dehydrogenase                110   1e-24    
ref|WP_035536720.1|  3-beta hydroxysteroid dehydrogenase                110   1e-24    
ref|WP_025311295.1|  3-beta hydroxysteroid dehydrogenase                110   1e-24    
ref|WP_008511319.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    110   1e-24    
ref|WP_038075675.1|  3-beta hydroxysteroid dehydrogenase                110   1e-24    
ref|WP_014330758.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      110   1e-24    
ref|WP_037450866.1|  3-beta hydroxysteroid dehydrogenase                110   1e-24    
ref|WP_005618365.1|  3-beta hydroxysteroid dehydrogenase/isomerase      110   1e-24    
gb|KDA03333.1|  putative NADH-quinone oxidoreductase                    110   1e-24    
ref|WP_035581487.1|  3-beta hydroxysteroid dehydrogenase                110   1e-24    
gb|EEY31663.1|  NAD-dependent epimerase/dehydratase                     110   1e-24    
ref|WP_039533427.1|  3-beta hydroxysteroid dehydrogenase                110   1e-24    
ref|WP_004856191.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      110   1e-24    
ref|WP_006192257.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    110   1e-24    
ref|WP_034853660.1|  3-beta hydroxysteroid dehydrogenase                110   1e-24    
gb|EEH13036.1|  NAD-dependent epimerase/dehydratase                     110   1e-24    
gb|EEP62440.1|  NAD-dependent epimerase/dehydratase                     110   1e-24    
ref|WP_037397392.1|  3-beta hydroxysteroid dehydrogenase                108   1e-24    
ref|WP_006175132.1|  MULTISPECIES: hypothetical protein                 110   1e-24    
gb|EEX89282.1|  NAD-dependent epimerase/dehydratase                     110   2e-24    
ref|WP_007811933.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      110   2e-24    
ref|WP_020809807.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      110   2e-24    
ref|WP_037431314.1|  3-beta hydroxysteroid dehydrogenase                110   2e-24    
ref|WP_025198912.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    110   2e-24    
ref|WP_039185049.1|  3-beta hydroxysteroid dehydrogenase                110   2e-24    
ref|WP_002968608.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    110   2e-24    
gb|KEO64026.1|  3-beta hydroxysteroid dehydrogenase                     110   2e-24    
ref|WP_012040577.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      110   2e-24    
ref|WP_027574763.1|  3-beta hydroxysteroid dehydrogenase                110   2e-24    
ref|WP_023796786.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      110   2e-24    
ref|WP_022724440.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      110   2e-24    
ref|WP_023081286.1|  hypothetical protein                               110   2e-24    
ref|WP_008035619.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      110   2e-24    
ref|WP_013300115.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      109   2e-24    
ref|WP_027279004.1|  3-beta hydroxysteroid dehydrogenase                109   2e-24    
ref|WP_024501904.1|  3-beta hydroxysteroid dehydrogenase                109   2e-24    
ref|WP_013950968.1|  NADH dehydrogenase subunit I                       109   3e-24    
ref|WP_034833137.1|  3-beta hydroxysteroid dehydrogenase                109   3e-24    
ref|WP_026942916.1|  3-beta hydroxysteroid dehydrogenase                109   3e-24    
ref|WP_040408243.1|  3-beta hydroxysteroid dehydrogenase                109   3e-24    
ref|WP_007088365.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      109   3e-24    
gb|ABL97602.1|  NADH-ubiquinone oxidoreductase                          109   3e-24    
ref|WP_026607026.1|  3-beta hydroxysteroid dehydrogenase                109   3e-24    
ref|WP_019172720.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      109   3e-24    
ref|WP_024920181.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    109   3e-24    
ref|WP_006023269.1|  hypothetical protein                               109   3e-24    
ref|WP_019977208.1|  hypothetical protein                               109   4e-24    
ref|WP_044418410.1|  3-beta hydroxysteroid dehydrogenase                109   4e-24    
ref|WP_011453372.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      109   4e-24    
ref|WP_034796574.1|  3-beta hydroxysteroid dehydrogenase                109   4e-24    
ref|WP_039192493.1|  3-beta hydroxysteroid dehydrogenase                108   4e-24    
ref|WP_029204950.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    108   4e-24    
ref|WP_006193633.1|  hypothetical protein                               108   4e-24    
ref|WP_040974907.1|  3-beta hydroxysteroid dehydrogenase                108   5e-24    
ref|WP_027061893.1|  3-beta hydroxysteroid dehydrogenase                108   5e-24    
gb|EEW89461.1|  NADH-ubiquinone oxidoreductase                          108   5e-24    
ref|WP_009570312.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      108   5e-24    
ref|WP_036556342.1|  3-beta hydroxysteroid dehydrogenase                108   5e-24    
ref|WP_044551122.1|  3-beta hydroxysteroid dehydrogenase                108   5e-24    
ref|WP_006133507.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    108   5e-24    
ref|WP_045229992.1|  3-beta hydroxysteroid dehydrogenase                108   5e-24    
ref|WP_009177486.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      108   5e-24    
ref|WP_008833881.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      108   5e-24    
ref|WP_027842051.1|  3-beta hydroxysteroid dehydrogenase                108   5e-24    
ref|WP_024576732.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    108   6e-24    
ref|WP_006281113.1|  hypothetical protein                               108   6e-24    
ref|WP_035025231.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    108   6e-24    
ref|WP_023080904.1|  hypothetical protein                               108   6e-24    
dbj|BAB51684.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex     108   6e-24    
ref|WP_023761469.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      108   7e-24    
ref|WP_039147810.1|  3-beta hydroxysteroid dehydrogenase                108   7e-24    
ref|WP_027230840.1|  3-beta hydroxysteroid dehydrogenase                108   7e-24    
ref|WP_018065082.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      108   7e-24    
ref|WP_018997099.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      108   7e-24    
ref|WP_012778068.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      108   7e-24    
ref|WP_027032673.1|  3-beta hydroxysteroid dehydrogenase                108   8e-24    
ref|WP_009813247.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      108   8e-24    
ref|WP_032933972.1|  3-beta hydroxysteroid dehydrogenase                108   8e-24    
ref|WP_027052758.1|  3-beta hydroxysteroid dehydrogenase                108   8e-24    
ref|WP_007552271.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      108   8e-24    
ref|WP_038128501.1|  3-beta hydroxysteroid dehydrogenase                108   9e-24    
ref|WP_035382329.1|  3-beta hydroxysteroid dehydrogenase                107   9e-24    
ref|WP_007255607.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      108   9e-24    
gb|KEO61068.1|  hypothetical protein DT23_10935                         108   9e-24    
ref|WP_029416985.1|  3-beta hydroxysteroid dehydrogenase                108   1e-23    
ref|WP_041001079.1|  3-beta hydroxysteroid dehydrogenase                108   1e-23    
ref|WP_045684065.1|  3-beta hydroxysteroid dehydrogenase                107   1e-23    
ref|WP_019015136.1|  hypothetical protein                               107   1e-23    
ref|WP_020057796.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      108   1e-23    
ref|WP_035250386.1|  3-beta hydroxysteroid dehydrogenase                107   1e-23    
gb|KGB20951.1|  NAD-dependent epimerase/dehydratase                     107   1e-23    
ref|WP_022700865.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    
ref|WP_041007225.1|  3-beta hydroxysteroid dehydrogenase                107   1e-23    
ref|WP_011645124.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    107   1e-23    
ref|WP_041605182.1|  3-beta hydroxysteroid dehydrogenase                107   1e-23    
gb|AFK52022.1|  NADH-ubiquinone oxidoreductase 39 kDa subunit pre...    107   1e-23    
ref|WP_022698487.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    
ref|WP_038304852.1|  3-beta hydroxysteroid dehydrogenase                107   1e-23    
ref|WP_008262623.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    
ref|WP_018148326.1|  hypothetical protein                               107   1e-23    
ref|WP_035842520.1|  3-beta hydroxysteroid dehydrogenase                107   1e-23    
ref|WP_008886715.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    
ref|WP_029207369.1|  hypothetical protein                               107   1e-23    
gb|KCZ94903.1|  putative NADH-quinone oxidoreductase                    107   1e-23    
ref|WP_011338750.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    
ref|WP_009563193.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    107   1e-23    
ref|WP_027039835.1|  3-beta hydroxysteroid dehydrogenase                107   1e-23    
ref|WP_046001207.1|  3-beta hydroxysteroid dehydrogenase                107   1e-23    



>ref|XP_011080124.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Sesamum indicum]
Length=400

 Score =   369 bits (946),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 171/207 (83%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA  EEAVLRE+PEATI++PA MIGTEDR+LNPWA FAK Y FLPL+G G+TKIQ
Sbjct  193  RMLRAKAAGEEAVLRELPEATIMRPAAMIGTEDRVLNPWAHFAKKYSFLPLLGDGSTKIQ  252

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVASAI+A+LKDDG+SMGKVYELGGPEI+T+HQLAELMYD+IREWP YVKVPFPI
Sbjct  253  PVYVVDVASAIVAALKDDGSSMGKVYELGGPEIYTLHQLAELMYDMIREWPHYVKVPFPI  312

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAIATPRE+LL KVPFP+PTP+IFNLD IEAL+TDTLVSENAL FEDLGIVP KLKGYP
Sbjct  313  AKAIATPREVLLNKVPFPMPTPTIFNLDQIEALSTDTLVSENALKFEDLGIVPCKLKGYP  372

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSY  179
            VE+LIQYRKGGPQYGSTVSEK++P S+
Sbjct  373  VEFLIQYRKGGPQYGSTVSEKVTPQSW  399



>ref|XP_007050148.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOX94305.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 4 [Theobroma 
cacao]
Length=313

 Score =   359 bits (922),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  +AKA AEEAVLRE+PEAT++KPA+MIGTEDRI+N WAQF K Y FLPLIG G+TKIQ
Sbjct  106  RFLRAKAAAEEAVLRELPEATVMKPAIMIGTEDRIMNRWAQFVKKYSFLPLIGDGSTKIQ  165

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVASAI+A+LKDDGTSMGK YELGGPEIFTVH+LAELM+D+IREWPRYVKVP P+
Sbjct  166  PVYVVDVASAIVAALKDDGTSMGKAYELGGPEIFTVHELAELMHDMIREWPRYVKVPLPV  225

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAIA PRE+LLKKVPFPLP P IFNLD I A  TDT+VSENALTF DLGIVPHKLKGYP
Sbjct  226  AKAIAMPREVLLKKVPFPLPNPDIFNLDQIHAFATDTIVSENALTFTDLGIVPHKLKGYP  285

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VEYLIQYRKGGPQ+GSTVSEK++P+ +P
Sbjct  286  VEYLIQYRKGGPQFGSTVSEKVNPEYWP  313



>gb|KJB42336.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=345

 Score =   360 bits (925),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  +AKA  EEAVL+E+PEAT++KPAVMIGTEDRI+N WA FAK Y FLPLIGGG+TKIQ
Sbjct  138  RFLRAKAAGEEAVLKELPEATVMKPAVMIGTEDRIMNRWAHFAKKYSFLPLIGGGSTKIQ  197

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVASAI+A+LKDDG+SMG VYELGGPEI+TVH+LAELMY+ IREWPRYV +P PI
Sbjct  198  PVYVVDVASAIVAALKDDGSSMGNVYELGGPEIYTVHELAELMYETIREWPRYVNIPLPI  257

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAIA PRE+LLKKVPFPLP P IFNLD I A  TDT+VSENALTF DLGIVPHKLKGYP
Sbjct  258  AKAIAMPREVLLKKVPFPLPNPDIFNLDQINAFATDTVVSENALTFMDLGIVPHKLKGYP  317

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VEYLIQYRKGGPQ+GSTVSEK++PDSYP
Sbjct  318  VEYLIQYRKGGPQFGSTVSEKVNPDSYP  345



>gb|KHG08643.1| hypothetical protein F383_12346 [Gossypium arboreum]
Length=370

 Score =   361 bits (927),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  +AKA  EEAVL+E+PEAT++KPAVMIGTEDRI+N WA FAK Y FLPLIGGG+TKIQ
Sbjct  163  RFLRAKAAGEEAVLKELPEATVMKPAVMIGTEDRIMNRWAHFAKKYSFLPLIGGGSTKIQ  222

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVASAI+A+LKDDG+SMG VYELGGPEI+TVH+LAELMY+ IREWPRYV VP P+
Sbjct  223  PVYVVDVASAIVAALKDDGSSMGNVYELGGPEIYTVHELAELMYETIREWPRYVNVPLPV  282

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAIA PRE+LLKKVPFPLP P IFNLD I A  TDT+VSENALTF DLGIVPHKLKGYP
Sbjct  283  AKAIAMPREVLLKKVPFPLPNPDIFNLDQIHAFATDTVVSENALTFMDLGIVPHKLKGYP  342

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VEYLIQYRKGGPQ+GSTVSEK++PDSYP
Sbjct  343  VEYLIQYRKGGPQFGSTVSEKVNPDSYP  370



>gb|KJB42339.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=356

 Score =   360 bits (925),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  +AKA  EEAVL+E+PEAT++KPAVMIGTEDRI+N WA FAK Y FLPLIGGG+TKIQ
Sbjct  149  RFLRAKAAGEEAVLKELPEATVMKPAVMIGTEDRIMNRWAHFAKKYSFLPLIGGGSTKIQ  208

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVASAI+A+LKDDG+SMG VYELGGPEI+TVH+LAELMY+ IREWPRYV +P PI
Sbjct  209  PVYVVDVASAIVAALKDDGSSMGNVYELGGPEIYTVHELAELMYETIREWPRYVNIPLPI  268

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAIA PRE+LLKKVPFPLP P IFNLD I A  TDT+VSENALTF DLGIVPHKLKGYP
Sbjct  269  AKAIAMPREVLLKKVPFPLPNPDIFNLDQINAFATDTVVSENALTFMDLGIVPHKLKGYP  328

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VEYLIQYRKGGPQ+GSTVSEK++PDSYP
Sbjct  329  VEYLIQYRKGGPQFGSTVSEKVNPDSYP  356



>emb|CDP03802.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/224 (76%), Positives = 195/224 (87%), Gaps = 16/224 (7%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA  EEA+L+E PEAT+++PA MIGTEDR+LNPWA F KNYGFLPLIG GTTKIQ
Sbjct  195  RMLRAKAAGEEALLQEFPEATVMRPAAMIGTEDRVLNPWAHFVKNYGFLPLIGEGTTKIQ  254

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVASAI+A+LKDDG+ MGKVYELGGPEIFTVH+LAELM+DVIREWPRYVK+PFP+
Sbjct  255  PVYVIDVASAIVAALKDDGSCMGKVYELGGPEIFTVHELAELMFDVIREWPRYVKIPFPV  314

Query  439  AK----------------AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL  308
            AK                AIA PRE+LLKKVPFP+PTPSIFNLD IEALTTDTLVS++AL
Sbjct  315  AKASYIPLSFCCYSCLLSAIAMPREVLLKKVPFPMPTPSIFNLDAIEALTTDTLVSKDAL  374

Query  307  TFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            TF+DLGI PHKLKGYPVE+LIQYRKGGP+YGSTVSEK+SP+S+P
Sbjct  375  TFDDLGIAPHKLKGYPVEFLIQYRKGGPKYGSTVSEKVSPESWP  418



>gb|KJB42335.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=400

 Score =   361 bits (927),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  +AKA  EEAVL+E+PEAT++KPAVMIGTEDRI+N WA FAK Y FLPLIGGG+TKIQ
Sbjct  193  RFLRAKAAGEEAVLKELPEATVMKPAVMIGTEDRIMNRWAHFAKKYSFLPLIGGGSTKIQ  252

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVASAI+A+LKDDG+SMG VYELGGPEI+TVH+LAELMY+ IREWPRYV +P PI
Sbjct  253  PVYVVDVASAIVAALKDDGSSMGNVYELGGPEIYTVHELAELMYETIREWPRYVNIPLPI  312

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAIA PRE+LLKKVPFPLP P IFNLD I A  TDT+VSENALTF DLGIVPHKLKGYP
Sbjct  313  AKAIAMPREVLLKKVPFPLPNPDIFNLDQINAFATDTVVSENALTFMDLGIVPHKLKGYP  372

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VEYLIQYRKGGPQ+GSTVSEK++PDSYP
Sbjct  373  VEYLIQYRKGGPQFGSTVSEKVNPDSYP  400



>ref|XP_007050147.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOX94304.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
Length=392

 Score =   360 bits (923),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  +AKA AEEAVLRE+PEAT++KPA+MIGTEDRI+N WAQF K Y FLPLIG G+TKIQ
Sbjct  185  RFLRAKAAAEEAVLRELPEATVMKPAIMIGTEDRIMNRWAQFVKKYSFLPLIGDGSTKIQ  244

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVASAI+A+LKDDGTSMGK YELGGPEIFTVH+LAELM+D+IREWPRYVKVP P+
Sbjct  245  PVYVVDVASAIVAALKDDGTSMGKAYELGGPEIFTVHELAELMHDMIREWPRYVKVPLPV  304

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAIA PRE+LLKKVPFPLP P IFNLD I A  TDT+VSENALTF DLGIVPHKLKGYP
Sbjct  305  AKAIAMPREVLLKKVPFPLPNPDIFNLDQIHAFATDTIVSENALTFTDLGIVPHKLKGYP  364

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VEYLIQYRKGGPQ+GSTVSEK++P+ +P
Sbjct  365  VEYLIQYRKGGPQFGSTVSEKVNPEYWP  392



>ref|XP_007050145.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007050146.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX94302.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX94303.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=400

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  +AKA AEEAVLRE+PEAT++KPA+MIGTEDRI+N WAQF K Y FLPLIG G+TKIQ
Sbjct  193  RFLRAKAAAEEAVLRELPEATVMKPAIMIGTEDRIMNRWAQFVKKYSFLPLIGDGSTKIQ  252

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVASAI+A+LKDDGTSMGK YELGGPEIFTVH+LAELM+D+IREWPRYVKVP P+
Sbjct  253  PVYVVDVASAIVAALKDDGTSMGKAYELGGPEIFTVHELAELMHDMIREWPRYVKVPLPV  312

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAIA PRE+LLKKVPFPLP P IFNLD I A  TDT+VSENALTF DLGIVPHKLKGYP
Sbjct  313  AKAIAMPREVLLKKVPFPLPNPDIFNLDQIHAFATDTIVSENALTFTDLGIVPHKLKGYP  372

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VEYLIQYRKGGPQ+GSTVSEK++P+ +P
Sbjct  373  VEYLIQYRKGGPQFGSTVSEKVNPEYWP  400



>ref|XP_010264829.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nelumbo nucifera]
 ref|XP_010264830.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nelumbo nucifera]
Length=397

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA AE+A+LRE+PEATI++PAVMIGTEDRILN WAQF K + FLPL+G G+T+IQ
Sbjct  191  RMLRAKAAAEQAILRELPEATIMRPAVMIGTEDRILNRWAQFVKKWSFLPLVGDGSTRIQ  250

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+A+LKDDGTSMGKVYELGGPE+FTVH+LAELM+D IREWPRYVKVPFPI
Sbjct  251  PVYVVDVAAAILAALKDDGTSMGKVYELGGPEVFTVHELAELMFDTIREWPRYVKVPFPI  310

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A+PRE LL KVPFPLPTP IFNLD I ALT DT+VSENALTF DLGIVPHKLKGYP
Sbjct  311  AKALASPREFLLNKVPFPLPTPDIFNLDQINALTVDTVVSENALTFNDLGIVPHKLKGYP  370

Query  259  VEYLIQYRKGGPQYGSTVSEKISPD  185
            VEYLI YRKGGPQ+GST+SE++SPD
Sbjct  371  VEYLISYRKGGPQFGSTISERVSPD  395



>ref|XP_007144408.1| hypothetical protein PHAVU_007G153700g [Phaseolus vulgaris]
 gb|ESW16402.1| hypothetical protein PHAVU_007G153700g [Phaseolus vulgaris]
Length=394

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA AEE VLRE+PEATILKPAVMIGTEDRILNPWA FAK Y F+PL G G+TKIQ
Sbjct  189  RMLRAKAAAEEVVLRELPEATILKPAVMIGTEDRILNPWAHFAKKYSFIPLFGNGSTKIQ  248

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+A+   LKDDGTSMGK YELGGP+IFTVH LAELMY+ IREWPRYVKVPFPI
Sbjct  249  PVYVVDVAAALTTVLKDDGTSMGKTYELGGPDIFTVHDLAELMYETIREWPRYVKVPFPI  308

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+ATPRE+LL KVPFPLP P IFNLD I+ALTTDT+VSENALTF DLGIVPHKLKGYP
Sbjct  309  AKALATPREILLNKVPFPLPNPDIFNLDKIQALTTDTIVSENALTFNDLGIVPHKLKGYP  368

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDS  182
            +E+LI YRKGGPQ+GST+SE+ISPD+
Sbjct  369  IEFLISYRKGGPQFGSTISERISPDA  394



>gb|ACJ84721.1| unknown [Medicago truncatula]
 gb|AFK38059.1| unknown [Medicago truncatula]
 gb|KEH42458.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Medicago truncatula]
Length=396

 Score =   358 bits (919),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 184/208 (88%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM + KA AEEAVLRE+PEATI KPAVMIGTEDRILN WA FAK YGF+PL+G G TKIQ
Sbjct  189  RMLRCKAAAEEAVLRELPEATIFKPAVMIGTEDRILNRWAHFAKKYGFIPLMGNGNTKIQ  248

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+A+  +LKDDGTSMGK+YELGGPEIFTVHQLAE+MYDVIREWPRYV VP PI
Sbjct  249  PVYVVDVAAALTTALKDDGTSMGKIYELGGPEIFTVHQLAEIMYDVIREWPRYVNVPLPI  308

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+ATPREL L K+PFPLP P +FNLD I A   DT+VSENALTF DLGIVPHKLKGYP
Sbjct  309  AKALATPRELFLNKLPFPLPKPEMFNLDQIHAYAADTVVSENALTFNDLGIVPHKLKGYP  368

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            +E+LIQYRKGGPQ+GST+SEK+SPD++P
Sbjct  369  IEFLIQYRKGGPQFGSTISEKVSPDAWP  396



>ref|XP_003542442.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Glycine max]
 gb|KHN48948.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Glycine soja]
Length=396

 Score =   358 bits (918),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM + K+ AEE +LRE+PEATILKPAVMIGTEDRILNPWA FAK YGFLPL G G+TKIQ
Sbjct  189  RMLRTKSAAEEMILRELPEATILKPAVMIGTEDRILNPWAHFAKKYGFLPLFGDGSTKIQ  248

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+A+ + LKDDGTSMGK+YELGGPEIFTVH+LA++M+D IREWPRYVKVPFPI
Sbjct  249  PVYVIDVAAALTSLLKDDGTSMGKIYELGGPEIFTVHELADVMFDTIREWPRYVKVPFPI  308

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+ATPRE+LL KVPFPLP P I NLD I+ALTTDT+VSENALTF DLGIVPHKLKGYP
Sbjct  309  AKALATPREILLNKVPFPLPVPEILNLDKIQALTTDTVVSENALTFNDLGIVPHKLKGYP  368

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            +E+LI YRKGGPQ+GST+SE+++PDS+P
Sbjct  369  IEFLISYRKGGPQFGSTISERVTPDSWP  396



>ref|XP_010548735.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Tarenaya hassleriana]
Length=402

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 186/208 (89%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            +MR+ KA  EEA+L+ +PEATI++PA MIGTEDRILNPWAQF K Y FLPLIG GTTKIQ
Sbjct  195  KMRRTKAAGEEAILKVLPEATIMRPATMIGTEDRILNPWAQFVKKYSFLPLIGDGTTKIQ  254

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA A+I +LKDDG SMGK YELGGPE+FT+H+LAELMYD+IREWPRYVKVPFPI
Sbjct  255  PVYVVDVAGAVIQALKDDGISMGKTYELGGPEVFTIHELAELMYDMIREWPRYVKVPFPI  314

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A+PRE++L KVPFPLPTP IFNLD I ALTTDTLVS+NALTF+DLGIVPHKLKGYP
Sbjct  315  AKALASPREVMLNKVPFPLPTPQIFNLDQINALTTDTLVSDNALTFQDLGIVPHKLKGYP  374

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VEYLIQYRKGGPQ+GSTVSEK+  D  P
Sbjct  375  VEYLIQYRKGGPQFGSTVSEKVPTDFDP  402



>gb|AFK48198.1| unknown [Lotus japonicus]
Length=396

 Score =   356 bits (913),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA AEEA+LRE+PEATILKPA MIGTEDRILN WA FAK Y FLPL G G+TKIQ
Sbjct  189  RMLRAKAAAEEAILRELPEATILKPATMIGTEDRILNRWAHFAKKYSFLPLFGDGSTKIQ  248

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+A+ A+LKDDGTSMGKVYELGGPE++T+H+LAELMY+VIREWPRYVKVPFPI
Sbjct  249  PVYVVDVANALTAALKDDGTSMGKVYELGGPEVYTMHELAELMYEVIREWPRYVKVPFPI  308

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A+PRELL+ K+PFPLPTP+IFNLD I ALTTDT+VSENALTF DLGI P KLKGYP
Sbjct  309  AKALASPRELLINKLPFPLPTPNIFNLDQIRALTTDTVVSENALTFNDLGINPQKLKGYP  368

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
             E+LI YRKGGPQ+GST+SE++SPD++P
Sbjct  369  TEFLISYRKGGPQFGSTISERVSPDAWP  396



>ref|XP_010936110.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Elaeis guineensis]
Length=398

 Score =   355 bits (912),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA AEE+VLR  PEATI+KP +MIGTEDRILN WAQFAK + FLPLIG G+TKIQ
Sbjct  192  RMLRAKAAAEESVLRVFPEATIMKPGIMIGTEDRILNRWAQFAKKWSFLPLIGDGSTKIQ  251

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AIIASLKDDG+SMGK+YELGGPE+FTVHQLAELMYD+IREWPRYVK+PFPI
Sbjct  252  PVYVVDVAAAIIASLKDDGSSMGKIYELGGPELFTVHQLAELMYDMIREWPRYVKIPFPI  311

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A+PRE LLKKVPFPLP P IFNLD I ALT DTLVSENALTF DLGIVPHKLKGYP
Sbjct  312  AKALASPREFLLKKVPFPLPNPDIFNLDQINALTVDTLVSENALTFSDLGIVPHKLKGYP  371

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSY  179
            VEYLI YRKGGP YGSTVSE+++   +
Sbjct  372  VEYLICYRKGGPAYGSTVSERVTGSEF  398



>ref|XP_010540921.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Tarenaya hassleriana]
Length=402

 Score =   355 bits (911),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 186/208 (89%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RMR+ KA AEEA+L+ +PEATI++PA MIGTED+ILNPWAQF K Y FLPLIG GTTKIQ
Sbjct  195  RMRRTKAAAEEAILKVLPEATIMRPATMIGTEDKILNPWAQFVKKYSFLPLIGDGTTKIQ  254

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA A++ +LKDDG+SMGK YELGGPE+FT+H+LAELM+D+IREWPRYVKVPFPI
Sbjct  255  PVYVVDVAGAVVQALKDDGSSMGKTYELGGPEVFTIHELAELMFDMIREWPRYVKVPFPI  314

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AK +A+PRE+LL K+PFPLPTP IFNLD I ALTTDTLVS NALTF+DLGI PHKLKGYP
Sbjct  315  AKVMASPREVLLNKLPFPLPTPQIFNLDQINALTTDTLVSGNALTFQDLGIAPHKLKGYP  374

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VEYLIQYRKGGPQ+GSTVSEK+  D YP
Sbjct  375  VEYLIQYRKGGPQFGSTVSEKVPTDFYP  402



>ref|XP_002271401.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Vitis vinifera]
 emb|CBI37199.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM  AKA AEEAVLRE+PEATI++PAVMIGTEDRILN WAQFAK YGFLPL G G+TK Q
Sbjct  192  RMLMAKAAAEEAVLRELPEATIMRPAVMIGTEDRILNRWAQFAKKYGFLPLYGDGSTKFQ  251

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+A+LKDDGTSMGKVYELGGPEIFT+H+LA +MYD IREWPRYVKVPFPI
Sbjct  252  PVYVIDVAAAIMAALKDDGTSMGKVYELGGPEIFTMHELAAVMYDTIREWPRYVKVPFPI  311

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+  PRE+LL KVPFPLPTP +FNLD+I A T+DT+VSENALTF+DLGIVPHKLKGYP
Sbjct  312  AKAMTLPREILLNKVPFPLPTPGLFNLDLINAFTSDTVVSENALTFDDLGIVPHKLKGYP  371

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            +E+L+ YRKGGPQ+GST+SE++ P+++P
Sbjct  372  IEFLLSYRKGGPQFGSTISERVDPEAFP  399



>ref|XP_009395307.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Musa acuminata subsp. malaccensis]
Length=397

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 187/205 (91%), Gaps = 0/205 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA AEEAVLR+ PEATI+KP +MIGTEDRILN WAQFAK + FLPLIG G+TKIQ
Sbjct  193  RMLRAKAAAEEAVLRQFPEATIMKPGIMIGTEDRILNRWAQFAKKWSFLPLIGDGSTKIQ  252

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+ASLKDDG+SMGKVYELGGPE++T+HQLAELMYD+IREWPRYVK+PFPI
Sbjct  253  PVYVIDVAAAIMASLKDDGSSMGKVYELGGPEVYTLHQLAELMYDMIREWPRYVKIPFPI  312

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAIATPRELLLKKVPFPLP P IFNLD I + T DT+VS+NALTF+DLGIVPHKLKGYP
Sbjct  313  AKAIATPRELLLKKVPFPLPNPDIFNLDQINSFTVDTVVSDNALTFKDLGIVPHKLKGYP  372

Query  259  VEYLIQYRKGGPQYGSTVSEKISPD  185
            VEYLI YRKGGP +GSTVSE+++ +
Sbjct  373  VEYLISYRKGGPSFGSTVSERVTAE  397



>ref|XP_004247128.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Solanum lycopersicum]
Length=401

 Score =   354 bits (908),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R+ +AKA  EEAV RE+PEATIL+P+VMIGTEDRILNPWA FAK YGFLPLIGGG+TKIQ
Sbjct  194  RLLRAKAAGEEAVTRELPEATILRPSVMIGTEDRILNPWAFFAKKYGFLPLIGGGSTKIQ  253

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PV+V DVASAI++SLKD+GTSMGKVYELGGP+I+T+H LAELM+D+IREWPRYV VPFPI
Sbjct  254  PVFVADVASAIVSSLKDNGTSMGKVYELGGPDIYTMHDLAELMFDMIREWPRYVNVPFPI  313

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAIA+PRE LL KVP P+P P+IFNLD I+AL TD +VS++ALTFEDLG+ PHK+KGYP
Sbjct  314  AKAIASPREFLLNKVPTPMPVPTIFNLDAIKALATDNVVSKDALTFEDLGLAPHKVKGYP  373

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VE+LIQYRKGGP YGSTVSEK+SP+SYP
Sbjct  374  VEFLIQYRKGGPNYGSTVSEKMSPESYP  401



>ref|XP_011024495.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Populus euphratica]
Length=399

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA  EEAVLRE+PEAT++KPAVMIGTEDRILN WA FAK Y FLPLIG G+TKIQ
Sbjct  192  RMLRAKAAGEEAVLREMPEATVMKPAVMIGTEDRILNRWAHFAKKYSFLPLIGDGSTKIQ  251

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AIIA+LKDDG+SMGKVYELGGPEIFTVH+LA+LMYDVIREWPRYVKVPFPI
Sbjct  252  PVYVVDVAAAIIAALKDDGSSMGKVYELGGPEIFTVHELADLMYDVIREWPRYVKVPFPI  311

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+ATPR +L+ KVPFPLPTP+IFNLD I ALT +++VSENALTF DLGIVPHKLKGYP
Sbjct  312  AKALATPRAVLINKVPFPLPTPNIFNLDEINALTINSVVSENALTFSDLGIVPHKLKGYP  371

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            +E+LI YRKGGPQ+GST+SE++SPDS+P
Sbjct  372  IEFLISYRKGGPQFGSTISERVSPDSFP  399



>ref|XP_006355892.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Solanum tuberosum]
Length=401

 Score =   353 bits (906),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R+ +AKA  EEAV RE+PEATI++PAVMIGTEDRILNPWA FAK YGFLPLIGGG+TKIQ
Sbjct  194  RLLRAKAAGEEAVTRELPEATIMRPAVMIGTEDRILNPWAFFAKKYGFLPLIGGGSTKIQ  253

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PV+V DVASAI++SLKD+GTSMGKVYELGGP+I+T+H LAELM+D+IREWPRYV VPFPI
Sbjct  254  PVFVADVASAIVSSLKDNGTSMGKVYELGGPDIYTMHDLAELMFDMIREWPRYVNVPFPI  313

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAIA+PRE LL KVP P+P P+IFNLD I+A  TD +VS++ALTFEDLG+ PHK+KGYP
Sbjct  314  AKAIASPREFLLNKVPTPMPVPTIFNLDAIKAFATDNIVSKDALTFEDLGLAPHKVKGYP  373

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VE+LIQYRKGGP YGSTVSEK+SP+SYP
Sbjct  374  VEFLIQYRKGGPNYGSTVSEKMSPESYP  401



>gb|ABK94679.1| unknown [Populus trichocarpa]
Length=399

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA  EEAVLRE+PEAT++KPAVMIGTEDRILN WA FAK Y FLPLIG G+TKIQ
Sbjct  192  RMLRAKAAGEEAVLREMPEATVMKPAVMIGTEDRILNRWAHFAKKYSFLPLIGDGSTKIQ  251

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AIIA+LKDDG+SMGKVYELGGPEIFTVH+LA+LM+DVIREWPRYVKVPFPI
Sbjct  252  PVYVVDVAAAIIAALKDDGSSMGKVYELGGPEIFTVHELADLMHDVIREWPRYVKVPFPI  311

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+ATPR +L+ KVPFPLP P IFNLD I ALT D++VSENALTF DLGIVPHKLKGYP
Sbjct  312  AKALATPRAVLINKVPFPLPAPKIFNLDEINALTIDSVVSENALTFNDLGIVPHKLKGYP  371

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            +E+LI YRKGGPQ+GST+SE++SPDS+P
Sbjct  372  IEFLISYRKGGPQFGSTISERVSPDSFP  399



>gb|ACU23211.1| unknown [Glycine max]
Length=396

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM + K+ AEE +LRE+PEATILKPAVMIGTEDRILNPWA FAK YGFLPL G G+TKIQ
Sbjct  189  RMLRTKSAAEEMILRELPEATILKPAVMIGTEDRILNPWAHFAKKYGFLPLFGDGSTKIQ  248

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+A+ + LKDDGTSMGK+YELGGPEIFTVH+LA++M+D IREWPRYVKVPFPI
Sbjct  249  PVYVIDVAAALTSLLKDDGTSMGKIYELGGPEIFTVHELADVMFDTIREWPRYVKVPFPI  308

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+ATPRE+LL KVPFPLP P I NLD I+ALTTDT+VSENALTF DLGIVPHKLK YP
Sbjct  309  AKALATPREILLNKVPFPLPVPEILNLDKIQALTTDTVVSENALTFNDLGIVPHKLKEYP  368

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            +E+LI YRKGGPQ+GST+SE+++PD +P
Sbjct  369  IEFLISYRKGGPQFGSTISERVTPDFWP  396



>ref|XP_004495054.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Cicer arietinum]
Length=396

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 185/208 (89%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM + KA AEEA+LRE+PEATIL+PAVMIGTEDRILN WA +AK YGFLPL+G G TKIQ
Sbjct  189  RMLRCKAAAEEAILRELPEATILRPAVMIGTEDRILNQWAHYAKKYGFLPLMGNGNTKIQ  248

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+A+ A+LKDDGTSMGK YELGGPEIFTVH+LA++M+DVIREWPRYV VP PI
Sbjct  249  PVYVVDVAAALTAALKDDGTSMGKTYELGGPEIFTVHELADIMFDVIREWPRYVNVPLPI  308

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+ATPRELLL KVPFPLP P +FNLD I A  TDT+VSENALTF DLGIVPHKLKGYP
Sbjct  309  AKALATPRELLLNKVPFPLPKPEMFNLDQIHAFATDTVVSENALTFNDLGIVPHKLKGYP  368

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            +EYLI +RKGGP++GSTVSEK+SP+ +P
Sbjct  369  IEYLISHRKGGPRFGSTVSEKVSPEDWP  396



>ref|XP_002301843.1| hypothetical protein POPTR_0002s25720g [Populus trichocarpa]
 gb|EEE81116.1| hypothetical protein POPTR_0002s25720g [Populus trichocarpa]
Length=399

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA  EEAVLRE+PEAT++KPAVMIGTEDRILN WA FAK Y FLPLIG G+TKIQ
Sbjct  192  RMLRAKAAGEEAVLREMPEATVMKPAVMIGTEDRILNRWAHFAKKYSFLPLIGDGSTKIQ  251

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AIIA+LKDDG+SMGKVYELGGPEIFTVH+LA+LM+DVIREWPRYVKVPFPI
Sbjct  252  PVYVVDVAAAIIAALKDDGSSMGKVYELGGPEIFTVHELADLMHDVIREWPRYVKVPFPI  311

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+ATPR +L+ KVPFPLP P IFNLD I ALT D++VSENALTF DLGIVPHKLKGYP
Sbjct  312  AKALATPRAVLINKVPFPLPAPKIFNLDEINALTIDSVVSENALTFNDLGIVPHKLKGYP  371

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            +E+LI YRKGGPQ+GST+SE++SPDS+P
Sbjct  372  IEFLISYRKGGPQFGSTISERVSPDSFP  399



>ref|XP_008459972.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
1 alpha subcomplex subunit 9, mitochondrial [Cucumis melo]
Length=402

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 186/208 (89%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  ++KA  EE+VL+  PEATIL+PA MIGTEDRI+NPWA F K YGF+PL G G+TKIQ
Sbjct  195  RFLRSKAAGEESVLKAFPEATILRPATMIGTEDRIMNPWAHFLKKYGFIPLFGDGSTKIQ  254

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+ I+++LKDDGTS+GKVYELGGPEI+TVH LAELMYD+IREWPRY+KVPFPI
Sbjct  255  PVYVVDVAAGIVSALKDDGTSIGKVYELGGPEIYTVHDLAELMYDMIREWPRYLKVPFPI  314

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAIATPRE+LL KVPFPLPTPSIFNLD I ALT DT+VSE ALTF DLGI+PHKLKGYP
Sbjct  315  AKAIATPREILLNKVPFPLPTPSIFNLDQILALTQDTVVSEKALTFNDLGIIPHKLKGYP  374

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            +E+LI YRKGGPQ+GSTVSEK+SPDS+P
Sbjct  375  IEFLISYRKGGPQFGSTVSEKVSPDSFP  402



>gb|EYU46388.1| hypothetical protein MIMGU_mgv1a007681mg [Erythranthe guttata]
 gb|EYU46389.1| hypothetical protein MIMGU_mgv1a007681mg [Erythranthe guttata]
Length=399

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            ++ + KA AEEA+LRE+PEAT+++PAVMIGTEDRILNPWA FAK Y F+PL+G G+TKIQ
Sbjct  193  KLLRTKAAAEEAILRELPEATVVRPAVMIGTEDRILNPWAHFAKKYSFIPLMGDGSTKIQ  252

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVASAIIA+LKDDG+SMGKVYELGGP+I+T+HQLAELM++ IRE+P YVK+PFPI
Sbjct  253  PVYVVDVASAIIAALKDDGSSMGKVYELGGPDIYTMHQLAELMFETIREYPHYVKIPFPI  312

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAI+TPRELLLKKVPFPLP P+IFNLD+IE+L+TDT+VSENALTFEDLGI P KLKGYP
Sbjct  313  AKAISTPRELLLKKVPFPLPVPTIFNLDLIESLSTDTVVSENALTFEDLGIAPRKLKGYP  372

Query  259  VEYLIQYRKGGPQYGSTVSEKISP  188
            VE+LIQYRKGGP YGSTVSEKISP
Sbjct  373  VEFLIQYRKGGPNYGSTVSEKISP  396



>ref|XP_007201067.1| hypothetical protein PRUPE_ppa006705mg [Prunus persica]
 gb|EMJ02266.1| hypothetical protein PRUPE_ppa006705mg [Prunus persica]
Length=399

 Score =   351 bits (901),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 185/208 (89%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  +AKA AEEAVLRE+PEAT+L+PAV+IGTEDRILN WA FAK YGFLPLIG G+TKIQ
Sbjct  192  RFLRAKAAAEEAVLRELPEATVLRPAVLIGTEDRILNRWAFFAKKYGFLPLIGDGSTKIQ  251

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA AI+A+LKDDGTSMGKVYELGGPE+FTVHQLAELM++ IREWP YVKVP PI
Sbjct  252  PVYVVDVAGAIVAALKDDGTSMGKVYELGGPEVFTVHQLAELMFETIREWPHYVKVPLPI  311

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAIA PRE+LL KVPFPLP P IFN D I A  TDT+VSEN+LTF DLG+VPHKLKGYP
Sbjct  312  AKAIAAPREILLNKVPFPLPNPEIFNRDQILAQATDTVVSENSLTFSDLGLVPHKLKGYP  371

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VE+LIQYRKGGP YGSTVSE++SPD++P
Sbjct  372  VEFLIQYRKGGPNYGSTVSERVSPDAWP  399



>ref|XP_011656761.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Cucumis sativus]
 gb|KGN46368.1| hypothetical protein Csa_6G087960 [Cucumis sativus]
Length=401

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 185/208 (89%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  ++KA  EE+VL+  PEATIL+PA MIGTEDRILNPWA FAK YGF+PL G G+TKIQ
Sbjct  194  RFLRSKAAGEESVLKAFPEATILRPATMIGTEDRILNPWAHFAKKYGFIPLFGNGSTKIQ  253

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA  I+++LKDDGTS+GKVYELGGPEI++VH LAELM+DVIREWP Y+KVPFPI
Sbjct  254  PVYVVDVAGGIVSALKDDGTSIGKVYELGGPEIYSVHDLAELMFDVIREWPHYLKVPFPI  313

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAIATPRE+LL KVPFPLPTP+IFNLD I ALT DT+VSE ALTF DLGIVPHKLKGYP
Sbjct  314  AKAIATPREILLNKVPFPLPTPAIFNLDQILALTQDTVVSEKALTFNDLGIVPHKLKGYP  373

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VE+LI YRKGGPQ+GSTVSE+++PDS+P
Sbjct  374  VEFLISYRKGGPQFGSTVSERVNPDSFP  401



>ref|XP_008372401.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Malus domestica]
Length=399

 Score =   349 bits (896),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 182/208 (88%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R    KATAEEAVL E+PEATIL+PAVM+GTEDRILN WA FAK YGFLPLIG G+TK Q
Sbjct  192  RFLSTKATAEEAVLSELPEATILRPAVMVGTEDRILNRWAFFAKKYGFLPLIGDGSTKFQ  251

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA AI+A+LKDDGTSMGK+YELGGPE+FT+HQLAELM+D IREWPRYVKVP PI
Sbjct  252  PVYVVDVAGAIVAALKDDGTSMGKIYELGGPEVFTMHQLAELMFDTIREWPRYVKVPLPI  311

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+  PRE+LL KVPFPLP P IFN D I A  TDTLVSENALTF DLG+VPHKLKGYP
Sbjct  312  AKAMGAPREILLNKVPFPLPNPEIFNRDQILAQATDTLVSENALTFSDLGLVPHKLKGYP  371

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            +EYLIQ+RKGGP YGSTVSE++SPD++P
Sbjct  372  IEYLIQFRKGGPNYGSTVSERVSPDAWP  399



>gb|EPS69627.1| hypothetical protein M569_05135, partial [Genlisea aurea]
Length=360

 Score =   348 bits (892),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM + KA AEE+V REIPEATIL+PA M+GTEDRILNPWAQF KN+ FLPLIG G+T+IQ
Sbjct  153  RMLRTKAAAEESVFREIPEATILRPAAMVGTEDRILNPWAQFVKNFSFLPLIGNGSTRIQ  212

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVASAI+++LKDDG SMGKVYELGGP+I+TVH+LAELM+D IREWPRY+ VP+PI
Sbjct  213  PVYVVDVASAIVSALKDDGRSMGKVYELGGPDIYTVHELAELMFDTIREWPRYLNVPYPI  272

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAIA PRE  LKKVPFPLPTP IFNLD I+  ++DTLVSENAL F+DLGI P KLKGYP
Sbjct  273  AKAIAVPREFFLKKVPFPLPTPKIFNLDQIKEFSSDTLVSENALKFQDLGIAPRKLKGYP  332

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSY  179
            VEYLIQYRKGGPQYGSTVSEK  P S+
Sbjct  333  VEYLIQYRKGGPQYGSTVSEKELPRSW  359



>ref|XP_009335235.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Pyrus x bretschneideri]
Length=399

 Score =   348 bits (893),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 182/208 (88%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  + KA AEEAVL E+PEATIL+PAVM+GTEDRILN WA FAK YGFLPLIG G+TK Q
Sbjct  192  RFLRTKAAAEEAVLSELPEATILRPAVMVGTEDRILNRWAFFAKKYGFLPLIGDGSTKFQ  251

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA AI+A+LKDDGTSMGKVYELGGPE+FT+HQLAELM+D IREWPRYVKVP PI
Sbjct  252  PVYVVDVAGAIVAALKDDGTSMGKVYELGGPEVFTMHQLAELMFDTIREWPRYVKVPLPI  311

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+  PRE+LL KVPFPLP P IFN D I A  TDTLVSENALTF DLG+VPHKLKGYP
Sbjct  312  AKAMGAPREILLNKVPFPLPNPEIFNRDQILAQETDTLVSENALTFNDLGLVPHKLKGYP  371

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            +E+LIQ+RKGGP YGSTVSE++SPD++P
Sbjct  372  IEFLIQFRKGGPNYGSTVSERVSPDAWP  399



>ref|XP_010036149.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Eucalyptus grandis]
 gb|KCW47684.1| hypothetical protein EUGRSUZ_K01422 [Eucalyptus grandis]
Length=394

 Score =   347 bits (891),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E A+LRE+PEATIL+PAVMIGTEDRILN WA FAK Y FLPLIGGG+TKIQPVY
Sbjct  190  QTKAAGEAALLRELPEATILRPAVMIGTEDRILNTWAHFAKKYSFLPLIGGGSTKIQPVY  249

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA+A++++LKDDG+SMGK+YELGGP++FTV +LAELMYD+IREWPRYV VPFPIAKA
Sbjct  250  VFDVAAAVVSALKDDGSSMGKIYELGGPDVFTVRELAELMYDMIREWPRYVSVPFPIAKA  309

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
             A PRELLLKKVPFPLP P IFNLD I ALT DT+VS++ALTF DLGIVPHK+KGYPVE+
Sbjct  310  FAMPRELLLKKVPFPLPNPDIFNLDQINALTEDTVVSKDALTFNDLGIVPHKVKGYPVEF  369

Query  250  LIQYRKGGPQYGSTVSEKISPDSYP  176
            LI YRKGGP +GSTVSE++SPD+YP
Sbjct  370  LISYRKGGPNFGSTVSERVSPDAYP  394



>ref|XP_008382707.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Malus domestica]
Length=437

 Score =   345 bits (885),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 181/208 (87%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  + KA AEEAVL E+PEATIL+PAVM+GTEDRILN WA FAK YGFLPLIG G+TK Q
Sbjct  230  RFLRTKAAAEEAVLSELPEATILRPAVMVGTEDRILNRWAFFAKKYGFLPLIGDGSTKFQ  289

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA AI+A+LKDDGTSMGKVYELGGPE FT+HQLAELM+D IREWPRYVKVP PI
Sbjct  290  PVYVVDVAGAIVAALKDDGTSMGKVYELGGPEXFTMHQLAELMFDTIREWPRYVKVPLPI  349

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+  PRE+LL KVPFPLP P IFN D I A  TDTLVSENAL+F DLG+VPHKLKGYP
Sbjct  350  AKAMGAPREILLNKVPFPLPNPEIFNRDQILAQATDTLVSENALSFNDLGLVPHKLKGYP  409

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            +E+LIQ+RKGGP YGSTVSE++SPD++P
Sbjct  410  IEFLIQFRKGGPNYGSTVSERVSPDAWP  437



>ref|XP_009370595.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Pyrus x bretschneideri]
Length=399

 Score =   343 bits (881),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 180/208 (87%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  + KA AEEAVL E+PEATIL+PAVM+GTEDRILN WA FAK YGFLPL+G G+TK Q
Sbjct  192  RFLRTKAAAEEAVLSELPEATILRPAVMVGTEDRILNRWAFFAKKYGFLPLVGDGSTKFQ  251

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA AI+A+LKDDGTSMGK+YELGGPE+FT+HQLAELM+D IREWPRYVKVP PI
Sbjct  252  PVYVVDVAGAIVAALKDDGTSMGKIYELGGPEVFTMHQLAELMFDTIREWPRYVKVPLPI  311

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAI  PRE+LL KVPFPLP P IFN D I A  TDTLVSENALTF DLG+VPHKLKGYP
Sbjct  312  AKAIGAPREILLNKVPFPLPNPEIFNRDQILAQATDTLVSENALTFSDLGLVPHKLKGYP  371

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            +E+LIQ+RKGGP YGSTVSE+ SP ++P
Sbjct  372  IEFLIQFRKGGPNYGSTVSERGSPHAWP  399



>dbj|BAG95473.1| unnamed protein product [Oryza sativa Japonica Group]
Length=311

 Score =   340 bits (872),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA  EE+VL+E PEATI++PA MIGTEDRILN WAQFAKN+GFLPL+  G+TKIQ
Sbjct  105  RMLRAKAAGEESVLKEFPEATIMRPATMIGTEDRILNRWAQFAKNWGFLPLVDSGSTKIQ  164

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+ SLKDDGTSMGK YELGGPEI+TVH+LAELMY+ IREWPRY+ VP PI
Sbjct  165  PVYVVDVAAAIVNSLKDDGTSMGKTYELGGPEIYTVHELAELMYETIREWPRYIDVPLPI  224

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            A+AIA+PRE+LL KVPFPLPTPSIFN D I A + DTLVS+NALTF DLGIVPHKLKGYP
Sbjct  225  ARAIASPREMLLNKVPFPLPTPSIFNKDQINAFSVDTLVSDNALTFSDLGIVPHKLKGYP  284

Query  259  VEYLIQYRKGGPQYGSTVSEKI  194
            VE+L+ YRKGGP +GSTVSEKI
Sbjct  285  VEFLVCYRKGGPAFGSTVSEKI  306



>ref|XP_004954373.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Setaria italica]
Length=408

 Score =   343 bits (880),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            +M +AKA  EE++L+E PEATI++PA MIGTEDRILN WAQFAKN+GFLPL+GGG++KIQ
Sbjct  202  KMLRAKAAGEESILKEFPEATIMRPATMIGTEDRILNRWAQFAKNWGFLPLVGGGSSKIQ  261

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+ SLKDDGTSMGK+YELGGPEI+TVH+LAELMY+ IREWPRYV VP P+
Sbjct  262  PVYVIDVAAAIVNSLKDDGTSMGKIYELGGPEIYTVHELAELMYETIREWPRYVNVPLPV  321

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            A+AIA+PRE+LL KVPFPLPTPSIFNLD I A + D LVSE+ALTFEDLGI+P KLKGYP
Sbjct  322  ARAIASPREMLLNKVPFPLPTPSIFNLDQINAFSVDNLVSEDALTFEDLGIMPQKLKGYP  381

Query  259  VEYLIQYRKGGPQYGSTVSEKI  194
            VEYL+ YRKGGP +GSTVSEK+
Sbjct  382  VEYLLSYRKGGPAFGSTVSEKM  403



>ref|XP_006648113.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Oryza brachyantha]
Length=360

 Score =   340 bits (873),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA  EE+VL+E PEATI++PA MIGTEDRILN WAQFAKN+ FLPL+ GGTTKIQ
Sbjct  154  RMLRAKAAGEESVLKEFPEATIMRPATMIGTEDRILNRWAQFAKNWSFLPLVDGGTTKIQ  213

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+ SLKDDGTSMGK YELGGPEI+TVH+LAELMY+ IREWPRY+ VP P+
Sbjct  214  PVYVVDVAAAIVNSLKDDGTSMGKTYELGGPEIYTVHELAELMYETIREWPRYINVPLPV  273

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            A+AI++PRE+LL KVPFPLP+PSIFNLD I A + D LVSENALTF DLGI+PHKLKGYP
Sbjct  274  ARAISSPREMLLNKVPFPLPSPSIFNLDQINAFSVDNLVSENALTFADLGIMPHKLKGYP  333

Query  259  VEYLIQYRKGGPQYGSTVSEKI  194
            VE+L+ YRKGGP +GSTVSEKI
Sbjct  334  VEFLVCYRKGGPAFGSTVSEKI  355



>ref|XP_006854436.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Amborella trichopoda]
 gb|ERN15903.1| hypothetical protein AMTR_s00039p00218660 [Amborella trichopoda]
Length=397

 Score =   341 bits (875),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA AEEA+LR+ PEATI+KPAVMIGTEDRILN WAQF K + FLPLIG G+TKIQ
Sbjct  190  RMLRAKAAAEEAILRQFPEATIMKPAVMIGTEDRILNRWAQFVKKWSFLPLIGDGSTKIQ  249

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV D A+AIIASLKDDGTSMGK YELGGPE+FTVHQLAELMYD IREWPRYVKVPFPI
Sbjct  250  PVYVVDAAAAIIASLKDDGTSMGKTYELGGPEVFTVHQLAELMYDTIREWPRYVKVPFPI  309

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A+PRE+LL+KVPFPLPTP +FNLD I +LT DT+VSE ALTFE+LGIVP KLKGYP
Sbjct  310  AKALASPREILLRKVPFPLPTPDVFNLDYINSLTVDTVVSEKALTFENLGIVPRKLKGYP  369

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSY  179
            +E+LI YRKGGPQYGSTVSE+++   Y
Sbjct  370  IEFLISYRKGGPQYGSTVSERVTGPEY  396



>ref|NP_001048516.1| Os02g0816800 [Oryza sativa Japonica Group]
 dbj|BAD21515.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAD22016.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF10430.1| Os02g0816800 [Oryza sativa Japonica Group]
Length=408

 Score =   341 bits (874),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA  EE+VL+E PEATI++PA MIGTEDRILN WAQFAKN+GFLPL+  G+TKIQ
Sbjct  202  RMLRAKAAGEESVLKEFPEATIMRPATMIGTEDRILNRWAQFAKNWGFLPLVDSGSTKIQ  261

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+ SLKDDGTSMGK YELGGPEI+TVH+LAELMY+ IREWPRY+ VP PI
Sbjct  262  PVYVVDVAAAIVNSLKDDGTSMGKTYELGGPEIYTVHELAELMYETIREWPRYIDVPLPI  321

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            A+AIA+PRE+LL KVPFPLPTPSIFN D I A + DTLVS+NALTF DLGIVPHKLKGYP
Sbjct  322  ARAIASPREMLLNKVPFPLPTPSIFNKDQINAFSVDTLVSDNALTFSDLGIVPHKLKGYP  381

Query  259  VEYLIQYRKGGPQYGSTVSEKI  194
            VE+L+ YRKGGP +GSTVSEKI
Sbjct  382  VEFLVCYRKGGPAFGSTVSEKI  403



>gb|EEC74241.1| hypothetical protein OsI_09443 [Oryza sativa Indica Group]
Length=408

 Score =   341 bits (874),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA  EE+VL+E PEATI++PA MIGTEDRILN WAQFAKN+GFLPL+  G+TKIQ
Sbjct  202  RMLRAKAAGEESVLKEFPEATIMRPATMIGTEDRILNRWAQFAKNWGFLPLVDSGSTKIQ  261

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+ SLKDDGTSMGK YELGGPEI+TVH+LAELMY+ IREWPRY+ VP PI
Sbjct  262  PVYVVDVAAAIVNSLKDDGTSMGKTYELGGPEIYTVHELAELMYETIREWPRYIDVPLPI  321

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            A+AIA+PRE+LL KVPFPLPTPSIFN D I A + DTLVS+NALTF DLGIVPHKLKGYP
Sbjct  322  ARAIASPREMLLNKVPFPLPTPSIFNKDQINAFSVDTLVSDNALTFSDLGIVPHKLKGYP  381

Query  259  VEYLIQYRKGGPQYGSTVSEKI  194
            VE+L+ YRKGGP +GSTVSEKI
Sbjct  382  VEFLVCYRKGGPAFGSTVSEKI  403



>ref|XP_002453037.1| hypothetical protein SORBIDRAFT_04g037200 [Sorghum bicolor]
 gb|EES06013.1| hypothetical protein SORBIDRAFT_04g037200 [Sorghum bicolor]
Length=408

 Score =   340 bits (872),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R+ + KA  E+++L+E PEATI++PA MIGTEDRILN WAQFAKN+GFLPL+GGG+TKIQ
Sbjct  202  RLLRTKAAGEQSILKEFPEATIMRPATMIGTEDRILNRWAQFAKNWGFLPLVGGGSTKIQ  261

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+ SLKDDGTSMGK+YELGGPEI+TVH+LAELMY+ IREWPRYV VP P+
Sbjct  262  PVYVIDVAAAIVNSLKDDGTSMGKIYELGGPEIYTVHELAELMYETIREWPRYVNVPLPV  321

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            A+AIA+PRE+LL KVPFPLPTPSIFNLD I A   D LVSE+ALTFEDLGI+P KLKGYP
Sbjct  322  ARAIASPREMLLNKVPFPLPTPSIFNLDQINAFAVDNLVSEDALTFEDLGIMPQKLKGYP  381

Query  259  VEYLIQYRKGGPQYGSTVSEKI  194
            VE+L+ YRKGGP +GSTVSEK+
Sbjct  382  VEFLVSYRKGGPSFGSTVSEKM  403



>ref|XP_011458045.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Fragaria vesca subsp. vesca]
Length=397

 Score =   340 bits (871),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 183/208 (88%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  +AKA AE AVL  +PEAT+++PAVMIGTEDRILN WA  +K YGFLPLIG G+TKIQ
Sbjct  190  RYLRAKAAAEGAVLSALPEATVMRPAVMIGTEDRILNRWAFVSKKYGFLPLIGDGSTKIQ  249

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA AI+++L+DDGTSMGKVYELGGP+++TVHQLAELM+D+IREWP YVK+P PI
Sbjct  250  PVYVADVAGAIVSALQDDGTSMGKVYELGGPDVYTVHQLAELMFDMIREWPHYVKIPIPI  309

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAIA PRE+LLKKVPFPLP P IFNLD I A   DT+VSENALTF DLGI+PHK+KGYP
Sbjct  310  AKAIAMPREILLKKVPFPLPNPEIFNLDQILAQAPDTVVSENALTFNDLGILPHKIKGYP  369

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            +E+LIQYRKGGP +GSTVSEK+SPDSYP
Sbjct  370  IEFLIQYRKGGPNFGSTVSEKVSPDSYP  397



>ref|XP_012085214.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Jatropha curcas]
 gb|KDP26455.1| hypothetical protein JCGZ_17613 [Jatropha curcas]
Length=396

 Score =   340 bits (871),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA AEEAVLREIPEAT+LKPAVMIGTEDRILN WA FAK Y FLPL G G+TKIQ
Sbjct  189  RMLRAKAAAEEAVLREIPEATVLKPAVMIGTEDRILNRWAHFAKKYSFLPLFGDGSTKIQ  248

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+A+IA+LKDDGTSMGKVYELGGPEIFTVH+LAELM+D IREWPRYVK+PFPI
Sbjct  249  PVYVVDVAAAVIAALKDDGTSMGKVYELGGPEIFTVHELAELMFDTIREWPRYVKIPFPI  308

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A PRE+LL KVPFPLPTP+I NLD I AL+ DT+VS++ALTF DLGIVPHKLKGYP
Sbjct  309  AKALAMPREVLLNKVPFPLPTPNILNLDEINALSVDTVVSKDALTFHDLGIVPHKLKGYP  368

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VE+LI YRKGGPQ+GSTVSE++SPDS+P
Sbjct  369  VEFLISYRKGGPQFGSTVSERVSPDSFP  396



>gb|ACF85773.1| unknown [Zea mays]
 gb|ACR35734.1| unknown [Zea mays]
Length=407

 Score =   339 bits (869),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM + KA  E++V +E PEATI++PA MIGTEDRILN WAQFAKN+GFLPL+GGG+TKIQ
Sbjct  201  RMLRTKAAGEQSVFKEFPEATIMRPATMIGTEDRILNRWAQFAKNWGFLPLVGGGSTKIQ  260

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+ SLKDDGTSMGK+YELGGPEI+TVH+LAELMY+ IREWPRYV VP P+
Sbjct  261  PVYVIDVAAAIVNSLKDDGTSMGKIYELGGPEIYTVHELAELMYETIREWPRYVNVPLPV  320

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            A+AIA+PRE+LL KVPFPLPTPSIFNLD I A   D LVSE+ALTFEDL I+P KLKGYP
Sbjct  321  ARAIASPREMLLNKVPFPLPTPSIFNLDQINAFAVDNLVSEDALTFEDLSIMPQKLKGYP  380

Query  259  VEYLIQYRKGGPQYGSTVSEKI  194
            VEYL+ YRKGGP +GSTVSEK+
Sbjct  381  VEYLVSYRKGGPSFGSTVSEKM  402



>ref|XP_009370589.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Pyrus x bretschneideri]
Length=422

 Score =   338 bits (868),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 175/201 (87%), Gaps = 0/201 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  + KA AEEAVL E+PEATIL+PAVM+GTEDRILN WA FAK YGFLPL+G G+TK Q
Sbjct  192  RFLRTKAAAEEAVLSELPEATILRPAVMVGTEDRILNRWAFFAKKYGFLPLVGDGSTKFQ  251

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA AI+A+LKDDGTSMGK+YELGGPE+FT+HQLAELM+D IREWPRYVKVP PI
Sbjct  252  PVYVVDVAGAIVAALKDDGTSMGKIYELGGPEVFTMHQLAELMFDTIREWPRYVKVPLPI  311

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAI  PRE+LL KVPFPLP P IFN D I A  TDTLVSENALTF DLG+VPHKLKGYP
Sbjct  312  AKAIGAPREILLNKVPFPLPNPEIFNRDQILAQATDTLVSENALTFSDLGLVPHKLKGYP  371

Query  259  VEYLIQYRKGGPQYGSTVSEK  197
            +E+LIQ+RKGGP YGSTVSE+
Sbjct  372  IEFLIQFRKGGPNYGSTVSER  392



>ref|XP_010940664.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Elaeis guineensis]
Length=398

 Score =   337 bits (865),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA AEEAVLRE PEATI+KP  +IGTEDRILN WAQFAK + FLPLIG G+TKIQ
Sbjct  192  RMLRAKAAAEEAVLREFPEATIMKPGTLIGTEDRILNRWAQFAKKWSFLPLIGDGSTKIQ  251

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            P+YV D A+AIIASLKDDG+SMGKVYELGGP++FT+HQLAELMYD+IREWPRYVKVPFPI
Sbjct  252  PIYVVDAAAAIIASLKDDGSSMGKVYELGGPDVFTLHQLAELMYDMIREWPRYVKVPFPI  311

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A+PRE LL KVPFPLP P IFNLD I A T DT+VSENALT  DLGIVPHKLKGYP
Sbjct  312  AKALASPREFLLNKVPFPLPNPDIFNLDQINAFTVDTVVSENALTLSDLGIVPHKLKGYP  371

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSY  179
            VEYLI YRKGGP YGSTVSE+I+   +
Sbjct  372  VEYLICYRKGGPAYGSTVSERITRSDF  398



>ref|XP_009586626.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586627.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586628.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586629.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586630.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
Length=397

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -1

Query  751  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  572
            +PEATI++PAVMIGTEDRILNPWA FAK YGF+PL G G+TKIQPV+V DVASAI+ASLK
Sbjct  206  LPEATIMRPAVMIGTEDRILNPWAHFAKKYGFIPLFGDGSTKIQPVFVADVASAIVASLK  265

Query  571  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  392
            D+G SMGKVYELGGP+++T+H+LAELM+D+IREWPRYV VPFPIAKAIA+PRE LLKKVP
Sbjct  266  DNGISMGKVYELGGPDVYTMHELAELMFDMIREWPRYVNVPFPIAKAIASPREFLLKKVP  325

Query  391  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  212
             P+PTP+IFNLD IEA+TTD +VS++ALTFEDLG+ PHK+KGYPVE+LIQYRKGGP YGS
Sbjct  326  APMPTPTIFNLDAIEAITTDNIVSKDALTFEDLGLAPHKVKGYPVEFLIQYRKGGPNYGS  385

Query  211  TVSEKISPDSYP  176
            TVSE++SP+SYP
Sbjct  386  TVSERVSPESYP  397



>gb|AFW74028.1| NADH-ubiquinone oxidoreductase subunit [Zea mays]
Length=460

 Score =   338 bits (866),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM + KA  E++V +E PEATI++PA MIGTEDRILN WAQFAKN+GFLPL+GGG+TKIQ
Sbjct  254  RMLRTKAAGEQSVFKEFPEATIMRPATMIGTEDRILNRWAQFAKNWGFLPLVGGGSTKIQ  313

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+ SLKDDGTSMGK+YELGGPEI+TVH+LAELMY+ IREWPRYV VP P+
Sbjct  314  PVYVIDVAAAIVNSLKDDGTSMGKIYELGGPEIYTVHELAELMYETIREWPRYVNVPLPV  373

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            A+AIA+PRE+LL KVPFPLPTPSIFNLD I A   D LVSE+ALTFEDL I+P KLKGYP
Sbjct  374  ARAIASPREMLLNKVPFPLPTPSIFNLDQINAFAVDNLVSEDALTFEDLSIMPQKLKGYP  433

Query  259  VEYLIQYRKGGPQYGSTVSEKI  194
            VEYL+ YRKGGP +GSTVSEK+
Sbjct  434  VEYLVSYRKGGPSFGSTVSEKM  455



>ref|XP_003570393.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brachypodium distachyon]
Length=412

 Score =   336 bits (862),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 182/209 (87%), Gaps = 1/209 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA  EE+VL+E PEATI++PA +IGTEDRILN WA +AKN+GFLPL+GGG+TKIQ
Sbjct  202  RMLRAKAAGEESVLKEFPEATIMRPATLIGTEDRILNRWAMYAKNWGFLPLMGGGSTKIQ  261

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+ SLKDDGTSMGK YELGGP+I+TVH LAELM++ IREWPRYV VPFPI
Sbjct  262  PVYVVDVAAAIVNSLKDDGTSMGKTYELGGPDIYTVHDLAELMFETIREWPRYVNVPFPI  321

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            A+AIA+PRE+LL KVPFPLPTPSIFNLD I AL+ D LVSENALTF DL I PHKLKGYP
Sbjct  322  ARAIASPREMLLNKVPFPLPTPSIFNLDQINALSVDNLVSENALTFADLEIRPHKLKGYP  381

Query  259  VEYLIQYRKGGPQYGSTVSEKI-SPDSYP  176
            VE+L+ YRKGGP +GSTVSEK+ S D  P
Sbjct  382  VEFLVCYRKGGPSFGSTVSEKMGSSDVAP  410



>ref|NP_001149069.1| LOC100282690 [Zea mays]
 gb|ACG34074.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Zea mays]
Length=407

 Score =   335 bits (860),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM + KA  E++V +E PEATI++PA MIGTEDRILN WAQFAKN+GFLPL+GGG+TKIQ
Sbjct  201  RMLRTKAAGEQSVFKEFPEATIMRPATMIGTEDRILNRWAQFAKNWGFLPLVGGGSTKIQ  260

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+ SLKDDGTSMGK+YEL GPEI+TVH+LAELMY+ IREWPRYV VP P+
Sbjct  261  PVYVIDVAAAIVNSLKDDGTSMGKIYELEGPEIYTVHELAELMYETIREWPRYVNVPLPV  320

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            A+AIA+PRE+LL KVPFPLPTPSIFNLD I A   D LVSE+ALTFEDL I+P KLKGYP
Sbjct  321  ARAIASPREMLLNKVPFPLPTPSIFNLDQINAFAVDNLVSEDALTFEDLSIMPQKLKGYP  380

Query  259  VEYLIQYRKGGPQYGSTVSEKI  194
            VEYL+ YRKGGP +GSTVSEK+
Sbjct  381  VEYLVSYRKGGPSFGSTVSEKM  402



>ref|XP_008789505.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Phoenix dactylifera]
Length=398

 Score =   335 bits (859),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA AEEAVLRE PEATI+KP  +IGTEDRILN WAQF K + FLPLIG G+TKIQ
Sbjct  192  RMLRAKAAAEEAVLREFPEATIMKPGTLIGTEDRILNRWAQFIKKWSFLPLIGDGSTKIQ  251

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV D A+AIIASLKDDG+SMGKVYELGGP++FTVHQLAELMYD+IREWPRYVKVPFP+
Sbjct  252  PVYVVDAAAAIIASLKDDGSSMGKVYELGGPDVFTVHQLAELMYDMIREWPRYVKVPFPV  311

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A+PRE LL KVPFPLP P IFNLD I ALT DT+VSENALT  DLGIVPHKLKGYP
Sbjct  312  AKALASPREFLLNKVPFPLPNPDIFNLDQINALTVDTVVSENALTLSDLGIVPHKLKGYP  371

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSY  179
            VEYLI YRKGGP YG+TVSE+++   +
Sbjct  372  VEYLICYRKGGPAYGATVSERVTRSDF  398



>ref|XP_002526534.1| NADH-ubiquinone oxidoreductase 39 kD subunit, putative [Ricinus 
communis]
 gb|EEF35812.1| NADH-ubiquinone oxidoreductase 39 kD subunit, putative [Ricinus 
communis]
Length=394

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA AEEAVLREIPEAT++KPA MIGTEDRILN WA F K Y FLPL G G+TK+Q
Sbjct  193  RMLRAKAAAEEAVLREIPEATVMKPAAMIGTEDRILNKWAHFVKKYSFLPLFGDGSTKLQ  252

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AIIA+LKDDG+SMGK+YELGGPEI TVH+LAE+M+D+IREWPRYVKVPFPI
Sbjct  253  PVYVVDVAAAIIAALKDDGSSMGKIYELGGPEILTVHELAEIMFDMIREWPRYVKVPFPI  312

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAIATPRE+L+ KVPFPLPTP+IFNLD I ALT DT+VSENALTF DLGI+PHKLKGYP
Sbjct  313  AKAIATPREVLINKVPFPLPTPNIFNLDEIIALTMDTVVSENALTFHDLGIMPHKLKGYP  372

Query  259  VEYLIQYRKGGPQYGST  209
            VEYLI YRKGGPQ+GST
Sbjct  373  VEYLISYRKGGPQFGST  389



>gb|EMT17104.1| putative NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 
9, mitochondrial [Aegilops tauschii]
Length=315

 Score =   326 bits (835),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 180/209 (86%), Gaps = 1/209 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R+ +AKA  EE+VL+E PEATI++PA +IGTEDRILN WA +AKN+GFLPL GGG+TK Q
Sbjct  105  RLLRAKAAGEESVLKEFPEATIMRPATLIGTEDRILNRWAMYAKNWGFLPLFGGGSTKFQ  164

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+ SLKDDGTSMGK YELGGP+I+TVH LAE+M++ IRE+PRYV +PFPI
Sbjct  165  PVYVVDVAAAIVNSLKDDGTSMGKTYELGGPDIYTVHDLAEMMFETIREYPRYVNIPFPI  224

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A+PRE+LL KVPFPLPTPSIFNLD I+ALT D LVSENAL+F DL I PHKLKGYP
Sbjct  225  AKAMASPREMLLNKVPFPLPTPSIFNLDHIKALTVDNLVSENALSFADLEIKPHKLKGYP  284

Query  259  VEYLIQYRKGGPQYGSTVSEKI-SPDSYP  176
             E+L+ YRKGGP +GSTVSEK+ S D  P
Sbjct  285  TEFLVCYRKGGPSFGSTVSEKMGSADVAP  313



>gb|EMS47161.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Triticum urartu]
Length=315

 Score =   326 bits (835),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 180/209 (86%), Gaps = 1/209 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R+ +AKA  EE+VL+E PEATI++PA +IGTEDRILN WA +AKN+GFLPL GGG+TK Q
Sbjct  105  RLLRAKAAGEESVLKEFPEATIMRPATLIGTEDRILNRWAMYAKNWGFLPLFGGGSTKFQ  164

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+ SLKDDGTSMGK YELGGP+I+TVH LAE+M++ IRE+PRYV +PFPI
Sbjct  165  PVYVVDVAAAIVNSLKDDGTSMGKTYELGGPDIYTVHDLAEMMFETIREYPRYVNLPFPI  224

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A+PRE+LL KVPFPLPTPSIFNLD I+ALT D LVSENAL+F DL I PHKLKGYP
Sbjct  225  AKAMASPREMLLNKVPFPLPTPSIFNLDQIKALTVDNLVSENALSFADLEIKPHKLKGYP  284

Query  259  VEYLIQYRKGGPQYGSTVSEKI-SPDSYP  176
             E+L+ YRKGGP +GSTVSEK+ S D  P
Sbjct  285  TEFLVCYRKGGPSFGSTVSEKMGSADVAP  313



>dbj|BAH20309.1| AT2G20360 [Arabidopsis thaliana]
Length=335

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 184/208 (88%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA AEEAVL  +PEATI++PA MIGTEDRILNPW+ F K YGFLPLIGGGTTK Q
Sbjct  128  RMLRAKAAAEEAVLNALPEATIMRPATMIGTEDRILNPWSMFVKKYGFLPLIGGGTTKFQ  187

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+A+LKDDG+SMGK YELGGP++FT H+LAE+MYD+IREWPRYVK+PFPI
Sbjct  188  PVYVVDVAAAIVAALKDDGSSMGKTYELGGPDVFTTHELAEIMYDMIREWPRYVKLPFPI  247

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A PR+ ++ KVPFPLP+P IFNLD I ALTTDTLVS+NAL F+DL +VPHKLKGYP
Sbjct  248  AKAMAAPRDFMVNKVPFPLPSPQIFNLDQINALTTDTLVSDNALKFQDLDLVPHKLKGYP  307

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VE+LIQYRKGGP +GSTVSEKI  D YP
Sbjct  308  VEFLIQYRKGGPNFGSTVSEKIPTDFYP  335



>dbj|BAJ86608.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96242.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88789.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=413

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R+ +AKA  EE+VL+E PEATI++PA +IGTEDRILN WA +AKN+GFLPL GGG+TK Q
Sbjct  203  RLLRAKAAGEESVLKEFPEATIMRPATLIGTEDRILNRWAMYAKNWGFLPLFGGGSTKFQ  262

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+ SLKDDGTSMGK YELGGP+++TVH LAE+MY+ IRE+PRYV +PFPI
Sbjct  263  PVYVVDVAAAIVNSLKDDGTSMGKTYELGGPDVYTVHDLAEMMYETIREYPRYVNLPFPI  322

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A+PRE+LL KVPFPLPTPSIFNLD I+AL+ D LVSENALTF DL I PHKLKGYP
Sbjct  323  AKAMASPREMLLNKVPFPLPTPSIFNLDQIKALSVDNLVSENALTFADLEIKPHKLKGYP  382

Query  259  VEYLIQYRKGGPQYGSTVSEKISPD  185
             E+L+ YRKGGP +GSTVSEK+  +
Sbjct  383  TEFLVCYRKGGPSFGSTVSEKMGSE  407



>ref|NP_565469.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Arabidopsis 
thaliana]
 sp|Q9SK66.2|NDUA9_ARATH RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK59545.1| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAK93749.1| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAD21752.2| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAT68351.1| hypothetical protein At2g20360 [Arabidopsis thaliana]
 gb|AAX23820.1| hypothetical protein At2g20360 [Arabidopsis thaliana]
 gb|AEC06997.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Arabidopsis 
thaliana]
Length=402

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 184/208 (88%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA AEEAVL  +PEATI++PA MIGTEDRILNPW+ F K YGFLPLIGGGTTK Q
Sbjct  195  RMLRAKAAAEEAVLNALPEATIMRPATMIGTEDRILNPWSMFVKKYGFLPLIGGGTTKFQ  254

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+A+LKDDG+SMGK YELGGP++FT H+LAE+MYD+IREWPRYVK+PFPI
Sbjct  255  PVYVVDVAAAIVAALKDDGSSMGKTYELGGPDVFTTHELAEIMYDMIREWPRYVKLPFPI  314

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A PR+ ++ KVPFPLP+P IFNLD I ALTTDTLVS+NAL F+DL +VPHKLKGYP
Sbjct  315  AKAMAAPRDFMVNKVPFPLPSPQIFNLDQINALTTDTLVSDNALKFQDLDLVPHKLKGYP  374

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VE+LIQYRKGGP +GSTVSEKI  D YP
Sbjct  375  VEFLIQYRKGGPNFGSTVSEKIPTDFYP  402



>ref|XP_010489051.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Camelina sativa]
Length=403

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 183/208 (88%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM++AKA AEEAVL  +PEATI++PA MIGTEDRILNPW+ F K YGFLPLIGGGTTK Q
Sbjct  196  RMQRAKAAAEEAVLSALPEATIMRPATMIGTEDRILNPWSMFVKKYGFLPLIGGGTTKFQ  255

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+A+LKDDG+SMGK YELGGP++FT H+LAE+MYD+IREWPRYV +PFPI
Sbjct  256  PVYVVDVAAAIVAALKDDGSSMGKTYELGGPDVFTTHELAEIMYDMIREWPRYVNLPFPI  315

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A PR+ ++ KVPFPLP+P IFNLD I  LTTDTLVS+NAL F+DL +VPHKLKGYP
Sbjct  316  AKAMAAPRDFMVNKVPFPLPSPQIFNLDQINTLTTDTLVSDNALKFQDLDLVPHKLKGYP  375

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VE+LIQYRKGGP +GSTVSEKI  D YP
Sbjct  376  VEFLIQYRKGGPNFGSTVSEKIPTDFYP  403



>ref|XP_010415893.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Camelina sativa]
Length=403

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 183/208 (88%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM++AKA AEEAVL  +PEATI++PA MIGTEDRILNPW+ F K YGFLPLIGGGTTK Q
Sbjct  196  RMQRAKAAAEEAVLSALPEATIMRPATMIGTEDRILNPWSMFVKKYGFLPLIGGGTTKFQ  255

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+A+LKDDG+SMGK YELGGP++FT H+LAE+MYD+IREWPRYV +PFPI
Sbjct  256  PVYVVDVAAAIVAALKDDGSSMGKTYELGGPDVFTTHELAEIMYDMIREWPRYVNLPFPI  315

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A PR+ ++ KVPFPLP+P IFNLD I  LTTDTLVS+NAL F+DL +VPHKLKGYP
Sbjct  316  AKAMAAPRDFMVNKVPFPLPSPQIFNLDQINTLTTDTLVSDNALKFQDLDLVPHKLKGYP  375

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VE+LIQYRKGGP +GSTVSEKI  D YP
Sbjct  376  VEFLIQYRKGGPNFGSTVSEKIPTDFYP  403



>ref|XP_002884196.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60455.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
Length=402

 Score =   323 bits (827),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 183/208 (88%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA AEEAVL  +PEAT+++PA MIGTEDRILNPW+ F K YGFLPLIGGGTTK Q
Sbjct  195  RMLRAKAAAEEAVLNALPEATVMRPATMIGTEDRILNPWSMFVKKYGFLPLIGGGTTKFQ  254

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+A+LKDDG+SMGK YELGGP++FT H+LAE+MYD+IREWPRYVK+PFPI
Sbjct  255  PVYVVDVAAAIVAALKDDGSSMGKTYELGGPDVFTTHELAEIMYDMIREWPRYVKLPFPI  314

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A PR+ ++ KVPFPLP+P IFNLD I ALTTDTLVS+ AL F+DL +VPHKLKGYP
Sbjct  315  AKAMAAPRDFMVNKVPFPLPSPQIFNLDQINALTTDTLVSDKALKFQDLDLVPHKLKGYP  374

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VE+LIQYRKGGP +GSTVSEKI  D YP
Sbjct  375  VEFLIQYRKGGPNFGSTVSEKIPTDFYP  402



>ref|XP_010467837.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Camelina sativa]
Length=403

 Score =   322 bits (826),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 181/208 (87%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM++AKA AEEAVL  +PEATI++PA MIGTEDRILNPW+ F K YGFLPLIGGGTTK Q
Sbjct  196  RMQRAKAAAEEAVLSALPEATIMRPATMIGTEDRILNPWSMFVKKYGFLPLIGGGTTKFQ  255

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+A LKDDG+SMGK YELGGP++FT H+LAE+MYD+IREWPRYV +PFPI
Sbjct  256  PVYVVDVAAAIVAVLKDDGSSMGKTYELGGPDVFTTHELAEIMYDMIREWPRYVNLPFPI  315

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A PR+ ++ KVPFPLP+P IFNLD I  LTTDTLVS+NA  F+DL +VPHKLKGYP
Sbjct  316  AKAMAAPRDFMVNKVPFPLPSPQIFNLDQINTLTTDTLVSDNAFKFQDLDLVPHKLKGYP  375

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VE+LIQYRKGGP +GSTVSEKI  D YP
Sbjct  376  VEFLIQYRKGGPNFGSTVSEKIPTDFYP  403



>emb|CDY13877.1| BnaA09g43790D [Brassica napus]
Length=403

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 183/207 (88%), Gaps = 0/207 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM++AKA AEEAVL  +PEAT+++PA MIGTEDRILNPWA F K YGFLPLIGGGT K Q
Sbjct  196  RMQRAKAAAEEAVLSALPEATVMRPATMIGTEDRILNPWAMFVKKYGFLPLIGGGTNKFQ  255

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+A+LKDDG+SMGK+YELGGP++FT H LAE+M+D+IREWPRYVK+PFPI
Sbjct  256  PVYVVDVAAAIVAALKDDGSSMGKIYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPI  315

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A PR+ ++ KVPFPLP+P IFNLD I ALTTDTLVS+ ALTF+DL +VPHKLKGYP
Sbjct  316  AKAMAGPRDFMVNKVPFPLPSPQIFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYP  375

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSY  179
            VE+LIQYRKGGP +GSTVSEKI  D Y
Sbjct  376  VEFLIQYRKGGPNFGSTVSEKIPTDFY  402



>emb|CDX81965.1| BnaC08g36360D [Brassica napus]
Length=403

 Score =   320 bits (820),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM++AKA AEEAVL  +PEAT+++PA MIGTEDRILNPWA F K YGFLPLIGGGT K Q
Sbjct  196  RMQRAKAAAEEAVLNALPEATVMRPATMIGTEDRILNPWAMFVKKYGFLPLIGGGTNKFQ  255

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+A+LKDDG+SMGK YELGGP++FT H LAE+M+D+IREWPRYVK+PFPI
Sbjct  256  PVYVVDVAAAIVAALKDDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPI  315

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A PR+ ++ KVPFPLP+P IFNLD I ALTTDTLVS+ ALTF+DL +VPHKLKGYP
Sbjct  316  AKAMAGPRDFMVNKVPFPLPSPQIFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYP  375

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSY  179
            VE+LIQYRKGGP +GSTVSEKI  D Y
Sbjct  376  VEFLIQYRKGGPNFGSTVSEKIPTDFY  402



>gb|KJB42340.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=383

 Score =   319 bits (817),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 170/208 (82%), Gaps = 17/208 (8%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  +AKA  EEAVL+E+PEAT++KPAVMIGTEDRI+N WA FAK Y FLPLIGGG+TKIQ
Sbjct  193  RFLRAKAAGEEAVLKELPEATVMKPAVMIGTEDRIMNRWAHFAKKYSFLPLIGGGSTKIQ  252

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVASAI+A+LKDDG+SMG                  LMY+ IREWPRYV +P PI
Sbjct  253  PVYVVDVASAIVAALKDDGSSMG-----------------NLMYETIREWPRYVNIPLPI  295

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAIA PRE+LLKKVPFPLP P IFNLD I A  TDT+VSENALTF DLGIVPHKLKGYP
Sbjct  296  AKAIAMPREVLLKKVPFPLPNPDIFNLDQINAFATDTVVSENALTFMDLGIVPHKLKGYP  355

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            VEYLIQYRKGGPQ+GSTVSEK++PDSYP
Sbjct  356  VEYLIQYRKGGPQFGSTVSEKVNPDSYP  383



>emb|CDY31970.1| BnaA07g00250D [Brassica napus]
Length=402

 Score =   319 bits (818),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM++AKA AEEAVL  +PEAT+++PA MIGTEDRILNPWA F K YGFLPLIGGGT K Q
Sbjct  195  RMQRAKAAAEEAVLSALPEATVMRPATMIGTEDRILNPWAMFVKKYGFLPLIGGGTNKFQ  254

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+A+LKDDG+SMGK YELGGP++FT H LAE+M+D+IREWPRYVK+PFPI
Sbjct  255  PVYVVDVAAAIVAALKDDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPI  314

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A PR+ ++ KVPFPLP+P IFNLD I ALTTDTLVS+ ALTF+DL +VPHKLKGYP
Sbjct  315  AKAMAGPRDFMVNKVPFPLPSPQIFNLDQINALTTDTLVSDEALTFQDLDLVPHKLKGYP  374

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSY  179
            VE+LIQYRKGGP +GSTVSEKI  D Y
Sbjct  375  VEFLIQYRKGGPNFGSTVSEKIPTDFY  401



>emb|CDY39772.1| BnaA09g10240D [Brassica napus]
Length=403

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM++AKA AEEAV   +PEAT+++PA MIGTEDRILNPWA F K YGFLPLIGGGT K Q
Sbjct  196  RMQRAKAAAEEAVFSALPEATVMRPATMIGTEDRILNPWAMFVKKYGFLPLIGGGTNKFQ  255

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+A+LKDDG+SMGK YELGGP++FT H LAE+M+D+IREWPRYVK+PFPI
Sbjct  256  PVYVVDVAAAIVAALKDDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPI  315

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A PR+ ++ KVPFPLP+P IFNLD I ALTTDTLVS+ ALTF+DL +VPHKLKGYP
Sbjct  316  AKAMAGPRDFMVNKVPFPLPSPQIFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYP  375

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSY  179
            VE+LIQYRKGGP +GSTVSEKI  D Y
Sbjct  376  VEFLIQYRKGGPNFGSTVSEKIPTDFY  402



>ref|XP_009112664.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Brassica rapa]
Length=403

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM++AKA AEEAVL  +PEAT+++PA MIGTEDRILNPWA F K YGFLPLIGGGT + Q
Sbjct  196  RMQRAKAAAEEAVLSALPEATVMRPATMIGTEDRILNPWAMFVKKYGFLPLIGGGTNRFQ  255

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+A+LKDDG+SMGK YELGGP++FT H LAE+M+D+IREWPRYVK+PFPI
Sbjct  256  PVYVVDVAAAIVAALKDDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPI  315

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A PR+ ++ KVPFPLP+P IFNLD I ALTTDTLVS+ ALTF+DL +VPHKLKGYP
Sbjct  316  AKAMAGPRDFMVNKVPFPLPSPQIFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYP  375

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSY  179
            VE+LIQYRKGGP +GSTVSEKI  D Y
Sbjct  376  VEFLIQYRKGGPNFGSTVSEKIPTDFY  402



>ref|XP_009117495.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brassica rapa]
Length=403

 Score =   317 bits (813),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM++AKA AEEAVL  +PEAT+++PA MIGTEDRILNPWA F K YGFLPLIGGGT K Q
Sbjct  196  RMQRAKAAAEEAVLSALPEATVMRPATMIGTEDRILNPWAMFVKKYGFLPLIGGGTNKFQ  255

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+A+LKDDG+SMGK YELGGP++FT H LAE+M+D+IREWPRYVK+PFPI
Sbjct  256  PVYVVDVAAAIVAALKDDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPI  315

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A PR+ ++ KVPFPLP+P IFNLD I ALT DTLVS+ ALTF+DL +VPHKLKGYP
Sbjct  316  AKAMAGPRDFMVNKVPFPLPSPQIFNLDQINALTIDTLVSDKALTFQDLDLVPHKLKGYP  375

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSY  179
            VE+LIQYRKGGP +GSTVSEKI  D Y
Sbjct  376  VEFLIQYRKGGPNFGSTVSEKIPTDFY  402



>ref|XP_010091822.1| hypothetical protein L484_015891 [Morus notabilis]
 gb|EXB46030.1| hypothetical protein L484_015891 [Morus notabilis]
Length=399

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM KAKA AEEAVLRE+PEATI+KPA+MIGTEDRI+N WAQ AK Y FLPLIG G+TKIQ
Sbjct  192  RMLKAKAAAEEAVLRELPEATIMKPAIMIGTEDRIMNRWAQIAKKYSFLPLIGDGSTKIQ  251

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+A+LKDDGTSMGK+YELGGPE+FTVH+LAELMY+ IREWPRY+KVPFPI
Sbjct  252  PVYVVDVAAAIVAALKDDGTSMGKIYELGGPEVFTVHELAELMYETIREWPRYLKVPFPI  311

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAIATPRE+LL KVPFPLP P IFNLD I A TTDT+VSENALTF DL I+PHKLKGYP
Sbjct  312  AKAIATPREILLNKVPFPLPKPDIFNLDQILAQTTDTVVSENALTFNDLEIMPHKLKGYP  371

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            +E+L  YRKGGPQ+GST+SE++SPD++P
Sbjct  372  IEFLACYRKGGPQFGSTISERVSPDAWP  399



>emb|CDY05746.1| BnaC07g00570D [Brassica napus]
Length=402

 Score =   315 bits (808),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM++AKA AEEAVL  +PEAT+++PA MIGTEDRILNPWA F K YGFLPLIGGGT K Q
Sbjct  195  RMQRAKAAAEEAVLSALPEATVMRPATMIGTEDRILNPWAMFVKKYGFLPLIGGGTNKFQ  254

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+A+LKDDG+SMGK YELGGP++FT H LAE+M+D+IREWPRYVK+PFPI
Sbjct  255  PVYVVDVAAAIVAALKDDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPI  314

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A  R+ ++ KVPFPLP+P IFNLD I  LTTDTLVS+ ALTF+DL +VPHKLKGYP
Sbjct  315  AKAMAGTRDFMVNKVPFPLPSPQIFNLDQINTLTTDTLVSDKALTFQDLDLVPHKLKGYP  374

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSY  179
            VE+LIQYRKGGP +GSTVSEKI  D Y
Sbjct  375  VEFLIQYRKGGPNFGSTVSEKIPTDFY  401



>ref|XP_010684864.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Beta vulgaris subsp. vulgaris]
Length=395

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM KAKA AEEA+LRE+PEATI++P++M+GTEDRILNPWAQF K Y FLPLIG G+TKIQ
Sbjct  188  RMLKAKAAAEEAILRELPEATIMRPSIMVGTEDRILNPWAQFVKKYSFLPLIGDGSTKIQ  247

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            P +V DVA AI+A+LKDDG+SMGK YELGGP++FT+HQLAELMY+ IRE+P YVK+P  I
Sbjct  248  PAFVVDVAGAIVAALKDDGSSMGKTYELGGPDVFTIHQLAELMYETIREYPHYVKIPSLI  307

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AK ++TPRELLL KVPFPLP+P+IFNLD I AL+ DT+VS+ ALTF DL I PHKL+GYP
Sbjct  308  AKGVSTPRELLLNKVPFPLPSPTIFNLDQIHALSVDTVVSDKALTFADLDIAPHKLRGYP  367

Query  259  VEYLIQYRKGGPQYGSTVSEKISPD  185
            VEYL  YRKGGPQ+GST+SE++S D
Sbjct  368  VEYLSCYRKGGPQFGSTISERVSTD  392



>ref|XP_006408954.1| hypothetical protein EUTSA_v10002002mg [Eutrema salsugineum]
 gb|ESQ50407.1| hypothetical protein EUTSA_v10002002mg [Eutrema salsugineum]
Length=402

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM++AKA AEEAVL  +PEAT+++PA MIGTEDRILNPWAQF K YGFLPLIGGGTTK Q
Sbjct  195  RMQRAKAAAEEAVLNALPEATVMRPATMIGTEDRILNPWAQFVKKYGFLPLIGGGTTKFQ  254

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+A+LKDDG+SMGK YELGGP++F    LAE+M+D+IRE PRYVK+PFPI
Sbjct  255  PVYVVDVAAAIVAALKDDGSSMGKTYELGGPDVFNAQDLAEIMFDMIRERPRYVKLPFPI  314

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AK +A PR+ ++ KVPFPLP+P +FNLD I ALTTDTLVS+ ALTF+DL +VPHKLKGYP
Sbjct  315  AKVMAGPRDFMVNKVPFPLPSPQVFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYP  374

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSY  179
            VE+LIQYRKGGP +GSTVSEKI  D Y
Sbjct  375  VEFLIQYRKGGPNFGSTVSEKIPTDFY  401



>ref|XP_006443722.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 ref|XP_006443723.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 ref|XP_006479428.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X1 [Citrus sinensis]
 gb|ESR56962.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 gb|ESR56963.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
Length=400

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 183/208 (88%), Gaps = 0/208 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R+   KA AEEAVLRE+P ATI++PA MIGTEDR+LN WAQF K + F PL G G+T+IQ
Sbjct  193  RVFSTKAAAEEAVLRELPWATIMRPAAMIGTEDRLLNKWAQFVKKFNFFPLFGDGSTRIQ  252

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+A+ A+LKDDGTSMGK+YELGGP+IFTVH+LAELMYD IRE+P YVKVPFP+
Sbjct  253  PVYVVDVAAAVTAALKDDGTSMGKIYELGGPDIFTVHELAELMYDTIREYPHYVKVPFPV  312

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A PRE+LLKKVPFPLP P +FNLD I A T+DT+VS+NALTF+DLGIVPHKLKGYP
Sbjct  313  AKAVAMPREILLKKVPFPLPRPGLFNLDEINAYTSDTIVSDNALTFQDLGIVPHKLKGYP  372

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSYP  176
             EYLI YRKGGP++GSTVSE+I+P+++P
Sbjct  373  TEYLIWYRKGGPKFGSTVSERINPEAWP  400



>emb|CDY03308.1| BnaC09g10400D [Brassica napus]
Length=402

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 179/207 (86%), Gaps = 0/207 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM++AKA AEEAV   +PEAT+++PA MIGTEDRILNPWA F K YGF PLIGGGT K Q
Sbjct  195  RMQRAKAAAEEAVFSALPEATVMRPATMIGTEDRILNPWAMFVKKYGFFPLIGGGTNKFQ  254

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+A+LKDDG+SMGK YELGGP++FT   LAE+M+D+IREWPRYVK+PFPI
Sbjct  255  PVYVVDVAAAIVAALKDDGSSMGKTYELGGPDVFTPRDLAEIMFDMIREWPRYVKLPFPI  314

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A PR+ ++ KVPFPLP+P IFNLD I ALTTDTLVS+ ALTF+DL +VPHKLKGYP
Sbjct  315  AKAMAGPRDFMVNKVPFPLPSPQIFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYP  374

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSY  179
            VE+LIQYRKGGP +GSTVSEKI  D Y
Sbjct  375  VEFLIQYRKGGPNFGSTVSEKIPTDFY  401



>ref|XP_002321296.2| hypothetical protein POPTR_0014s18680g [Populus trichocarpa]
 gb|EEE99611.2| hypothetical protein POPTR_0014s18680g [Populus trichocarpa]
Length=384

 Score =   312 bits (800),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 175/211 (83%), Gaps = 16/211 (8%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R+ +AKA  EEAVLRE+PE             DRILN WA F K Y FLPLIG G+TKIQ
Sbjct  187  RLLRAKAAGEEAVLREMPE-------------DRILNRWAHFTKKYSFLPLIGDGSTKIQ  233

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV D+A+AIIA+LKDDGTSMGKVYELGGPEIFTVH+LAELMYDVIREWPRYVKVPFPI
Sbjct  234  PVYVVDIAAAIIAALKDDGTSMGKVYELGGPEIFTVHELAELMYDVIREWPRYVKVPFPI  293

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA---LTFEDLGIVPHKLK  269
            AKA ATPRE+LL KVPFPLP P +FNLD I +LT DT+VSEN    LTF DLGIVPHKLK
Sbjct  294  AKAFATPREILLNKVPFPLPNPKMFNLDEINSLTMDTVVSENGEFTLTFSDLGIVPHKLK  353

Query  268  GYPVEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            GYPVE+LI YRKGGPQ+GST+SE++SPDS+P
Sbjct  354  GYPVEFLISYRKGGPQFGSTISERVSPDSFP  384



>ref|XP_009102039.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brassica rapa]
Length=402

 Score =   312 bits (799),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 179/207 (86%), Gaps = 0/207 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM++AKA AEEAVL  +PEAT+++PA MIGTEDRILNPW  F K YGFLPLIGGGT K Q
Sbjct  195  RMQRAKAAAEEAVLSALPEATVMRPATMIGTEDRILNPWEMFVKKYGFLPLIGGGTNKFQ  254

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+A+LKDDG+SMGK YELGGP++FT H LAE+M+D+IREWPRYVK+PFPI
Sbjct  255  PVYVVDVAAAIVAALKDDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPI  314

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A PR+ ++ KVP PLP+P IFN D I ALTTDTLVS+ ALTF+DL +VPHKLKGYP
Sbjct  315  AKAMAGPRDFMVNKVPSPLPSPQIFNRDQINALTTDTLVSDKALTFQDLDLVPHKLKGYP  374

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSY  179
            VE+LIQYRKGGP +GSTVSEKI  D Y
Sbjct  375  VEFLIQYRKGGPNFGSTVSEKIPTDFY  401



>ref|XP_008235764.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Prunus mume]
Length=387

 Score =   307 bits (786),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  +AKA AEEAVLRE+PEAT+L+PAV+IGTEDRILN WA FAK YGFLPLIG G+TKIQ
Sbjct  192  RFLRAKAAAEEAVLRELPEATVLRPAVLIGTEDRILNRWAFFAKKYGFLPLIGDGSTKIQ  251

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA AI+A+LKDDGTSMGKVYELGGPE+FTVHQLAELM++ IREWP YVKVP PI
Sbjct  252  PVYVVDVAGAIVAALKDDGTSMGKVYELGGPEVFTVHQLAELMFETIREWPHYVKVPLPI  311

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKAIA PRE+LL KVPFPLP P IFN D I A  TDT+VSEN+LTF DLG+VPHKLKGYP
Sbjct  312  AKAIAAPREILLNKVPFPLPNPEIFNRDQILAQATDTVVSENSLTFSDLGLVPHKLKGYP  371

Query  259  VEY  251
            VE+
Sbjct  372  VEF  374



>gb|KFK40412.1| hypothetical protein AALP_AA3G370500 [Arabis alpina]
Length=404

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 175/207 (85%), Gaps = 0/207 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RMR+AKA AEEAV   +PEAT+++PA MIGTEDRILNPW+ F K YGFLPLIGGGTTK Q
Sbjct  197  RMRRAKAAAEEAVFNALPEATVMRPATMIGTEDRILNPWSMFVKKYGFLPLIGGGTTKFQ  256

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AIIA+LKDDG+SMGK YELGGP++F    LAE+M+D+IRE PRYVK+PFPI
Sbjct  257  PVYVVDVAAAIIAALKDDGSSMGKTYELGGPDVFNARDLAEIMFDMIREVPRYVKLPFPI  316

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AK +A PR+ ++ KVPFPLP P +FNLD I A T DTLVS+ ALTF+DL +VPHKLKGYP
Sbjct  317  AKVMAGPRDFMVNKVPFPLPCPQVFNLDQINASTIDTLVSDKALTFQDLDLVPHKLKGYP  376

Query  259  VEYLIQYRKGGPQYGSTVSEKISPDSY  179
            VE+LIQYRKGGP +GSTVSEKI  D Y
Sbjct  377  VEFLIQYRKGGPNFGSTVSEKIPTDFY  403



>gb|KDO37085.1| hypothetical protein CISIN_1g047628mg, partial [Citrus sinensis]
Length=327

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R+   KA AEEAVLRE+P ATI++PA MIGTEDR+LN WAQF K + F PL G G+T+IQ
Sbjct  134  RVFSTKAAAEEAVLRELPWATIMRPAAMIGTEDRLLNKWAQFVKKFNFFPLFGDGSTRIQ  193

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+A+ A+LKDDGTSMGK+YELGGP+IFTVH+LAELMYD IRE+P YVKVPFP+
Sbjct  194  PVYVVDVAAAVTAALKDDGTSMGKIYELGGPDIFTVHELAELMYDTIREYPHYVKVPFPV  253

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A PRE+LLKKVPFPLP P +FNLD I A T+DT+VS+NALTF+DLGIVPHKLKGYP
Sbjct  254  AKAVAMPREILLKKVPFPLPRPGLFNLDEINAYTSDTIVSDNALTFQDLGIVPHKLKGYP  313

Query  259  VEYLIQYRKGGPQY  218
             EYLI YRKGGP++
Sbjct  314  TEYLIWYRKGGPKF  327



>gb|ABK24353.1| unknown [Picea sitchensis]
Length=401

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            +M++ KA AEE V RE+PEATIL+PA M+GTEDRILN WAQ AK +  LP+IG G+T++Q
Sbjct  195  KMQRTKAAAEEVVRRELPEATILRPAAMVGTEDRILNKWAQIAKKWSVLPIIGDGSTRLQ  254

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AIIA+LKDDGTS+GK YELGGP++FT+ QL  LM+++IRE PR++K+P PI
Sbjct  255  PVYVIDVAAAIIAALKDDGTSIGKTYELGGPDVFTIDQLVHLMFEMIREEPRFIKIPIPI  314

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            A+ I++PRE LL KVPFPLPTP IFN D +++L  D +VS++ALTF DL +VPHKLKGYP
Sbjct  315  ARLISSPREFLLNKVPFPLPTPEIFNQDYVDSLLADNVVSQDALTFTDLSVVPHKLKGYP  374

Query  259  VEYLIQYRKGGPQYGSTVSEKIS  191
            +E+L QYR GGP +G+T+ E+IS
Sbjct  375  IEFLFQYRTGGPSFGATLGERIS  397



>gb|KJB42337.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=358

 Score =   273 bits (697),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  +AKA  EEAVL+E+PEAT++KPAVMIGTEDRI+N WA FAK Y FLPLIGGG+TKIQ
Sbjct  193  RFLRAKAAGEEAVLKELPEATVMKPAVMIGTEDRIMNRWAHFAKKYSFLPLIGGGSTKIQ  252

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVASAI+A+LKDDG+SMG VYELGGPEI+TVH+LAELMY+ IREWPRYV +P PI
Sbjct  253  PVYVVDVASAIVAALKDDGSSMGNVYELGGPEIYTVHELAELMYETIREWPRYVNIPLPI  312

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA  311
            AKAIA PRE+LLKKVPFPLP P IFNLD I A  TDT+VSEN 
Sbjct  313  AKAIAMPREVLLKKVPFPLPNPDIFNLDQINAFATDTVVSENG  355



>gb|KJB42338.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=367

 Score =   273 bits (697),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 144/171 (84%), Gaps = 1/171 (1%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  +AKA  EEAVL+E+PEAT++KPAVMIGTEDRI+N WA FAK Y FLPLIGGG+TKIQ
Sbjct  193  RFLRAKAAGEEAVLKELPEATVMKPAVMIGTEDRIMNRWAHFAKKYSFLPLIGGGSTKIQ  252

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVASAI+A+LKDDG+SMG VYELGGPEI+TVH+LAELMY+ IREWPRYV +P PI
Sbjct  253  PVYVVDVASAIVAALKDDGSSMGNVYELGGPEIYTVHELAELMYETIREWPRYVNIPLPI  312

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA-LTFEDLG  290
            AKAIA PRE+LLKKVPFPLP P IFNLD I A  TDT+VSEN    F   G
Sbjct  313  AKAIAMPREVLLKKVPFPLPNPDIFNLDQINAFATDTVVSENGHFNFYGFG  363



>gb|EEE58042.1| hypothetical protein OsJ_08874 [Oryza sativa Japonica Group]
Length=310

 Score =   250 bits (639),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 142/202 (70%), Gaps = 41/202 (20%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA  EE+VL+E PE                                         
Sbjct  145  RMLRAKAAGEESVLKEFPE-----------------------------------------  163

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+ SLKDDGTSMGK YELGGPEI+TVH+LAELMY+ IREWPRY+ VP PI
Sbjct  164  PVYVVDVAAAIVNSLKDDGTSMGKTYELGGPEIYTVHELAELMYETIREWPRYIDVPLPI  223

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            A+AIA+PRE+LL KVPFPLPTPSIFN D I A + DTLVS+NALTF DLGIVPHKLKGYP
Sbjct  224  ARAIASPREMLLNKVPFPLPTPSIFNKDQINAFSVDTLVSDNALTFSDLGIVPHKLKGYP  283

Query  259  VEYLIQYRKGGPQYGSTVSEKI  194
            VE+L+ YRKGGP +GSTVSEKI
Sbjct  284  VEFLVCYRKGGPAFGSTVSEKI  305



>ref|XP_009763970.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Nicotiana sylvestris]
Length=314

 Score =   191 bits (485),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -1

Query  751  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  572
            +PE TI++PAVMIGTEDRILNPWA FAK YGF+PL G G+TKIQPV+V DVASAI+ASLK
Sbjct  206  LPEVTIMRPAVMIGTEDRILNPWAHFAKKYGFIPLFGDGSTKIQPVFVADVASAIVASLK  265

Query  571  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            D+G SMGKVYELGGP+++T+H+LAELM+D+IREWPRYV VPFPIAKA
Sbjct  266  DNGISMGKVYELGGPDVYTMHELAELMFDMIREWPRYVNVPFPIAKA  312



>ref|XP_001765756.1| predicted protein [Physcomitrella patens]
 gb|EDQ69347.1| predicted protein [Physcomitrella patens]
Length=405

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 142/202 (70%), Gaps = 1/202 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R+ ++K  AEEAV++  PEATIL+ A ++G EDR+LN WA  AK   F+P+ G G +K+Q
Sbjct  200  RLIRSKHAAEEAVMQNFPEATILRTAPLVGVEDRLLNRWAIQAKKLPFVPIPGDGLSKLQ  259

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PV V DVA+A+IA+++D+G SMGK +ELGGP++FTV++L  LM++ IRE+PR V +P P+
Sbjct  260  PVLVVDVAAAVIAAIRDEGFSMGKTFELGGPDVFTVNELVALMFEAIREYPRVVHIPMPL  319

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
             +  A PREL +K+   P+P    F+ D ++ L  D +VS++A+   DLGI  HK+ G  
Sbjct  320  CQIAAMPRELAMKR-GIPIPFSPSFSKDYLDQLACDLIVSQDAMGLADLGITSHKIGGLT  378

Query  259  VEYLIQYRKGGPQYGSTVSEKI  194
            +E+L  YR GGP  G+TV E +
Sbjct  379  IEHLNAYRTGGPSVGTTVGESV  400



>ref|XP_002976090.1| hypothetical protein SELMODRAFT_104564, partial [Selaginella 
moellendorffii]
 gb|EFJ22995.1| hypothetical protein SELMODRAFT_104564, partial [Selaginella 
moellendorffii]
Length=353

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 131/197 (66%), Gaps = 1/197 (1%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            +  + KA  EEAV +E PEATI++PA M G  D+ LN +A  AK +  +P+   G T++Q
Sbjct  154  KQHRTKALGEEAVRQEFPEATIMRPASMFGYHDKFLNRFATKAKFWPNVPMFFDGKTRVQ  213

Query  619  PVYVTDVASAIIASLKD-DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFP  443
            PV V DVA+A +A++K+ +G  +GKVYELGGP+++T+H+L   M++V+RE PR + +P P
Sbjct  214  PVCVLDVAAAFLAAVKEKEGIHVGKVYELGGPDVYTIHELLLWMFEVLREKPRIINIPLP  273

Query  442  IAKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGY  263
            +A+A++  RE   K+VP PLP         I++L  D +VS +ALTFE+LGI P  L G 
Sbjct  274  LAEAVSRVREFFFKRVPVPLPQLWPCYRHYIDSLKVDQVVSPDALTFEELGIKPRPLGGL  333

Query  262  PVEYLIQYRKGGPQYGS  212
              EYL  YR+GGP  G 
Sbjct  334  ATEYLFYYREGGPHMGQ  350



>ref|XP_002968287.1| hypothetical protein SELMODRAFT_89106, partial [Selaginella moellendorffii]
 gb|EFJ30541.1| hypothetical protein SELMODRAFT_89106, partial [Selaginella moellendorffii]
Length=362

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 130/197 (66%), Gaps = 1/197 (1%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            +  + KA  EEAV +E PEATI++PA M G  D+ LN +A  AK +  +P    G TK+Q
Sbjct  163  KQHRTKALGEEAVRQEFPEATIMRPASMFGYHDKFLNRFATKAKFWPNVPTFFDGKTKVQ  222

Query  619  PVYVTDVASAIIASLKD-DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFP  443
            PV V DVA+A +A++K+ +G  +GKVYELGGP+++T+H+L   M++V+RE PR + +P P
Sbjct  223  PVCVLDVAAAFLAAVKEKEGIHVGKVYELGGPDVYTIHELLLWMFEVLREKPRIINIPLP  282

Query  442  IAKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGY  263
            +A+A++  RE   K+VP PLP         I++L  D +VS +ALTFE+LGI P  L G 
Sbjct  283  LAEAVSRVREFFFKRVPVPLPQLWPCYRHYIDSLKVDQVVSPDALTFEELGIKPRPLGGL  342

Query  262  PVEYLIQYRKGGPQYGS  212
              EYL  YR+GGP  G 
Sbjct  343  ATEYLFYYREGGPHMGQ  359



>ref|XP_001757609.1| predicted protein [Physcomitrella patens]
 gb|EDQ77666.1| predicted protein [Physcomitrella patens]
Length=393

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 137/202 (68%), Gaps = 1/202 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R+ ++K  AEE V +  PEATIL+   M+G EDR+LN WA  AK    +P+ G G TK+Q
Sbjct  188  RLLRSKHAAEEVVKQNFPEATILRTGPMVGVEDRLLNRWAIQAKKLPVVPIPGDGLTKMQ  247

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PV V DVA+A+IA+++D+G SMGK +ELGGP++FTV+ L  L+++ IRE PR V +P  +
Sbjct  248  PVLVVDVAAAVIAAIRDEGFSMGKTFELGGPDVFTVNDLVTLVFEAIREHPRVVHIPMAL  307

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            A+ +A PRE+ +K+   P+P    F+ D ++ L+ D +VS +A+   DLG+  HK+ G  
Sbjct  308  AQLLAMPREVAMKR-GIPIPFSPTFSKDYLDQLSCDLVVSSDAMGLADLGVTSHKIGGLT  366

Query  259  VEYLIQYRKGGPQYGSTVSEKI  194
            +E+L  YR GGP  G+TV E I
Sbjct  367  IEHLNAYRTGGPSVGTTVGESI  388



>ref|XP_005651289.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26745.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
Length=378

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 123/192 (64%), Gaps = 4/192 (2%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  + KA  + AV   +P AT+ KP  ++GTEDR+ N +A  AK   F+PL+GGG TK+Q
Sbjct  171  RRLRTKAAGDAAVRSILPYATVFKPGHVVGTEDRMYNIYATMAKQVPFIPLVGGGETKLQ  230

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            P YV DVA A+I SLK    ++GK Y L GPE+ TV Q+ EL+Y  IRE      +P P+
Sbjct  231  PTYVRDVADAVIHSLKTK-EALGKEYFLAGPEVLTVKQIVELVYTTIREPISTFNLPLPV  289

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKL-KGY  263
            A+ +A PRE L K   FP+P  ++F  D IE +T D ++  N LT+ DL +VP K+ +G+
Sbjct  290  ARLLAVPREKLFKM--FPIPVNTMFTADYIEEMTQDHVLPPNVLTYADLEVVPKKVTEGF  347

Query  262  PVEYLIQYRKGG  227
            P+E+L  YR GG
Sbjct  348  PIEHLRHYRVGG  359



>gb|EEC74184.1| hypothetical protein OsI_09314 [Oryza sativa Indica Group]
Length=366

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 93/127 (73%), Gaps = 17/127 (13%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA  EE+VL+E PEATI++PA MIGTED ILN W Q                 IQ
Sbjct  255  RMLRAKAAGEESVLKEFPEATIMRPATMIGTEDWILNRWVQ-----------------IQ  297

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+ SLKDDGTSMGK Y LGGPEI+TVH LAELMY+ I EWPRY+ VP PI
Sbjct  298  PVYVVDVAAAIVNSLKDDGTSMGKSYGLGGPEIYTVHDLAELMYETICEWPRYIDVPLPI  357

Query  439  AKAIATP  419
            A+AIA+P
Sbjct  358  ARAIASP  364



>emb|CEF99374.1| NAD(P)-binding domain [Ostreococcus tauri]
Length=359

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 119/193 (62%), Gaps = 2/193 (1%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E AV    P AT+++PA M+G EDR LN +A+ ++ Y  +P+I GG T+ QPV+
Sbjct  159  RTKAQGEAAVREAFPSATVVRPAKMVGVEDRFLNVFAEHSRKYPMVPIIDGGDTQHQPVF  218

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA AI   + D+ TS G+ YEL G +++TVH LA+L+    R       +P  I +A
Sbjct  219  VDDVAVAIRQIVHDELTS-GRTYELAGKKVYTVHDLAKLVLRTARSRRSTAYIPSFIMRA  277

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLK-GYPVE  254
            ++ P E LL+KVPFP+PTP       I+A + D + + + L F DLGI P+ ++ GY ++
Sbjct  278  LSCPHEFLLRKVPFPMPTPVGLTRSYIDAQSRDYVKAPDTLGFSDLGIDPNDIENGYVLD  337

Query  253  YLIQYRKGGPQYG  215
            YL  +R GG   G
Sbjct  338  YLRSFRAGGYALG  350



>ref|XP_009803384.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana sylvestris]
Length=147

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -1

Query  463  YVKVPFPIAKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIV  284
            Y+     + +AIA+PRE LL KVP P+PTP+IFNLD IEAL TD +VS++ALTFEDLG+ 
Sbjct  52   YLHFGLFLFQAIASPREFLLNKVPAPMPTPTIFNLDAIEALATDNIVSKDALTFEDLGLA  111

Query  283  PHKLKGYPVEYLIQYRKGGPQYGSTVSEKISPDSYP  176
            PHK+KGYPVE+LIQYRKGGP YGSTVSE++SP+SYP
Sbjct  112  PHKVKGYPVEFLIQYRKGGPNYGSTVSERVSPESYP  147



>ref|XP_001420142.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98435.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=366

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 120/193 (62%), Gaps = 2/193 (1%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA  E AV    P ATI++PA ++G EDR LN + + ++ Y  +P+I GG TK QPV+
Sbjct  160  RSKAAGEAAVREAFPSATIVRPAKIVGVEDRFLNIFGEHSRKYPAVPIIDGGDTKHQPVF  219

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA AI   + D+ TS G+ YEL G +++T  +LA+++   IR       +P  I KA
Sbjct  220  VDDVAVAIRQIVHDELTS-GRTYELAGNKVYTFDELAKMVLKTIRTRKSTAYIPSFIMKA  278

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLK-GYPVE  254
            ++ P E LL++VPFP+PTP       I+A + D +   ++L F DLGI P+ ++ GY ++
Sbjct  279  LSCPHEWLLRRVPFPMPTPLGLTRSYIDAQSRDYVKRADSLGFSDLGIEPNNIENGYVLD  338

Query  253  YLIQYRKGGPQYG  215
            YL  +R GG Q G
Sbjct  339  YLRSFRAGGYQVG  351



>ref|XP_006296717.1| hypothetical protein CARUB_v10014190mg [Capsella rubella]
 gb|EOA29615.1| hypothetical protein CARUB_v10014190mg [Capsella rubella]
Length=323

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM++AKA AEEAVL  +PEATI++PA MIGTEDRILNPW+ F K YGFLPLIGGGTTK Q
Sbjct  195  RMQRAKAAAEEAVLNALPEATIMRPATMIGTEDRILNPWSMFVKKYGFLPLIGGGTTKFQ  254

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQL  503
            PVYV DVA+AI+A+LKDDG+SMGK YELGGP++FT H+L
Sbjct  255  PVYVVDVAAAIVAALKDDGSSMGKTYELGGPDVFTTHEL  293



>ref|XP_003059930.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55882.1| predicted protein [Micromonas pusilla CCMP1545]
Length=353

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 118/199 (59%), Gaps = 3/199 (2%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  +EAV    P AT++KPA +IGTEDR+LN +A+    +    LI  G +K QPVY
Sbjct  153  RTKAEGDEAVRAAFPNATVVKPAKLIGTEDRLLNVFAEHTCKFPVQTLIDDGGSKHQPVY  212

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIR--EWPRYVKVPFPIA  437
            V DVA AI A + D+ T+ G+ +EL G +I T+  + ++   +IR     R V VP  I 
Sbjct  213  VDDVALAIRAIVHDESTA-GRTFELCGEKILTMEDMLKMTQSIIRAQNASRIVYVPSFIL  271

Query  436  KAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPV  257
            K +A P E LL +VPFPLPTP+      I+A   D L    +  F++LGIVP KL+G  +
Sbjct  272  KMLAAPHEFLLNRVPFPLPTPTGLTRSYIDAQGEDYLKDPKSEGFKELGIVPAKLEGVVI  331

Query  256  EYLIQYRKGGPQYGSTVSE  200
            +YL  +R GG   G+T  +
Sbjct  332  DYLRAFRFGGYDVGATAGQ  350



>ref|WP_026986147.1| 3-beta hydroxysteroid dehydrogenase [Fodinicurvata fenggangensis]
Length=313

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 110/188 (59%), Gaps = 10/188 (5%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA  EEAV + +P A IL+P+V+ G ED   N +A   +   FLPLIGGG TK QPVY
Sbjct  131  RSKAEGEEAVRKALPNAVILRPSVVFGPEDDFFNRFAVMTRMSPFLPLIGGGHTKFQPVY  190

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A + +L+D     GK YELGGP +++  +L ELM   IR     V VPF +AK 
Sbjct  191  VGDVADAAVQTLQDT-KCQGKTYELGGPRVYSFKELMELMLKTIRRKRLLVPVPFGMAKV  249

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
            + +  +LL    PF   T      D +E L  D +VS++ALT EDLGI  H  +     Y
Sbjct  250  MGSVAQLL----PFAPITA-----DQVELLKNDNIVSKDALTLEDLGIEKHSAEVIIPTY  300

Query  250  LIQYRKGG  227
            L +YR GG
Sbjct  301  LDRYRPGG  308



>ref|XP_002504449.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65707.1| predicted protein [Micromonas sp. RCC299]
Length=390

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 118/194 (61%), Gaps = 3/194 (2%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  ++AV    P ATI+KPA +IGTEDR+LN +A+    +   PL+  G +K QPVY
Sbjct  187  QTKAAGDDAVRAAFPNATIVKPAKLIGTEDRLLNVFAEHTCKFPLAPLVDDGESKHQPVY  246

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIRE--WPRYVKVPFPIA  437
            V DVA AI A ++D+ T+ G+ +EL G +++T+  +   +   IR   +P+ + VP  I 
Sbjct  247  VDDVALAIQAIVEDEETA-GQTFELAGDKVYTMEDMLRFVQKTIRTPGYPKILYVPSFIL  305

Query  436  KAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPV  257
            +A+  P E LL+KVPFPLPTP+      I+A + + L +     FE LGI P KL+G  +
Sbjct  306  RALGAPHEFLLRKVPFPLPTPTGLTKSYIDAQSVNYLKNPRVPGFEQLGIKPAKLEGVVI  365

Query  256  EYLIQYRKGGPQYG  215
            +YL  +R GG   G
Sbjct  366  DYLRAFRFGGYDAG  379



>ref|XP_007510295.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18640.1| predicted protein [Bathycoccus prasinos]
Length=431

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 111/189 (59%), Gaps = 2/189 (1%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  +E V R  P ATI+KPA +IG EDR LN +A+ A  + F+PL G G +K QPV 
Sbjct  223  RTKAEGDEEVRRIFPRATIVKPAKLIGVEDRFLNVFAEHASKFPFVPLTGLGESKHQPVS  282

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIR-EWPRYVKVPFPIAK  434
            V DVA A I+ +  D  ++GK Y L G + FT+ +LA+L  D  R    R   +P  + K
Sbjct  283  VDDVAIA-ISQMPYDEETVGKEYVLAGEKTFTMEELAKLTVDAGRFRSARVAYIPKFVYK  341

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVE  254
             ++ P E LL +VPFPLPTP       ++A   D +   N L F++LG+ P K+ G  ++
Sbjct  342  LLSAPHEFLLNRVPFPLPTPKGLTRSFVDAQDADYVKKPNELGFKELGMTPAKMDGITID  401

Query  253  YLIQYRKGG  227
            YL  YR GG
Sbjct  402  YLRSYRSGG  410



>ref|WP_022729668.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Fodinicurvata 
sediminis]
Length=313

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 110/188 (59%), Gaps = 10/188 (5%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA  EEAV   +P+A IL+P+V+ G ED   N +A  ++   FLPLIGGG TK QPVY
Sbjct  131  RSKAAGEEAVRSALPDAVILRPSVVFGPEDDFFNRFAVMSRMSPFLPLIGGGHTKFQPVY  190

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A + +L+D     GK YELGGP  ++  +L ELM   IR     V VPF +AK 
Sbjct  191  VGDVADAAVQTLQDT-KCHGKTYELGGPRTYSFKELMELMLKTIRRKRLLVPVPFGMAKI  249

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
            + +  +LL    PF   T      D +E L  D +VS++ALT EDLGI  H  +     Y
Sbjct  250  MGSVAQLL----PFAPITA-----DQVELLKNDNIVSKDALTLEDLGIEKHSAEVIIPTY  300

Query  250  LIQYRKGG  227
            L +YR GG
Sbjct  301  LDRYRPGG  308



>gb|KJB42341.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=312

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -1

Query  403  KKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGP  224
            K +PFPLP P IFNLD I A  TDT+VSENALTF DLGIVPHKLKGYPVEYLIQYRKGGP
Sbjct  237  KYMPFPLPNPDIFNLDQINAFATDTVVSENALTFMDLGIVPHKLKGYPVEYLIQYRKGGP  296

Query  223  QYGSTVSEKISPDSYP  176
            Q+GSTVSEK++PDSYP
Sbjct  297  QFGSTVSEKVNPDSYP  312


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPL  647
            R  +AKA  EEAVL+E+PEAT++KPAVMIGTEDRI+N WA FAK Y   PL
Sbjct  193  RFLRAKAAGEEAVLKELPEATVMKPAVMIGTEDRIMNRWAHFAKKYMPFPL  243



>ref|XP_005850526.1| hypothetical protein CHLNCDRAFT_34039 [Chlorella variabilis]
 gb|EFN58424.1| hypothetical protein CHLNCDRAFT_34039 [Chlorella variabilis]
Length=415

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 117/205 (57%), Gaps = 8/205 (4%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREI-PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKI  623
            R  + KA  +E V  E+ P +TI KPA + GTEDR+ N +A  AK   FLPLI GG T++
Sbjct  194  RRLRTKAAGDEVVRSELGPISTIFKPAAVSGTEDRLFNMFATMAKRTPFLPLIDGGKTRM  253

Query  622  QPVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFP  443
            QPV+V DVA+AI+ SLK    S+G+ Y L GP++ TV QL    Y  IRE    V +P  
Sbjct  254  QPVWVRDVAAAIMNSLKTY-DSLGQTYYLAGPDVMTVAQLVAFTYHTIRERNASVPMPAA  312

Query  442  IAKAIATPRELLLKKVPFPLPTPSIFNLDVIEALT---TDTLVSENALTFEDLGIVPHKL  272
            +A  +A   + L +    PL  P +F+ D I  +     D ++    L FE L + PH++
Sbjct  313  VAGVLAKGWDALGRST--PLRGPLMFSSDFIAEMKGGWGDYVMPSGVLGFEHLDVEPHRV  370

Query  271  -KGYPVEYLIQYRKGGPQYGSTVSE  200
             +G P+EYL  YR GG  +GS   E
Sbjct  371  AEGIPIEYLRHYRSGGYDFGSLAEE  395



>ref|WP_045446206.1| 3-beta hydroxysteroid dehydrogenase [alpha proteobacterium MA2]
 dbj|GAK45366.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9 
[alpha proteobacterium MA2]
Length=323

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 114/192 (59%), Gaps = 14/192 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  EEAVL+ +P ATIL+P+++ G ED   N +A  A+    LPLIGGGTT+ QP+Y
Sbjct  135  RTKALGEEAVLKAVPTATILRPSIVFGPEDDFFNRFAAMARLSPVLPLIGGGTTRFQPIY  194

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVASAI+A+L+++  + GK+YELGGPE+F+  +L E M + IR     V +PF +AK 
Sbjct  195  VKDVASAILAALENE-EARGKIYELGGPEVFSFKELMERMLEEIRRKRVLVTLPFGLAK-  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
                   L+ +V   LP P +   D +E L  D +VS+ A     T   LG+    L   
Sbjct  253  -------LMGRVAGLLPNPPL-TADQVELLKRDNVVSDEAREEERTLAALGVPATGLDSV  304

Query  262  PVEYLIQYRKGG  227
               YL ++R+ G
Sbjct  305  LSTYLYRFRRTG  316



>ref|WP_024512948.1| 3-beta hydroxysteroid dehydrogenase [Bradyrhizobium sp. ARR65]
Length=322

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 112/193 (58%), Gaps = 15/193 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KAT E+AVL  +P ATI++P+VM G ED+  N +A  A+    LPLIGGG TK+QPVY
Sbjct  133  RTKATGEKAVLATLPSATIMRPSVMFGPEDQFTNRFAALARISPMLPLIGGGVTKLQPVY  192

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVASA IA   D  T  G  YELGGPE+ ++ ++ EL+ ++       V +PF +AK 
Sbjct  193  VGDVASA-IAEAADGKTRPGATYELGGPEVLSMREIMELILEITDRDRALVSLPFGLAKF  251

Query  430  IATPRELLLKKVPFPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKG  266
             A      L+  P  L  TP     D +E L TD +VSE A    LT E LGI P  L+ 
Sbjct  252  QAA----FLQFAPGALKLTP-----DQVELLRTDNVVSEAAKAAGLTLEGLGITPDSLEA  302

Query  265  YPVEYLIQYRKGG  227
               +YL ++R  G
Sbjct  303  IAPQYLWRFRPAG  315



>ref|WP_027287982.1| 3-beta hydroxysteroid dehydrogenase [Rhodovibrio salinarum]
Length=320

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 110/188 (59%), Gaps = 10/188 (5%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  EEA  +  P+ +IL+P+++IG ED  LN +AQ A+    LPLIGGG T+ QPVY
Sbjct  131  RTKALGEEATHKHFPQVSILRPSIVIGPEDGFLNFFAQMARISPALPLIGGGKTRFQPVY  190

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +  + +  T  GK YELGGP+I+T  QL E++   IR     + +PF +A+ 
Sbjct  191  VGDVADAAMVCVHESKTK-GKTYELGGPQIYTFKQLMEILLKEIRRKRLLLPIPFGVAQV  249

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
             A   ELL    P PL T      D +  L  D +V + AL+F+ LG+ P  ++     Y
Sbjct  250  QAGIAELL----PKPLLT-----RDQVTLLKQDNVVQKGALSFKTLGLEPQAIEAILPTY  300

Query  250  LIQYRKGG  227
            LI+YR GG
Sbjct  301  LIRYRPGG  308



>ref|WP_029621248.1| MULTISPECIES: 3-beta hydroxysteroid dehydrogenase [Rhizobium]
 gb|KEQ03966.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. R1-200B4]
 gb|KEQ04550.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. R2-400B4]
Length=326

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 110/193 (57%), Gaps = 14/193 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++K  AE A+L   P + IL+P+++ G ED   N +A  AK +  LPLIGGG TK QPVY
Sbjct  134  RSKGRAEAAILSNAPGSVILRPSIVFGPEDSFFNKFAAMAKMFPALPLIGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAK  434
            V DVA A+  +L  DGT + GK+YELGGPE+ T  +  EL+   IR     V +PF IA 
Sbjct  194  VEDVAQAV--ALGVDGTIAGGKIYELGGPEVLTFRECMELVLHTIRRQRPLVSLPFGIAS  251

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKG  266
             + +   L+      PL TP I + D +  L  D +VSE+A+    T E +GI P  L  
Sbjct  252  MLGSVASLI------PLITPPITS-DQVALLRHDNVVSEDAIRDGRTLEGMGIRPTLLSS  304

Query  265  YPVEYLIQYRKGG  227
                YL+QYR  G
Sbjct  305  VVPSYLVQYRPQG  317



>ref|WP_036555293.1| 3-beta hydroxysteroid dehydrogenase [Nisaea denitrificans]
Length=317

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/191 (41%), Positives = 105/191 (55%), Gaps = 10/191 (5%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  ++KA  E AV    P ATIL+P+++ G +D   N +   A+ + FLPLIGGG TK Q
Sbjct  129  RYARSKAAGEAAVKSAFPTATILRPSIVFGPDDDFFNRFGTMAEAFSFLPLIGGGQTKFQ  188

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA A +A+L  D  + G+ YELGGP  ++   L EL+        R V++PF +
Sbjct  189  PVYVDDVARAALAALTSD-AAEGQTYELGGPTTYSFRDLMELVVAQTGRKCRLVQIPFWL  247

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            A   AT  EL        LPTP +   D +  L +D +VSE A T  D GI P   +   
Sbjct  248  ASLEATFLEL--------LPTPPL-TRDQVVLLKSDNVVSEGAATLADFGIKPTACEAIL  298

Query  259  VEYLIQYRKGG  227
              YL ++R GG
Sbjct  299  PTYLDRFRSGG  309



>gb|EKE10168.1| NADH dehydrogenase (Ubiquinone) 1 alpha subcomplex subunit 9 
[uncultured bacterium]
Length=308

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 108/192 (56%), Gaps = 12/192 (6%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R    KA  EE VL+  PEAT+ +P+V+ G ED  LN +A+ A+   FLPLIGGG T+ Q
Sbjct  126  RYASTKARGEEVVLKHFPEATVFRPSVIFGPEDAFLNRFAEMARFSPFLPLIGGGKTRFQ  185

Query  619  PVYVTDVASAII-ASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFP  443
            PVYV DVA   + A+ K +  S GK YELGG EI+T  QL   +   I      + VPF 
Sbjct  186  PVYVGDVAECFLKAAFKKE--SRGKTYELGGTEIYTFKQLMAYLLKTIYRKRLLLPVPFS  243

Query  442  IAKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGY  263
            +A+ +AT  + L    P P  TP     D +E L ++T VS  AL  +DLG+    ++  
Sbjct  244  LARIMATFAQFL----PTPPLTP-----DQVELLKSNTTVSSKALIAKDLGVHVKAMEAL  294

Query  262  PVEYLIQYRKGG  227
               YL +YR GG
Sbjct  295  APFYLKRYRPGG  306



>ref|WP_038036038.1| 3-beta hydroxysteroid dehydrogenase, partial [Thermopetrobacter 
sp. TC1]
Length=316

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 112/195 (57%), Gaps = 14/195 (7%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  + KA  E  V   +P+A IL+P+V++G ED   N +A+ A+    LPLIGGG T+ Q
Sbjct  124  RYGRTKAEGERRVRAAMPQAVILRPSVVVGPEDSFFNKFAEMARFSPVLPLIGGGKTRFQ  183

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA A + +L+D+  S GK  ELGGPE++T  +L E M  VIR     V VPF +
Sbjct  184  PVYVEDVAKAAVKALEDETLS-GKTLELGGPEVWTFRELMEYMLMVIRRRRMLVSVPFGV  242

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKL  272
            AK +A P + L    P P  TP     D ++ L  + +VS+ A     T E +GI P  +
Sbjct  243  AKVMAWPAQFL----PGPPLTP-----DQVKMLMRNNVVSDKARAEGRTLEGIGIEPDGI  293

Query  271  KGYPVEYLIQYRKGG  227
            +    +YL++YR  G
Sbjct  294  EAVVPDYLVRYRPAG  308



>ref|WP_045581478.1| 3-beta hydroxysteroid dehydrogenase [Azospirillum thiophilum]
 gb|KJR66167.1| 3-beta hydroxysteroid dehydrogenase [Azospirillum thiophilum]
Length=323

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 115/197 (58%), Gaps = 13/197 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA  E+AVL   P ATIL+P+++ G ED   N +A  A+    LPLIGGG T+ QPVY
Sbjct  133  RSKAAGEQAVLAAFPTATILRPSIVFGPEDNFFNKFAAMAQKAPVLPLIGGGKTRFQPVY  192

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V D+A A++A+L  DG + GK YELGGP +++  +L ELM   I+     V +P+ +A++
Sbjct  193  VGDLADAVVAALDLDG-ARGKTYELGGPRVYSFKELLELMQKDIQRHRPLVTLPWNVAES  251

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPV--  257
            +A      L+K+P   P       D +  L  DT+V++ AL F+DLGI   +L    V  
Sbjct  252  LAG----FLEKIPVLAPA---LTRDQVAMLKRDTVVAQGALGFKDLGIT--ELASCEVIL  302

Query  256  -EYLIQYRKGGPQYGST  209
              YL ++  GG   G T
Sbjct  303  PTYLSRFIVGGKYNGQT  319



>ref|WP_035694954.1| 3-beta hydroxysteroid dehydrogenase [Aurantimonas coralicida]
Length=334

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 109/192 (57%), Gaps = 14/192 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E+AVL  IP A I++P+++ G ED+  N +A  A+   FLPLIGGG T+ QPVY
Sbjct  133  RTKAEGEKAVLDAIPGAYIMRPSIVFGAEDQFFNRFADMARFSPFLPLIGGGKTRFQPVY  192

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A IA   D     G+VYELGGPE+ T  Q+ E M  +I     +V +PF  A +
Sbjct  193  VGDVAEA-IADTVDGKVPGGRVYELGGPEVLTFRQMMEEMLRIIERKRNFVTIPFGAAAS  251

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGY  263
            +A     L++ +P    TP     D +  L TD +VS++A+    T E  GI P  +   
Sbjct  252  MAK----LMRFLPGAPLTP-----DQVTQLQTDNVVSQDAIEDGRTLEAFGIRPRTVDAI  302

Query  262  PVEYLIQYRKGG  227
               YL+++RK G
Sbjct  303  LPTYLVRFRKHG  314



>ref|WP_029585516.1| 3-beta hydroxysteroid dehydrogenase [Bradyrhizobium sp. URHD0069]
Length=322

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 112/193 (58%), Gaps = 15/193 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA  E+AVL  IP ATI++P++M G ED+  N +A  A+    LPLIGGG T++QPVY
Sbjct  133  RSKAAGEKAVLSAIPSATIMRPSIMFGPEDQFTNRFASLARISPVLPLIGGGVTRLQPVY  192

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V+DVA+A +A   D  T  G  YELGGPE+ T+ ++ E++   I      + +PF +AK 
Sbjct  193  VSDVATA-VADAVDGKTKPGATYELGGPEVLTMREIMEIILATIERRRTMISLPFGLAKL  251

Query  430  IATPRELLLKKVPFPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKG  266
             A    L L+  P PL  TP     D +E L +D +VS+ A    LT E LGI    L+ 
Sbjct  252  QA----LFLQFAPGPLKLTP-----DQVELLRSDNVVSDAAKAAGLTLEGLGIAADTLEA  302

Query  265  YPVEYLIQYRKGG  227
                YL ++R  G
Sbjct  303  IAPLYLWRFRAAG  315



>ref|WP_041345268.1| 3-beta hydroxysteroid dehydrogenase [Nitrobacter winogradskyi]
Length=322

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 114/193 (59%), Gaps = 15/193 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            +AKA+ E+AVL  +P ATIL+P+VM G ED+  N +A  A     LPLIGGG T++QPV+
Sbjct  133  RAKASGEKAVLAAVPSATILRPSVMFGPEDQFANRFAALALISPMLPLIGGGATRMQPVH  192

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA+A +A   D  T  G VYELGGP++ ++ ++  ++  VI      V VPF +A+ 
Sbjct  193  VGDVATA-VADAVDGRTKAGAVYELGGPDVLSMREIMRIILRVIERERMLVPVPFLMARL  251

Query  430  IATPRELLLKKVPFPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKG  266
            +A    + L+  P PL  TP     D +  L TD +VS  A    LT + LGI P  ++ 
Sbjct  252  MA----MGLQFAPGPLKLTP-----DQVALLRTDNVVSNTATAAGLTLQGLGIAPDSMEA  302

Query  265  YPVEYLIQYRKGG  227
               +YL ++RK G
Sbjct  303  VVPQYLWRFRKAG  315



>ref|WP_040326025.1| 3-beta hydroxysteroid dehydrogenase [Aurantimonas manganoxydans]
Length=334

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 109/192 (57%), Gaps = 14/192 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E+AVL  IP A I++P+++ G ED+  N +A  A+   FLPLIGGG T+ QPVY
Sbjct  133  RTKAEGEKAVLDAIPGAYIMRPSIVFGAEDQFFNRFADMARFSPFLPLIGGGKTRFQPVY  192

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A IA   D     G+VYELGGPE+ T  Q+ E M  +I     +V +PF  A +
Sbjct  193  VGDVAEA-IADTVDGKVPGGRVYELGGPEVLTFRQMMEEMLRIIERKRSFVTIPFGAAAS  251

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGY  263
            +A     L++ +P    TP     D +  L TD +VS++A+    T E  GI P  +   
Sbjct  252  MAK----LMRFLPGAPLTP-----DQVTQLQTDNVVSQDAIEDGRTLEAFGIRPRTVDAI  302

Query  262  PVEYLIQYRKGG  227
               YL+++RK G
Sbjct  303  LPTYLVRFRKHG  314



>ref|WP_035569694.1| 3-beta hydroxysteroid dehydrogenase [Hyphomonas adhaerens]
 gb|KCZ84945.1| putative NADH-quinone oxidoreductase [Hyphomonas adhaerens MHS-3]
Length=329

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 109/173 (63%), Gaps = 8/173 (5%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA AEEAV + +P ATIL+P+V+ G ED   N +AQ A+    +P IGGG TK+QPVY
Sbjct  131  RTKAEAEEAVRKAVPTATILRPSVVFGPEDEFFNKFAQMARVAPVMPAIGGGKTKMQPVY  190

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRY-VKVPFPIAK  434
              DVA AI  S+ DD T+ GK YELGGP ++T++++ + +   I   PR+ + +PF +AK
Sbjct  191  AGDVAEAIAVSVDDD-TTAGKTYELGGPRVYTMNEIYDFICKTISR-PRFKISLPFVLAK  248

Query  433  AIATPRELLLKKV-PFP---LPTPSIFNLDVIEALTTDTLVSENALTFEDLGI  287
             I      + + V PF    L  P +   D +E L TD +V+++ALT EDLG+
Sbjct  249  PIGYLSGAVWRYVPPFSWGFLGQPPVTG-DQVEMLKTDNVVADDALTLEDLGV  300



>ref|WP_024514903.1| 3-beta hydroxysteroid dehydrogenase [Bradyrhizobium sp. Tv2a-2]
Length=322

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 111/193 (58%), Gaps = 15/193 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E+AVL  +P ATI++P+V+ G ED+  N +   A+   FLPLIGGG TK+QPVY
Sbjct  133  RTKAEGEKAVLAAVPTATIMRPSVVFGPEDQFTNRFGALARISPFLPLIGGGVTKMQPVY  192

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVASA +A   D     G  YELGGPEI ++ ++ E + D+       V +PF IA+ 
Sbjct  193  VGDVASA-VADAVDGKAKAGATYELGGPEILSMREIMETILDITDRERMLVSLPFGIARF  251

Query  430  IATPRELLLKKVPFPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKG  266
                +  +L+  P  L  TP     D +E L +D +VS+ A    LT E LGI P  L+G
Sbjct  252  ----QSHVLQFAPGALKLTP-----DQVELLRSDNVVSQAAKDAGLTLEGLGITPDSLEG  302

Query  265  YPVEYLIQYRKGG  227
               +YL ++R  G
Sbjct  303  VAPQYLWRFRPAG  315



>gb|EAS48786.1| NADH-ubiquinone oxidoreductase [Aurantimonas manganoxydans SI85-9A1]
Length=369

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 109/192 (57%), Gaps = 14/192 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E+AVL  IP A I++P+++ G ED+  N +A  A+   FLPLIGGG T+ QPVY
Sbjct  168  RTKAEGEKAVLDAIPGAYIMRPSIVFGAEDQFFNRFADMARFSPFLPLIGGGKTRFQPVY  227

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A IA   D     G+VYELGGPE+ T  Q+ E M  +I     +V +PF  A +
Sbjct  228  VGDVAEA-IADTVDGKVPGGRVYELGGPEVLTFRQMMEEMLRIIERKRSFVTIPFGAAAS  286

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGY  263
            +A     L++ +P    TP     D +  L TD +VS++A+    T E  GI P  +   
Sbjct  287  MAK----LMRFLPGAPLTP-----DQVTQLQTDNVVSQDAIEDGRTLEAFGIRPRTVDAI  337

Query  262  PVEYLIQYRKGG  227
               YL+++RK G
Sbjct  338  LPTYLVRFRKHG  349



>gb|ABA03434.1| NAD-dependent epimerase/dehydratase [Nitrobacter winogradskyi 
Nb-255]
Length=353

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 114/193 (59%), Gaps = 15/193 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            +AKA+ E+AVL  +P ATIL+P+VM G ED+  N +A  A     LPLIGGG T++QPV+
Sbjct  164  RAKASGEKAVLAAVPSATILRPSVMFGPEDQFANRFAALALISPMLPLIGGGATRMQPVH  223

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA+A +A   D  T  G VYELGGP++ ++ ++  ++  VI      V VPF +A+ 
Sbjct  224  VGDVATA-VADAVDGRTKAGAVYELGGPDVLSMREIMRIILRVIERERMLVPVPFLMARL  282

Query  430  IATPRELLLKKVPFPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKG  266
            +A    + L+  P PL  TP     D +  L TD +VS  A    LT + LGI P  ++ 
Sbjct  283  MA----MGLQFAPGPLKLTP-----DQVALLRTDNVVSNTATAAGLTLQGLGIAPDSMEA  333

Query  265  YPVEYLIQYRKGG  227
               +YL ++RK G
Sbjct  334  VVPQYLWRFRKAG  346



>ref|WP_041768854.1| 3-beta hydroxysteroid dehydrogenase [Pseudovibrio sp. FO-BEG1]
Length=326

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 114/202 (56%), Gaps = 15/202 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            K KA  E+AVL  +P A I +P+++ G ED   N +   A+ +  LPLIGGG TK QPVY
Sbjct  135  KTKAAGEKAVLDAMPNAVIFRPSIVFGPEDDFFNRFGSMAQLFPALPLIGGGHTKFQPVY  194

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A IA+  ++    GK+YELGGP++ T  +  +LM +VI      V +PF +A+ 
Sbjct  195  VGDVALA-IANAAENKVETGKIYELGGPQVATFKECLQLMMNVILRRRMLVSLPFLMARI  253

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
             A      L+ +P P+ T     +D +  L +D +VS+ A     TFE LGI PH ++  
Sbjct  254  QAK----FLQMLPKPMLT-----VDQVNLLKSDNVVSKEAQAEKRTFEGLGIEPHSMEAI  304

Query  262  PVEYLIQYRKGGPQYGSTVSEK  197
               YL ++R  G QY S  S K
Sbjct  305  LPTYLDKFRPRG-QYDSQKSAK  325



>ref|WP_041801299.1| 3-beta hydroxysteroid dehydrogenase [Rhodopseudomonas palustris]
Length=327

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 79/193 (41%), Positives = 111/193 (58%), Gaps = 15/193 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA  E+AVL  +P+A I +P+V+ G ED+  N +A  A+    +PLIGGG TK+QPVY
Sbjct  133  RSKAAGEQAVLAAVPQAVIFRPSVVFGPEDQFTNRFAGLARMSAVVPLIGGGATKLQPVY  192

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA+A +A   D     G  YELGGPE+ T+ Q+ E++ DVI+     + +PF +A+ 
Sbjct  193  VGDVATA-VAQAVDGKAKPGATYELGGPEVLTMRQVIEIILDVIQRRRILLSLPFGLARL  251

Query  430  IATPRELLLKKVPFPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKG  266
             A     LL+  P PL  TP     D +  L  D +VSE A    LT + LGI P  L+ 
Sbjct  252  QAQ----LLQFAPGPLKLTP-----DQVALLQVDNVVSEAAQAAGLTLQGLGIPPDSLQA  302

Query  265  YPVEYLIQYRKGG  227
                YL ++R  G
Sbjct  303  IAPSYLWRFRATG  315



>gb|AEV35208.1| NADH dehydrogenase (ubiquinone) [Pseudovibrio sp. FO-BEG1]
Length=328

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 114/202 (56%), Gaps = 15/202 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            K KA  E+AVL  +P A I +P+++ G ED   N +   A+ +  LPLIGGG TK QPVY
Sbjct  137  KTKAAGEKAVLDAMPNAVIFRPSIVFGPEDDFFNRFGSMAQLFPALPLIGGGHTKFQPVY  196

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A IA+  ++    GK+YELGGP++ T  +  +LM +VI      V +PF +A+ 
Sbjct  197  VGDVALA-IANAAENKVETGKIYELGGPQVATFKECLQLMMNVILRRRMLVSLPFLMARI  255

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
             A      L+ +P P+ T     +D +  L +D +VS+ A     TFE LGI PH ++  
Sbjct  256  QAK----FLQMLPKPMLT-----VDQVNLLKSDNVVSKEAQAEKRTFEGLGIEPHSMEAI  306

Query  262  PVEYLIQYRKGGPQYGSTVSEK  197
               YL ++R  G QY S  S K
Sbjct  307  LPTYLDKFRPRG-QYDSQKSAK  327



>ref|WP_035693857.1| 3-beta hydroxysteroid dehydrogenase, partial [Azospirillum halopraeferens]
Length=313

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 107/188 (57%), Gaps = 8/188 (4%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA  E AVL   PEATIL+P+++ G ED+  N +A  A+    LPLIGGG T+ QPVY
Sbjct  133  RSKAAGEAAVLEAFPEATILRPSIVFGPEDQFFNRFAAMAQVSPVLPLIGGGKTRFQPVY  192

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA AI+ +L  D  + G+ YELGGP ++T  QL E M   IR     V VP+  A  
Sbjct  193  VGDVADAIVGALTAD-DAAGRTYELGGPGVYTFRQLMERMLGEIRRKRLLVPVPWGAAGT  251

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
            +      +L+KVP   P   +   D +E L  D +V+ +A   ++LG+ P  L+     Y
Sbjct  252  LGG----ILEKVPLGAP---LLTRDQVEMLRHDNVVAADAPGLKELGVTPTALEVILPTY  304

Query  250  LIQYRKGG  227
            L ++  GG
Sbjct  305  LFRFIVGG  312



>sp|Q0DWQ7.1|CCB12_ORYSJ RecName: Full=Cyclin-B1-2; AltName: Full=G2/mitotic-specific 
cyclin-B1-2; Short=CycB1;2 [Oryza sativa Japonica Group]
Length=391

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 82/127 (65%), Gaps = 17/127 (13%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            RM +AKA  EE+VL+E PE   L  +        ILN                   ++IQ
Sbjct  280  RMLRAKAAGEESVLKEFPEPLRLLISHRQSMGTCILNF-----------------HSRIQ  322

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA+AI+ SLKDDGTSMGK Y LGGPEI+TVH LAELMY+ I EWPRY+ VP PI
Sbjct  323  PVYVVDVAAAIVNSLKDDGTSMGKSYGLGGPEIYTVHDLAELMYETICEWPRYIDVPLPI  382

Query  439  AKAIATP  419
            A+AIA+P
Sbjct  383  ARAIASP  389



>gb|ABD86012.1| NAD-dependent epimerase/dehydratase [Rhodopseudomonas palustris 
BisB18]
Length=349

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 79/193 (41%), Positives = 111/193 (58%), Gaps = 15/193 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA  E+AVL  +P+A I +P+V+ G ED+  N +A  A+    +PLIGGG TK+QPVY
Sbjct  155  RSKAAGEQAVLAAVPQAVIFRPSVVFGPEDQFTNRFAGLARMSAVVPLIGGGATKLQPVY  214

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA+A +A   D     G  YELGGPE+ T+ Q+ E++ DVI+     + +PF +A+ 
Sbjct  215  VGDVATA-VAQAVDGKAKPGATYELGGPEVLTMRQVIEIILDVIQRRRILLSLPFGLARL  273

Query  430  IATPRELLLKKVPFPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKG  266
             A     LL+  P PL  TP     D +  L  D +VSE A    LT + LGI P  L+ 
Sbjct  274  QAQ----LLQFAPGPLKLTP-----DQVALLQVDNVVSEAAQAAGLTLQGLGIPPDSLQA  324

Query  265  YPVEYLIQYRKGG  227
                YL ++R  G
Sbjct  325  IAPSYLWRFRATG  337



>gb|EEA95143.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9 
[Pseudovibrio sp. JE062]
Length=328

 Score =   127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 80/202 (40%), Positives = 114/202 (56%), Gaps = 15/202 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            K KA  E+AVL  +P A I +P+++ G ED   N +   A+ +  LPLIGGG TK QPVY
Sbjct  137  KTKAAGEKAVLEAMPNAVIFRPSIVFGPEDDFFNRFGSMAQLFPALPLIGGGHTKFQPVY  196

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A IA+  ++    GK+YELGGP++ T  +  +LM +VI      V +PF +A+ 
Sbjct  197  VGDVALA-IANAAENKVETGKIYELGGPQVATFKECLQLMMNVILRKRMLVSLPFLMARI  255

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
             A      L+ +P P+ T     +D +  L +D +VS+ A     TFE LGI PH ++  
Sbjct  256  QAK----FLQMLPKPMLT-----VDQVNLLKSDNVVSKEAQAEKRTFEGLGIEPHSMEAI  306

Query  262  PVEYLIQYRKGGPQYGSTVSEK  197
               YL ++R  G QY S  + K
Sbjct  307  LPTYLDKFRPRG-QYDSQNAAK  327



>ref|WP_027845124.1| 3-beta hydroxysteroid dehydrogenase [Mastigocoleus testarum]
Length=324

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 114/203 (56%), Gaps = 15/203 (7%)
 Frame = -1

Query  787  AKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYV  608
            +KA  E AVL   PEA IL+P+++ G  D   N +A  A+    LPL+GGG TK+QPVYV
Sbjct  132  SKANGEAAVLEAFPEAVILRPSIVFGKGDGFFNRFAGLARFLPALPLLGGGHTKMQPVYV  191

Query  607  TDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAI  428
             DVA A+  +L+D GTS GK+YELGGP +++  +L +++ D  +       VP+PIA+  
Sbjct  192  DDVADAVCVALEDTGTS-GKIYELGGPRVYSFKELMQIVLDETQRKRLLAPVPWPIAR--  248

Query  427  ATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYP  260
                  L  ++   LP P +   D ++ L TD +VSE A+    T  DLGI    ++   
Sbjct  249  ------LQGRILGLLPNP-LLTHDQVKMLETDNVVSEAAIAEKRTLGDLGIEATSVEAIV  301

Query  259  VEYLIQYRKGGPQYGSTVSEKIS  191
              YL  YR+ G QY   +  + +
Sbjct  302  PSYLWMYRRQG-QYAEDIRRETA  323



>ref|WP_011661958.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhodopseudomonas 
palustris]
 gb|ABJ04464.1| NAD-dependent epimerase/dehydratase [Rhodopseudomonas palustris 
BisA53]
Length=328

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 113/204 (55%), Gaps = 17/204 (8%)
 Frame = -1

Query  784  KATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVT  605
            KA  E+AVL  +P ATI++P+V+ G ED+  N +A  A+   F+PL+GGG  ++QPVYV 
Sbjct  135  KAAGEKAVLAAVPAATIMRPSVVFGPEDQFTNRFAALARMLPFVPLVGGGANRLQPVYVG  194

Query  604  DVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIA  425
            DVA A +A+  +     G VYELGGPE+ T+ ++ E +  +I+     + +PF +AK  A
Sbjct  195  DVAQA-VATAVEGLAKPGAVYELGGPEVLTMREVIEAILQIIQRRRTLLSLPFGLAKLQA  253

Query  424  TPRELLLKKVPFPLPTPSIFNL--DVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
               +            P I  L  D +E L  D +VSE A    LT + LGI P  L+  
Sbjct  254  ALLQF----------APGILQLTPDQVELLKVDNVVSEAAKAAGLTLQGLGIAPDSLQAM  303

Query  262  PVEYLIQYRKGGPQYGSTVSEKIS  191
               YL ++RK G   G  ++E+ S
Sbjct  304  APSYLWRFRKTGQFAGKPIAERPS  327



>ref|WP_037036496.1| 3-beta hydroxysteroid dehydrogenase [Pseudovibrio sp. JE062]
Length=326

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/202 (40%), Positives = 114/202 (56%), Gaps = 15/202 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            K KA  E+AVL  +P A I +P+++ G ED   N +   A+ +  LPLIGGG TK QPVY
Sbjct  135  KTKAAGEKAVLEAMPNAVIFRPSIVFGPEDDFFNRFGSMAQLFPALPLIGGGHTKFQPVY  194

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A IA+  ++    GK+YELGGP++ T  +  +LM +VI      V +PF +A+ 
Sbjct  195  VGDVALA-IANAAENKVETGKIYELGGPQVATFKECLQLMMNVILRKRMLVSLPFLMARI  253

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
             A      L+ +P P+ T     +D +  L +D +VS+ A     TFE LGI PH ++  
Sbjct  254  QAK----FLQMLPKPMLT-----VDQVNLLKSDNVVSKEAQAEKRTFEGLGIEPHSMEAI  304

Query  262  PVEYLIQYRKGGPQYGSTVSEK  197
               YL ++R  G QY S  + K
Sbjct  305  LPTYLDKFRPRG-QYDSQNAAK  325



>ref|WP_038279873.1| 3-beta hydroxysteroid dehydrogenase [alpha proteobacterium Mf 
1.05b.01]
Length=328

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 120/200 (60%), Gaps = 17/200 (9%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA  E AVL  IP ATI++P+++ G ED+  N +A  A+    LPLIGGG T+ QPVY
Sbjct  141  RSKAIGEAAVLEAIPTATIVRPSIIFGPEDQFFNRFAAMARLAPALPLIGGGETRYQPVY  200

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPR---YVKVPFPI  440
            V DVA+A+  +L+    + GKV ELGGPE+ T    AELM   ++E  R    VK+P   
Sbjct  201  VKDVAAAMTIALQQPQWN-GKVLELGGPEVAT---FAELMEITLKETGRSRPLVKLPSFA  256

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AKA+A+    +L+ +P PL T     +D +E L  D +VS+ AL F DLGI P  +    
Sbjct  257  AKAMAS----VLQFLPAPLLT-----VDQVELLKHDNVVSDGALGFSDLGIEPSAMSAIL  307

Query  259  VEYLIQYRKGGPQYGSTVSE  200
              YL ++R+ G Q+   V++
Sbjct  308  PAYLYRFRRTG-QFADGVAD  326



>ref|WP_039195170.1| 3-beta hydroxysteroid dehydrogenase [Aureimonas altamirensis]
 gb|KHJ53663.1| 3-beta hydroxysteroid dehydrogenase [Aureimonas altamirensis]
Length=335

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 114/214 (53%), Gaps = 20/214 (9%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  + KA  E  V   +P+AT+L+P+++ G ED+  N +A  A+   FLPLIGGG T  Q
Sbjct  130  RYARTKALGERYVFEAVPDATVLRPSIVFGAEDQFFNRFADMARFSPFLPLIGGGKTMFQ  189

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVA A+  ++ D     G VYELGGPEI +   L E M  VI    R++ +PF  
Sbjct  190  PVYVNDVAEAVAKTV-DGAVPGGCVYELGGPEILSFRALMEEMLLVIDRKRRFLDIPFGA  248

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKL  272
            A+ +A     L+K +P      +    D ++ L  D +VS+ A     TFE  GI P  L
Sbjct  249  AERLAG----LMKYLP-----GAPLTHDQVQQLRQDNVVSQAAKAEGRTFEAFGIQPRTL  299

Query  271  KGYPVEYLIQYR------KGGPQYGSTVSEKISP  188
            +     YL+++R      KG P    T+  +I+P
Sbjct  300  EAVLPTYLVRFRPQGQFTKGSPTSDQTIDPEIAP  333



>ref|WP_014249039.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Azospirillum lipoferum]
 emb|CBS88060.1| putative NAD-dependent epimerase/dehydratase [Azospirillum lipoferum 
4B]
Length=323

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 101/168 (60%), Gaps = 8/168 (5%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA  E+AVL   P ATIL+P+++ G ED   N +A  A+    LPLIGGG T+ QPVY
Sbjct  133  RSKAAGEQAVLSAFPAATILRPSIVFGPEDNFFNKFAAMAQKAPALPLIGGGKTRFQPVY  192

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V ++A A++A+L+ D  S GK YELGGP +++  +L EL    I+     V +P+ IA++
Sbjct  193  VGNLADAVVAALESD-DSRGKTYELGGPRVYSFRELLELTQKDIQRHRPLVTIPWNIAES  251

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGI  287
            +A      L+KVP   P       D +  L  D +VS  AL F+DLGI
Sbjct  252  LAG----FLEKVPVLAPA---LTRDQVALLRQDNVVSPTALGFKDLGI  292



>ref|WP_020043898.1| hypothetical protein [alpha proteobacterium SCGC AAA298-K06]
Length=327

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/193 (41%), Positives = 110/193 (57%), Gaps = 5/193 (3%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E +VL+  PEATIL+P+++ G ED+  N +AQ A    FLPL+ G  TK QPVY
Sbjct  130  RTKALGEASVLKYFPEATILRPSIIFGAEDQFFNRFAQMATLSPFLPLV-GANTKFQPVY  188

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A+  +L D  +S+  VYELGGP + T  +L + M  VI+     + VPF +A+ 
Sbjct  189  VGDVAVAVEKALLD--SSVCGVYELGGPNVETFSELMKRMLGVIQRRRLMLNVPFFVAEI  246

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
            +    + L+K V   L   +I   D ++ L  D +VS NA    DL I P  ++    EY
Sbjct  247  MGQTLD-LIKAVSLGLFPNNILTQDQVKNLKNDNVVSANAKNLGDLDIKPTAMETVLPEY  305

Query  250  LIQYRKGGPQYGS  212
            L +YR  G QY S
Sbjct  306  LWRYRVSG-QYAS  317



>ref|WP_008943960.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Oceanibaculum 
indicum]
 gb|EKE76880.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Oceanibaculum 
indicum P24]
Length=316

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 106/188 (56%), Gaps = 10/188 (5%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA  E AV    PEATIL+P+++ G ED   N +A  A+    LPLIGGG T  QPVY
Sbjct  132  RSKAAGEAAVREVFPEATILRPSIVFGPEDGFFNRFAAMARLSPALPLIGGGHTLFQPVY  191

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A++  L D   + GK+YELGGP+ ++   L ELM   I      V VPF IA+ 
Sbjct  192  VGDVADAVLRVLSDP-KAQGKIYELGGPKTYSFKALMELMLATIGRSRLLVPVPFGIAEL  250

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
             A+  +L        LP P +   D +  L  D +VSE ALT  DLGI P  ++     Y
Sbjct  251  QASVLQL--------LPVPPL-TRDQVTLLKRDNVVSEGALTLADLGIEPTTVEVILPAY  301

Query  250  LIQYRKGG  227
            + ++R+GG
Sbjct  302  MERFRRGG  309



>emb|CCF21999.1| putative NADH dehydrogenase/NADH dehydrogenase (Ubiquinone) protein 
[Rhizobium sp.]
Length=326

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 107/193 (55%), Gaps = 14/193 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++K  AE A+L  +P+A IL+P+++ G ED   N +A  AK +  LPLIGGG TK QPVY
Sbjct  134  QSKGRAEAAILDTVPDAVILRPSIVFGPEDSFFNKFAGMAKMFPALPLIGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAK  434
            V DVA A+  +L  DG    G++YELGGPE+ T  +  E++          + +PFPIA 
Sbjct  194  VEDVAKAV--ALGVDGVIPGGRIYELGGPEVLTFRECMEIVLRTTARKRPLISLPFPIAS  251

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKG  266
             I +   L+      PL  P I + D +  L  D +VSE A+    T E +GI P  L  
Sbjct  252  MIGSVASLI------PLIKPPITS-DQVALLKKDNVVSEEAIRDGRTLEGMGIRPTHLTS  304

Query  265  YPVEYLIQYRKGG  227
                YL+QYR  G
Sbjct  305  VVPSYLVQYRPQG  317



>ref|WP_043948096.1| 3-beta hydroxysteroid dehydrogenase [Candidatus Phaeomarinobacter 
ectocarpi]
Length=323

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 112/201 (56%), Gaps = 15/201 (7%)
 Frame = -1

Query  787  AKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYV  608
            +KA  E AVL   P+A IL+P+++ G  D   N +A  AK    LPL+GGG TK+QPVYV
Sbjct  132  SKAEGEAAVLDAFPDAVILRPSIIFGNGDGFFNRFAAMAKFSPALPLLGGGHTKMQPVYV  191

Query  607  TDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAI  428
             DVA A+  +L+D  T  GK YELGGP   TV+   ELM  V+ E  R  ++  PI  +I
Sbjct  192  DDVADAVCTALEDTSTQ-GKTYELGGP---TVYSFKELMQIVLDETQRK-RILAPIPWSI  246

Query  427  ATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYP  260
            A  +  +L  +P PL T     LD +  L TD +VSE A     T EDLGI P  ++   
Sbjct  247  ARLQGRILGLLPAPLLT-----LDQVRMLETDNVVSEEATSQNRTIEDLGITPKSVEAIV  301

Query  259  VEYLIQYRKGGPQYGSTVSEK  197
              YL  YR+ G QY   +  +
Sbjct  302  PGYLWMYRRQG-QYAEDIKRE  321



>ref|WP_023512751.1| putative nucleoside-diphosphate-sugar epimerase [Shinella sp. 
DD12]
 gb|EYR83343.1| putative nucleoside-diphosphate-sugar epimerase [Shinella sp. 
DD12]
Length=326

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 106/193 (55%), Gaps = 14/193 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E AVLR +P+A IL+P+++ G ED   N +A  A+    LPLIGGG TK QPVY
Sbjct  134  RTKARGEAAVLRTVPDAVILRPSIVFGPEDGFFNKFATMARYAPVLPLIGGGHTKFQPVY  193

Query  610  VTDVASAIIASLKDDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAK  434
            V DVA A+  S+  DGT   G+VYELGGPE+ T  Q  ELM  ++      V +PF IA 
Sbjct  194  VADVAEAVARSV--DGTIERGRVYELGGPEVLTFRQCLELMLRIVDRKNPLVSLPFGIAS  251

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKG  266
             + +   L    VPF  P       D +  L +D +VS+ A     T E +GI P   + 
Sbjct  252  LMGSVASL----VPFIKPP---LTADQVTLLRSDNIVSDAARNEGRTLEAIGIEPILAEA  304

Query  265  YPVEYLIQYRKGG  227
                YL++YR  G
Sbjct  305  ILPSYLVRYRPQG  317



>ref|WP_042689500.1| 3-beta hydroxysteroid dehydrogenase [Azospirillum sp. B506]
Length=323

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 110/199 (55%), Gaps = 13/199 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA  E+AVL   P ATIL+P+++ G ED   N +A  A+    LPLIGGG T  QPVY
Sbjct  133  RSKAAGEQAVLSAFPAATILRPSIVFGPEDNFFNKFAAMAQKAPALPLIGGGKTLFQPVY  192

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V D+A A++A+L  D  S GK YELGGP ++T  +L +L    I      V +P+  A++
Sbjct  193  VGDLADAVVAALDSD-ASRGKTYELGGPRVYTFRELLDLTQKAILRHRPLVTIPWNAAES  251

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPV--  257
            +A     +L+KVP   P       D +  L  D +VS  AL F+DLGI   +L    V  
Sbjct  252  LAG----ILEKVPVLAPA---LTRDQVALLKQDNVVSPGALGFKDLGIA--ELASCEVIL  302

Query  256  -EYLIQYRKGGPQYGSTVS  203
              YL ++  GG   G T S
Sbjct  303  PTYLSRFIVGGKFSGQTNS  321



>ref|XP_011401632.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Auxenochlorella protothecoides]
 gb|KFM28596.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Auxenochlorella protothecoides]
Length=378

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 108/191 (57%), Gaps = 8/191 (4%)
 Frame = -1

Query  742  ATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKDDG  563
            ATI K A + GTEDR+ N  A+  K Y  LPL+ GG  ++QPV+V DVA A+  S++++G
Sbjct  183  ATIFKVAPVTGTEDRVFNQLARLIKAYPALPLVAGGALRLQPVWVRDVAQAVFNSMQEEG  242

Query  562  TSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPFPL  383
             + GK Y L GPE+ T+ QLA+L Y  IRE    + VP  +A+  + P   L  K PF  
Sbjct  243  AA-GKTYALAGPEVLTLSQLADLTYHTIREPHNVLPVPEKLAELASRPLGWLGTKTPF-R  300

Query  382  PTPSIFNLDVIEALTTD-TLVSENA----LTFEDLGIVPHKL-KGYPVEYLIQYRKGGPQ  221
              P   +  V E    D TL +  A    LT EDLG+ P ++ +G+P+E+L  YR GG  
Sbjct  301  ANPFFSSDSVAELARGDFTLAAATADQPLLTIEDLGVAPRRVTEGHPIEFLRYYRSGGYD  360

Query  220  YGSTVSEKISP  188
             G+      +P
Sbjct  361  MGAVAEVDSAP  371



>ref|WP_020042805.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Salipiger mucosus]
 gb|EPX79806.1| NAD-dependent epimerase/dehydratase [Salipiger mucosus DSM 16094]
Length=327

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 106/195 (54%), Gaps = 14/195 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  EEAVL+ +P+A IL+P+VM G ED+  N +A  ++    LPL+ G  TK QPVY
Sbjct  130  RTKALGEEAVLKHMPDAMILRPSVMFGVEDQFFNRFAGMSRMGPVLPLV-GAETKFQPVY  188

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +  +   G + G  YELGGP++ T  +L   M ++IR     V +PF IA  
Sbjct  189  VDDVARAAVMGVT--GEAAGGTYELGGPDVDTFRELISQMLEIIRRRRLLVNIPFGIASV  246

Query  430  IA----TPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGY  263
            +     T   L    VP  + +  + N      L  D +VSE A  FE LG  P  ++  
Sbjct  247  MGRVFETVSRLTGGLVPAQITSDQVIN------LRHDNVVSEGARGFETLGFEPASMEAV  300

Query  262  PVEYLIQYRKGGPQY  218
              EYL ++RKGG QY
Sbjct  301  LPEYLWRFRKGG-QY  314



>ref|WP_009449172.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Nitratireductor 
indicus]
 gb|EKF44097.1| NAD-dependent epimerase/dehydratase [Nitratireductor indicus 
C115]
Length=324

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 103/192 (54%), Gaps = 14/192 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E+AVL  I +A I++P+++ G ED+  N +A  A+   F+PLIGGG TK QPVY
Sbjct  135  RTKALGEQAVLETIKDAVIVRPSIVFGPEDKFFNRFANMARFSPFIPLIGGGETKFQPVY  194

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA     S+  D    GK+YELGGPE+ T  Q  E M DV       V VP+ IA+ 
Sbjct  195  VGDVAEVFARSVDGD-LEGGKIYELGGPEVLTFRQCMEQMLDVTCRKRWLVSVPWAIAR-  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGY  263
                   L  ++   LP P +  LD ++ L  D +VSE A     T + LGI  H L   
Sbjct  253  -------LQGRILGLLPNP-LLTLDQVKLLEKDNVVSEEAAREKRTLQGLGIAGHSLAAI  304

Query  262  PVEYLIQYRKGG  227
               YL ++R  G
Sbjct  305  LPMYLWRFRPAG  316



>ref|WP_011508790.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Nitrobacter hamburgensis]
 gb|ABE61084.1| NAD-dependent epimerase/dehydratase [Nitrobacter hamburgensis 
X14]
Length=322

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 111/187 (59%), Gaps = 15/187 (8%)
 Frame = -1

Query  772  EEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVAS  593
            E+AVL  +P ATIL+P+V+ G+ED+  N +A  A     LPLIGGG TK+QPVYV DVA+
Sbjct  139  EKAVLAAVPSATILRPSVVFGSEDQFANRFAALALMSPVLPLIGGGATKLQPVYVGDVAT  198

Query  592  AIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRE  413
            A +A   D  T  G VYELGGPE+ ++ ++ +++  VI      V +PF IA+     + 
Sbjct  199  A-VADAVDGRTKAGAVYELGGPEVLSMREIIQIILRVIERERVLVPLPFLIARF----KA  253

Query  412  LLLKKVPFPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYL  248
            + L+  P  L  TP     D +  L TD +VS++A    LT + LGI P  ++    +YL
Sbjct  254  MFLQFAPGALKLTP-----DQVALLRTDNVVSDSATAAGLTLQGLGISPDSMEAVVPQYL  308

Query  247  IQYRKGG  227
             ++RK G
Sbjct  309  WRFRKAG  315



>ref|WP_039540296.1| 3-beta hydroxysteroid dehydrogenase [Ruegeria sp. ANG-R]
 gb|KIC40448.1| 3-beta hydroxysteroid dehydrogenase [Ruegeria sp. ANG-R]
Length=327

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 108/191 (57%), Gaps = 5/191 (3%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E  VL+ +P A IL+P+V+ GTED+  N +A   +   FLPL+ G  T+ QPVY
Sbjct  130  RTKAQGEAGVLQHMPNAVILRPSVIFGTEDQFFNRFAGMTRMSPFLPLV-GADTQFQPVY  188

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +  +   G +   VYELGGPE+ +   L + M DVI      V +PF +AK 
Sbjct  189  VDDVAQAAVQGVL--GKATAGVYELGGPEVKSFRALMQQMLDVIHRRRIIVGLPFWVAKI  246

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
            +A   + ++K V F L   +I   D ++ L  D +V+E+A  F DLGI P  L     EY
Sbjct  247  MAGVLD-IVKFVSFQLFPNNILTRDQLKNLRRDNVVAEDARGFADLGIEPATLDSILPEY  305

Query  250  LIQYRKGGPQY  218
            L ++R  G QY
Sbjct  306  LWKFRPSG-QY  315



>ref|WP_038592623.1| 3-beta hydroxysteroid dehydrogenase [Neorhizobium galegae]
 emb|CDN50644.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Neorhizobium galegae 
bv. orientalis str. HAMBI 540]
Length=326

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 104/198 (53%), Gaps = 14/198 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++K  AE  +L  +P+A IL+P++M G ED   N +A  A+ +  LPLIGGG TK QPVY
Sbjct  134  RSKGRAEATILSTLPDAVILRPSIMFGPEDSFFNKFASMARTFPALPLIGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAK  434
            V DVA  +  S+  DGT + GK+YELGG E+ T  Q  E M  V       V +PF IA 
Sbjct  194  VEDVAETVARSV--DGTIASGKIYELGGGEVMTFRQCLETMLRVTNRTNALVSLPFGIAS  251

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKG  266
             I +   L    +PF  P       D ++ L  D +VS+ A     T + +GI P     
Sbjct  252  LIGSIASL----IPFVQPP---ITSDQVKLLKIDNVVSDAAATEGRTLQGIGIRPTLASS  304

Query  265  YPVEYLIQYRKGGPQYGS  212
                YL+QYR  G   GS
Sbjct  305  ILPSYLVQYRPQGQYTGS  322



>ref|WP_028793393.1| 3-beta hydroxysteroid dehydrogenase [Thalassobaculum salexigens]
Length=317

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 109/193 (56%), Gaps = 20/193 (10%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA  E+AV    PEATIL+P+V+ G  D   N +A  A     LPLIGGGTT+ QPVY
Sbjct  131  RSKAEGEQAVRAAFPEATILRPSVVFGANDSFFNKFASLALLSPVLPLIGGGTTRFQPVY  190

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V +VA A++A+L+    + G+ YELGGPEI++  +L E++        + V +PF  A  
Sbjct  191  VDNVADAVMAALETP-AAKGQTYELGGPEIYSFRELMEMVLKETNRKAKLVNLPFWAASI  249

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVE-  254
             A   EL        LP+P +   D +E L +D +V+ +A T  DLG+     K  PVE 
Sbjct  250  QAAFLEL--------LPSP-MLTRDQVELLKSDNVVAADAKTLADLGV-----KATPVEV  295

Query  253  ----YLIQYRKGG  227
                YL ++R GG
Sbjct  296  IVPTYLDKFRPGG  308



>ref|WP_044427727.1| 3-beta hydroxysteroid dehydrogenase [Skermanella aerolata]
 gb|KJB96015.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Skermanella aerolata 
KACC 11604]
Length=321

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 110/188 (59%), Gaps = 10/188 (5%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA  E+AVL+  PEATIL+P+V+ G ED   N +   A+    LPLIGGG TK QPVY
Sbjct  133  RSKAAGEQAVLKAFPEATILRPSVVFGPEDGFFNRFGAMARISPVLPLIGGGHTKFQPVY  192

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA AI+ +L++   ++GK YELGGP +++  ++  L+    R     V VP+ +A+ 
Sbjct  193  VGDVADAIMKALENP-AALGKTYELGGPRVYSFKEIMGLVLTETRRKRIMVTVPWGVAEL  251

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
                +  +L K+P PL T     +D +E L  D +V+  A T  DLG+ P   +     Y
Sbjct  252  ----QGKILGKLPKPLLT-----VDQVELLKRDNVVAPGAATLADLGVEPTAAEVIIPTY  302

Query  250  LIQYRKGG  227
            L ++R GG
Sbjct  303  LDRFRVGG  310



>ref|WP_027297804.1| 3-beta hydroxysteroid dehydrogenase [Rhodospirillales bacterium 
URHD0088]
Length=317

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 104/188 (55%), Gaps = 10/188 (5%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA  E+A+    P ATIL+P+++ G ED   N +A+ A+    LPLIGGG T+ QPVY
Sbjct  131  RSKAAGEQALRAGFPGATILRPSIVFGPEDAFFNRFARLARILPALPLIGGGKTRFQPVY  190

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A++A+L DD  S G+ YELGGP I+T   L EL+    R     V VP+ +A+ 
Sbjct  191  VGDVADAVMAAL-DDPASAGQTYELGGPRIYTFKALMELILAETRRKRLLVPVPWAVARC  249

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
                     +     L       LD + +L  D +V   A T +DLGI P  ++     Y
Sbjct  250  ---------QGALLQLLPNPPLTLDQVRSLERDNIVPPGARTLKDLGITPDTVEAIVPAY  300

Query  250  LIQYRKGG  227
            L +YR+GG
Sbjct  301  LDRYRRGG  308



>ref|WP_037197314.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. OK494]
Length=326

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 106/197 (54%), Gaps = 12/197 (6%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA AE A+L   P+A I++P+++ G ED   N +A  ++   FLPLIGGG TK QPVY
Sbjct  134  RTKARAEAAILSIKPDAVIMRPSIVFGPEDGFFNKFADMSRTAPFLPLIGGGETKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A+  S+ D     G  YELGGPE+ T  +  E    VI      V +PF +A  
Sbjct  194  VEDVAEAVARSV-DGKLKAGTTYELGGPEVLTFRECLETTLSVINRKKTLVSIPFAVASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            I +   L+      PL TP I   D +  L +D +VS+ A     T +D+G++P  L   
Sbjct  253  IGSIASLV------PLITPPI-TPDQVTLLKSDNVVSKQAEAEGRTLKDIGLLPTLLISV  305

Query  262  PVEYLIQYRKGGPQYGS  212
               YL++YR  G   GS
Sbjct  306  LPSYLVRYRPQGQFTGS  322



>ref|WP_009757683.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Ahrensia sp. R2A130]
 gb|EFL90794.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9 
[Ahrensia sp. R2A130]
Length=320

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 107/192 (56%), Gaps = 14/192 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E+ V +  P+A I++P+++ G ED   N +A  A+    LPLIGGG ++ QPVY
Sbjct  131  RTKALGEDMVRKASPDAIIMRPSIIFGPEDDFFNRFAGMARIAPALPLIGGGKSRFQPVY  190

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A IA+  D+    G  +ELGGPE+ T  +  E M DVI      V +PFPIA A
Sbjct  191  VGDVAKA-IANAADEKLEAGSTWELGGPEVLTFRECMERMLDVIDRKRALVSLPFPIASA  249

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGY  263
            + +    LL+  P    TP       +E L +D +VS++++    T ED G+ P  L   
Sbjct  250  MGS----LLQFAPGAPITPG-----QVEMLKSDNVVSDDSITQNRTLEDAGVEPTALSAV  300

Query  262  PVEYLIQYRKGG  227
               YL+++RK G
Sbjct  301  LPTYLVRFRKHG  312



>ref|WP_008596326.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Nitratireductor 
pacificus]
 gb|EKF19243.1| NAD-dependent epimerase/dehydratase [Nitratireductor pacificus 
pht-3B]
Length=324

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 105/193 (54%), Gaps = 16/193 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E+A L  + +A I++P+++ G ED+  N +A  A+   FLPLIGGG T+ QPVY
Sbjct  135  RTKALGEQAALETVKDAVIIRPSIIFGPEDQFFNRFANMARFSPFLPLIGGGETRFQPVY  194

Query  610  VTDVASAIIASLKDDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAK  434
            V DVA     S+  DGT   GKVYELGGPE+ T  +  E M +VI     +V +P+ +A+
Sbjct  195  VGDVAEVYARSV--DGTLKGGKVYELGGPEVLTFRECMEQMLEVIHRKRWFVSIPWSVAR  252

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKG  266
                    +L K+P  L T     LD +E L  D +VSE A     T   LGI  H L  
Sbjct  253  LQGR----ILGKLPGHLLT-----LDQVEQLRHDNVVSEAAAKDKRTLAGLGIAQHSLAA  303

Query  265  YPVEYLIQYRKGG  227
                YL ++R  G
Sbjct  304  MLPAYLWRFRPAG  316



>ref|WP_008972707.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Bradyrhizobium 
sp. STM 3843]
 emb|CCE10197.1| conserved hypothetical protein [Bradyrhizobium sp. STM 3843]
Length=322

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 109/193 (56%), Gaps = 15/193 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            +AKA  E+AVL  +P ATI++P+V+ G ED   N +A  A+   FLPLIGGG T++QPVY
Sbjct  133  RAKAAGEKAVLTALPTATIMRPSVVFGPEDDFTNRFAGLARISPFLPLIGGGATRMQPVY  192

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA+A IA   D     G  YELGGPE+ +  ++ E++ D+       + +PF +AK 
Sbjct  193  VGDVATA-IADAVDGKARAGATYELGGPEVLSFREIIEIILDITDRKRMLLSLPFGLAKF  251

Query  430  IATPRELLLKKVPFPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKG  266
             A      L+  P PL  TP     D +E L +D +VS+ A     T + L I P  L+ 
Sbjct  252  QAA----FLQFAPGPLKLTP-----DQVELLRSDNVVSDAAQADGRTLQGLSITPDSLEA  302

Query  265  YPVEYLIQYRKGG  227
               +YL ++R  G
Sbjct  303  VGPQYLWRFRPAG  315



>ref|WP_038548505.1| 3-beta hydroxysteroid dehydrogenase [Neorhizobium galegae]
 emb|CDN56803.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Neorhizobium galegae 
bv. officinalis bv. officinalis str. HAMBI 1141]
Length=326

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 103/198 (52%), Gaps = 14/198 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++K  AE  +   +P+A IL+P++M G ED   N +A  A+ +  LPLIGGG TK QPVY
Sbjct  134  RSKGRAEATIFSTLPDAVILRPSIMFGPEDSFFNKFASMARTFPALPLIGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAK  434
            V DVA  +  S+  DGT + GK+YELGG E+ T  Q  E M  V       V +PF IA 
Sbjct  194  VEDVAETVARSV--DGTIASGKIYELGGGEVMTFRQCLETMLRVTNRTNALVSLPFGIAS  251

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKG  266
             I +   L    +PF  P       D ++ L  D +VS+ A     T + +GI P     
Sbjct  252  LIGSIASL----IPFVQPP---ITSDQVKLLKIDNVVSDTAATEGRTLQGIGIRPTLASS  304

Query  265  YPVEYLIQYRKGGPQYGS  212
                YL+QYR  G   GS
Sbjct  305  ILPSYLVQYRPQGQYTGS  322



>ref|WP_037079590.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium vignae]
Length=326

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 105/198 (53%), Gaps = 14/198 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++K  AE  +L  +P+A IL+P+++ G ED   N +A  A+ +  LPLIGGG TK QPVY
Sbjct  134  RSKGRAEATILSTLPDAVILRPSIVFGPEDSFFNKFASMARTFPALPLIGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAK  434
            V DVA  +  S+  DGT + GK+YELGG E+ T  Q  E M  V       V +PF IA 
Sbjct  194  VEDVAETVARSV--DGTIASGKIYELGGGEVMTFRQCLETMLRVTNRSNALVSLPFGIAS  251

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKG  266
             I +   L    +PF  P       D ++ L  D +VS+ A+    T + +GI P     
Sbjct  252  LIGSIASL----IPFVQPP---ITSDQVKLLKIDNVVSDAAITEGRTLQGIGIRPTLASS  304

Query  265  YPVEYLIQYRKGGPQYGS  212
                YL+QYR  G   GS
Sbjct  305  ILPSYLVQYRPQGQYTGS  322



>ref|WP_037457841.1| 3-beta hydroxysteroid dehydrogenase [Skermanella stibiiresistens]
 gb|EWY38050.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Skermanella stibiiresistens 
SB22]
Length=320

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 106/188 (56%), Gaps = 10/188 (5%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E+AV    PEATIL+P+V+ G ED   N +A  A+    LPLIGGG TK QPVY
Sbjct  133  RTKAAGEQAVREAFPEATILRPSVVFGPEDGFFNRFAAMARVLPALPLIGGGHTKFQPVY  192

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA AI+ +L     + GK YELGGP ++T  +L EL+    +     V VP+ +A+ 
Sbjct  193  VGDVADAIMKALA-SAEAPGKTYELGGPRVYTFKELMELVLAETKRKRFLVSVPWSVAEF  251

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
                +  +L K+P P+ T      D +E L +D +V+  A T  DLGI P   +     Y
Sbjct  252  ----QGKVLGKLPKPMLTE-----DQVELLRSDNVVAPGAATLADLGISPTAAEVIIPTY  302

Query  250  LIQYRKGG  227
            L +YR GG
Sbjct  303  LDRYRIGG  310



>ref|WP_028034557.1| 3-beta hydroxysteroid dehydrogenase [Chelativorans sp. J32]
Length=323

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 104/193 (54%), Gaps = 16/193 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E+A L  +  A +++P+++ G ED+  N +A  A+   FLPL+GGG  ++QPVY
Sbjct  135  RTKAAGEQAALETVKNAVVIRPSIIFGPEDKFFNRFANMARFSPFLPLVGGGRNRLQPVY  194

Query  610  VTDVASAIIASLKDDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAK  434
            V DVA     S+  DGT   G +YELGGP++ T  +  E M +VI     ++ VP+P+A+
Sbjct  195  VGDVAEVYARSV--DGTLKPGAIYELGGPQVLTFRECMEEMLEVIERKRAFISVPWPLAR  252

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKG  266
                    L  +V   LP P +  LD +  L  D +VSE A    LT E LGI  H L  
Sbjct  253  --------LQARVLGLLPNP-LLTLDQVRMLAVDNVVSEEASRRGLTLEGLGISRHALAT  303

Query  265  YPVEYLIQYRKGG  227
                YL  YR  G
Sbjct  304  ILPTYLWTYRPAG  316



>gb|KIE04291.1| NADH dehydrogenase (Ubiquinone) 1 alpha subcomplex subunit 9 
[endosymbiont of Acanthamoeba sp. UWC36]
Length=307

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 105/179 (59%), Gaps = 10/179 (6%)
 Frame = -1

Query  784  KATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVT  605
            K   E+AVL+  P + I++P+V+ G ED  +N +A+    +  +PLIGGG T++QPVYV 
Sbjct  138  KLEGEKAVLQTFPNSVIIRPSVVFGREDNFINMFAKLVAVFPVIPLIGGGRTRLQPVYVV  197

Query  604  DVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIA  425
            DVA A+   L  D    GKV+ELGG +++T+ ++ EL++ +I +    V +PF  AK +A
Sbjct  198  DVAEAVGRCLVKDNIC-GKVFELGGSKVYTLREIYELVFKLIGKKKPLVSIPFIFAKVMA  256

Query  424  TPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYL  248
                LL    P PL T      D +E L TD ++ +   +FE+LG+ P  ++    EY+
Sbjct  257  AILSLL----PRPLLT-----CDQVELLKTDNVIVKTKNSFEELGLTPTSMEAVLSEYI  306



>ref|WP_029057708.1| 3-beta hydroxysteroid dehydrogenase [Stappia stellulata]
Length=330

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 109/195 (56%), Gaps = 15/195 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA  E  V   +PEA + +P+++ G ED   N +A  A+    LPLIGGG T+ QPV+
Sbjct  140  RSKALGEAGVFETVPEAVVFRPSIVFGPEDGFFNRFASMARMSPVLPLIGGGATRFQPVF  199

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A+  ++ D  T+ G +YELGGPEI T  +  ELM +VIR     V +PF +A+ 
Sbjct  200  VGDVAEAVAMAV-DGQTARGTIYELGGPEIKTFKECLELMLEVIRRKRLLVTLPFSVARV  258

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGY  263
             A+  +         LP+P +  +D +E L +D +V E A+    T E LGI    L   
Sbjct  259  QASVMQW--------LPSPPL-TVDQVELLKSDNVVCEEAIADGRTLEGLGIEGRTLMAI  309

Query  262  PVEYLIQYRKGGPQY  218
               YL ++R+ G QY
Sbjct  310  LPTYLERFREHG-QY  323



>ref|WP_039459013.1| hypothetical protein, partial [endosymbiont of Acanthamoeba sp. 
UWC36]
Length=305

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 105/179 (59%), Gaps = 10/179 (6%)
 Frame = -1

Query  784  KATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVT  605
            K   E+AVL+  P + I++P+V+ G ED  +N +A+    +  +PLIGGG T++QPVYV 
Sbjct  137  KLEGEKAVLQTFPNSVIIRPSVVFGREDNFINMFAKLVAVFPVIPLIGGGRTRLQPVYVV  196

Query  604  DVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIA  425
            DVA A+   L  D    GKV+ELGG +++T+ ++ EL++ +I +    V +PF  AK +A
Sbjct  197  DVAEAVGRCLVKDNIC-GKVFELGGSKVYTLREIYELVFKLIGKKKPLVSIPFIFAKVMA  255

Query  424  TPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYL  248
                LL    P PL T      D +E L TD ++ +   +FE+LG+ P  ++    EY+
Sbjct  256  AILSLL----PRPLLT-----CDQVELLKTDNVIVKTKNSFEELGLTPTSMEAVLSEYI  305



>ref|WP_025425609.1| 3-beta hydroxysteroid dehydrogenase [Ensifer adhaerens]
 gb|AHK43123.1| NADH-ubiquinone oxidoreductase [Ensifer adhaerens OV14]
Length=326

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 105/197 (53%), Gaps = 17/197 (9%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L  +P+A IL+P+++ G ED   N +AQ A+    LPLIGGG TK QPVY
Sbjct  134  RTKGRAEAAILETLPDAIILRPSIVFGPEDGFFNKFAQMARFAPALPLIGGGNTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            VTDVA  +  S+ D   S G +YELGGP++ T  +  E+M   I      V VPF IA  
Sbjct  194  VTDVAEVVARSV-DGKLSAGTIYELGGPDVLTFRECLEIMLQTIDRKRSLVSVPFGIASL  252

Query  430  IATPRELLLKKVPFPLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLK  269
            +      +   +PF  P  TP     D +  L +D +VS  A     T   +GI P  L+
Sbjct  253  MGR----VASMIPFITPPITP-----DQVVLLKSDNIVSAKAESEGRTLGGIGITPTMLE  303

Query  268  GYPVEYLIQYRKGGPQY  218
                 YL++YR  G QY
Sbjct  304  SILSTYLVRYRPQG-QY  319



>ref|WP_006310143.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Agrobacterium 
sp. ATCC 31749]
 gb|EGL67030.1| NADH-ubiquinone oxidoreductase [Agrobacterium sp. ATCC 31749]
Length=326

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 103/192 (54%), Gaps = 12/192 (6%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+   +P A IL+P+++ G ED   N +A+ A+N  FLPLIGGG TK QPVY
Sbjct  134  RTKGRAEAAIHSVLPGAVILRPSIVFGPEDDFFNKFAKMARNLPFLPLIGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A+  S+ D     G +YELGGP++ T     E +         +V +PF +A  
Sbjct  194  VEDVAEAVARSV-DGKLKPGAIYELGGPDVMTFRDCLEAVLAATYRERSFVNLPFGVASM  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVS----ENALTFEDLGIVPHKLKGY  263
            I     L+      PL TP +   D +  L  D +VS    +N LT E +GI P ++   
Sbjct  253  IGKLASLV------PLITPPL-TPDQVTMLKKDNVVSAEAEKNGLTLEGIGITPVRVASV  305

Query  262  PVEYLIQYRKGG  227
               Y++QYR+ G
Sbjct  306  LPSYMVQYRQHG  317



>ref|WP_002717736.1| hypothetical protein [Afipia felis]
 gb|EKS30141.1| hypothetical protein HMPREF9697_02669 [Afipia felis ATCC 53690]
Length=321

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 108/196 (55%), Gaps = 16/196 (8%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R   +KA  E+AVL   P+ATI++P+++ G ED   N +A  A+ +  LPLI G  TK+Q
Sbjct  130  RYATSKALGEQAVLEATPDATIIRPSIVFGPEDHFTNRFAALARLFPALPLI-GADTKLQ  188

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            PVYV DVASA IA   D  T  G  YELGGPE+ T+ +  EL+  V    P  V +PF +
Sbjct  189  PVYVGDVASA-IADAVDGKTKAGATYELGGPEVMTMREAIELILRVAERDPMLVPLPFGL  247

Query  439  AKAIATPRELLLKKVPFPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHK  275
            AK  A      L+  P  L  TP     D +E L TD +VS+ A    LT E LGI P  
Sbjct  248  AKLQAA----FLQFAPGDLKLTP-----DQVEMLKTDNVVSDAAKSAGLTLEGLGIAPES  298

Query  274  LKGYPVEYLIQYRKGG  227
            +      YL ++RK G
Sbjct  299  MAAVLPSYLWRFRKTG  314



>ref|WP_037065538.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium leguminosarum]
Length=326

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 105/199 (53%), Gaps = 16/199 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L   P+A I +P+V+ G ED   N +A  A+    LPL+GGG TK QPVY
Sbjct  134  RTKGRAEAAILSIKPDAIIYRPSVVFGPEDGFFNKFADMARIAPVLPLVGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A+  +++    + GK+YELGGPE+ T  +  E M  V     R V +PF +A  
Sbjct  194  VVDVAEAVAKAVEGK-VAGGKIYELGGPEVLTFRECLEAMLKVTCRTNRLVSIPFSLASL  252

Query  430  IATPRELLLKKVPFPLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLK  269
            I +   L    VPF  P  TP     D +  L  D +VS++A     T + LGI P  + 
Sbjct  253  IGSVASL----VPFVAPPITP-----DQVRLLKKDNVVSKDAEADGRTLKGLGIAPTMVS  303

Query  268  GYPVEYLIQYRKGGPQYGS  212
                 YL+QYR  G   GS
Sbjct  304  SVLPSYLVQYRPHGQYTGS  322



>ref|WP_007529376.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium mesoamericanum]
 emb|CCM74073.1| NAD-dependent epimerase/dehydratase [Rhizobium mesoamericanum 
STM3625]
Length=326

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 103/197 (52%), Gaps = 12/197 (6%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+    P+A I +P+V+ G ED   N +A  A+   FLPLIGGG TK QPVY
Sbjct  134  RTKGRAEAAIHAIKPDAIIFRPSVVFGPEDSFFNKFADMARVSPFLPLIGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A+  +++   T+ G+VYELGGPE+ T  +  E+M    R   R V +PF IA  
Sbjct  194  VVDVAQAVARAVEGKVTA-GEVYELGGPEVLTFRECLEIMLKATRRKNRLVSLPFSIASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            +     L+      P  TP I   D +  L  D +VS+ A     T + +G+ P  +   
Sbjct  253  MGNIASLV------PFVTPPI-TADQVRLLKKDNIVSKEAEAEGRTLKGIGVTPTLVSSV  305

Query  262  PVEYLIQYRKGGPQYGS  212
               YL+ YR  G   GS
Sbjct  306  IGSYLVHYRPQGQYTGS  322



>ref|WP_011642056.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Maricaulis maris]
 gb|ABI64409.1| NAD-dependent epimerase/dehydratase [Maricaulis maris MCS10]
Length=321

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 110/192 (57%), Gaps = 7/192 (4%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  + KA  E AVL  +P+ATIL+P+++ GTED   N +A  A+    LPL GGG T+ Q
Sbjct  129  RYARTKAEGEAAVLAAMPDATILRPSIVFGTEDSFFNRFAAMARFVPALPLFGGGKTRFQ  188

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRY-VKVPFP  443
            PV+  DV  A++A+ +   T  G+ YELGGP ++T  +L   + D I + PR+ + +P+ 
Sbjct  189  PVFAGDVGKAVLAAFERSDTR-GQTYELGGPGVYTFEELMRFILDEI-DRPRFLLPLPWA  246

Query  442  IAKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGY  263
            I K IAT  EL+      PL  P +   D +  L +D +V+++A    DLGI    ++  
Sbjct  247  IGKVIATVSELV---GALPL-MPVLITRDQLVQLQSDNVVADDAKGLADLGIAGETVEAI  302

Query  262  PVEYLIQYRKGG  227
               YL +YR+ G
Sbjct  303  VPGYLERYRRYG  314



>ref|WP_040489901.1| 3-beta hydroxysteroid dehydrogenase, partial [Fulvimarina pelagi]
Length=323

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 107/192 (56%), Gaps = 14/192 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E+AV    P+A IL+P+++ G ED   N +A+ ++    LPL+GGG TK QP+Y
Sbjct  133  RTKAAGEKAVHAARPDAYILRPSIVFGPEDEFFNRFAEMSRFSPVLPLLGGGKTKFQPIY  192

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A+  ++ D+  + G VYELGGPE+ +  QL E M  VI    R+V +PF +A +
Sbjct  193  VVDVAEAVAKTV-DNEVAGGTVYELGGPEVLSFRQLMEEMLRVINRKRRFVSIPFSLAGS  251

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGY  263
            +A       + VP    TP     D ++ L  D +VSE A+    T +  GI P  +   
Sbjct  252  MAQ----FAQYVPGAPLTP-----DQVKQLQNDNVVSEEAIADGRTLDAFGIRPRTVDSI  302

Query  262  PVEYLIQYRKGG  227
               YL+++R  G
Sbjct  303  LPTYLVRFRPQG  314



>ref|WP_025029733.1| 3-beta hydroxysteroid dehydrogenase, partial [Nitratireductor 
aquibiodomus]
Length=217

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 106/192 (55%), Gaps = 14/192 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E+AVL  + +A I++P+++ G ED   N +A  A+   FLPLIGGG TK QPVY
Sbjct  28   RTKALGEQAVLETVKDAVIIRPSIVFGPEDDFFNRFANMARFSPFLPLIGGGETKFQPVY  87

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A   S+  D    G++YELGGPE+ +  +  E M +       +V +P+ +A+ 
Sbjct  88   VGDVAEAYARSVDGD-LEGGQIYELGGPEVLSFRECLEEMLEATYRKRWFVSLPWFVARI  146

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
             A     +L+ +P P+ T     LD ++ L TD +VSE A     T + LGI  H L   
Sbjct  147  QAR----ILQLLPKPMLT-----LDQVKLLKTDNVVSEEANAAGRTLDGLGIQKHSLAAI  197

Query  262  PVEYLIQYRKGG  227
               YL +YR  G
Sbjct  198  LPTYLWRYRPAG  209



>ref|WP_037115283.1| MULTISPECIES: 3-beta hydroxysteroid dehydrogenase [Rhizobium]
 gb|KEC72238.1| NADH dehydrogenase/NADH dehydrogenase (ubiquinone) protein [Rhizobium 
leguminosarum bv. phaseoli CCGM1]
Length=326

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 101/199 (51%), Gaps = 16/199 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L   P+A I +P+++ G ED   N +A  A+    LPL+GGG TK QPVY
Sbjct  134  RTKGRAEAAILSIKPDAVIFRPSIVFGPEDSFFNKFADMARMSPVLPLVGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +A   D    +GKVYELGGPE+ +  +  E M  V     R V +PF IA  
Sbjct  194  VEDVAEA-VARAVDGKVPVGKVYELGGPEVLSFRECLETMLKVTSRKNRLVSLPFGIASM  252

Query  430  IATPRELLLKKVPFPLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLK  269
            I +   L    +PF  P  TP     D +  L  D +VS  A     T + LGI P    
Sbjct  253  IGSIASL----IPFVTPPITP-----DQVRLLKRDNVVSAEAEAEGRTLKGLGIAPTMAA  303

Query  268  GYPVEYLIQYRKGGPQYGS  212
                 YL+QYR  G   GS
Sbjct  304  SVLESYLVQYRPHGQYTGS  322



>ref|WP_007813453.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium sp. 
CF142]
 gb|EJJ31046.1| putative nucleoside-diphosphate sugar epimerase [Rhizobium sp. 
CF142]
Length=326

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 103/199 (52%), Gaps = 16/199 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L   P+A I +P+++ G ED   N +A  A+ +  LPL+GGG TK QPVY
Sbjct  134  RTKGRAEAAILSIKPDAIIFRPSIVFGPEDSFFNKFADMARTFPVLPLVGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +A   D     GK+YELGGPE+ T  +  E +  V     R V +PF IA  
Sbjct  194  VEDVAEA-VARAVDGKVEGGKIYELGGPEVLTFRECLETILKVTVRKNRLVSLPFSIASL  252

Query  430  IATPRELLLKKVPFPLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLK  269
            I +   L+    PF  P  TP     D ++ L  D +VS+ A     T + LGI P    
Sbjct  253  IGSIASLM----PFIAPPITP-----DQVKLLKHDNVVSKAAEAEGRTLKGLGITPTMAT  303

Query  268  GYPVEYLIQYRKGGPQYGS  212
                 YL+QYR  G   GS
Sbjct  304  SVLDSYLVQYRPHGQYTGS  322



>ref|WP_008127552.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Phyllobacterium 
sp. YR531]
 gb|EJN00035.1| putative nucleoside-diphosphate sugar epimerase [Phyllobacterium 
sp. YR531]
Length=322

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 107/197 (54%), Gaps = 15/197 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
             +K  AEEAVL+ +PEA I++P+V+ G ED   N +A  A+   FLPLIGGG TK QPVY
Sbjct  133  SSKGRAEEAVLKILPEAYIIRPSVIFGPEDGFFNKFAAMARISPFLPLIGGGHTKFQPVY  192

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA AI  S+ D     G  YELGG E+ T HQ  + M  VI     ++ +PF +A  
Sbjct  193  VGDVAEAIARSV-DGALQPGATYELGGGEVLTFHQCMDEMLKVIGRKRLFLPIPFWVASI  251

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
              +   L        LP P I +  VI+ L  D +VSE A     T E LGI P  ++  
Sbjct  252  QGSILGL--------LPKPMITSDQVIQ-LRNDNIVSEAAKADGRTLEGLGIRPQTIETI  302

Query  262  PVEYLIQYRKGGPQYGS  212
               YL ++R  G QY S
Sbjct  303  LPSYLWRFRVQG-QYSS  318



>ref|WP_034804481.1| 3-beta hydroxysteroid dehydrogenase [Ensifer adhaerens]
 gb|KDP70627.1| 3-beta hydroxysteroid dehydrogenase [Ensifer adhaerens]
Length=326

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 109/196 (56%), Gaps = 15/196 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++K  AE A+L   P+A IL+P+V+ G ED   N +A  A+    LPLIGGG TK QPVY
Sbjct  134  RSKGRAEAAILETKPDAIILRPSVVFGPEDGFFNKFANMARFSPVLPLIGGGETKFQPVY  193

Query  610  VTDVASAIIASLKDDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAK  434
            VTDVA A+  ++  DGT + GK+YELGGP++ +     E+M + I      V +PF +A 
Sbjct  194  VTDVAEAVARAV--DGTIAKGKIYELGGPDVLSFRDCLEIMLNTIDRKRTLVSLPFGVAS  251

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKG  266
             I +   L+      P  TP +   D +  L +D +VS  A+    T   +GI P  L+ 
Sbjct  252  LIGSVSSLI------PFVTPPL-TADQVVLLKSDNVVSTKAVSEGRTLSGIGIDPTMLES  304

Query  265  YPVEYLIQYRKGGPQY  218
                YL++YR  G QY
Sbjct  305  ILPTYLVRYRPQG-QY  319



>ref|WP_037100746.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium alamii]
Length=326

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 103/199 (52%), Gaps = 16/199 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L   P+A I +P+++ G ED   N +A  A+ +  LPL+GGG TK QPVY
Sbjct  134  RTKGRAEAAILSIKPDAIIFRPSIVFGPEDSFFNKFADMARTFPVLPLVGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +A   D     GK+YELGGPE+ T  +  E +  V     R + +PF IA  
Sbjct  194  VEDVAEA-VARAVDGKVEGGKIYELGGPEVLTFRECLETILKVTVRKNRLISLPFSIASL  252

Query  430  IATPRELLLKKVPFPLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLK  269
            I +   L    VPF  P  TP     D ++ L  D +VS+ A     T + LGI P    
Sbjct  253  IGSIASL----VPFIAPPITP-----DQVKLLKHDNVVSKAAEAEGRTLKGLGITPTMAT  303

Query  268  GYPVEYLIQYRKGGPQYGS  212
                 YL+QYR  G   GS
Sbjct  304  SVLDSYLVQYRPHGQYTGS  322



>ref|WP_019199324.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Afipia birgiae]
Length=322

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 105/180 (58%), Gaps = 15/180 (8%)
 Frame = -1

Query  751  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  572
            +P ATI++P+V+ G ED+  N +A  A+    LPLIGGG TK+QPVYV DVA+A +A+  
Sbjct  146  VPSATIIRPSVVFGPEDQFTNRFAGLARISPMLPLIGGGLTKMQPVYVGDVATA-VANAV  204

Query  571  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  392
            D  T  G  YELGGPEI T+ ++ +L+ ++ R     + +PFP+AK     +   L+  P
Sbjct  205  DGKTRPGATYELGGPEIMTMREIIDLILNITRRNRMLMSLPFPLAKI----QSYFLQFAP  260

Query  391  FPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  227
              L  TP     + +E L +D +VS+ A    LT E LGI P  L      YL +YRK G
Sbjct  261  GDLKLTP-----NQVELLRSDNVVSDTAKAAGLTLEGLGITPDSLAAVAPSYLWRYRKTG  315



>ref|WP_037159370.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. YS-1r]
 gb|KGD86540.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. YS-1r]
Length=326

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 104/197 (53%), Gaps = 17/197 (9%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE  +   +P+A IL+P++M G ED   N +A  A+ +  LPL+GGG TK QPVY
Sbjct  134  RTKGRAEAMIFSLLPDAVILRPSIMFGPEDSFFNKFAAMARIFPALPLVGGGNTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA  +  S+ D   + GK+YELGGPE+ T  Q  E M  +     R V +P  IA  
Sbjct  194  VEDVAETVARSV-DGAIAPGKIYELGGPEVMTFRQCLETMLRITNRQNRLVSLPSGIASL  252

Query  430  IATPRELLLKKVPFPLP--TPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLK  269
            I +   L    +PF  P  TP     D ++ L  D +VS+ A+    T E +GI P    
Sbjct  253  IGSIASL----IPFVQPPITP-----DQVKLLKVDNVVSDAAVKEGRTLEAIGIRPTLAT  303

Query  268  GYPVEYLIQYRKGGPQY  218
                 YL+QYR  G QY
Sbjct  304  SILPSYLVQYRPQG-QY  319



>ref|WP_009796496.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Nitrobacter sp. 
Nb-311A]
 gb|EAQ37017.1| NAD-dependent epimerase/dehydratase [Nitrobacter sp. Nb-311A]
Length=322

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 114/193 (59%), Gaps = 15/193 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            +AKA+ E+AVL  +P ATIL+P+VM G ED+  N +A  A     LPLIGGG T++QPVY
Sbjct  133  RAKASGEKAVLAAVPSATILRPSVMFGPEDQFANRFAALALMSPVLPLIGGGATQMQPVY  192

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA+A   ++     + G VYELGGPE+ ++ ++ +++  VI      V +PF    A
Sbjct  193  VGDVATAAADAVDGKAKA-GAVYELGGPEVLSMREIMQIILRVIERERMLVPLPF----A  247

Query  430  IATPRELLLKKVPFPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKG  266
            IA  + + L+  P PL  TP     D +E L TD +VS  A    LT + LGI P  ++ 
Sbjct  248  IARLKAMFLQFAPGPLKLTP-----DQVELLKTDNVVSNAAIAAGLTLQGLGITPDSMEA  302

Query  265  YPVEYLIQYRKGG  227
               +YL ++RK G
Sbjct  303  VVPQYLWRFRKAG  315



>ref|WP_017269127.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase, partial [Sinorhizobium 
meliloti]
Length=206

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 107/196 (55%), Gaps = 15/196 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L  +P A IL+P+++ G ED   N +A+ A+    LPLIGGG T+ QPVY
Sbjct  14   RTKGRAEAAILETLPAAVILRPSIIFGPEDGFFNKFAEMARFSPVLPLIGGGNTRFQPVY  73

Query  610  VTDVASAIIASLKDDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAK  434
            VTDVA A+  S+  DGT + G +YELGGP++ +  +  ++M   I     +V +PF IA 
Sbjct  74   VTDVAEAVARSV--DGTLTGGTIYELGGPQVLSFRECLDIMLKTIDRKRSFVSLPFGIAS  131

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKG  266
             + +   L    VPF  P       D +  L +D +VS  A     T   +GI P  L+ 
Sbjct  132  LMGSVASL----VPFITPP---LTADQVVLLKSDNVVSAKAEAEGRTLAGIGIEPTMLES  184

Query  265  YPVEYLIQYRKGGPQY  218
                YL++YR  G QY
Sbjct  185  ILPTYLVRYRPHG-QY  199



>gb|EAU41592.1| putative oxidoreductase protein [Fulvimarina pelagi HTCC2506]
Length=335

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 107/192 (56%), Gaps = 14/192 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E+AV    P+A IL+P+++ G ED   N +A+ ++    LPL+GGG TK QP+Y
Sbjct  133  RTKAAGEKAVHAARPDAYILRPSIVFGPEDEFFNRFAEMSRFSPVLPLLGGGKTKFQPIY  192

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A+  ++ D+  + G VYELGGPE+ +  QL E M  VI    R+V +PF +A +
Sbjct  193  VVDVAEAVAKTV-DNEVAGGTVYELGGPEVLSFRQLMEEMLRVINRKRRFVSIPFSLAGS  251

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGY  263
            +A       + VP    TP     D ++ L  D +VSE A+    T +  GI P  +   
Sbjct  252  MAQ----FAQYVPGAPLTP-----DQVKQLQNDNVVSEEAIADGRTLDAFGIRPRTVDSI  302

Query  262  PVEYLIQYRKGG  227
               YL+++R  G
Sbjct  303  LPTYLVRFRPQG  314



>ref|WP_003493425.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Agrobacterium 
tumefaciens]
 gb|EGP58646.1| NADH-ubiquinone oxidoreductase [Agrobacterium tumefaciens F2]
Length=326

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 107/193 (55%), Gaps = 14/193 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+   +P A IL+P+++ G ED   N +A+ A+   FLPLIGGGTTK QPVY
Sbjct  134  RTKGRAEAAIHSVLPNAVILRPSIIFGPEDDFFNKFAKMARGLPFLPLIGGGTTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAE-LMYDVIREWPRYVKVPFPIAK  434
            V DVA A+  S+ D     G +YELGG ++ T     E ++    R+ P +V +PF IA 
Sbjct  194  VEDVAEAVARSV-DGKLKPGAIYELGGQDVMTFRDCLEAVLAATYRQRP-FVDLPFGIAS  251

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVS----ENALTFEDLGIVPHKLKG  266
             IA    ++      PL TP +  +D +  L  D +VS    +N LT E +GI P ++  
Sbjct  252  MIAKITSMI------PLITPPL-TVDQVTMLKKDNVVSADAEKNGLTLEGIGITPVRVAS  304

Query  265  YPVEYLIQYRKGG  227
                Y++QYR  G
Sbjct  305  VLPSYMVQYRTHG  317



>ref|WP_016735020.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium phaseoli]
Length=326

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 100/199 (50%), Gaps = 16/199 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L   P+A I +P+++ G ED   N +A  A+    LPL+GGG TK QPVY
Sbjct  134  RTKGRAEAAILSIKPDAVIFRPSIVFGPEDSFFNKFADMARMSPVLPLVGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +A   D     GKVYELGGPE+ +  +  E M  V     R V +PF IA  
Sbjct  194  VEDVAEA-VARAVDGKVPAGKVYELGGPEVLSFRECLETMLKVTSRKNRLVSLPFGIASM  252

Query  430  IATPRELLLKKVPFPLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLK  269
            I +   L    +PF  P  TP     D +  L  D +VS  A     T + LGI P    
Sbjct  253  IGSIASL----IPFVTPPITP-----DQVRLLKRDNVVSAEAESEGRTLKGLGIAPTMAA  303

Query  268  GYPVEYLIQYRKGGPQYGS  212
                 YL+QYR  G   GS
Sbjct  304  SVLESYLVQYRPHGQYTGS  322



>ref|WP_012482360.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium etli]
 gb|ACE89344.1| probable NADH dehydrogenase/NADH dehydrogenase (ubiquinone) protein 
[Rhizobium etli CIAT 652]
Length=326

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 100/199 (50%), Gaps = 16/199 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L   P+A I +P+++ G ED   N +A  A+    LPL+GGG TK QPVY
Sbjct  134  RTKGRAEAAILSIKPDAVIFRPSIVFGPEDSFFNKFADMARMSPVLPLVGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +A   D     GKVYELGGPE+ +  +  E M  V     R V +PF IA  
Sbjct  194  VEDVAEA-VARAVDGKVPAGKVYELGGPEVLSFRECLETMLKVTSRKNRLVSLPFGIASM  252

Query  430  IATPRELLLKKVPFPLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLK  269
            I +   L    +PF  P  TP     D +  L  D +VS  A     T + LGI P    
Sbjct  253  IGSIASL----IPFVTPPITP-----DQVRLLKRDNVVSAEAESEGRTLKGLGIAPTMAA  303

Query  268  GYPVEYLIQYRKGGPQYGS  212
                 YL+QYR  G   GS
Sbjct  304  SVLESYLVQYRPHGQYTGS  322



>ref|WP_025602653.1| 3-beta hydroxysteroid dehydrogenase [Proteobacteria bacterium 
JGI 0001013-N05]
Length=326

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 103/196 (53%), Gaps = 15/196 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++K  AE  +   +P+A IL+P++M G ED   N +A  A+ +  LPL+GGG TK QPVY
Sbjct  134  RSKGRAETTIFSMLPDAVILRPSIMFGQEDSFFNKFASMARMFPVLPLVGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAK  434
            V DVA  +  S+  DGT + GKVYELGG E+ T  Q  E M  V       V +PF IA 
Sbjct  194  VEDVAETVARSV--DGTIASGKVYELGGSEVLTFRQCLETMLSVTNRKNPLVSLPFGIAS  251

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKG  266
             I +   L    VPF  P       D ++ L TD +VS+ A     T   +GI P     
Sbjct  252  LIGSIASL----VPFVQPP---ITSDQVKLLKTDNVVSQAATNEGRTLAGIGIHPTLPAS  304

Query  265  YPVEYLIQYRKGGPQY  218
                YL+QYR  G QY
Sbjct  305  ILPTYLVQYRPQG-QY  319



>ref|WP_007598696.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium sp. 
PDO1-076]
 gb|EHS53162.1| NAD-dependent epimerase/dehydratase [Rhizobium sp. PDO1-076]
Length=326

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 107/195 (55%), Gaps = 12/195 (6%)
 Frame = -1

Query  784  KATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVT  605
            K  AE A+   IP+ATIL+P+++ G ED   N +A  A+   FLPL+GGG TK QPVYV 
Sbjct  136  KGRAEAAIQSIIPDATILRPSIVFGPEDSFFNKFAAMARISPFLPLVGGGKTKFQPVYVE  195

Query  604  DVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIA  425
            DVA A+  S+ D   + GK+YELGG ++ T  Q  + M +VI      V +PF IA  I 
Sbjct  196  DVAEAVALSV-DGKIASGKIYELGGRDVLTFKQCLQTMLEVIGRKRALVPMPFGIASMIG  254

Query  424  TPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPV  257
            +    +      PL TP + + D +  L  D +VS++A     T E +GI P K+     
Sbjct  255  SIASAI------PLITPPLTS-DQVTLLKRDNVVSDSAKAEGRTLEGMGIQPVKVASILP  307

Query  256  EYLIQYRKGGPQYGS  212
             YL+ +R  G   GS
Sbjct  308  TYLVHFRPHGQFTGS  322



>ref|WP_009604313.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [SAR116 cluster 
alpha proteobacterium HIMB100]
 gb|EHI49131.1| putative nucleoside-diphosphate sugar epimerase [SAR116 cluster 
alpha proteobacterium HIMB100]
Length=315

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 105/188 (56%), Gaps = 10/188 (5%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E A+LR+ P+AT+L+P+++ G  D   N + Q A     LPLIGGG+  +QPVY
Sbjct  134  RTKAEGERALLRQFPQATVLQPSIIFGPGDGFFNRFGQMAMIAPALPLIGGGSGLMQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A++A+L  +  + G++Y+LGGP+ ++  +L     D +      + VPF +A  
Sbjct  194  VGDVAGAVLAALTTE-EARGQIYQLGGPQTYSFAELMRFTLDCVGRRRLLLPVPFAVASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
             A    L        LP P +  LD ++ L  D +  ++A    DLGIVP  ++G    Y
Sbjct  253  PAAFASL--------LPNPPL-TLDQLKLLKVDNICKKSAPGLADLGIVPTAIEGVVPAY  303

Query  250  LIQYRKGG  227
            L+ +R GG
Sbjct  304  LMPFRPGG  311



>gb|EGE59004.1| putative NADH dehydrogenase/NADH dehydrogenase (ubiquinone) protein 
[Rhizobium etli CNPAF512]
Length=396

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 101/197 (51%), Gaps = 12/197 (6%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L   P+A I +P+++ G ED   N +A  A+    LPL+GGG TK QPVY
Sbjct  204  RTKGRAEAAILSIKPDAVIFRPSIVFGPEDSFFNKFADMARMSPVLPLVGGGKTKFQPVY  263

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A+  ++ D    +GKVYELGGPE+ +  +  E M  V     R V +PF IA  
Sbjct  264  VEDVAEAVARAV-DGKVPVGKVYELGGPEVLSFRECLETMLKVTSRKNRLVSLPFGIASM  322

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            I +   L+      P  TP I   D +  L  D +VS  A     T + LGI P      
Sbjct  323  IGSIASLI------PFVTPPI-TPDQVRLLKRDNVVSAEAEAEGRTLKGLGIAPTMAASV  375

Query  262  PVEYLIQYRKGGPQYGS  212
               YL+QYR  G   GS
Sbjct  376  LESYLVQYRPHGQYTGS  392



>ref|WP_010970802.1| MULTISPECIES: 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Agrobacterium 
tumefaciens complex]
 ref|NP_353326.2| NADH-ubiquinone oxidoreductase [Agrobacterium fabrum str. C58]
 gb|AAK86111.2| NADH-ubiquinone oxidoreductase [Agrobacterium fabrum str. C58]
 gb|KEY54712.1| 3-beta hydroxysteroid dehydrogenase [Agrobacterium tumefaciens]
 gb|KJX89859.1| NADH-ubiquinone oxidoreductase 39 kd subunit [Agrobacterium tumefaciens]
Length=326

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 102/192 (53%), Gaps = 12/192 (6%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+   +P A IL+P+++ G ED   N +A+ A+N  FLPLIGGG TK QPVY
Sbjct  134  RTKGRAEAAIHSVLPGAVILRPSIIFGPEDDFFNKFAKMARNLPFLPLIGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A+  S+ D     G +YELGGP++ T     E +         +V +PF +A  
Sbjct  194  VEDVAEAVARSV-DGKLKPGAIYELGGPDVMTFRDCLEAVLAATYRERSFVNLPFGVASM  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            I     L+      PL TP +   D +  L  D +VS  A    LT E +GI P ++   
Sbjct  253  IGKLASLV------PLITPPL-TPDQVTMLKKDNVVSAEAEKKGLTLEGIGITPVRVASV  305

Query  262  PVEYLIQYRKGG  227
               Y++QYR+ G
Sbjct  306  LPSYMVQYRQHG  317



>ref|WP_037314823.1| 3-beta hydroxysteroid dehydrogenase [Ruegeria halocynthiae]
Length=327

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 106/191 (55%), Gaps = 5/191 (3%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E  VL  +P A IL+P+V+ GTED+  N +A   +   FLPL G G TK QPV+
Sbjct  130  RTKAQGEAGVLAHMPNAVILRPSVVFGTEDQFFNRFAGMTRMGPFLPLAGAG-TKFQPVF  188

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +   +  G +   +YELGGPE+ +   L + M DVI      + +PF +A+ 
Sbjct  189  VDDVAKAAVQGAQ--GQAEAGIYELGGPEVKSFRALMQQMLDVIYRRRVIIGMPFWVARI  246

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
            +A+  + +LK   F L    I   D ++ L  D +VS+ A  F DLGI P  L+    +Y
Sbjct  247  MASVLD-ILKFASFQLFPNHILTRDQLKNLRRDNVVSDGAKGFADLGIEPAALESILPDY  305

Query  250  LIQYRKGGPQY  218
            L ++R  G QY
Sbjct  306  LWKFRPSG-QY  315



>ref|WP_038686352.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium etli]
 gb|AIC25502.1| NAD-dependent nucleoside-diphosphate-sugar epimerase protein 
[Rhizobium etli bv. mimosae str. IE4771]
 gb|AJC77596.1| NAD-dependent nucleoside-diphosphate-sugar epimerase protein 
[Rhizobium etli bv. phaseoli str. IE4803]
Length=326

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 100/197 (51%), Gaps = 12/197 (6%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L   P+A I +P+++ G ED   N +A  A+    LPLIGGG TK QPVY
Sbjct  134  RTKGRAETAILSIKPDAVIFRPSIVFGPEDSFFNKFADMARMSPVLPLIGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +A   D     GKVYELGGPE+ +  +  E M  V      ++ +PF IA  
Sbjct  194  VEDVAEA-VARAVDGKVPSGKVYELGGPEVLSFRECLETMLKVTSRKNPFISLPFGIASM  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            I +   L+      P  TP I   D +  L  D +VS  A     T + LGI P  +   
Sbjct  253  IGSIASLI------PFVTPPI-TPDQVRLLKRDNVVSAEAEAEGRTLKGLGIAPTMVASV  305

Query  262  PVEYLIQYRKGGPQYGS  212
               YL+QYR  G   GS
Sbjct  306  LESYLVQYRPHGQYTGS  322



>ref|WP_034514069.1| 3-beta hydroxysteroid dehydrogenase [Agrobacterium rhizogenes]
Length=326

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 105/197 (53%), Gaps = 12/197 (6%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA AE A+L   P+  I++P+++ G ED   N +A  ++   FLPLIGGG TK QPVY
Sbjct  134  RTKARAEAAILSIKPDTVIMRPSIVFGPEDGFFNKFADMSRTAPFLPLIGGGETKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V D+A A+  S+ D     G  YELGGPE+ +  +  E    VI      V +PF +A  
Sbjct  194  VEDIAEAVARSV-DGKLKGGTTYELGGPEVLSFRECLETTLSVINRKKSLVSIPFAVASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            I +   L+      PL TP I   D +  L +D +VS+ A     T +D+G++P  L   
Sbjct  253  IGSIASLV------PLITPPI-TPDQVTLLKSDNVVSKQAEAEGRTLKDIGLLPTLLISV  305

Query  262  PVEYLIQYRKGGPQYGS  212
               YL++YR  G   GS
Sbjct  306  LPSYLVRYRPQGQFTGS  322



>ref|WP_035069164.1| 3-beta hydroxysteroid dehydrogenase, partial [Caulobacteraceae 
bacterium PMMR1]
Length=316

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 106/183 (58%), Gaps = 4/183 (2%)
 Frame = -1

Query  775  AEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVA  596
             E AV   +P++ IL+P+V+ G ED+  N +A  A     LPLIGGG T++QPVY  DV 
Sbjct  135  GEAAVRTRLPDSVILRPSVVFGAEDQFFNRFAAMAAVAPALPLIGGGKTRMQPVYAGDVG  194

Query  595  SAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPR  416
             AI+ SL +  ++ G+++ELGGP I+T  +L +L+ +  +     V +PF +A+ I    
Sbjct  195  EAIVRSL-EQASAGGRIFELGGPAIYTFKELMQLVLNETQRRRALVPLPFEVARLIGVAG  253

Query  415  ELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYR  236
            ++L   +P  +P P     D +E L  D +V+  ALT  DLG+ P  ++     YL ++R
Sbjct  254  DVLSAVLPV-IPPP--LTTDQVELLKRDNVVAPGALTLADLGVTPTAVEAVVPTYLWRFR  310

Query  235  KGG  227
             GG
Sbjct  311  PGG  313



>ref|WP_043140566.1| 3-beta hydroxysteroid dehydrogenase [Ponticoccus sp. UMTAT08]
 gb|KHQ53530.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Ponticoccus sp. 
UMTAT08]
Length=327

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 105/191 (55%), Gaps = 6/191 (3%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            K+K   EEAVL  +P+A IL+P+V+ G ED   N +A   +    LP++ GG TK QPVY
Sbjct  130  KSKGKGEEAVLEHMPQAVILRPSVIFGPEDAFFNRFASMTRMGPVLPIV-GGATKFQPVY  188

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +  +   G +   +YELGGP++ T  +L ++M DVIR       +PF  A  
Sbjct  189  VDDVAQAAVKGVL--GQAEPGIYELGGPDVMTFRELMQVMLDVIRRRRLVANIPFFAASV  246

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
            I    + L++ +   L  P+    D + +L  D + +E A  F DLGI P  ++    +Y
Sbjct  247  IGAVSD-LVQSLSLGL-IPAQITADQVRSLRQDNVTAEGARGFSDLGISPMSVQAVLPDY  304

Query  250  LIQYRKGGPQY  218
            L ++R  G QY
Sbjct  305  LWRFRPSG-QY  314



>ref|WP_007007136.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Nitratireductor 
aquibiodomus]
 gb|EIM77328.1| NAD-dependent epimerase/dehydratase [Nitratireductor aquibiodomus 
RA22]
Length=324

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 106/192 (55%), Gaps = 14/192 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E+AVL  + +A I++P+++ G ED   N +A  A+   FLPLIGGG TK QPVY
Sbjct  135  RTKALGEQAVLETVKDAVIIRPSIVFGPEDDFFNRFANMARFSPFLPLIGGGETKFQPVY  194

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A   S+  D    G++YELGGPE+ +  +  E M +       +V +P+ +A+ 
Sbjct  195  VGDVAEAYARSVDGD-LEGGQIYELGGPEVLSFRECLEEMLEATYRKRWFVSLPWFVARI  253

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
             A     +L+ +P P+ T     LD ++ L TD +VSE A     T + LGI  H L   
Sbjct  254  QAR----ILQLLPKPMLT-----LDQVKLLKTDNVVSEEANAAGRTLDGLGIQKHSLAAI  304

Query  262  PVEYLIQYRKGG  227
               YL +YR  G
Sbjct  305  LPTYLWRYRPAG  316



>ref|WP_015241008.1| putative nucleoside-diphosphate-sugar epimerase [Sinorhizobium 
meliloti]
 gb|AGA05314.1| putative nucleoside-diphosphate-sugar epimerase [Sinorhizobium 
meliloti GR4]
Length=326

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 107/196 (55%), Gaps = 15/196 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L  +P A IL+P+++ G ED   N +A+ A+    LPLIGGG TK QPVY
Sbjct  134  RTKGRAEAAILETLPAAVILRPSIIFGPEDGFFNKFAEMARFSPVLPLIGGGNTKFQPVY  193

Query  610  VTDVASAIIASLKDDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAK  434
            VTDVA A+  S+  DGT + G +YELGGP++ +  +  ++M   I     +V +PF IA 
Sbjct  194  VTDVAEAVARSV--DGTLTGGTIYELGGPQVLSFRECLDIMLKTIDRKRSFVSLPFGIAS  251

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKG  266
             + +   L    VPF  P       D +  L +D +VS  A     T   +GI P  L+ 
Sbjct  252  LMGSVASL----VPFITPP---LTADQVVLLKSDNVVSAKAEAEGRTLAGIGIEPTMLES  304

Query  265  YPVEYLIQYRKGGPQY  218
                YL++YR  G QY
Sbjct  305  ILPTYLVRYRPHG-QY  319



>ref|WP_007763297.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium sp. 
CF080]
 gb|EUC00531.1| hypothetical protein PMI07_003817 [Rhizobium sp. CF080]
Length=326

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 104/198 (53%), Gaps = 14/198 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++K  AE  +L  +P+A IL+P+++ G ED   N +A  A+ +  LPLIGGG TK QPVY
Sbjct  134  QSKGRAEATILSTLPDAIILRPSIVFGPEDSFFNKFASMARTFPALPLIGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAK  434
            V DVA  +  S+  DGT + GK+YELGG E+ T  Q  E +  V       V +PF IA 
Sbjct  194  VEDVAETVARSV--DGTIASGKIYELGGGEVMTFRQCLETVLRVTNRSNALVSLPFGIAS  251

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKG  266
             I +   L    +PF  P       D ++ L  D +VS+ A     T + +GI P     
Sbjct  252  LIGSIASL----IPFVQPP---ITSDQVKLLKVDNVVSDAAAAEGRTLQGIGIRPTLASS  304

Query  265  YPVEYLIQYRKGGPQYGS  212
                YL+QYR  G   GS
Sbjct  305  ILPSYLVQYRPQGQYTGS  322



>ref|WP_036515289.1| 3-beta hydroxysteroid dehydrogenase [Oceanicaulis sp. HL-87]
Length=315

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 103/188 (55%), Gaps = 5/188 (3%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E+AV+  IP AT+L+P+++ G ED   N +AQ A     LPLIGGG T  QPV+
Sbjct  127  QTKAAGEKAVMDTIPTATVLRPSIVFGAEDSFFNRFAQMALYTPALPLIGGGKTLFQPVW  186

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
              DV +AI+A+L+    + GK YELGGP  ++  QL + +   I+     V VP+  A  
Sbjct  187  AGDVGAAILAALESP-AAQGKTYELGGPATYSFKQLLQYITATIQRPRLLVPVPWLAAYG  245

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
            I    E +   +PF    P++   D +  L TD +VS       DLGI P  ++     Y
Sbjct  246  IGFAGE-IAGALPF---VPTVLTRDQVTLLKTDNVVSGTLPGLSDLGIRPDSVEAIVPSY  301

Query  250  LIQYRKGG  227
            L ++RKGG
Sbjct  302  LYRFRKGG  309



>gb|AIL13087.1| hypothetical protein IM40_05525 [Candidatus Caedibacter acanthamoebae]
Length=308

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 106/183 (58%), Gaps = 10/183 (5%)
 Frame = -1

Query  784  KATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVT  605
            K   EEAVL+  P+ATI +P+++ G  D   N +++ ++    LPL+G G T++QP Y+ 
Sbjct  133  KIQGEEAVLKAYPQATIFRPSLVFGPHDHFFNRFSEISRFSPVLPLVGEGKTRLQPAYIG  192

Query  604  DVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIA  425
            DV  A+I +  +   S GK+YELGG +I+   +L E+M  +I+     + +P+ IAK+I 
Sbjct  193  DVVEAMITA-ANQPESQGKIYELGGDKIYAFKELFEIMLKIIQLKRLLLPLPYFIAKSIG  251

Query  424  TPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLI  245
               E         LPTP  F  D ++ L  D +++ ++LTF DLGI+P  L+     YL 
Sbjct  252  FFCEF--------LPTPP-FTRDQVKLLKKDNILNNSSLTFRDLGIIPSALESILPRYLS  302

Query  244  QYR  236
            +Y+
Sbjct  303  RYK  305



>ref|WP_017966662.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium leguminosarum]
Length=326

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 101/198 (51%), Gaps = 13/198 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L   P+A I +P+++ G ED   N +A+ A+    LPL+GGG TK QPVY
Sbjct  134  RTKGRAETAILSVKPDAVIFRPSIVFGPEDSFFNKFAEMARMSPILPLVGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +A   D   + GKVYELGGPE+ +  +  E M  V     R + +PF IA  
Sbjct  194  VEDVAEA-VARAVDGKVAGGKVYELGGPEVLSFRECLETMLKVTCRKNRLISLPFGIASM  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            I +   L+      P  TP I   D +  L  D +VS  A     T + LGI P      
Sbjct  253  IGSIASLI------PFITPPI-TPDQVRLLKRDNVVSREAEAEGRTLKGLGITPTMAASV  305

Query  262  PVEYLIQYRKGGPQYGST  209
               YL+ YR  G QY  T
Sbjct  306  LGSYLVHYRPHG-QYTGT  322



>ref|WP_045018279.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium nepotum]
 gb|KJF68958.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium nepotum 39/7]
Length=326

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 107/193 (55%), Gaps = 14/193 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+   +P A IL+P+++ G ED   N +A+ A++  FLPLIGGG TK QPVY
Sbjct  134  RTKGRAEAAIHSTLPGAVILRPSIIFGPEDDFFNKFAKMARSLPFLPLIGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAE-LMYDVIREWPRYVKVPFPIAK  434
            V DVA A+  S+ D     G +YELGG ++ T     E ++    R+ P +V +PF +A 
Sbjct  194  VEDVAEAVARSV-DGKLKPGTIYELGGQDVMTFRDCLEAVLAATYRQRP-FVNLPFGVAS  251

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVS----ENALTFEDLGIVPHKLKG  266
             I     L+      PL TP +  +D +  L  D +VS    +N LT E +GI P ++  
Sbjct  252  MIGKIASLV------PLITPPL-TVDQVTMLKKDNIVSADAEKNGLTLEGIGITPVRVAS  304

Query  265  YPVEYLIQYRKGG  227
                Y++QYR+ G
Sbjct  305  VLPSYMVQYRQHG  317



>ref|WP_022713397.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium mongolense]
Length=326

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 102/197 (52%), Gaps = 12/197 (6%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L    +A I +P+++ G ED   N +A+ A+    LPLIGGG TK+QPVY
Sbjct  134  RTKGRAEAAILSTKKDAIIFRPSIVFGPEDGFFNKFAEMARLSPVLPLIGGGKTKLQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A+  +++    S G +YELGGPE+ T  +  ++M  +     R V +PF IA  
Sbjct  194  VEDVAEAVARAVEGKAAS-GTIYELGGPEVLTFRECLQVMLKITARKNRLVSIPFTIASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            I +   L    +PF  P       D +  L  D +VS  A    LT + LG+ P  L   
Sbjct  253  IGSVASL----IPFVKPP---ITADQVRLLKRDNVVSTKAETDGLTLKALGVTPTMLTSV  305

Query  262  PVEYLIQYRKGGPQYGS  212
               YL+ YR  G   GS
Sbjct  306  LPSYLVHYRPHGQYTGS  322



>ref|WP_020011099.1| MULTISPECIES: 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Agrobacterium]
Length=326

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 106/193 (55%), Gaps = 14/193 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+   +P A IL+P+++ G ED   N +A+ A+N  FLPLIGGG TK QPVY
Sbjct  134  RTKGRAEAAIHSILPGAVILRPSIIFGPEDDFFNKFAKMARNLPFLPLIGGGQTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAE-LMYDVIREWPRYVKVPFPIAK  434
            V DVA A+  S+ D     G +YELGG +I T     E ++    R+ P +V +PF IA 
Sbjct  194  VEDVAEAVARSV-DGKLKPGAIYELGGQDIMTFRDCLEAVLAATYRQRP-FVDLPFGIAS  251

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVS----ENALTFEDLGIVPHKLKG  266
             +A    L+      PL  P +  +D +  L  D +VS    +N LT E +GI P ++  
Sbjct  252  TVAKLTSLV------PLIKPPL-TVDQVTMLKKDNVVSADAEKNGLTLEGIGITPVRVAS  304

Query  265  YPVEYLIQYRKGG  227
                Y++QYR  G
Sbjct  305  ILPSYMVQYRTHG  317



>ref|WP_029011978.1| 3-beta hydroxysteroid dehydrogenase [Niveispirillum irakense]
Length=321

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 106/187 (57%), Gaps = 9/187 (5%)
 Frame = -1

Query  787  AKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYV  608
            +KA  E+AVL   P ATI +P+++ G ED   N +A  ++   FLPLIGGG T++QPVYV
Sbjct  134  SKAQGEQAVLSAFPSATIFRPSIVFGPEDGFFNRFAAMSQTAPFLPLIGGGNTRMQPVYV  193

Query  607  TDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAI  428
             DVA AI+A+++ +GT  GK+YEL GP  +T  +L +L    + +  R  K    +   +
Sbjct  194  GDVADAIVAAVETEGTE-GKIYELAGPRTYTFKELIDL---TLAQVGRPKKCTLSLGFGM  249

Query  427  ATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYL  248
            A+    +L+ +P  + T      D +E L TD +VS       DLG+ P  ++     YL
Sbjct  250  ASLLGGILQNLPGQMLTA-----DQVELLKTDNVVSGAKPGLTDLGVQPTAVEVILPTYL  304

Query  247  IQYRKGG  227
             +YR GG
Sbjct  305  DKYRIGG  311



>ref|WP_043773282.1| 3-beta hydroxysteroid dehydrogenase [Roseivivax isoporae]
 gb|ETX27695.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Roseivivax isoporae 
LMG 25204]
Length=327

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 107/191 (56%), Gaps = 6/191 (3%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  EEAVLR +P A IL+P+++ G ED   N +A   K    LP++G G T+ QPVY
Sbjct  130  RTKAAGEEAVLRHMPGAVILRPSIVFGPEDAFFNRFAAMTKLGPVLPVVGAG-TRFQPVY  188

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +A +   GT+   +YELGGP++ T  +L + M  ++R     + VPFP+A  
Sbjct  189  VDDVARAAVAGIL--GTAAPGIYELGGPDVNTFRELMQQMLRIVRRRKLILNVPFPVASL  246

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
            +      LL+K+ F L  P +   D +  L  D +VS     F DLGI P  L+    +Y
Sbjct  247  MGGAFG-LLQKMSFGLILPPL-TRDQVANLKRDNVVSGTHPGFADLGIEPVSLEAVLPDY  304

Query  250  LIQYRKGGPQY  218
            L ++R  G QY
Sbjct  305  LWRFRPSG-QY  314



>gb|EWM25568.1| nadh dehydrogenase, partial [Nannochloropsis gaditana]
Length=273

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 105/196 (54%), Gaps = 11/196 (6%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R    K   EEA+    P ATI++P  + G EDR+LN +AQ A ++G +PL  GG   +Q
Sbjct  80   RWLATKGQGEEALKSVFPRATIVRPGRLFGPEDRLLNWFAQNAASFGVIPLFNGGNALLQ  139

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            P Y +DV  A++  ++D     GK +EL G   FT  +L +  +D+  + PR V +P  +
Sbjct  140  PTYASDVVDAMVKIIEDPEDYEGKTFELAGEHNFTWRELMDFTFDITYQKPRVVDLPLAV  199

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLV--SENALTFEDLGIVPHKLKG  266
             +  A      L ++P PL T     +D  + ++TD ++  S +A+TF+DL I P  L+ 
Sbjct  200  GEMAA----FGLSQLPNPLLT-----IDDAKLMSTDVILEPSSSAMTFQDLHIKPTPLEK  250

Query  265  YPVEYLIQYRKGGPQY  218
                YL +YR  G  +
Sbjct  251  VAFNYLYRYRTDGGHF  266



>ref|WP_028750945.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium leucaenae]
Length=326

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 104/199 (52%), Gaps = 16/199 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA AE A+L   P+A IL+P+++ G ED   N +A  ++   FLPL+GGG TK QPVY
Sbjct  134  RTKARAEAAILSIKPDAVILRPSIVFGPEDGFFNKFADMSRTAPFLPLVGGGQTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A+   + D     G +YELGGPE+ T  +  E    VI      V +PF +A  
Sbjct  194  VEDVAEAVARGV-DGKLKAGTIYELGGPEVLTFRECLETTLSVINRKKSLVSLPFGLASF  252

Query  430  IATPRELLLKKVPFPLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLK  269
            I      +   VPF  P  TP     D +  L  D +VS+ A     T +D+G++P  L 
Sbjct  253  IGG----IASAVPFITPPITP-----DQVRLLKHDNVVSKEAEAEGRTLKDIGLMPTLLI  303

Query  268  GYPVEYLIQYRKGGPQYGS  212
                 YL++YR  G   GS
Sbjct  304  SVLPSYLVRYRPQGQFTGS  322



>ref|WP_043615439.1| 3-beta hydroxysteroid dehydrogenase [Ensifer sp. ZNC0028]
Length=326

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/195 (39%), Positives = 106/195 (54%), Gaps = 13/195 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++K  AE A+L   P+A IL+P+V+ G ED   N +A  A+    LPLIGGG TK QPVY
Sbjct  134  RSKGRAEAAILETKPDAIILRPSVVFGPEDGFFNKFANMARFSPALPLIGGGETKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            VTDVA A +A   D   + GK+YELGGP++ +     E+M + I      V +PF +A  
Sbjct  194  VTDVAEA-VARAVDGKIAKGKIYELGGPDVLSFRDCLEIMLNTIDRKRALVSLPFGVASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGY  263
            I +   L+      P  TP +   D +  L +D +VS  A+    T   +GI P  L+  
Sbjct  253  IGSVSSLI------PFVTPPL-TADQVVLLKSDNVVSAKAVSEGRTLSGIGIDPTMLEPI  305

Query  262  PVEYLIQYRKGGPQY  218
               YL++YR  G QY
Sbjct  306  LPTYLVRYRPQG-QY  319



>ref|WP_037104352.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. OK665]
Length=326

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 107/200 (54%), Gaps = 13/200 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++K  AE A+L  +P A IL+P+++ G ED   N +A+ ++    LPL+GGG T  QPVY
Sbjct  134  RSKGRAERAILETVPNAVILRPSIVFGPEDGFFNKFAEMSRFSPVLPLVGGGETAFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            VTDVA A+  S++    + GK+YE+GGP++ T     E++   I      + VPF IA  
Sbjct  194  VTDVAEAVAKSVEGK-VAKGKIYEIGGPDVLTFKNCLEILMKTIDRKRTLLPVPFGIASM  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            I +   L    VPF  P       D +  L +D +VS NA     T +  GI P  ++  
Sbjct  253  IGSVASL----VPFITPP---LTSDQVTLLKSDNVVSANAQTEGRTLQAFGIAPTSVEAV  305

Query  262  PVEYLIQYRKGGPQYGSTVS  203
               Y+++YR  G QY  + S
Sbjct  306  LPSYVVRYRPQG-QYSRSGS  324



>ref|WP_039846586.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium gallicum]
 gb|AJD39699.1| NAD-dependent nucleoside-diphosphate-sugar epimerase protein 
[Rhizobium gallicum bv. gallicum R602]
Length=326

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 102/197 (52%), Gaps = 12/197 (6%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L    +A I +P+++ G ED   N +A+ A+    LPLIGGG TK+QPVY
Sbjct  134  RTKGRAEAAILSTKKDAIIFRPSIVFGPEDGFFNKFAEMARLSPVLPLIGGGKTKLQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A+  +++      G +YELGGPE+ T  +  ++M  +     R V +PF IA  
Sbjct  194  VEDVAEAVARAVEGKAAG-GTIYELGGPEVLTFRECLQVMLKITARKNRLVSIPFSIASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            I +   L    VPF  P       D +  L  D +VS  A    LT + LG+ P  L   
Sbjct  253  IGSVASL----VPFVKPP---ITADQVRLLKRDNVVSTKAETDGLTLKALGVTPTMLTSV  305

Query  262  PVEYLIQYRKGGPQYGS  212
               YL++YR  G   GS
Sbjct  306  LPSYLVRYRPHGQYTGS  322



>ref|WP_007799503.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium sp. 
CF122]
 gb|EJL51308.1| putative nucleoside-diphosphate sugar epimerase [Rhizobium sp. 
CF122]
Length=326

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 104/197 (53%), Gaps = 12/197 (6%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+    P+A I +P+V+ G ED   N +A  A+   FLPLIGGG TK QPVY
Sbjct  134  RTKGRAEAAIHAIKPDAIIFRPSVVFGPEDGFFNKFADMARISPFLPLIGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A+  ++++  T+ G+VYELGGPE+ T  +  E+M        R V +PF IA  
Sbjct  194  VVDVAEAVAKAVENKVTA-GEVYELGGPEVLTFRECLEIMLKATWRKNRLVSLPFGIASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            I     L+      P  TP I   D +  L  + +VS+ A     T + +GI P  +   
Sbjct  253  IGRVASLV------PFITPPI-TADQVRLLKKNNIVSKEAEAEGRTLKGIGITPTLVSSV  305

Query  262  PVEYLIQYRKGGPQYGS  212
               YL+QYR  G   GS
Sbjct  306  IGSYLVQYRPHGQYTGS  322



>ref|WP_013845015.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Sinorhizobium 
meliloti]
 gb|AEG06329.1| NAD-dependent epimerase/dehydratase [Sinorhizobium meliloti BL225C]
 gb|AEG55363.1| NAD-dependent epimerase/dehydratase [Sinorhizobium meliloti AK83]
 gb|AEH81033.1| probabable NADH-ubiquinone oxidoreductase [Sinorhizobium meliloti 
SM11]
 emb|CCM69506.1| NAD-dependent epimerase/dehydratase [Sinorhizobium meliloti Rm41]
 emb|CDH87752.1| putative NADH-ubiquinone oxidoreductase [Sinorhizobium meliloti 
RU11/001]
 gb|AIL98183.1| 3-beta hydroxysteroid dehydrogenase [Sinorhizobium meliloti]
 gb|KKA15325.1| 3-beta hydroxysteroid dehydrogenase [Sinorhizobium meliloti]
Length=326

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 107/196 (55%), Gaps = 15/196 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L  +P A IL+P+++ G ED   N +A+ A+    LPLIGGG T+ QPVY
Sbjct  134  RTKGRAEAAILETLPAAVILRPSIIFGPEDGFFNKFAEMARFSPVLPLIGGGNTRFQPVY  193

Query  610  VTDVASAIIASLKDDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAK  434
            VTDVA A+  S+  DGT + G +YELGGP++ +  +  ++M   I     +V +PF IA 
Sbjct  194  VTDVAEAVARSV--DGTLTGGTIYELGGPQVLSFRECLDIMLKTIDRKRSFVSLPFGIAS  251

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKG  266
             + +   L    VPF  P       D +  L +D +VS  A     T   +GI P  L+ 
Sbjct  252  LMGSVASL----VPFITPP---LTADQVVLLKSDNVVSAKAEAEGRTLAGIGIEPTMLES  304

Query  265  YPVEYLIQYRKGGPQY  218
                YL++YR  G QY
Sbjct  305  ILPTYLVRYRPHG-QY  319



>ref|WP_038328123.1| hypothetical protein [alpha proteobacterium SCGC AAA240-E13]
Length=311

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 108/195 (55%), Gaps = 11/195 (6%)
 Frame = -1

Query  799  RMRKAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQ  620
            R  + K   E+ +L     + IL+P+++ G ED+  N +A  A  +  LPLIGGG TK Q
Sbjct  128  RYMQTKLKGEKNILNNFNRSVILRPSLIFGPEDKFFNQFASLAAFFPALPLIGGGKTKFQ  187

Query  619  PVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPI  440
            P+YV+D+   I+A ++ +  +   +YELGGP+IFT  +L E++   +++   ++ +PF  
Sbjct  188  PIYVSDLCKVIVAIIEKEEINEN-IYELGGPQIFTFKELMEILLVHVKKKRLFISIPFSF  246

Query  439  AKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYP  260
            AK  A     +L+  P PL T      D +E L  D +V+ N  T +D  I P  +    
Sbjct  247  AKFQAK----ILQLFPKPLLTT-----DQVEILKYDNVVTNNYPTIKDFKINPKTIDSIL  297

Query  259  VEYLIQYRKGGPQYG  215
              Y+ ++RKGG Q+G
Sbjct  298  PNYIWRFRKGG-QFG  311



>ref|WP_015338537.1| NADH dehydrogenase [Rhizobium tropici]
 gb|AGB69806.1| NADH dehydrogenase [Rhizobium tropici CIAT 899]
Length=326

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 104/197 (53%), Gaps = 12/197 (6%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA AE A+L   P+A IL+P+++ G ED   N +A  ++   FLPLIGGG TK QPVY
Sbjct  134  RTKARAEAAILSIKPDAIILRPSIVFGPEDEFFNKFADMSRTAPFLPLIGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V D+A  +  S+ D     G  YELGGPE+ +  +  E    VI     +V +PF +A  
Sbjct  194  VQDIAETVARSV-DGKLKAGTTYELGGPEVLSFRECLETTLAVINRKKSFVSIPFGLASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            I +   L+      PL  P I   D +  L +D +VS+ A     T + +G++P  L   
Sbjct  253  IGSVASLV------PLIKPPI-TADQVTLLKSDNVVSKQAEAEGRTLKGIGLLPTLLVSV  305

Query  262  PVEYLIQYRKGGPQYGS  212
               YL++YR  G   GS
Sbjct  306  LPSYLVRYRPQGQFTGS  322



>ref|WP_026613537.1| 3-beta hydroxysteroid dehydrogenase [Ensifer sp. TW10]
Length=326

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 102/198 (52%), Gaps = 13/198 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L  +PEA IL+P+++ G ED   N +A  A+    LPL+GGG TK QPVY
Sbjct  134  RTKGRAEIAILETVPEAVILRPSIIFGPEDDFFNKFAGMARLSPVLPLVGGGHTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +A   D     G +YELGGP++ T  +  E+M   I    R+V +PF IA  
Sbjct  194  VADVAEA-VARAVDGKLKGGTIYELGGPQVLTFRECLEIMLKTIDRKRRFVSIPFGIASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            + +   L    VPF  P       D +  L TD +VS  A     T   +GI    L   
Sbjct  253  MGSVASL----VPFITPP---LTADQVVLLKTDNVVSAEAEAEGRTLAGIGIKSTMLDSI  305

Query  262  PVEYLIQYRKGGPQYGST  209
               YL++YR  G QY  T
Sbjct  306  LPTYLVRYRPQG-QYTGT  322



>ref|WP_038378462.1| 3-beta hydroxysteroid dehydrogenase, partial [Bradyrhizobium 
elkanii]
Length=279

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 107/193 (55%), Gaps = 15/193 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            +AKA  E AVL  +P+ATI++P+++ G ED+  N +A  A+    LPL+GGG   +QP Y
Sbjct  90   RAKAEGEAAVLAALPQATIMRPSLLFGPEDQFTNRFAALARMSPVLPLVGGGVNTVQPAY  149

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA+A +A   D     G  YELGGPE+ T+ ++ +++  +I+       +PF +AK 
Sbjct  150  VGDVANA-VADAVDGKAKQGATYELGGPEVLTMREVMQIILKIIQRDRMLAPLPFGLAKF  208

Query  430  IATPRELLLKKVPFPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKG  266
                +   L+  P P   TP     D +  L +D +VS+ A    LTF  LGI P  ++ 
Sbjct  209  ----QSYFLQFAPGPFTLTP-----DQVAMLRSDNVVSDAAKAAGLTFAGLGISPDSMEA  259

Query  265  YPVEYLIQYRKGG  227
               +YL ++R  G
Sbjct  260  IAPQYLWRFRAAG  272



>ref|WP_009502685.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Citreicella sp. 
357]
 gb|EIE52822.1| NADH-ubiquinone oxidoreductase, putative [Citreicella sp. 357]
Length=327

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 104/193 (54%), Gaps = 10/193 (5%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA  E+AVL  +P+A IL+P+V+ G ED   N +A  ++    LPL+ G  TK QPVY
Sbjct  130  RSKAQGEQAVLNHMPDAVILRPSVIFGPEDSFFNRFAGMSRMGPVLPLV-GADTKFQPVY  188

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +  L   G +   +YELGGP++ T     E M  VIR     V +PF IA  
Sbjct  189  VDDVAHAAV--LGATGKAAAGIYELGGPDVGTFRAFIEQMLTVIRRRRWIVNIPFGIAWV  246

Query  430  IATPRELL--LKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPV  257
            +    E L  L    FP P  S    D + +L +D +VS+ A  F DLGI P   +    
Sbjct  247  MGKGFETLAGLTGGLFPAPITS----DQVASLKSDNVVSQGARGFADLGITPTSSEAVLP  302

Query  256  EYLIQYRKGGPQY  218
            +YL ++R  G QY
Sbjct  303  DYLWRFRPSG-QY  314



>ref|WP_034489081.1| 3-beta hydroxysteroid dehydrogenase [Agrobacterium rhizogenes]
Length=326

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 105/197 (53%), Gaps = 12/197 (6%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA AE A+L   P+A IL+P+++ G ED   N +A  ++   FLPLIGGG TK QPVY
Sbjct  134  RTKARAEAAILSIKPDAVILRPSIVFGPEDGFFNKFADMSRTAPFLPLIGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V D+A A+   + D     G  YELGGPE+ +  +  E    VI      V +PF +A  
Sbjct  194  VEDIAEAVARGV-DGKLKAGTTYELGGPEVLSFRECLETTLSVINRKKPLVSIPFGLASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            I +   L+      PL TP I + D +  L +D +VS+ A     T + +G++P  L   
Sbjct  253  IGSVASLV------PLITPPITS-DQVTLLKSDNIVSKQAEAEGRTLKGIGLLPTLLVSV  305

Query  262  PVEYLIQYRKGGPQYGS  212
               YL++YR  G   GS
Sbjct  306  LPSYLVRYRPQGQFTGS  322



>ref|WP_018323842.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium giardinii]
Length=326

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 108/199 (54%), Gaps = 16/199 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            K+K  AE+A+L  +PEA IL+P+++ G ED   N +A+ A+    LPL+GGG T  QPVY
Sbjct  134  KSKGRAEKAILETVPEAVILRPSIIFGPEDGFFNKFAEMARFSPVLPLVGGGKTAFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A+  +++    + G++YELGGPE+ T     E+M   I      + +PF +A  
Sbjct  194  VADVAEAVARAVEGK-VAKGRIYELGGPEVLTFKNCLEIMLKTIGRTRTLLPLPFGLASL  252

Query  430  IATPRELLLKKVPFPLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLK  269
            + +   L    VPF  P  TP     D +  L  D +VSE+A     T +  GI P  ++
Sbjct  253  MGSVASL----VPFVAPPITP-----DQVILLKRDNVVSESAQAEGRTLQTFGIEPTSVE  303

Query  268  GYPVEYLIQYRKGGPQYGS  212
                 Y+++YR  G   GS
Sbjct  304  AILPSYMVRYRPQGQYTGS  322



>ref|WP_028096083.1| 3-beta hydroxysteroid dehydrogenase [Dongia sp. URHE0060]
Length=316

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 104/188 (55%), Gaps = 7/188 (4%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA  E A+ +  P ATI +P+++ G ED   N +A+ A     LPLIGGGTT+ QPVY
Sbjct  131  RSKAAGEAAIGKAFPAATIFRPSIVFGPEDGFFNRFAKMALLAPALPLIGGGTTRFQPVY  190

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA AI  ++++     GK+YELGGP I++  +L  +M   I        +PF    A
Sbjct  191  VLDVAEAISRAIENPAAYGGKIYELGGPRIYSFRELMTVMLAEIGRKRWLCSMPF----A  246

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
            +A+ +  +L+ +PF  P      +D ++ L  D +V   A  F+ LGI P  L+     Y
Sbjct  247  LASLQGAVLQAIPFIQPP---LTVDQVKLLKRDNVVGPQAAGFKSLGITPTALEPILPTY  303

Query  250  LIQYRKGG  227
            L +YR  G
Sbjct  304  LDRYRPHG  311



>ref|WP_018093937.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Sinorhizobium 
meliloti]
Length=326

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 105/195 (54%), Gaps = 13/195 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L  +P A IL+P+++ G ED   N +A+ A+    LPLIGGG T+ QPVY
Sbjct  134  RTKGRAEAAILETLPAAVILRPSIIFGPEDGFFNKFAEMARFSPVLPLIGGGNTRFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            VTDVA A+  S+ D   + G +YELGGP++ +  +  ++M   I     +V +PF IA  
Sbjct  194  VTDVAEAVARSV-DGKLTGGTIYELGGPQVLSFRECLDIMLKTIDRKRSFVSLPFGIASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            + +   L    VPF  P       D +  L +D +VS  A     T   +GI P  L+  
Sbjct  253  MGSVASL----VPFITPP---LTADQVVLLKSDNVVSAKAEAEGRTLAGIGIEPTMLESI  305

Query  262  PVEYLIQYRKGGPQY  218
               YL++YR  G QY
Sbjct  306  LPTYLVRYRPHG-QY  319



>ref|WP_022702351.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Pseudorhodobacter 
ferrugineus]
Length=328

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 106/193 (55%), Gaps = 5/193 (3%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E AVL   P A IL+P+V+ GTED   N +A  ++    LP++ G +T+ QPV+
Sbjct  130  RTKAKGEAAVLAAFPSAVILRPSVVFGTEDGFFNRFAGMSRMGPILPVV-GASTRFQPVF  188

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +  +   GT+   VYELGGP++ T   L + M  VI+     V +PF  A  
Sbjct  189  VDDVAKAAV--MGATGTAAPGVYELGGPDVATFRDLMKQMLAVIQRSRLVVNIPFIFANV  246

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
            +A   +  L      L +  +   D +++L +D +VS+ A TF DLGI P  ++    EY
Sbjct  247  MAAGFD-FLSFATGGLISNGVLTRDQVKSLRSDNVVSDGAKTFADLGITPVTMESVLPEY  305

Query  250  LIQYRKGGPQYGS  212
            L +YR  G QY +
Sbjct  306  LWRYRASG-QYAA  317



>gb|AIF81505.1| NADH dehydrogenase (ubiquinone) [endosymbiont of Acanthamoeba 
sp. UWC8]
Length=306

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 102/179 (57%), Gaps = 10/179 (6%)
 Frame = -1

Query  784  KATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVT  605
            K   E+AVL+  P + I++P+V+ G ED  +N +A+    +  +PLIGGG T+ QPVYV+
Sbjct  137  KLEGEKAVLQTFPNSVIIRPSVVFGREDNFINMFAKLVAVFPVIPLIGGGRTRFQPVYVS  196

Query  604  DVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIA  425
            DVA A+   L  D    GKV+ELGG +++T+ ++ EL++ +I +    V +PF  AK +A
Sbjct  197  DVAKAVGRCLVKDNIC-GKVFELGGSKVYTLREIYELIFKLIGKKKPLVSIPFIFAKVMA  255

Query  424  TPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYL  248
            T            L    +   D +E L TD ++ +N   FE+LG+ P  ++    EY+
Sbjct  256  TVL---------TLLPRPLLTCDQVELLKTDNIIVKNKNGFEELGLTPTSMEAVLSEYI  305



>ref|WP_012067733.1| MULTISPECIES: 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Sinorhizobium]
 ref|YP_001329189.1| NADH dehydrogenase (ubiquinone) [Sinorhizobium medicae WSM419]
 gb|ABR62354.1| NADH dehydrogenase (ubiquinone) [Sinorhizobium medicae WSM419]
Length=326

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 107/198 (54%), Gaps = 13/198 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L  +P A IL+P+++ G ED   N +A+ A+    LPLIGGG T+ QPVY
Sbjct  134  RTKGRAEAAILEILPTAVILRPSIIFGPEDGFFNKFAEMARFSPVLPLIGGGNTRFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            VTDVA A+  S+ D   + G +YELGGP++ +  +  ++M   I     +V +PF IA  
Sbjct  194  VTDVAEAVARSV-DGKLAGGTIYELGGPQVLSFRECLDIMLKTIDRKRSFVSLPFGIASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            + +   L    VPF  P       D +  L +D +VS  A     TF  +GI P  L+  
Sbjct  253  MGSVASL----VPFIEPP---LTADQVVLLKSDNVVSAMAETEGRTFAGIGIEPTMLESI  305

Query  262  PVEYLIQYRKGGPQYGST  209
               YL++YR  G QY  T
Sbjct  306  LPTYLVRYRPHG-QYTRT  322



>ref|WP_036306739.1| 3-beta hydroxysteroid dehydrogenase [Methylopila sp. 73B]
Length=329

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 108/196 (55%), Gaps = 15/196 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E+AVL   P+A IL+P+++ G ED   N +A  A+    LPLIGGGTT+ QPV+
Sbjct  140  RTKAAGEQAVLDTFPDAAILRPSIVFGPEDDFFNRFAAMARVSPALPLIGGGTTRFQPVF  199

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA  +  +L+ +  + G  YELGGPE+ T  Q+ E +  V       + +PF +AKA
Sbjct  200  VGDVAQTVAKALRGE-VAAGLPYELGGPEVLTFRQILEYVLQVTDRSRLLLPLPFGLAKA  258

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
             A   +LL      PL       +D +  L TD +VSE A     T E LGI P  ++  
Sbjct  259  QAKILQLLPNA---PL------TVDQVTMLETDNVVSEEARAAGRTLEGLGITPAPIEAV  309

Query  262  PVEYLIQYRKGGPQYG  215
               YL ++RK G Q+G
Sbjct  310  VPSYLWRFRKTG-QFG  324



>ref|WP_003544730.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium leguminosarum]
 gb|EJC69053.1| putative nucleoside-diphosphate sugar epimerase [Rhizobium leguminosarum 
bv. viciae WSM1455]
Length=326

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 79/200 (40%), Positives = 102/200 (51%), Gaps = 17/200 (9%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L   P+A I +P+++ G ED   N +A+ A+    LPLIGGG TK QPVY
Sbjct  134  RTKGRAETAILSVKPDAVIFRPSIVFGPEDSFFNKFAEMARMSPILPLIGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V D+A A +A   D   + GKVYELGGPE+ +  +  E M  V       V +PF IA  
Sbjct  194  VEDIAEA-VARAVDGKVAGGKVYELGGPEVLSFRECLETMLKVTCRRNPLVSLPFGIASM  252

Query  430  IATPRELLLKKVPFPLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLK  269
            I +   L    VPF  P  TP     D +  L  D +VS  A     T + LGI P  + 
Sbjct  253  IGSIASL----VPFITPPITP-----DQVRMLKRDNVVSREAEAEGRTLKGLGIAPTMVA  303

Query  268  GYPVEYLIQYRKGGPQYGST  209
                 YL+ YR  G QY  T
Sbjct  304  SVLGSYLVHYRPHG-QYTGT  322



>ref|WP_003589083.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium leguminosarum]
 gb|ACI57581.1| NAD-dependent epimerase/dehydratase [Rhizobium leguminosarum 
bv. trifolii WSM2304]
 gb|EJB04576.1| putative nucleoside-diphosphate sugar epimerase [Rhizobium leguminosarum 
bv. trifolii WSM597]
Length=326

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 100/198 (51%), Gaps = 13/198 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L   P+A I +P+++ G ED   N +A  A+    LPLIGGG TK QPVY
Sbjct  134  RTKGRAETAILSVKPDAVIFRPSIVFGPEDSFFNKFADMARMSPVLPLIGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +A   D   + GKVYELGGPE+ +  +  E+M  V       V +PF IA  
Sbjct  194  VEDVAEA-VARAVDGKVAGGKVYELGGPEVLSFRECLEMMLKVTSRKNPLVSLPFGIASM  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            I +   L+      P  TP I   D +  L  D +VS  A     T + LGI P      
Sbjct  253  IGSIASLI------PFITPPI-TPDQVRMLKHDNIVSREAEAEGRTLKGLGIAPTMAASV  305

Query  262  PVEYLIQYRKGGPQYGST  209
               YL+ YR  G QY  T
Sbjct  306  LGSYLVHYRPHG-QYTGT  322



>ref|WP_038541460.1| hypothetical protein, partial [endosymbiont of Acanthamoeba sp. 
UWC8]
Length=305

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 102/179 (57%), Gaps = 10/179 (6%)
 Frame = -1

Query  784  KATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVT  605
            K   E+AVL+  P + I++P+V+ G ED  +N +A+    +  +PLIGGG T+ QPVYV+
Sbjct  137  KLEGEKAVLQTFPNSVIIRPSVVFGREDNFINMFAKLVAVFPVIPLIGGGRTRFQPVYVS  196

Query  604  DVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIA  425
            DVA A+   L  D    GKV+ELGG +++T+ ++ EL++ +I +    V +PF  AK +A
Sbjct  197  DVAKAVGRCLVKDNIC-GKVFELGGSKVYTLREIYELIFKLIGKKKPLVSIPFIFAKVMA  255

Query  424  TPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYL  248
            T            L    +   D +E L TD ++ +N   FE+LG+ P  ++    EY+
Sbjct  256  TVL---------TLLPRPLLTCDQVELLKTDNIIVKNKNGFEELGLTPTSMEAVLSEYI  305



>ref|WP_003529781.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Sinorhizobium 
meliloti]
 gb|EHK77009.1| NAD-dependent epimerase/dehydratase [Sinorhizobium meliloti CCNWSX0020]
Length=326

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 105/195 (54%), Gaps = 13/195 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L  +P A IL+P+++ G ED   N +A+ A+    LPLIGGG T+ QPVY
Sbjct  134  RTKGRAEAAILETLPAAVILRPSIIFGPEDGFFNKFAEMARFSPVLPLIGGGNTRFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            VTDVA A+  S+ D   + G +YELGGP++ +  +  ++M   I     +V +PF IA  
Sbjct  194  VTDVAEAVARSV-DGKLTGGTIYELGGPQVLSFRECLDIMLKTIDRKRSFVSLPFGIASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            + +   L    VPF  P       D +  L +D +VS  A     T   +GI P  L+  
Sbjct  253  MGSVASL----VPFITPP---LTADQVVLLKSDNVVSAKAEAEGRTLAGIGIEPTMLESI  305

Query  262  PVEYLIQYRKGGPQY  218
               YL++YR  G QY
Sbjct  306  LPTYLVRYRPHG-QY  319



>ref|WP_012589203.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Methylocella silvestris]
 gb|ACK49133.1| NADH dehydrogenase (ubiquinone) [Methylocella silvestris BL2]
Length=335

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 105/196 (54%), Gaps = 8/196 (4%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            K KA  E  V    P A IL+P+V+ G ED   N +A  A+    LPLIGGG TK+QPV+
Sbjct  137  KTKAQGEALVAAAFPGAVILRPSVVFGPEDEFFNRFAAMARFMPVLPLIGGGETKLQPVF  196

Query  610  VTDVASAIIASLKDDGTSM-GKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAK  434
            V DVA A  A+L  DG +  G +YELGGPE+ T+ ++ E +  V     R V + F  A+
Sbjct  197  VGDVARA--AALALDGKAKPGAIYELGGPEVATMRRIMEFVLKVTERKRRLVTLSFDQAR  254

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKG  266
            ++    E+L K     LP       D +E L  D +VS+ A+    T + LG+ P   + 
Sbjct  255  SVGGVTEVLSKLSLGLLPKMFEITRDQVELLKHDNVVSKAAIVEGRTLQGLGLAPESFEA  314

Query  265  YPVEYLIQYRKGGPQY  218
            +   YL +YR  G QY
Sbjct  315  FTPTYLTRYRATG-QY  329



>ref|WP_024317749.1| MULTISPECIES: 3-beta hydroxysteroid dehydrogenase [Rhizobium]
 emb|CDM56065.1| NADH dehydrogenase/NADH dehydrogenase(ubiquinone) protein [Rhizobium 
sp. LPU83]
Length=326

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 104/197 (53%), Gaps = 12/197 (6%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+    P+A I +P+V+ G ED   N +A  A+    LPLIGGG TK QPVY
Sbjct  134  RTKGRAEAAIHAIKPDAIIYRPSVVFGPEDSFFNKFADMARIAPVLPLIGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A+  +++    ++G+VYELGGPE+ T  +  E+M        R V +PF IA  
Sbjct  194  VVDVAEAVAKAVEGK-VAVGEVYELGGPEVLTFRECLEIMLKATWRKNRLVSIPFGIASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            I +   L+      P  TP I   D +  L  D +VS++A     T + +G+ P  +   
Sbjct  253  IGSIASLV------PFITPPI-TADQVRLLKKDNIVSKDAEAEDRTLKGIGVTPTLVSSV  305

Query  262  PVEYLIQYRKGGPQYGS  212
               YL+QYR  G   GS
Sbjct  306  IGSYLVQYRPHGQYTGS  322



>ref|WP_018269295.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Bradyrhizobium 
elkanii]
Length=323

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 107/193 (55%), Gaps = 15/193 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            +AKA  E AVL  +P+ATI++P+++ G ED+  N +A  A+    LPL+GGG   +QP Y
Sbjct  134  RAKAEGEAAVLAALPQATIMRPSLLFGPEDQFTNRFAALARMSPVLPLVGGGVNTVQPAY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA+A +A   D     G  YELGGPE+ T+ ++ +++  +I+       +PF +AK 
Sbjct  194  VGDVANA-VADAVDGKAKQGATYELGGPEVLTMREVMQIILKIIQRDRMLAPLPFGLAKF  252

Query  430  IATPRELLLKKVPFPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKG  266
                +   L+  P P   TP     D +  L +D +VS+ A    LTF  LGI P  ++ 
Sbjct  253  ----QSYFLQFAPGPFTLTP-----DQVAMLRSDNVVSDAAKAAGLTFAGLGISPDSMEA  303

Query  265  YPVEYLIQYRKGG  227
               +YL ++R  G
Sbjct  304  IAPQYLWRFRAAG  316



>ref|WP_015663304.1| hypothetical protein [Bradyrhizobium oligotrophicum]
 dbj|BAM86162.1| conserved hypothetical protein [Bradyrhizobium oligotrophicum 
S58]
Length=326

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 103/180 (57%), Gaps = 15/180 (8%)
 Frame = -1

Query  751  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  572
            +PEA I++P+V+ G ED+  N +A  A+   FLPLIGGG TK+QPVYV DVASA +A   
Sbjct  150  VPEAVIMRPSVVFGPEDQFTNRFAGLARMSPFLPLIGGGETKMQPVYVGDVASA-VADAV  208

Query  571  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  392
            D     G  YELGGPE+ +  ++ +++ D+       + +PF +AK  A     +L+  P
Sbjct  209  DGKAQAGATYELGGPEVLSFREILKIILDITDRDRALLPLPFGLAKLQAA----VLQFAP  264

Query  391  FPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  227
             PL  TP     D +E L  D +VSE A    LT + LGI P  L+    +YL ++R  G
Sbjct  265  GPLKLTP-----DQVELLRHDNVVSEAAKAAGLTLQGLGITPDSLEAVAPQYLWRFRPSG  319



>ref|WP_010968509.1| oxidoreductase [Sinorhizobium meliloti]
 ref|NP_384436.1| oxidoreductase [Sinorhizobium meliloti 1021]
 emb|CAC41767.1| Probable NADH-ubiquinone oxidoreductase [Sinorhizobium meliloti 
1021]
 gb|AGG72910.1| putative NADH-ubiquinone oxidoreductase [Sinorhizobium meliloti 
2011]
Length=326

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 106/196 (54%), Gaps = 15/196 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L  +P A IL+P+++ G ED   N +A+ A+    LPLIGGG T+ QPVY
Sbjct  134  RTKGRAEAAILETLPAAVILRPSIIFGPEDGFFNKFAEMARFSPVLPLIGGGNTRFQPVY  193

Query  610  VTDVASAIIASLKDDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAK  434
            VTDVA A+  S+  DGT + G +YELGGP++ +  +  ++M   I     +V +PF IA 
Sbjct  194  VTDVAEAVARSV--DGTLTGGTIYELGGPQVLSFRECLDIMLKTIDRKRSFVSLPFGIAS  251

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKG  266
             + +   L    VPF  P       D +  L  D +VS  A     T   +GI P  L+ 
Sbjct  252  LMGSVASL----VPFITPP---LTADQVVLLKLDNVVSAKAEAEGRTLAGIGIEPTMLES  304

Query  265  YPVEYLIQYRKGGPQY  218
                YL++YR  G QY
Sbjct  305  ILPTYLVRYRPHG-QY  319



>ref|WP_027989547.1| 3-beta hydroxysteroid dehydrogenase [Sinorhizobium meliloti]
Length=326

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 104/195 (53%), Gaps = 13/195 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L  +P A IL+P+++ G ED   N +A+ A+    LPLIGGG T+ QPVY
Sbjct  134  RTKGRAEAAILETLPAAVILRPSIIFGPEDGFFNKFAEMARFSPVLPLIGGGNTRFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            VTDVA A+  S+ D   + G +YELGGP++ +  +  + M   I     +V +PF IA  
Sbjct  194  VTDVAEAVARSV-DGKLTGGTIYELGGPQVLSFRECLDFMLKTIDRKRSFVSLPFGIASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            + +   L    VPF  P       D +  L +D +VS  A     T   +GI P  L+  
Sbjct  253  MGSVASL----VPFITPP---LTADQVVLLKSDNVVSAKAEAEGRTLAGIGIEPTMLESI  305

Query  262  PVEYLIQYRKGGPQY  218
               YL++YR  G QY
Sbjct  306  LPTYLVRYRPHG-QY  319



>ref|XP_005971320.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Pantholops hodgsonii]
Length=326

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 105/193 (54%), Gaps = 14/193 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+   +P A IL+P+++ G ED   N +A+ A++  FLPLIGGG T+ QPVY
Sbjct  134  RTKGRAEAAIHSVLPGAVILRPSIIFGPEDDFFNKFAKMARSLPFLPLIGGGKTRFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAE-LMYDVIREWPRYVKVPFPIAK  434
            V DVA A+  S+ D     G +YELGG ++ T     E ++    RE P +V +PF IA 
Sbjct  194  VEDVAEAVARSV-DGKLKPGSIYELGGQDVMTFRDCLEAVLAATYRERP-FVNLPFGIAS  251

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVS----ENALTFEDLGIVPHKLKG  266
             I     L+      PL TP +   D +  L  D +VS    +N LT E +GI P ++  
Sbjct  252  TIGKIASLV------PLITPPL-TADQVTMLKKDNVVSAEAEKNGLTLEGIGITPVRVAS  304

Query  265  YPVEYLIQYRKGG  227
                Y++QYR  G
Sbjct  305  VLPSYMVQYRPHG  317



>ref|WP_037188156.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. YR519]
Length=326

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 104/197 (53%), Gaps = 12/197 (6%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L   P+A I +P+++ G ED   N +A  A+    LPLIGGG T+ QPVY
Sbjct  134  RTKGRAEAAILSIKPDAVIYRPSIVFGPEDDFFNKFADMARMAPVLPLIGGGKTRFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V D+A A+  +++      GKVYELGGPE+ T  +  E +          V +PF +A  
Sbjct  194  VMDIAEAVAKAVEGK-VEGGKVYELGGPEVLTFRECLEAVLKATSRKNPLVSIPFGLASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            I +   L+      PL  P I + D +  L TD +VS+ A     T +D+G+VP  +   
Sbjct  253  IGSVASLV------PLIKPPITS-DQVRLLKTDNVVSKEAEAEGRTLKDIGVVPTMVGSV  305

Query  262  PVEYLIQYRKGGPQYGS  212
               YL+QYR  G   GS
Sbjct  306  VDSYLVQYRPQGQYTGS  322



>ref|WP_029959614.1| 3-beta hydroxysteroid dehydrogenase [Ensifer sp. USDA 6670]
Length=326

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 105/195 (54%), Gaps = 13/195 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L  +P A IL+P+++ G ED   N +A+ A+    LPLIGGG T+ QPVY
Sbjct  134  RTKGRAEAAILEALPAAVILRPSIIFGPEDGFFNKFAEMARFSPVLPLIGGGKTRFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            VTDVA A+  S+ D   + G +YELGGP++ +  +  ++M   I     +V +PF IA  
Sbjct  194  VTDVAEAVARSV-DGKLTGGTIYELGGPQVLSFRECLDIMLKTIDRKRSFVSLPFGIASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            + +   L    VPF  P       D +  L +D +VS  A     T   +GI P  L+  
Sbjct  253  MGSVASL----VPFITPP---LTADQVVLLKSDNVVSAKAEAEGRTLAGIGIEPTMLESI  305

Query  262  PVEYLIQYRKGGPQY  218
               YL++YR  G QY
Sbjct  306  LPTYLVRYRPHG-QY  319



>ref|WP_028002286.1| 3-beta hydroxysteroid dehydrogenase [Sinorhizobium arboris]
Length=326

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 102/195 (52%), Gaps = 13/195 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L  +P A IL+P+++ G ED   N +A+ A+    LPLIGGG T+ QPVY
Sbjct  134  RTKGRAEAAILETLPTAVILRPSIIFGPEDGFFNKFAEMARFSPVLPLIGGGRTRFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            VTDVA A+  S+ D     G +YELGGP++ +  +  E M   I     +V VPF IA  
Sbjct  194  VTDVAEAVARSV-DGKLKAGTIYELGGPQVLSFRECLEAMLKTIDRKRSFVSVPFGIASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            + +   L    VPF  P       D +  L +D +VS  A     T   +GI P  L   
Sbjct  253  MGSVASL----VPFITPP---LTADQVVLLKSDNVVSAEAEAEGRTLTGIGIEPTLLDSI  305

Query  262  PVEYLIQYRKGGPQY  218
               YL++YR  G QY
Sbjct  306  LPTYLVRYRPHG-QY  319



>ref|WP_026756898.1| 3-beta hydroxysteroid dehydrogenase [Sediminimonas qiaohouensis]
Length=330

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 103/191 (54%), Gaps = 5/191 (3%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  EEAV   +P A IL+P+VMIG ED   N +A   +    LP++ G  TK QPVY
Sbjct  130  RTKAMGEEAVQSHMPNAVILRPSVMIGPEDNFFNRFAGMTRFGPILPVV-GAATKFQPVY  188

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A  A L  +G +   +YELGGPE+ T   L + M  ++      V +PF IA+ 
Sbjct  189  VDDVAHA--AVLGVEGQAAPGIYELGGPEVETFRALMQRMLKIVHRRRLIVNMPFFIARV  246

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
            +A   + +++K    L T  +   D +  L  D +VSE A  F+ LGI P  +     EY
Sbjct  247  MAFGFD-MVQKATLGLITNGVLTRDQLHNLRRDNVVSEGAQGFDALGITPKSMATILPEY  305

Query  250  LIQYRKGGPQY  218
            L ++R  G QY
Sbjct  306  LWRFRPSG-QY  315



>ref|WP_026622062.1| 3-beta hydroxysteroid dehydrogenase [Ensifer sp. WSM1721]
Length=326

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 103/198 (52%), Gaps = 13/198 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L  +PEA IL+P+++ G ED   N +A  A+    LPL+GGG TK QPVY
Sbjct  134  RTKGRAEIAILETVPEAVILRPSIIFGPEDDFFNKFAGMARLSPVLPLVGGGHTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A+  S+ D     G +YELGGP++ +  +  E+    I    R+V +PF IA  
Sbjct  194  VADVAEAVARSV-DGKLKGGTIYELGGPQVLSFRECLEITLKTIDRKRRFVSIPFGIASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            + +   L    VPF  P       D +  L TD +VS  A     T   +GI P  L   
Sbjct  253  MGSVASL----VPFITPP---LTADQVVLLKTDNVVSAEAEAEGRTLAGIGIKPTMLDPI  305

Query  262  PVEYLIQYRKGGPQYGST  209
               YL++YR  G QY  T
Sbjct  306  LPTYLVRYRPQG-QYTGT  322



>ref|WP_029873971.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium leguminosarum]
Length=326

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 101/198 (51%), Gaps = 13/198 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L   P+A I +P+++ G ED   N +A+ A+    LPLIGGG TK QPVY
Sbjct  134  RTKGRAETAILSVKPDAVIFRPSIVFGPEDSFFNKFAEMARMSPILPLIGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V D+A A +A   D   + GKVYELGGPE+ +  Q  E M  V       V +PF +A  
Sbjct  194  VEDIAEA-VARAVDGKVAGGKVYELGGPEVLSFRQCLETMLKVTCRKNPLVSLPFGVASM  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            I +   L+      P  TP I   D +  L  D +VS  A     T + LGI P  +   
Sbjct  253  IGSIASLI------PFITPPI-TPDQVRMLKRDNVVSPEAEAEGRTLKGLGIAPTMVASV  305

Query  262  PVEYLIQYRKGGPQYGST  209
               YL+ YR  G QY  T
Sbjct  306  LGSYLVHYRPHG-QYTGT  322



>ref|WP_033181246.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium leguminosarum]
Length=326

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 102/198 (52%), Gaps = 13/198 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L   P+A I +P+++ G ED   N +A+ A+    LPL+GGG TK QPVY
Sbjct  134  RTKGRAETAILSVKPDAVIFRPSIVFGPEDSFFNKFAEMARMSPILPLVGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +A   D   + GKVYELGGPE+ +  +  E M  V       V +PF IA  
Sbjct  194  VEDVAEA-VARAVDGKVAGGKVYELGGPEVLSFRECLETMLRVTCRKNPLVSLPFGIASM  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            I +   L+      P  TP I   D +  L  D +VS+ A     T + LGI P  +   
Sbjct  253  IGSIASLI------PFITPPI-TPDQVRMLKRDNVVSKEAEAEGRTLKGLGIAPTMVASV  305

Query  262  PVEYLIQYRKGGPQYGST  209
               YL+ YR  G QY  T
Sbjct  306  LGSYLVHYRPHG-QYTGT  322



>ref|WP_018485276.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium leguminosarum]
Length=326

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 101/198 (51%), Gaps = 13/198 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L   P+A I +P+++ G ED   N +A+ A+    LPL+GGG TK QPVY
Sbjct  134  RTKGRAETAILSVKPDAVIFRPSIVFGPEDSFFNKFAEMARMSPILPLVGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +A   D   + GKVYELGGPE+ +  +  E M  V       V +PF IA  
Sbjct  194  VEDVAEA-VARAVDGKVAGGKVYELGGPEVLSFRECLETMLKVTCRKNPLVSLPFGIASM  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            I +   L+      P  TP I   D +  L  D +VS  A     T + LGI P  +   
Sbjct  253  IGSIASLI------PFITPPI-TPDQVRLLKRDNIVSREAEAEGRTLKGLGIAPTMVASV  305

Query  262  PVEYLIQYRKGGPQYGST  209
               YL+ YR  G QY  T
Sbjct  306  LGSYLVHYRPHG-QYTGT  322



>ref|WP_027674017.1| 3-beta hydroxysteroid dehydrogenase [Agrobacterium larrymoorei]
Length=326

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 99/192 (52%), Gaps = 12/192 (6%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+   +PEA IL+P+++ G ED   N +A  A+   FLPLIGGG TK QPVY
Sbjct  134  RTKGRAEAAIRSVLPEAIILRPSIVFGPEDDFFNKFAGMAQRLPFLPLIGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A+  S+ D     G  YELGG ++ T  Q  E +        R V +PF IA  
Sbjct  194  VEDVAEAVARSV-DGALKSGSTYELGGQDVMTFRQCLEAVLTATYRQNRLVNLPFGIASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            + +   L+      PL  P + + D +  L  D +VS  A    LT + +GI P ++   
Sbjct  253  LGSVASLI------PLIKPPLTS-DQVALLKNDNVVSAEAEKAGLTLDGIGITPVRVSSV  305

Query  262  PVEYLIQYRKGG  227
               YL+ YR  G
Sbjct  306  LPSYLVSYRPHG  317



>ref|WP_023431376.1| NAD-dependent epimerase/dehydratase [Lutibaculum baratangense]
 gb|ESR25896.1| NAD-dependent epimerase/dehydratase [Lutibaculum baratangense 
AMV1]
Length=330

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 107/205 (52%), Gaps = 14/205 (7%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E A+   +P A IL+P++M G ED+  N +A  A+   FLPLIGGG T+ QPV+
Sbjct  136  RTKAAGEAAIRDAVPGAVILRPSIMFGQEDQFFNRFAAMARMSPFLPLIGGGQTRFQPVF  195

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DV  A +A   D   + G  YELGGPEI T  QL ELM  VI      + VPF  A  
Sbjct  196  VGDVGEA-VARAVDGKATPGCTYELGGPEIRTFRQLMELMLHVIGRKRVLLNVPFGAADR  254

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGY  263
            +A     +L  +P  L T      D +  L  D +VS+ A+    T E LGI P  ++  
Sbjct  255  LAG----VLGALPGRLLTT-----DQVIQLRHDNVVSQAAIEEGRTIEALGIDPVGMEAI  305

Query  262  PVEYLIQYRKGGPQYGSTVSEKISP  188
               YL ++R+ G    +  + ++ P
Sbjct  306  LPTYLQRFRRAGQFTNNVDTPRLQP  330



>ref|WP_037125547.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. CF097]
Length=326

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 108/197 (55%), Gaps = 17/197 (9%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            K+K  AE+A+L  +PEA IL+P+++ G ED   N +A+ A+    LPL+GGG T  QPVY
Sbjct  134  KSKGRAEKAILETVPEAVILRPSIIFGPEDGFFNKFAEMARLSPVLPLVGGGKTAFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A+  +++    + GK+YELGGPE+ T     E+M  +I      + +PF IA  
Sbjct  194  VADVAEAVARTIEGK-VAKGKIYELGGPEVLTFKNCLEIMLKIIDRKRTLLPIPFGIASL  252

Query  430  IATPRELLLKKVPFPLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLK  269
            + +    +   VPF  P  TP     D +  L  D +VS+ A     T +  GI P  ++
Sbjct  253  MGS----VASMVPFVAPPITP-----DQVILLKRDNVVSDGAQAEGRTLQAYGIEPTSVE  303

Query  268  GYPVEYLIQYRKGGPQY  218
                 Y+++YR  G QY
Sbjct  304  AILPSYMVRYRPQG-QY  319



>ref|WP_021102609.1| NAD-dependent epimerase/dehydratase [Litoreibacter arenae]
 gb|EPX77538.1| NAD-dependent epimerase/dehydratase [Litoreibacter arenae DSM 
19593]
Length=329

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 106/191 (55%), Gaps = 6/191 (3%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  EE VL   P+A IL+P++M G ED   N +A  ++    LP++ G  TK QPVY
Sbjct  130  RTKALGEEGVLEHWPQAVILRPSIMFGQEDEFFNRFASMSRFGPILPVV-GADTKFQPVY  188

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A   ++   G +   +YELGGPE+ T   L + M D++R     V +PF IA  
Sbjct  189  VDDVAQAATKAVL--GEAKPGIYELGGPEVATFRDLMQTMLDMVRRRRLIVNIPFFIAGI  246

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
            + +  + L+ K+ F L    +   D +  L  D +V+E+A+TF DLGI    L+    +Y
Sbjct  247  MGSAFD-LVNKISFGLINGPL-TRDQVRNLKRDNVVAEDAMTFADLGIRRTALEAIIPDY  304

Query  250  LIQYRKGGPQY  218
            L ++R  G QY
Sbjct  305  LWRFRPSG-QY  314



>ref|WP_045657033.1| 3-beta hydroxysteroid dehydrogenase [Hyphomonadaceae bacterium 
BRH_c29]
 gb|KJS24175.1| 3-beta hydroxysteroid dehydrogenase [Hyphomonadaceae bacterium 
BRH_c29]
Length=329

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 111/190 (58%), Gaps = 7/190 (4%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA AE AV   IP ATIL+P+V+ G ED   N +A  A+    +P IGGG TK+QPVY
Sbjct  131  RSKAEAEAAVRASIPTATILRPSVVFGPEDGFFNKFANMARFAPLMPAIGGGKTKMQPVY  190

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
              DVA AI  ++ D+G + GK YELGGP I+T++++ + ++         + +PF +AK 
Sbjct  191  AGDVAEAIAVAV-DNGEAAGKTYELGGPGIYTMNEIYDFIFRTTDRSRFKIGLPFFMAKP  249

Query  430  IATPRELLLKKV-PFP---LPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHK-LKG  266
            I      + + + PF    L  P +   D +E L +D +V++ ALT +DLGI   + ++ 
Sbjct  250  IGFLTGAVWRYIPPFCWGFLGEPPVTG-DQVEMLKSDNVVADEALTLKDLGITAQESIES  308

Query  265  YPVEYLIQYR  236
                YL ++R
Sbjct  309  IVPTYLWRFR  318



>ref|WP_012180246.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Dinoroseobacter 
shibae]
 gb|ABV95323.1| ubiquinone dependent NADH dehydrogenase [Dinoroseobacter shibae 
DFL 12 = DSM 16493]
Length=327

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/192 (37%), Positives = 111/192 (58%), Gaps = 7/192 (4%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E+AVL+ +PEA IL+P+++ G ED+  N +A  ++    LP++ G  TK QPVY
Sbjct  130  RTKAEGEQAVLQAMPEAVILRPSIVFGPEDQFFNRFASMSRLGPILPVV-GAETKFQPVY  188

Query  610  VTDVA-SAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAK  434
            V DVA +A+ A+L   G +   +YELGGP++ +  +L   M  VI      V VPFP+A 
Sbjct  189  VDDVARAAVKAAL---GQAKPGIYELGGPDVNSFRELMAHMLSVIDRRRLIVNVPFPVAH  245

Query  433  AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVE  254
             +    + L++K+   +    +   D +  L  D +V+ +A+ F+DLGI P  L+    E
Sbjct  246  VMGMTLD-LVQKLSLGIIHNGMLTHDQVRNLAKDNVVAADAMGFDDLGIEPVALEAVLPE  304

Query  253  YLIQYRKGGPQY  218
            YL ++R  G QY
Sbjct  305  YLWRFRPAG-QY  315



>ref|WP_024322235.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium leguminosarum]
Length=326

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/200 (39%), Positives = 102/200 (51%), Gaps = 17/200 (9%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L   P+A I +P+++ G ED   N +A+ A+    LPL+GGG TK QPVY
Sbjct  134  RTKGRAETAILSVKPDAVIFRPSIVFGPEDSFFNKFAEMARMSPILPLVGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +A   D   + GKVYELGGPE+ +  +  E M  V       V +PF IA  
Sbjct  194  VEDVAEA-VARAVDGKVAGGKVYELGGPEVLSFRECLETMLKVTCRKNPLVSLPFGIASM  252

Query  430  IATPRELLLKKVPFPLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLK  269
            I +    +   +PF  P  TP     D +  L  D +VS  A     T + LGI P  + 
Sbjct  253  IGS----IASMIPFITPPITP-----DQVRLLKRDNIVSREAEAEGRTLKGLGIAPTMVA  303

Query  268  GYPVEYLIQYRKGGPQYGST  209
                 YL+ YR  G QY  T
Sbjct  304  SVLGSYLVHYRPHG-QYTGT  322



>ref|WP_044564275.1| 3-beta hydroxysteroid dehydrogenase [Azospirillum sp. B4]
Length=335

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 107/193 (55%), Gaps = 11/193 (6%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA  E+AV    PEATIL+P+V+ G ED   N +A  A+   F+PLIGGG T+ QPVY
Sbjct  134  RSKAAGEQAVRAVFPEATILRPSVVFGPEDNFFNRFAGMARTLPFVPLIGGGATRFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA AIIA++   G   GK +ELGGP  ++  +L +L+ D+     R + +P+ +A  
Sbjct  194  VGDVADAIIAAVTRTGAE-GKTFELGGPRAYSFRELVQLVLDLTGRKTRLLSLPWGLASL  252

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
             A   EL+  K   PL        D +  L TD ++S       DLG+ P   +     Y
Sbjct  253  QAGFLELVPGK---PL------TRDQVTLLKTDNVLSGKLPGLADLGVTPTGAEVILPTY  303

Query  250  LIQYRKGGPQYGS  212
            L +++ GG +Y S
Sbjct  304  LDRFQVGG-RYAS  315



>ref|WP_011049451.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Ruegeria pomeroyi]
 gb|AAV96993.1| NADH ubiquinone oxidoreductase, putative [Ruegeria pomeroyi DSS-3]
Length=327

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 106/191 (55%), Gaps = 5/191 (3%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            ++KA  E  VLR +P+A IL+P+V+ GTED+  N +A   +   FLP++ G  T+ QPVY
Sbjct  130  RSKALGEAGVLRHMPDAMILRPSVIFGTEDQFFNRFAGMTRFGPFLPVV-GAETRFQPVY  188

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +  +   G + G VYELGGP++ T   L + M  VI      + +PF  A+ 
Sbjct  189  VDDVARAAVKGVL--GQAPGGVYELGGPDVETFRALMQRMLGVIHRKRIIIALPFFAARI  246

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  251
            +A   + + K V F L   +I   D ++ L  D +VSE A  F DLGI P  +      Y
Sbjct  247  MAGMLD-VAKFVSFQLFPNNILTRDQLKNLRRDNVVSEGAKGFADLGIAPEPMDTVLPAY  305

Query  250  LIQYRKGGPQY  218
            L ++R  G QY
Sbjct  306  LWKFRPNG-QY  315



>ref|WP_029061954.1| 3-beta hydroxysteroid dehydrogenase [Labrenzia sp. DG1229]
Length=324

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 103/195 (53%), Gaps = 15/195 (8%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + KA  E  VL  + ++ IL+P+++ G ED   N +A+ A+    LPLIGGG TK QPVY
Sbjct  135  RTKAAGEAGVLETLADSVILRPSIVFGPEDDFFNQFAEMARFSPALPLIGGGVTKFQPVY  194

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +A   D     G +YELGGPEI +     E M ++ R     + +PFP+A A
Sbjct  195  VCDVAQA-VAQAVDGQLQSGGIYELGGPEIKSFRDCLEEMLEITRRSRALLPIPFPVASA  253

Query  430  IATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGY  263
            +    +LL      PL        D +E L TD +VS+ A     T E +GI P  L   
Sbjct  254  MGKVMQLLPGA---PL------TADQVELLKTDNVVSDTAKSEGRTLEGIGIDPANLASI  304

Query  262  PVEYLIQYRKGGPQY  218
               YL ++R+ G QY
Sbjct  305  LPTYLERFREHG-QY  318



>ref|WP_020052566.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium leguminosarum]
Length=326

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/200 (40%), Positives = 101/200 (51%), Gaps = 17/200 (9%)
 Frame = -1

Query  790  KAKATAEEAVLREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVY  611
            + K  AE A+L   P+A I +P+++ G ED   N +A  A+    LPL+GGG TK QPVY
Sbjct  134  RTKGRAETAILSVKPDAVIFRPSIVFGPEDSFFNKFAGMARMSPILPLVGGGKTKFQPVY  193

Query  610  VTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  431
            V DVA A +A   D   + GKVYELGGPE+ +  +  E M  V       V +PF IA  
Sbjct  194  VEDVAEA-VARAVDGKVAGGKVYELGGPEVLSFRECLETMLKVTCRKNPLVSLPFGIASM  252

Query  430  IATPRELLLKKVPFPLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLK  269
            I +   L    VPF  P  TP     D +  L  D +VS  A     T + LGI P  + 
Sbjct  253  IGSIASL----VPFITPPITP-----DQVRMLKRDNIVSREAEAEGRTLKGLGIAPTMVA  303

Query  268  GYPVEYLIQYRKGGPQYGST  209
                 YL+ YR  G QY  T
Sbjct  304  SVLGSYLVHYRPHG-QYTGT  322



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1641823912876