BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8048

Length=1319
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009589163.1|  PREDICTED: uncharacterized protein LOC104086569    306   9e-96   Nicotiana tomentosiformis
ref|XP_011081359.1|  PREDICTED: uncharacterized protein LOC105164409    301   6e-94   Sesamum indicum [beniseed]
ref|XP_006343761.1|  PREDICTED: uncharacterized protein LOC102582708    295   1e-91   Solanum tuberosum [potatoes]
ref|XP_004245442.1|  PREDICTED: uncharacterized protein LOC101259469    295   1e-91   Solanum lycopersicum
gb|EYU35617.1|  hypothetical protein MIMGU_mgv1a007464mg                294   3e-91   Erythranthe guttata [common monkey flower]
ref|XP_011070403.1|  PREDICTED: uncharacterized protein LOC105156068    294   5e-91   Sesamum indicum [beniseed]
ref|XP_002518934.1|  phosphatidylcholine transfer protein, putative     290   3e-89   Ricinus communis
gb|EYU19436.1|  hypothetical protein MIMGU_mgv1a007177mg                288   6e-89   Erythranthe guttata [common monkey flower]
ref|XP_012086635.1|  PREDICTED: uncharacterized protein LOC105645602    288   1e-88   Jatropha curcas
ref|XP_009775677.1|  PREDICTED: uncharacterized protein LOC104225551    285   9e-88   Nicotiana sylvestris
ref|XP_011040605.1|  PREDICTED: uncharacterized protein LOC105136815    283   1e-86   Populus euphratica
ref|XP_002278777.1|  PREDICTED: uncharacterized protein LOC100247984    281   6e-86   Vitis vinifera
ref|XP_010104915.1|  hypothetical protein L484_024117                   279   6e-85   Morus notabilis
ref|XP_009348226.1|  PREDICTED: uncharacterized protein LOC103939842    278   7e-85   Pyrus x bretschneideri [bai li]
ref|XP_004146518.1|  PREDICTED: uncharacterized protein LOC101209389    277   2e-84   Cucumis sativus [cucumbers]
ref|XP_009344057.1|  PREDICTED: uncharacterized protein LOC103935948    277   3e-84   Pyrus x bretschneideri [bai li]
ref|XP_007039336.1|  Polyketide cyclase/dehydrase and lipid trans...    276   4e-84   
ref|XP_006439191.1|  hypothetical protein CICLE_v10020224mg             276   4e-84   Citrus clementina [clementine]
ref|XP_002317053.1|  hypothetical protein POPTR_0011s15470g             275   7e-84   
ref|XP_006476268.1|  PREDICTED: uncharacterized protein LOC102627263    275   2e-83   Citrus sinensis [apfelsine]
gb|KDO76778.1|  hypothetical protein CISIN_1g014046mg                   275   2e-83   Citrus sinensis [apfelsine]
ref|XP_008452046.1|  PREDICTED: uncharacterized protein LOC103493171    272   1e-82   Cucumis melo [Oriental melon]
ref|XP_008392651.1|  PREDICTED: uncharacterized protein LOC103454832    272   2e-82   Malus domestica [apple tree]
ref|XP_008245786.1|  PREDICTED: uncharacterized protein LOC103343932    271   5e-82   Prunus mume [ume]
ref|XP_009360210.1|  PREDICTED: uncharacterized protein LOC103950711    270   1e-81   Pyrus x bretschneideri [bai li]
ref|XP_011038005.1|  PREDICTED: uncharacterized protein LOC105135031    269   2e-81   Populus euphratica
ref|XP_002300509.2|  hypothetical protein POPTR_0001s45410g             269   4e-81   
ref|XP_008346656.1|  PREDICTED: uncharacterized protein LOC103409627    268   5e-81   Malus domestica [apple tree]
ref|XP_010053047.1|  PREDICTED: uncharacterized protein LOC104441594    266   2e-80   Eucalyptus grandis [rose gum]
gb|KCW77296.1|  hypothetical protein EUGRSUZ_D01658                     266   3e-80   Eucalyptus grandis [rose gum]
emb|CDP12249.1|  unnamed protein product                                263   4e-79   Coffea canephora [robusta coffee]
gb|KHG16904.1|  StAR-related lipid transfer 7, mitochondrial            262   1e-78   Gossypium arboreum [tree cotton]
gb|KJB39548.1|  hypothetical protein B456_007G018700                    258   5e-77   Gossypium raimondii
ref|XP_010267382.1|  PREDICTED: uncharacterized protein LOC104604645    258   9e-77   Nelumbo nucifera [Indian lotus]
ref|XP_004145876.1|  PREDICTED: uncharacterized protein LOC101209462    256   2e-76   Cucumis sativus [cucumbers]
ref|XP_008437458.1|  PREDICTED: uncharacterized protein LOC103482874    256   2e-76   Cucumis melo [Oriental melon]
gb|KJB37444.1|  hypothetical protein B456_006G204800                    256   4e-76   Gossypium raimondii
ref|XP_006840600.1|  PREDICTED: uncharacterized protein LOC18430430     255   4e-76   Amborella trichopoda
gb|KHG30399.1|  StAR-related lipid transfer 7, mitochondrial            255   6e-76   Gossypium arboreum [tree cotton]
ref|XP_010251494.1|  PREDICTED: uncharacterized protein LOC104593390    253   2e-75   Nelumbo nucifera [Indian lotus]
ref|XP_010553581.1|  PREDICTED: uncharacterized protein LOC104823628    253   3e-75   Tarenaya hassleriana [spider flower]
ref|XP_008778542.1|  PREDICTED: uncharacterized protein LOC103698325    247   6e-73   Phoenix dactylifera
ref|XP_010934199.1|  PREDICTED: uncharacterized protein LOC105054408    247   6e-73   Elaeis guineensis
ref|XP_010920227.1|  PREDICTED: uncharacterized protein LOC105044130    246   1e-72   Elaeis guineensis
ref|XP_004309518.1|  PREDICTED: uncharacterized protein LOC101297897    245   3e-72   Fragaria vesca subsp. vesca
ref|XP_002886329.1|  hypothetical protein ARALYDRAFT_892929             242   2e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_007209198.1|  hypothetical protein PRUPE_ppa006451mg             242   2e-71   
ref|XP_009757290.1|  PREDICTED: uncharacterized protein LOC104210169    241   6e-71   Nicotiana sylvestris
ref|XP_006391589.1|  hypothetical protein EUTSA_v10023504mg             241   9e-71   Eutrema salsugineum [saltwater cress]
ref|XP_010666130.1|  PREDICTED: uncharacterized protein LOC104883331    242   9e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009798509.1|  PREDICTED: uncharacterized protein LOC104244732    240   2e-70   Nicotiana sylvestris
ref|XP_011084568.1|  PREDICTED: uncharacterized protein LOC105166783    239   5e-70   Sesamum indicum [beniseed]
ref|XP_009604589.1|  PREDICTED: uncharacterized protein LOC104099...    239   9e-70   Nicotiana tomentosiformis
ref|XP_010496633.1|  PREDICTED: uncharacterized protein LOC104773688    236   3e-69   Camelina sativa [gold-of-pleasure]
emb|CDP04991.1|  unnamed protein product                                237   4e-69   Coffea canephora [robusta coffee]
ref|XP_006347513.1|  PREDICTED: uncharacterized protein LOC102587815    236   6e-69   Solanum tuberosum [potatoes]
ref|XP_010473737.1|  PREDICTED: uncharacterized protein LOC104753141    235   8e-69   Camelina sativa [gold-of-pleasure]
gb|ACJ84293.1|  unknown                                                 230   1e-68   Medicago truncatula
ref|XP_007039199.1|  Polyketide cyclase/dehydrase and lipid trans...    236   1e-68   
ref|XP_008234648.1|  PREDICTED: uncharacterized protein LOC103333...    236   1e-68   Prunus mume [ume]
ref|XP_008234647.1|  PREDICTED: uncharacterized protein LOC103333...    236   1e-68   Prunus mume [ume]
ref|XP_006302371.1|  hypothetical protein CARUB_v10020442mg             234   2e-68   Capsella rubella
ref|XP_007220046.1|  hypothetical protein PRUPE_ppa026850mg             234   3e-68   
ref|XP_009397003.1|  PREDICTED: uncharacterized protein LOC103981952    234   4e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_176653.1|  membrane related protein CP5                          232   8e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AAM91533.1|  membrane related protein CP5, putative                  232   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004235020.1|  PREDICTED: uncharacterized protein LOC101249155    233   1e-67   Solanum lycopersicum
gb|KEH42916.1|  mammalian STARD2 lipid-binding START domain protein     231   2e-67   Medicago truncatula
ref|XP_008785106.1|  PREDICTED: stAR-related lipid transfer prote...    231   4e-67   Phoenix dactylifera
ref|XP_009413766.1|  PREDICTED: uncharacterized protein LOC103995005    231   5e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007143962.1|  hypothetical protein PHAVU_007G117200g             229   2e-66   Phaseolus vulgaris [French bean]
ref|XP_006652076.1|  PREDICTED: uncharacterized protein LOC102712157    228   5e-66   Oryza brachyantha
ref|XP_010056033.1|  PREDICTED: uncharacterized protein LOC104444124    227   1e-65   Eucalyptus grandis [rose gum]
ref|XP_010544864.1|  PREDICTED: uncharacterized protein LOC104817383    227   2e-65   Tarenaya hassleriana [spider flower]
ref|XP_009382005.1|  PREDICTED: phosphatidylcholine transfer prot...    226   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004495515.1|  PREDICTED: uncharacterized protein LOC101494889    225   9e-65   Cicer arietinum [garbanzo]
ref|XP_010035315.1|  PREDICTED: uncharacterized protein LOC104424552    225   3e-64   Eucalyptus grandis [rose gum]
gb|KCW46620.1|  hypothetical protein EUGRSUZ_K00428                     224   3e-64   Eucalyptus grandis [rose gum]
ref|XP_010676932.1|  PREDICTED: uncharacterized protein LOC104892647    224   4e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006493201.1|  PREDICTED: uncharacterized protein LOC102612642    223   4e-64   Citrus sinensis [apfelsine]
gb|KGN49968.1|  hypothetical protein Csa_5G146910                       223   4e-64   Cucumis sativus [cucumbers]
ref|XP_002321959.2|  hypothetical protein POPTR_0015s00730g             222   1e-63   
ref|XP_010099429.1|  hypothetical protein L484_003253                   221   3e-63   
ref|XP_004307892.1|  PREDICTED: uncharacterized protein LOC101306175    220   1e-62   Fragaria vesca subsp. vesca
ref|XP_006441237.1|  hypothetical protein CICLE_v10020581mg             219   1e-62   Citrus clementina [clementine]
gb|KJB52500.1|  hypothetical protein B456_008G265200                    218   4e-62   Gossypium raimondii
gb|EYU19693.1|  hypothetical protein MIMGU_mgv1a0075021mg               213   4e-62   Erythranthe guttata [common monkey flower]
ref|XP_006606420.1|  PREDICTED: uncharacterized protein LOC100788121    217   7e-62   
emb|CBI34612.3|  unnamed protein product                                216   8e-62   Vitis vinifera
ref|XP_011014759.1|  PREDICTED: uncharacterized protein LOC105118...    217   2e-61   Populus euphratica
ref|XP_011014758.1|  PREDICTED: uncharacterized protein LOC105118...    217   3e-61   Populus euphratica
ref|NP_001052066.1|  Os04g0119500                                       216   3e-61   
emb|CAH65950.1|  H0716A07.8                                             216   3e-61   Oryza sativa [red rice]
emb|CAG27307.1|  membrane related protein                               215   6e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002317804.2|  hypothetical protein POPTR_0012s02830g             214   8e-61   
gb|KFK33976.1|  hypothetical protein AALP_AA5G086000                    214   1e-60   Arabis alpina [alpine rockcress]
ref|XP_003602373.1|  StAR-related lipid transfer protein                209   1e-60   
ref|XP_011043689.1|  PREDICTED: uncharacterized protein LOC105139...    214   2e-60   Populus euphratica
ref|XP_011043688.1|  PREDICTED: uncharacterized protein LOC105139...    214   2e-60   Populus euphratica
gb|KHG09152.1|  StAR-related lipid transfer 7, mitochondrial            214   5e-60   Gossypium arboreum [tree cotton]
gb|KDO45896.1|  hypothetical protein CISIN_1g013902mg                   212   1e-59   Citrus sinensis [apfelsine]
ref|XP_006376667.1|  hypothetical protein POPTR_0012s02830g             213   2e-59   
gb|AAD28760.1|AF130253_1  membrane related protein CP5                  210   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006489530.1|  PREDICTED: uncharacterized protein LOC102620401    211   2e-59   Citrus sinensis [apfelsine]
gb|AAL57201.1|AF355597_1  putative nodule membrane protein              211   3e-59   Medicago sativa [alfalfa]
ref|XP_003602372.1|  StAR-related lipid transfer protein                211   3e-59   Medicago truncatula
ref|XP_004952047.1|  PREDICTED: uncharacterized protein LOC101765...    210   6e-59   Setaria italica
ref|XP_003526760.1|  PREDICTED: uncharacterized protein LOC100802806    210   7e-59   Glycine max [soybeans]
ref|XP_006420124.1|  hypothetical protein CICLE_v10005003mg             210   8e-59   Citrus clementina [clementine]
ref|XP_006589231.1|  PREDICTED: uncharacterized protein LOC100810331    209   9e-59   Glycine max [soybeans]
ref|XP_009361280.1|  PREDICTED: uncharacterized protein LOC103951585    209   2e-58   Pyrus x bretschneideri [bai li]
ref|XP_003523319.1|  PREDICTED: uncharacterized protein LOC100785446    209   2e-58   Glycine max [soybeans]
ref|XP_012092681.1|  PREDICTED: stAR-related lipid transfer prote...    206   2e-58   Jatropha curcas
gb|KJB12570.1|  hypothetical protein B456_002G024700                    209   2e-58   Gossypium raimondii
ref|XP_002870309.1|  hypothetical protein ARALYDRAFT_493456             208   3e-58   Arabidopsis lyrata subsp. lyrata
ref|XP_011003261.1|  PREDICTED: uncharacterized protein LOC105110...    207   6e-58   Populus euphratica
ref|XP_011003260.1|  PREDICTED: uncharacterized protein LOC105110...    207   8e-58   Populus euphratica
ref|NP_567433.1|  polyketide cyclase/dehydrase and lipid transpor...    207   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_012069777.1|  PREDICTED: uncharacterized protein LOC105632095    206   2e-57   Jatropha curcas
gb|ABK24392.1|  unknown                                                 205   4e-57   Picea sitchensis
ref|XP_006414699.1|  hypothetical protein EUTSA_v10025252mg             205   6e-57   Eutrema salsugineum [saltwater cress]
ref|XP_002977388.1|  hypothetical protein SELMODRAFT_228472             205   6e-57   Selaginella moellendorffii
ref|XP_002974969.1|  hypothetical protein SELMODRAFT_267823             205   6e-57   
ref|XP_008376819.1|  PREDICTED: uncharacterized protein LOC103439947    204   6e-57   Malus domestica [apple tree]
gb|KHN14765.1|  StAR-related lipid transfer protein 7, mitochondrial    203   7e-57   Glycine soja [wild soybean]
ref|XP_002885543.1|  hypothetical protein ARALYDRAFT_319027             204   8e-57   Arabidopsis lyrata subsp. lyrata
ref|XP_007034990.1|  Polyketide cyclase/dehydrase and lipid trans...    205   8e-57   
ref|XP_007034988.1|  Polyketide cyclase/dehydrase and lipid trans...    205   8e-57   
gb|KHN23303.1|  StAR-related lipid transfer protein 7, mitochondrial    204   2e-56   Glycine soja [wild soybean]
gb|KHG25656.1|  StAR-related lipid transfer protein 7, mitochondrial    204   2e-56   Gossypium arboreum [tree cotton]
ref|XP_010087789.1|  hypothetical protein L484_016360                   204   2e-56   Morus notabilis
ref|XP_010650006.1|  PREDICTED: uncharacterized protein LOC100263172    203   3e-56   Vitis vinifera
ref|XP_010440453.1|  PREDICTED: uncharacterized protein LOC104723752    203   3e-56   Camelina sativa [gold-of-pleasure]
gb|EPS63012.1|  hypothetical protein M569_11775                         202   3e-56   Genlisea aurea
gb|KDO52781.1|  hypothetical protein CISIN_1g0167531mg                  199   4e-56   Citrus sinensis [apfelsine]
ref|XP_006283754.1|  hypothetical protein CARUB_v10004845mg             203   4e-56   Capsella rubella
ref|XP_007034987.1|  Polyketide cyclase/dehydrase and lipid trans...    205   5e-56   
ref|XP_006406092.1|  hypothetical protein EUTSA_v10020751mg             202   6e-56   Eutrema salsugineum [saltwater cress]
ref|XP_009107776.1|  PREDICTED: uncharacterized protein LOC103833443    202   7e-56   Brassica rapa
emb|CDY47149.1|  BnaA08g05340D                                          202   8e-56   Brassica napus [oilseed rape]
gb|KJB34524.1|  hypothetical protein B456_006G070300                    202   1e-55   Gossypium raimondii
gb|KHG25655.1|  StAR-related lipid transfer protein 7, mitochondrial    203   1e-55   Gossypium arboreum [tree cotton]
ref|XP_009114221.1|  PREDICTED: uncharacterized protein LOC103839466    200   1e-55   Brassica rapa
ref|XP_010435117.1|  PREDICTED: uncharacterized protein LOC104718985    201   2e-55   Camelina sativa [gold-of-pleasure]
gb|KFK32485.1|  hypothetical protein AALP_AA6G248600                    201   2e-55   Arabis alpina [alpine rockcress]
ref|XP_010466606.1|  PREDICTED: uncharacterized protein LOC104746781    201   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010527394.1|  PREDICTED: uncharacterized protein LOC104804749    201   2e-55   Tarenaya hassleriana [spider flower]
gb|KFK39597.1|  hypothetical protein AALP_AA3G264700                    200   3e-55   Arabis alpina [alpine rockcress]
emb|CDY62128.1|  BnaC08g47370D                                          200   3e-55   Brassica napus [oilseed rape]
emb|CDY16287.1|  BnaC01g23220D                                          200   4e-55   Brassica napus [oilseed rape]
ref|XP_010450029.1|  PREDICTED: uncharacterized protein LOC104732193    200   5e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010274161.1|  PREDICTED: stAR-related lipid transfer prote...    200   6e-55   Nelumbo nucifera [Indian lotus]
ref|XP_006838839.1|  PREDICTED: uncharacterized protein LOC18429490     199   7e-55   Amborella trichopoda
ref|XP_008661910.1|  PREDICTED: CP5 isoform X1                          199   9e-55   Zea mays [maize]
ref|XP_010667651.1|  PREDICTED: uncharacterized protein LOC104884663    199   1e-54   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY04099.1|  BnaA09g18770D                                          197   1e-54   
gb|AAM65221.1|  membrane related protein-like                           199   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009604590.1|  PREDICTED: phosphatidylcholine transfer prot...    195   2e-54   Nicotiana tomentosiformis
ref|XP_009757654.1|  PREDICTED: uncharacterized protein LOC104210451    199   2e-54   Nicotiana sylvestris
ref|XP_007136439.1|  hypothetical protein PHAVU_009G045400g             198   2e-54   Phaseolus vulgaris [French bean]
ref|XP_006280456.1|  hypothetical protein CARUB_v10026389mg             199   2e-54   Capsella rubella
emb|CDY17454.1|  BnaC09g20830D                                          197   2e-54   Brassica napus [oilseed rape]
dbj|BAB11579.1|  membrane related protein-like                          197   3e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006401611.1|  hypothetical protein EUTSA_v10013518mg             198   3e-54   Eutrema salsugineum [saltwater cress]
dbj|BAJ94056.1|  predicted protein                                      198   4e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_568805.1|  lipid-binding START domain-containing protein         198   4e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009627905.1|  PREDICTED: uncharacterized protein LOC104118382    198   5e-54   Nicotiana tomentosiformis
ref|XP_010482825.1|  PREDICTED: uncharacterized protein LOC104761442    197   9e-54   Camelina sativa [gold-of-pleasure]
ref|XP_002866025.1|  hypothetical protein ARALYDRAFT_918536             197   1e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_010442992.1|  PREDICTED: uncharacterized protein LOC104725938    197   1e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010532604.1|  PREDICTED: uncharacterized protein LOC104808596    197   1e-53   Tarenaya hassleriana [spider flower]
ref|XP_009119952.1|  PREDICTED: uncharacterized protein LOC103844879    196   2e-53   Brassica rapa
gb|EMT15608.1|  hypothetical protein F775_30865                         195   2e-53   
ref|XP_008362030.1|  PREDICTED: uncharacterized protein LOC103425717    196   3e-53   
ref|XP_009347795.1|  PREDICTED: stAR-related lipid transfer prote...    195   3e-53   Pyrus x bretschneideri [bai li]
ref|XP_004134093.1|  PREDICTED: uncharacterized protein LOC101216617    195   4e-53   Cucumis sativus [cucumbers]
emb|CDY14327.1|  BnaA10g07280D                                          193   4e-53   Brassica napus [oilseed rape]
ref|XP_009378796.1|  PREDICTED: stAR-related lipid transfer prote...    195   4e-53   Pyrus x bretschneideri [bai li]
ref|NP_001148371.1|  CP5                                                194   4e-53   Zea mays [maize]
ref|XP_002312574.2|  hypothetical protein POPTR_0008s16250g             195   4e-53   
ref|NP_001168384.1|  hypothetical protein                               194   5e-53   Zea mays [maize]
ref|XP_003537648.1|  PREDICTED: stAR-related lipid transfer prote...    194   5e-53   Glycine max [soybeans]
gb|AAL07016.1|  unknown protein                                         194   5e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566722.1|  polyketide cyclase/dehydrase and lipid transpor...    194   6e-53   Arabidopsis thaliana [mouse-ear cress]
gb|ACG40939.1|  CP5                                                     194   7e-53   Zea mays [maize]
ref|XP_004241025.1|  PREDICTED: uncharacterized protein LOC101253385    194   8e-53   Solanum lycopersicum
ref|XP_009132450.1|  PREDICTED: uncharacterized protein LOC103857054    194   9e-53   Brassica rapa
ref|XP_003517561.1|  PREDICTED: stAR-related lipid transfer prote...    193   2e-52   Glycine max [soybeans]
ref|XP_008438574.1|  PREDICTED: uncharacterized protein LOC103483641    193   2e-52   Cucumis melo [Oriental melon]
ref|XP_010233743.1|  PREDICTED: uncharacterized protein LOC100824806    192   2e-52   Brachypodium distachyon [annual false brome]
ref|XP_010527384.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    193   2e-52   
gb|EEC81632.1|  hypothetical protein OsI_25162                          192   4e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_007222114.1|  hypothetical protein PRUPE_ppa005679mg             192   5e-52   Prunus persica
ref|XP_006350666.1|  PREDICTED: uncharacterized protein LOC102588037    192   8e-52   Solanum tuberosum [potatoes]
ref|XP_009108270.1|  PREDICTED: uncharacterized protein LOC103833...    191   9e-52   Brassica rapa
ref|XP_002517011.1|  phosphatidylcholine transfer protein, putative     191   1e-51   Ricinus communis
emb|CDY00704.1|  BnaC03g36880D                                          191   2e-51   
gb|AFK33815.1|  unknown                                                 188   2e-51   Lotus japonicus
ref|XP_004502755.1|  PREDICTED: uncharacterized protein LOC101512743    190   2e-51   Cicer arietinum [garbanzo]
ref|XP_002314649.1|  hypothetical protein POPTR_0010s08690g             190   2e-51   
emb|CDY63033.1|  BnaCnng41290D                                          190   3e-51   Brassica napus [oilseed rape]
ref|XP_003557464.1|  PREDICTED: uncharacterized protein LOC100828...    190   4e-51   Brachypodium distachyon [annual false brome]
ref|XP_011030550.1|  PREDICTED: stAR-related lipid transfer prote...    189   5e-51   Populus euphratica
ref|XP_010228266.1|  PREDICTED: uncharacterized protein LOC100828...    189   5e-51   Brachypodium distachyon [annual false brome]
ref|XP_002447442.1|  hypothetical protein SORBIDRAFT_06g001130          189   5e-51   Sorghum bicolor [broomcorn]
ref|NP_001154233.1|  polyketide cyclase/dehydrase and lipid trans...    185   6e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007157092.1|  hypothetical protein PHAVU_002G042100g             189   6e-51   Phaseolus vulgaris [French bean]
gb|KFK27030.1|  hypothetical protein AALP_AA8G325000                    189   7e-51   Arabis alpina [alpine rockcress]
emb|CDY35496.1|  BnaA01g24160D                                          189   7e-51   Brassica napus [oilseed rape]
ref|XP_010278112.1|  PREDICTED: stAR-related lipid transfer prote...    188   1e-50   Nelumbo nucifera [Indian lotus]
ref|XP_009108264.1|  PREDICTED: uncharacterized protein LOC103833...    188   1e-50   Brassica rapa
tpg|DAA36544.1|  TPA: hypothetical protein ZEAMMB73_493286              183   2e-50   
ref|XP_010936383.1|  PREDICTED: uncharacterized protein LOC105056016    187   4e-50   Elaeis guineensis
ref|XP_011029867.1|  PREDICTED: stAR-related lipid transfer prote...    187   5e-50   Populus euphratica
emb|CDY43837.1|  BnaC03g14700D                                          194   5e-50   Brassica napus [oilseed rape]
gb|KCW60440.1|  hypothetical protein EUGRSUZ_H03157                     186   1e-49   Eucalyptus grandis [rose gum]
ref|XP_006297728.1|  hypothetical protein CARUB_v10013761mg             185   1e-49   Capsella rubella
ref|XP_004289478.1|  PREDICTED: uncharacterized protein LOC101293443    186   2e-49   Fragaria vesca subsp. vesca
ref|XP_007157091.1|  hypothetical protein PHAVU_002G042100g             184   4e-49   Phaseolus vulgaris [French bean]
ref|NP_001142403.1|  hypothetical protein                               184   4e-49   Zea mays [maize]
ref|XP_003580301.1|  PREDICTED: uncharacterized protein LOC100841092    183   5e-49   Brachypodium distachyon [annual false brome]
ref|XP_004977725.1|  PREDICTED: uncharacterized protein LOC101783053    188   8e-49   
ref|XP_001785300.1|  predicted protein                                  182   1e-48   
ref|XP_011073492.1|  PREDICTED: uncharacterized protein LOC105158432    183   1e-48   
ref|XP_004955685.1|  PREDICTED: uncharacterized protein LOC101781535    182   1e-48   Setaria italica
ref|XP_010923463.1|  PREDICTED: uncharacterized protein LOC105046548    182   1e-48   Elaeis guineensis
ref|XP_008805969.1|  PREDICTED: uncharacterized protein LOC103718779    181   5e-48   Phoenix dactylifera
dbj|BAJ95846.1|  predicted protein                                      180   9e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBI26372.3|  unnamed protein product                                179   2e-47   Vitis vinifera
ref|XP_009409211.1|  PREDICTED: uncharacterized protein LOC103991461    180   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK35199.1|  unknown                                                 179   3e-47   Medicago truncatula
gb|AFW66618.1|  hypothetical protein ZEAMMB73_358635                    174   3e-47   
ref|XP_003610788.1|  Membrane related protein-like protein              179   3e-47   Medicago truncatula
gb|AFK44283.1|  unknown                                                 179   3e-47   Medicago truncatula
emb|CDO99168.1|  unnamed protein product                                179   3e-47   Coffea canephora [robusta coffee]
gb|EMS48425.1|  hypothetical protein TRIUR3_01630                       176   5e-47   Triticum urartu
ref|XP_006658340.1|  PREDICTED: uncharacterized protein LOC102707324    177   1e-46   
ref|XP_009408481.1|  PREDICTED: uncharacterized protein LOC103990913    177   1e-46   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ97056.1|  predicted protein                                      177   2e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001142221.1|  hypothetical protein                               176   2e-46   Zea mays [maize]
gb|AFW66620.1|  hypothetical protein ZEAMMB73_358635                    176   2e-46   
ref|XP_006648262.1|  PREDICTED: uncharacterized protein LOC102714348    174   2e-46   
gb|AGV54490.1|  StAR-related lipid transfer protein                     176   2e-46   Phaseolus vulgaris [French bean]
ref|XP_009145238.1|  PREDICTED: uncharacterized protein LOC103868940    175   5e-46   Brassica rapa
gb|EMS50172.1|  hypothetical protein TRIUR3_23911                       173   5e-46   Triticum urartu
ref|XP_002453232.1|  hypothetical protein SORBIDRAFT_04g002070          175   6e-46   Sorghum bicolor [broomcorn]
ref|XP_002461562.1|  hypothetical protein SORBIDRAFT_02g004760          175   1e-45   Sorghum bicolor [broomcorn]
ref|XP_008676876.1|  PREDICTED: hypothetical protein isoform X1         176   2e-45   
ref|XP_004952046.1|  PREDICTED: uncharacterized protein LOC101765...    176   2e-45   
emb|CAB10229.1|  hypothetical protein                                   174   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004511397.1|  PREDICTED: stAR-related lipid transfer prote...    174   2e-45   Cicer arietinum [garbanzo]
gb|EPS72938.1|  hypothetical protein M569_01819                         174   3e-45   Genlisea aurea
ref|XP_008786107.1|  PREDICTED: uncharacterized protein LOC103704...    173   4e-45   Phoenix dactylifera
ref|XP_008786105.1|  PREDICTED: uncharacterized protein LOC103704...    173   6e-45   Phoenix dactylifera
gb|EEC72388.1|  hypothetical protein OsI_05667                          172   7e-45   Oryza sativa Indica Group [Indian rice]
dbj|BAD07966.1|  putative membrane related protein CP5                  172   8e-45   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001030744.1|  polyketide cyclase/dehydrase and lipid trans...    170   2e-44   Arabidopsis thaliana [mouse-ear cress]
gb|AFW59258.1|  hypothetical protein ZEAMMB73_830121                    169   3e-44   
gb|AFW57829.1|  hypothetical protein ZEAMMB73_202405                    165   3e-44   
dbj|BAC83004.1|  putative membrane related protein CP5                  168   1e-43   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059064.1|  Os07g0185200                                       168   2e-43   
ref|NP_001183196.1|  hypothetical protein                               168   2e-43   Zea mays [maize]
emb|CDY29739.1|  BnaA01g19270D                                          166   4e-43   Brassica napus [oilseed rape]
ref|XP_009622047.1|  PREDICTED: uncharacterized protein LOC104113550    166   5e-43   
gb|EYU32520.1|  hypothetical protein MIMGU_mgv1a005704mg                168   5e-43   Erythranthe guttata [common monkey flower]
ref|XP_001776276.1|  predicted protein                                  167   8e-43   
ref|XP_009148805.1|  PREDICTED: uncharacterized protein LOC103872218    167   2e-42   
ref|XP_008224419.1|  PREDICTED: uncharacterized protein LOC103324159    165   4e-42   Prunus mume [ume]
gb|KGN56908.1|  hypothetical protein Csa_3G143000                       164   7e-42   Cucumis sativus [cucumbers]
emb|CDY10698.1|  BnaA05g16640D                                          161   1e-41   Brassica napus [oilseed rape]
gb|AFW69926.1|  hypothetical protein ZEAMMB73_637092                    163   2e-41   
ref|XP_008680976.1|  PREDICTED: uncharacterized protein LOC100191...    164   2e-41   
gb|KHN35161.1|  StAR-related lipid transfer protein 7, mitochondrial    161   2e-41   Glycine soja [wild soybean]
ref|XP_004298241.1|  PREDICTED: stAR-related lipid transfer prote...    158   3e-40   Fragaria vesca subsp. vesca
gb|EMT19449.1|  hypothetical protein F775_07112                         156   2e-38   
ref|XP_007224298.1|  hypothetical protein PRUPE_ppa019593mg             151   8e-38   
gb|KEH27365.1|  mammalian STARD2 lipid-binding START domain protein     146   3e-36   Medicago truncatula
ref|XP_008390266.1|  PREDICTED: uncharacterized protein LOC103452546    143   9e-35   Malus domestica [apple tree]
gb|KCW52276.1|  hypothetical protein EUGRSUZ_J01696                     142   1e-34   Eucalyptus grandis [rose gum]
ref|XP_009353537.1|  PREDICTED: phosphatidylcholine transfer prot...    139   2e-33   
emb|CDY10351.1|  BnaC05g29280D                                          139   2e-33   
ref|XP_010032787.1|  PREDICTED: uncharacterized protein LOC104422...    140   2e-33   
ref|XP_010032788.1|  PREDICTED: uncharacterized protein LOC104422...    140   2e-33   
tpg|DAA36543.1|  TPA: hypothetical protein ZEAMMB73_493286              135   9e-33   
emb|CDY71555.1|  BnaAnng37890D                                          128   3e-30   
ref|XP_008367202.1|  PREDICTED: phosphatidylcholine transfer prot...    126   3e-29   
ref|XP_011462851.1|  PREDICTED: uncharacterized protein LOC101313...    124   5e-29   
ref|XP_008351115.1|  PREDICTED: uncharacterized protein LOC103414519    121   2e-28   
ref|XP_006844764.2|  PREDICTED: uncharacterized protein LOC18434637     122   5e-27   
ref|XP_002453233.1|  hypothetical protein SORBIDRAFT_04g002075          112   6e-26   
gb|EEE66698.1|  hypothetical protein OsJ_23361                          116   1e-25   
ref|XP_010430621.1|  PREDICTED: phosphatidylcholine transfer protein    107   4e-23   
ref|XP_008351117.1|  PREDICTED: uncharacterized protein LOC103414521    106   7e-23   
gb|ERN07498.1|  hypothetical protein AMTR_s00413p00010550               104   3e-22   
ref|XP_010038378.1|  PREDICTED: uncharacterized protein LOC104426900  92.0    4e-18   
ref|XP_010462468.1|  PREDICTED: uncharacterized protein LOC104743041  88.2    1e-15   
ref|XP_010481201.1|  PREDICTED: uncharacterized protein LOC104760048  87.8    1e-15   
ref|XP_010501231.1|  PREDICTED: uncharacterized protein LOC104778...  87.8    2e-15   
ref|XP_005649218.1|  Bet v1-like protein                              87.0    3e-15   
ref|XP_001783843.1|  predicted protein                                84.7    1e-14   
ref|XP_006392581.1|  hypothetical protein EUTSA_v10011546mg           85.5    1e-14   
ref|XP_010501230.1|  PREDICTED: uncharacterized protein LOC104778...  85.1    1e-14   
ref|XP_006392582.1|  hypothetical protein EUTSA_v10011546mg           85.1    1e-14   
ref|XP_002894547.1|  hypothetical protein ARALYDRAFT_314809           84.7    2e-14   
ref|XP_001703451.1|  lipid-binding START protein                      85.1    2e-14   
ref|XP_010696139.1|  PREDICTED: uncharacterized protein LOC104908693  83.6    6e-14   
ref|XP_010449744.1|  PREDICTED: uncharacterized protein LOC104731...  83.2    6e-14   
ref|XP_009124707.1|  PREDICTED: phosphatidylcholine transfer protein  83.2    7e-14   
ref|NP_001276256.1|  uncharacterized protein LOC102659764             82.8    8e-14   
ref|XP_010449745.1|  PREDICTED: phosphatidylcholine transfer prot...  81.6    8e-14   
gb|KFK38640.1|  hypothetical protein AALP_AA3G141200                  82.8    8e-14   
ref|XP_006582972.1|  PREDICTED: uncharacterized protein LOC102659...  82.8    8e-14   
ref|XP_006305042.1|  hypothetical protein CARUB_v10009408mg           82.4    1e-13   
emb|CDY52914.1|  BnaA06g00040D                                        82.4    1e-13   
ref|XP_009147459.1|  PREDICTED: uncharacterized protein LOC103871005  82.4    1e-13   
ref|XP_009381603.1|  PREDICTED: stAR-related lipid transfer prote...  82.4    1e-13   
gb|AFW71430.1|  hypothetical protein ZEAMMB73_880965                  79.7    1e-13   
gb|KHN38110.1|  StAR-related lipid transfer protein 7, mitochondrial  82.0    2e-13   
ref|XP_008228024.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  82.0    2e-13   
gb|KDP25029.1|  hypothetical protein JCGZ_22564                       82.0    2e-13   
ref|XP_012087290.1|  PREDICTED: uncharacterized protein LOC105646119  82.0    2e-13   
ref|XP_008643790.1|  PREDICTED: membrane related protein-like iso...  81.6    2e-13   
ref|XP_010542534.1|  PREDICTED: uncharacterized protein LOC104815704  82.0    2e-13   
ref|XP_011467513.1|  PREDICTED: uncharacterized protein LOC105352336  82.0    2e-13   
ref|NP_001151176.1|  membrane related protein-like                    81.6    2e-13   
ref|XP_007217244.1|  hypothetical protein PRUPE_ppa006681mg           81.6    2e-13   
ref|XP_006585684.1|  PREDICTED: uncharacterized protein LOC102661161  81.3    2e-13   
ref|XP_004488912.1|  PREDICTED: phosphatidylcholine transfer prot...  80.5    2e-13   
ref|XP_002452046.1|  hypothetical protein SORBIDRAFT_04g017500        81.6    2e-13   
ref|XP_004488911.1|  PREDICTED: phosphatidylcholine transfer prot...  81.3    3e-13   
ref|XP_002962282.1|  hypothetical protein SELMODRAFT_270291           81.3    3e-13   
emb|CDY43377.1|  BnaA01g30080D                                        81.6    3e-13   
ref|XP_010465108.1|  PREDICTED: uncharacterized protein LOC104745540  81.6    3e-13   
ref|XP_002965197.1|  hypothetical protein SELMODRAFT_167248           80.9    4e-13   
ref|XP_007135874.1|  hypothetical protein PHAVU_010G165300g           80.9    4e-13   
ref|XP_010252178.1|  PREDICTED: uncharacterized protein LOC104593...  80.5    4e-13   
ref|XP_010252177.1|  PREDICTED: uncharacterized protein LOC104593...  80.9    4e-13   
ref|XP_010552381.1|  PREDICTED: uncharacterized protein LOC104822743  80.9    4e-13   
dbj|BAB01397.1|  protein kinase-like protein                          81.6    6e-13   
ref|XP_002882805.1|  predicted protein                                81.3    6e-13   
ref|XP_010247187.1|  PREDICTED: uncharacterized protein LOC104590...  79.7    8e-13   
ref|XP_010499909.1|  PREDICTED: stAR-related lipid transfer prote...  79.7    9e-13   
ref|XP_010247186.1|  PREDICTED: uncharacterized protein LOC104590...  79.7    9e-13   
ref|XP_002508562.1|  predicted protein                                80.1    9e-13   
emb|CDY24223.1|  BnaC01g38030D                                        79.7    1e-12   
ref|XP_010499897.1|  PREDICTED: stAR-related lipid transfer prote...  79.7    1e-12   
ref|XP_010499904.1|  PREDICTED: stAR-related lipid transfer prote...  79.7    1e-12   
ref|NP_566443.1|  polyketide cyclase/dehydrase and lipid transpor...  79.3    1e-12   
ref|NP_850573.1|  polyketide cyclase/dehydrase and lipid transpor...  79.7    1e-12   
dbj|BAC43323.1|  unknown protein                                      79.3    1e-12   
ref|XP_009344019.1|  PREDICTED: uncharacterized protein LOC103935922  79.3    1e-12   
gb|ACM45607.1|  truncated At3g13062                                   77.0    1e-12   
ref|XP_006425180.1|  hypothetical protein CICLE_v10028538mg           79.3    1e-12   
ref|XP_006425181.1|  hypothetical protein CICLE_v10028538mg           79.3    2e-12   
gb|KDO67051.1|  hypothetical protein CISIN_1g015638mg                 79.0    2e-12   
ref|XP_006488604.1|  PREDICTED: uncharacterized protein LOC102619344  79.0    2e-12   
ref|XP_009395876.1|  PREDICTED: uncharacterized protein LOC103981028  78.6    2e-12   
emb|CBI18373.3|  unnamed protein product                              77.8    2e-12   
ref|XP_006407266.1|  hypothetical protein EUTSA_v10020844mg           78.6    3e-12   
ref|XP_008391055.1|  PREDICTED: uncharacterized protein LOC103453293  75.9    3e-12   
ref|XP_009135281.1|  PREDICTED: uncharacterized protein LOC103859496  78.2    3e-12   
ref|NP_001046822.1|  Os02g0468400                                     78.2    3e-12   
gb|EEC73136.1|  hypothetical protein OsI_07158                        78.2    3e-12   
ref|XP_010655237.1|  PREDICTED: stAR-related lipid transfer prote...  77.8    3e-12   
ref|NP_564705.1|  putative polyketide cyclase/dehydrase and lipid...  77.8    4e-12   
gb|KIZ04898.1|  hypothetical protein MNEG_3055                        76.6    4e-12   
gb|AHZ34664.1|  responsive START protein                              77.8    4e-12   
gb|AAF79332.1|AC002304_25  F14J16.24                                  77.8    4e-12   
gb|KFK35546.1|  hypothetical protein AALP_AA4G004800                  77.4    5e-12   
ref|XP_006297836.1|  hypothetical protein CARUB_v10013871mg           77.4    5e-12   
dbj|BAK05713.1|  predicted protein                                    77.4    6e-12   
emb|CDY72524.1|  BnaCnng78120D                                        74.3    8e-12   
emb|CDX82559.1|  BnaA03g32620D                                        76.6    8e-12   
gb|KJB56463.1|  hypothetical protein B456_009G120600                  76.6    9e-12   
ref|XP_008380443.1|  PREDICTED: uncharacterized protein LOC103443388  76.6    9e-12   
ref|XP_011395720.1|  Homeobox protein unc-4-like protein              77.8    1e-11   
ref|XP_009346022.1|  PREDICTED: uncharacterized protein LOC103937788  76.3    1e-11   
ref|XP_008461544.1|  PREDICTED: phosphatidylcholine transfer prot...  75.5    1e-11   
ref|XP_004952467.1|  PREDICTED: uncharacterized protein LOC101774356  76.3    1e-11   
gb|KHG09079.1|  StAR-related lipid transfer 7, mitochondrial          75.9    1e-11   
emb|CDY69376.1|  BnaCnng63240D                                        75.9    1e-11   
ref|XP_008461543.1|  PREDICTED: phosphatidylcholine transfer prot...  75.5    2e-11   
ref|XP_010087070.1|  hypothetical protein L484_010442                 75.9    2e-11   
ref|XP_010487050.1|  PREDICTED: stAR-related lipid transfer prote...  75.5    3e-11   
ref|XP_002513295.1|  phosphatidylcholine transfer protein, putative   75.1    3e-11   
ref|XP_010487051.1|  PREDICTED: stAR-related lipid transfer prote...  75.5    3e-11   
ref|XP_003064175.1|  predicted protein                                75.1    3e-11   
emb|CDY51901.1|  BnaC03g73640D                                        75.1    3e-11   
ref|XP_006850998.1|  PREDICTED: uncharacterized protein LOC18440797   74.7    3e-11   
ref|XP_010927159.1|  PREDICTED: uncharacterized protein LOC105049...  74.7    5e-11   
ref|XP_010927160.1|  PREDICTED: uncharacterized protein LOC105049...  74.3    5e-11   
ref|XP_011651346.1|  PREDICTED: phosphatidylcholine transfer prot...  73.2    6e-11   
ref|NP_850574.1|  polyketide cyclase/dehydrase and lipid transpor...  74.3    6e-11   
ref|XP_006342844.1|  PREDICTED: uncharacterized protein LOC102599...  74.3    6e-11   
ref|XP_009410229.1|  PREDICTED: uncharacterized protein LOC103992307  73.9    6e-11   
ref|XP_011072791.1|  PREDICTED: uncharacterized protein LOC105157944  73.9    6e-11   
ref|XP_004488913.1|  PREDICTED: phosphatidylcholine transfer prot...  72.8    7e-11   
ref|XP_003604117.1|  StAR-related lipid transfer protein              71.6    7e-11   
ref|XP_004145626.1|  PREDICTED: uncharacterized protein LOC101203...  73.9    7e-11   
ref|XP_008809077.1|  PREDICTED: uncharacterized protein LOC103720895  73.9    8e-11   
ref|XP_006342845.1|  PREDICTED: uncharacterized protein LOC102599...  73.6    9e-11   
ref|XP_002948648.1|  hypothetical protein VOLCADRAFT_116919           74.3    1e-10   
gb|EMT21662.1|  hypothetical protein F775_28432                       73.2    1e-10   
ref|XP_003604116.1|  StAR-related lipid transfer protein              72.4    2e-10   
ref|XP_009592651.1|  PREDICTED: uncharacterized protein LOC104089...  72.4    2e-10   
emb|CDO97728.1|  unnamed protein product                              70.1    3e-10   
ref|XP_001421847.1|  predicted protein                                72.4    3e-10   
ref|XP_009592652.1|  PREDICTED: phosphatidylcholine transfer prot...  71.6    3e-10   
ref|XP_011031252.1|  PREDICTED: uncharacterized protein LOC105130441  72.0    3e-10   
ref|XP_002310347.2|  hypothetical protein POPTR_0007s15160g           72.0    3e-10   
ref|XP_006374733.1|  hypothetical protein POPTR_0014s00330g           72.0    3e-10   
ref|XP_011011654.1|  PREDICTED: uncharacterized protein LOC105116...  72.0    3e-10   
ref|XP_011012290.1|  PREDICTED: uncharacterized protein LOC105116568  72.0    3e-10   
ref|XP_011011655.1|  PREDICTED: uncharacterized protein LOC105116...  71.6    3e-10   
ref|XP_003083840.1|  putative membrane related protein CP5 (ISS)      72.0    4e-10   
ref|XP_004235496.1|  PREDICTED: uncharacterized protein LOC101261699  71.6    5e-10   
ref|XP_009793255.1|  PREDICTED: uncharacterized protein LOC104240...  69.3    2e-09   
ref|XP_007512533.1|  predicted protein                                69.3    3e-09   
ref|XP_009793256.1|  PREDICTED: phosphatidylcholine transfer prot...  68.2    3e-09   
ref|XP_010063695.1|  PREDICTED: phosphatidylcholine transfer prot...  68.6    4e-09   
gb|KJB29809.1|  hypothetical protein B456_005G119500                  68.2    5e-09   
ref|XP_007023603.1|  Polyketide cyclase/dehydrase and lipid trans...  67.8    7e-09   
gb|EEE56964.1|  hypothetical protein OsJ_06676                        65.5    2e-08   
ref|XP_009680780.1|  PREDICTED: stAR-related lipid transfer prote...  64.7    3e-08   
gb|KFV85198.1|  hypothetical protein N308_16028                       64.3    3e-08   
ref|XP_008362454.1|  PREDICTED: uncharacterized protein LOC103426141  62.4    6e-08   
emb|CAF99310.1|  unnamed protein product                              64.3    8e-08   
emb|CAN60973.1|  hypothetical protein VITISV_032052                   64.3    8e-08   
gb|EMS46887.1|  hypothetical protein TRIUR3_11092                     64.3    9e-08   
ref|XP_010655238.1|  PREDICTED: uncharacterized protein LOC104880...  63.5    1e-07   
ref|XP_006342846.1|  PREDICTED: uncharacterized protein LOC102599...  63.5    1e-07   
ref|XP_008461545.1|  PREDICTED: phosphatidylcholine transfer prot...  62.8    1e-07   
ref|XP_004369404.1|  PREDICTED: stAR-related lipid transfer prote...  62.8    2e-07   
ref|XP_011603272.1|  PREDICTED: stAR-related lipid transfer prote...  62.8    3e-07   
gb|EYU21188.1|  hypothetical protein MIMGU_mgv1a007377mg              62.4    4e-07   
ref|NP_001279406.1|  StAR-related lipid transfer (START) domain c...  62.4    4e-07   
ref|XP_009098211.1|  PREDICTED: stAR-related lipid transfer prote...  62.4    4e-07   
ref|XP_009942234.1|  PREDICTED: stAR-related lipid transfer prote...  60.1    4e-07   
ref|XP_005647499.1|  hypothetical protein COCSUDRAFT_47454            62.4    5e-07   
ref|XP_010164877.1|  PREDICTED: stAR-related lipid transfer prote...  59.3    5e-07   
gb|KDD74525.1|  hypothetical protein H632_c1254p0                     62.0    6e-07   
ref|XP_009958386.1|  PREDICTED: stAR-related lipid transfer prote...  59.3    6e-07   
ref|XP_008760378.1|  PREDICTED: stAR-related lipid transfer prote...  61.2    7e-07   
ref|XP_010190001.1|  PREDICTED: stAR-related lipid transfer prote...  58.9    7e-07   
ref|XP_005068525.1|  PREDICTED: stAR-related lipid transfer prote...  61.2    7e-07   
gb|AAH80747.1|  START domain containing 7                             60.5    9e-07   
dbj|BAE25505.1|  unnamed protein product                              60.5    9e-07   
ref|XP_005140012.1|  PREDICTED: stAR-related lipid transfer prote...  58.5    1e-06   
ref|XP_006035598.1|  PREDICTED: stAR-related lipid transfer prote...  60.1    1e-06   
ref|XP_007118537.1|  PREDICTED: stAR-related lipid transfer prote...  60.5    1e-06   
ref|XP_006234979.1|  PREDICTED: stAR-related lipid transfer prote...  60.8    1e-06   
gb|KGL74929.1|  hypothetical protein N309_00285                       58.9    1e-06   
ref|XP_007197412.1|  PREDICTED: stAR-related lipid transfer prote...  60.5    1e-06   
ref|NP_647469.2|  stAR-related lipid transfer protein 7, mitochon...  60.8    1e-06   
ref|XP_003230027.1|  PREDICTED: stAR-related lipid transfer prote...  60.8    1e-06   
ref|XP_004277838.1|  PREDICTED: stAR-related lipid transfer prote...  60.8    1e-06   
gb|EDL28185.1|  START domain containing 7, isoform CRA_b              60.8    1e-06   
ref|XP_004590899.1|  PREDICTED: stAR-related lipid transfer prote...  60.5    1e-06   
ref|XP_005364488.1|  PREDICTED: stAR-related lipid transfer prote...  60.5    1e-06   
gb|ERE69891.1|  stAR-related lipid transfer protein 7                 60.1    1e-06   
ref|XP_009283125.1|  PREDICTED: stAR-related lipid transfer prote...  58.2    1e-06   
ref|XP_005020654.1|  PREDICTED: stAR-related lipid transfer prote...  59.7    1e-06   
ref|XP_010561147.1|  PREDICTED: stAR-related lipid transfer prote...  58.5    1e-06   
tpg|DAA24920.1|  TPA: START domain containing 7                       59.3    1e-06   
ref|XP_004651731.1|  PREDICTED: stAR-related lipid transfer prote...  60.5    1e-06   
ref|XP_006113852.1|  PREDICTED: stAR-related lipid transfer prote...  59.7    1e-06   
ref|XP_005891667.1|  PREDICTED: stAR-related lipid transfer prote...  59.3    2e-06   
ref|XP_007616316.1|  PREDICTED: stAR-related lipid transfer prote...  59.7    2e-06   
ref|XP_010599658.1|  PREDICTED: stAR-related lipid transfer prote...  60.1    2e-06   
ref|XP_006788862.1|  PREDICTED: stAR-related lipid transfer prote...  60.1    2e-06   
ref|XP_005934652.1|  PREDICTED: stAR-related lipid transfer prote...  60.1    2e-06   
gb|ERE69889.1|  stAR-related lipid transfer protein 7                 60.5    2e-06   
gb|ELR59337.1|  StAR-related lipid transfer protein 7, mitochondrial  59.3    2e-06   
ref|XP_005735354.1|  PREDICTED: stAR-related lipid transfer prote...  60.1    2e-06   
ref|XP_009490551.1|  PREDICTED: stAR-related lipid transfer prote...  58.2    2e-06   
ref|XP_010021144.1|  PREDICTED: stAR-related lipid transfer prote...  57.8    2e-06   
ref|XP_004538247.1|  PREDICTED: stAR-related lipid transfer prote...  60.1    2e-06   
ref|XP_007638034.1|  PREDICTED: stAR-related lipid transfer prote...  59.7    2e-06   
ref|XP_009585367.1|  PREDICTED: stAR-related lipid transfer prote...  58.2    2e-06   
ref|XP_010209571.1|  PREDICTED: stAR-related lipid transfer prote...  59.3    2e-06   
ref|XP_009814744.1|  PREDICTED: stAR-related lipid transfer prote...  58.2    2e-06   
ref|XP_007070815.1|  PREDICTED: stAR-related lipid transfer prote...  58.9    2e-06   
ref|XP_002757415.1|  PREDICTED: stAR-related lipid transfer prote...  60.1    2e-06   
gb|KFQ80931.1|  hypothetical protein N335_05857                       58.2    2e-06   
gb|KFO27350.1|  StAR-related lipid transfer protein 7, mitochondrial  59.3    2e-06   
ref|XP_006986520.1|  PREDICTED: stAR-related lipid transfer prote...  59.7    2e-06   
gb|KFV57290.1|  hypothetical protein N328_03915                       58.2    2e-06   
gb|KFO82607.1|  hypothetical protein N303_12493                       58.9    2e-06   
gb|EMP25438.1|  StAR-related lipid transfer protein 7                 58.9    2e-06   
gb|EOB00572.1|  StAR-related lipid transfer protein 7                 57.8    2e-06   
gb|KFV98487.1|  hypothetical protein N327_03844                       57.8    2e-06   
ref|XP_009567988.1|  PREDICTED: stAR-related lipid transfer prote...  59.3    2e-06   
ref|XP_006258627.1|  PREDICTED: stAR-related lipid transfer prote...  59.3    3e-06   
ref|XP_010636497.1|  PREDICTED: stAR-related lipid transfer prote...  59.3    3e-06   
ref|XP_007430456.1|  PREDICTED: stAR-related lipid transfer prote...  59.7    3e-06   
ref|XP_011573559.1|  PREDICTED: stAR-related lipid transfer prote...  58.5    3e-06   
ref|XP_009911920.1|  PREDICTED: stAR-related lipid transfer prote...  58.5    3e-06   
ref|XP_010827884.1|  PREDICTED: stAR-related lipid transfer prote...  59.3    3e-06   
ref|XP_009068041.1|  PREDICTED: stAR-related lipid transfer prote...  57.4    3e-06   
ref|XP_008836358.1|  PREDICTED: stAR-related lipid transfer prote...  59.3    3e-06   



>ref|XP_009589163.1| PREDICTED: uncharacterized protein LOC104086569 [Nicotiana tomentosiformis]
Length=419

 Score =   306 bits (784),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 159/237 (67%), Positives = 184/237 (78%), Gaps = 5/237 (2%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             MALV+ALLEI +RPS G+V+LEL++F  PIW+AVV+GVLVGWAWKP+WA +     S  S
Sbjct  1     MALVAALLEILERPSFGEVLLELVMFMGPIWIAVVVGVLVGWAWKPKWAKVGPDDVSASS  60

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIPKC-FSWIseetsssltpnsssplQENDKSR-V  968
                  +G+ LQ + SGF+S+  LK Q+P C   WI E  S      SS    E +  + V
Sbjct  61    SS---SGMLLQNLSSGFASLNTLKFQLPTCNIPWIKETQSPPTVSCSSFSSSELEGEKSV  117

Query  969   VDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATP  1148
             V E DL +L  LVEE + GPAWIQMMDRSA+NMSYQAWRRDPETGPPQYRSRT+YEDATP
Sbjct  118   VTEADLLYLDGLVEESNGGPAWIQMMDRSASNMSYQAWRRDPETGPPQYRSRTIYEDATP  177

Query  1149  EMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             EMVRDFFWDDEFR KWDDMLIHAETLE+ P+TGTM+VQWVRKFPFFCSDREYIIGRR
Sbjct  178   EMVRDFFWDDEFRLKWDDMLIHAETLEECPNTGTMMVQWVRKFPFFCSDREYIIGRR  234



>ref|XP_011081359.1| PREDICTED: uncharacterized protein LOC105164409 [Sesamum indicum]
Length=430

 Score =   301 bits (772),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 186/245 (76%), Gaps = 10/245 (4%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAs---rds  785
             MAL SA LEI QRP+I DV+ ELMVF  PIW+AVV+GVLVGWAWKP+WANL        +
Sbjct  1     MALGSAFLEILQRPTIWDVLFELMVFMAPIWIAVVVGVLVGWAWKPKWANLNVEFLDSTA  60

Query  786   fdsfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIs-------eetsssltpnssspl  944
                  ++ + + L Q  +   S+ +LKLQ+P C SWIS           S  +P+ SS  
Sbjct  61    KGGESNNKSRMVLPQFSASMPSLSSLKLQVPTCISWISDGFEKDNSSLPSISSPDYSSSK  120

Query  945   QENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSR  1124
              EN+KS +V+E+DL HL++LVEEKD GPAWIQMMDRS  NMSYQAWRRDPETGPPQYRSR
Sbjct  121   SENEKSSLVNEDDLRHLHRLVEEKDGGPAWIQMMDRSIPNMSYQAWRRDPETGPPQYRSR  180

Query  1125  TVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREY  1304
             TVYEDA PEM+RDFFWDDEFR KWDDMLIHAETL+D  +TGTMVV WVRKFPFFCSDREY
Sbjct  181   TVYEDANPEMLRDFFWDDEFRLKWDDMLIHAETLDDCSTTGTMVVHWVRKFPFFCSDREY  240

Query  1305  IIGRR  1319
             IIGRR
Sbjct  241   IIGRR  245



>ref|XP_006343761.1| PREDICTED: uncharacterized protein LOC102582708 [Solanum tuberosum]
Length=409

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 158/236 (67%), Positives = 179/236 (76%), Gaps = 13/236 (6%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             M LV+ALLEI QRP+ G+VILEL +F  PIW+AV++GVLVGW+WKP+WANL         
Sbjct  1     MGLVAALLEILQRPTFGEVILELGMFMAPIWIAVLVGVLVGWSWKPKWANLAIDSVPTTH  60

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssp-lQENDKSRVV  971
               +      LQ +  GFS+   LKLQ+P   SWI E  S     +S+S  LQ   K  VV
Sbjct  61    VPA------LQNLSFGFST---LKLQVP---SWIKETHSPPSISSSTSSSLQLEAKKSVV  108

Query  972   DENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPE  1151
              + DL +L  LVEE+D GPAWIQMMDRS  NMSYQAWRRDPETGPPQYRSRTVYEDATPE
Sbjct  109   TDADLCYLDGLVEEQDGGPAWIQMMDRSTPNMSYQAWRRDPETGPPQYRSRTVYEDATPE  168

Query  1152  MVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             M+RDFFWDDEFR KWDDMLIHAETLE+ P+TGTMVVQWVRKFPFFCSDREYIIGRR
Sbjct  169   MLRDFFWDDEFRLKWDDMLIHAETLEECPTTGTMVVQWVRKFPFFCSDREYIIGRR  224



>ref|XP_004245442.1| PREDICTED: uncharacterized protein LOC101259469 [Solanum lycopersicum]
Length=409

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 157/236 (67%), Positives = 178/236 (75%), Gaps = 13/236 (6%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             M LV+ALLEI QRP+ G+VILEL +F  PIW+AV++GVLVGW+WKP WANL         
Sbjct  1     MGLVAALLEILQRPTFGEVILELGMFMAPIWIAVLVGVLVGWSWKPNWANLAIDSVPTTH  60

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSR-VV  971
                     +LQ + SGFS+   LKLQIP   SWI E  S     +S+S     +  + VV
Sbjct  61    VP------SLQNLSSGFST---LKLQIP---SWIKETHSPPSISSSTSSSLHLEAEKLVV  108

Query  972   DENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPE  1151
              + DL +L  LVEEKD GPAWIQMMDRS  NMSYQAWRRDPETGPPQYRSRTVYEDATPE
Sbjct  109   TDADLRYLDGLVEEKDGGPAWIQMMDRSTPNMSYQAWRRDPETGPPQYRSRTVYEDATPE  168

Query  1152  MVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             M+RDFFW+DEFR KWDDMLIHAETLE+ P+TGTMVVQWVRKFPFFCSDREYIIGRR
Sbjct  169   MLRDFFWEDEFRLKWDDMLIHAETLEECPTTGTMVVQWVRKFPFFCSDREYIIGRR  224



>gb|EYU35617.1| hypothetical protein MIMGU_mgv1a007464mg [Erythranthe guttata]
Length=406

 Score =   294 bits (752),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 176/235 (75%), Gaps = 25/235 (11%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             MALVSA LEI QRP+ GDVI ELMVFTTPIWVAV +GVL+GWAWKP WANL         
Sbjct  1     MALVSAFLEILQRPNFGDVIFELMVFTTPIWVAVFVGVLLGWAWKPNWANL---------  51

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVVD  974
                     NL  + S   +         K  +  S  +S++  P+ SS   EN KS +V+
Sbjct  52    --------NLDFLDSAAKN--------NKGDANNSSLSSTNSGPDYSSSNSENGKSNLVN  95

Query  975   ENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEM  1154
             E+DL HL++LVEEKD GPAWIQMMDRS +NMSYQAWRRDP  GPPQYRSRT+YEDATPEM
Sbjct  96    EDDLKHLHKLVEEKDGGPAWIQMMDRSTSNMSYQAWRRDPPVGPPQYRSRTIYEDATPEM  155

Query  1155  VRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             +RDFFWDDEFR+KWDDML+HA+TLE+ P+TG MVVQWVRKFPFFCSDREYIIGRR
Sbjct  156   LRDFFWDDEFRSKWDDMLLHAQTLEECPATGQMVVQWVRKFPFFCSDREYIIGRR  210



>ref|XP_011070403.1| PREDICTED: uncharacterized protein LOC105156068 [Sesamum indicum]
Length=428

 Score =   294 bits (753),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 158/245 (64%), Positives = 183/245 (75%), Gaps = 10/245 (4%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCA--srdsf  788
             MALVSA LEI QRP+IGDV+ ELM F  PIWVAV++GVLVGWAWKP+WANL       + 
Sbjct  1     MALVSAFLEILQRPTIGDVMFELMGFMAPIWVAVLVGVLVGWAWKPKWANLNVDFVDSTA  60

Query  789   dsfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQ-------  947
             +   +  + + L Q  +   S+ +LK Q+P C SWISE        +  S          
Sbjct  61    NKGGTKKSVMVLPQFAASIPSLSSLKRQMPACVSWISEFGLEKENSSVPSVSSADYSSSK  120

Query  948   -ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSR  1124
              EN+KS +V+ +DL HL++LVEE D GPAWIQMMDRS TNMSYQAWRRDPE GPPQYRSR
Sbjct  121   LENEKSSLVNADDLKHLHKLVEETDGGPAWIQMMDRSTTNMSYQAWRRDPENGPPQYRSR  180

Query  1125  TVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREY  1304
             TVYEDATPEM+RDFFWDDEFR KWDDMLIHAETLE+ P+TG M+VQWVRKFPFFCSDREY
Sbjct  181   TVYEDATPEMLRDFFWDDEFRLKWDDMLIHAETLEECPTTGAMLVQWVRKFPFFCSDREY  240

Query  1305  IIGRR  1319
             IIGRR
Sbjct  241   IIGRR  245



>ref|XP_002518934.1| phosphatidylcholine transfer protein, putative [Ricinus communis]
 gb|EEF43467.1| phosphatidylcholine transfer protein, putative [Ricinus communis]
Length=428

 Score =   290 bits (741),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/243 (58%), Positives = 182/243 (75%), Gaps = 9/243 (4%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             MAL++ LLEI +RPS+ DV+ EL +FT P+W AV++GVLVGWAWKP+WANL  S    DS
Sbjct  1     MALLTILLEILKRPSVWDVLTELAMFTVPLWTAVIVGVLVGWAWKPKWANLGISSVCNDS  60

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQ--------E  950
                 ++ + ++   S  ++  +++ Q+P C SW+++      + ++   L         E
Sbjct  61    ANKVASPVAVESS-SSITTFKSMRFQLPSCMSWVADNHIQIDSASAPPSLSSDCSSSQLE  119

Query  951   NDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTV  1130
              + S +V+++DL HL ++V+EKD GPAWIQMMDRS   M+YQAWRRDPETGPPQYRSRTV
Sbjct  120   KETSSIVNDDDLEHLCKIVDEKDGGPAWIQMMDRSTPTMTYQAWRRDPETGPPQYRSRTV  179

Query  1131  YEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYII  1310
             +EDATPE VRDFFWDDEFR KWDDM++HA TLE+ P+TGTM+VQWVRKFPFFCSDREYII
Sbjct  180   FEDATPEFVRDFFWDDEFRLKWDDMMLHAATLEECPTTGTMIVQWVRKFPFFCSDREYII  239

Query  1311  GRR  1319
             GRR
Sbjct  240   GRR  242



>gb|EYU19436.1| hypothetical protein MIMGU_mgv1a007177mg [Erythranthe guttata]
Length=416

 Score =   288 bits (738),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 145/238 (61%), Positives = 179/238 (75%), Gaps = 15/238 (6%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             MAL+ AL+EI ++PS+ DV++EL+VF  PIW++V IGVLVGWAWKP WA+          
Sbjct  1     MALIGALVEILEKPSVVDVMIELIVFMAPIWISVFIGVLVGWAWKPNWAS----------  50

Query  795   fvsssTGINLQQVF-SGFSSIPALKLQIPKCFSWIseetsssltpnsssplQE--NDKSR  965
               SS+  ++L   F S  S++ + K+Q P C  W+S+     ++      L E   +KS 
Sbjct  51    --SSNKSVSLFPHFASSVSNLSSFKVQFPACIPWVSDSPLPPVSSAPHYSLSELEKEKSS  108

Query  966   VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDAT  1145
             VV++ DL HL++LVEEKD GPAWI+MMDRS  NMSYQAWRRDPETGPPQYRSRT+YEDAT
Sbjct  109   VVNDEDLIHLHKLVEEKDGGPAWIKMMDRSTPNMSYQAWRRDPETGPPQYRSRTIYEDAT  168

Query  1146  PEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             PE +RDFFWDDEFRA+WDDMLI A+TL +  STGTM+VQWVRKFPFFCSDREYIIGRR
Sbjct  169   PETLRDFFWDDEFRAEWDDMLIKAKTLNECRSTGTMLVQWVRKFPFFCSDREYIIGRR  226



>ref|XP_012086635.1| PREDICTED: uncharacterized protein LOC105645602 [Jatropha curcas]
 gb|KDP25225.1| hypothetical protein JCGZ_20381 [Jatropha curcas]
Length=428

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/243 (60%), Positives = 177/243 (73%), Gaps = 9/243 (4%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             MAL S LL+I  RP+IGD++ EL++F  P+W+AV+IGVLVGWAWKP+WANL         
Sbjct  1     MALWSILLDILNRPTIGDIVAELVMFMAPLWIAVIIGVLVGWAWKPKWANLGRELLDSSV  60

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQEN-------  953
                S+  +      S   ++ +LK Q+P C SWI+++     +P +   L  +       
Sbjct  61    NKDSANTVP-SPASSSIPTLNSLKFQLPSCISWIADDGIQKDSPPAPPSLSADCSSKQSQ  119

Query  954   -DKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTV  1130
              + S +V+E+DL HL +LVEEKD GPAWIQMMDRS   MSY+AWRRDPE GPPQYRS TV
Sbjct  120   KESSGIVNEDDLEHLCKLVEEKDGGPAWIQMMDRSTPTMSYKAWRRDPENGPPQYRSSTV  179

Query  1131  YEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYII  1310
             +EDATPEMVRDFFWDDEFR KWDDMLIHA TLE+ P+TGTM+VQWVRKFPFFCSDREYII
Sbjct  180   FEDATPEMVRDFFWDDEFRMKWDDMLIHAATLEECPTTGTMIVQWVRKFPFFCSDREYII  239

Query  1311  GRR  1319
             GRR
Sbjct  240   GRR  242



>ref|XP_009775677.1| PREDICTED: uncharacterized protein LOC104225551 [Nicotiana sylvestris]
Length=422

 Score =   285 bits (730),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 163/237 (69%), Positives = 189/237 (80%), Gaps = 2/237 (1%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsr-dsfd  791
             MALV+ALLEI ++PS G+V+LEL++F  PIW+AVV+GVLVGW WKP+WA L     DS D
Sbjct  1     MALVAALLEILEKPSFGEVLLELVMFMGPIWIAVVVGVLVGWVWKPKWAKLGPDSFDSRD  60

Query  792   sfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSR-V  968
                SSS+G+ LQ + SGF+SI +LKLQ+P C  WI E  S      SSS   E +  + V
Sbjct  61    VSASSSSGMLLQNLSSGFASISSLKLQLPTCIPWIKEAQSPPSISCSSSSSSELEGEKSV  120

Query  969   VDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATP  1148
             V E DL +L  LVEE D GPAWIQMMDRS +NMSY+AWRRDPETGPPQYRSRT+YEDATP
Sbjct  121   VTETDLLYLDGLVEESDGGPAWIQMMDRSTSNMSYKAWRRDPETGPPQYRSRTIYEDATP  180

Query  1149  EMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             EMVRDFFWDDEFR KWDDMLIHA+TLE+ P+TGTM+VQWVRKFPFFCSDREYIIGRR
Sbjct  181   EMVRDFFWDDEFRLKWDDMLIHAQTLEECPTTGTMMVQWVRKFPFFCSDREYIIGRR  237



>ref|XP_011040605.1| PREDICTED: uncharacterized protein LOC105136815 [Populus euphratica]
Length=427

 Score =   283 bits (724),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 147/245 (60%), Positives = 168/245 (69%), Gaps = 13/245 (5%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWA-NLCAsrdsfd  791
             MAL S LLEI  RP+ G V+ EL +F  P+WVAV IGVLVGW WKP+WA NL        
Sbjct  1     MALGSVLLEILHRPTTGQVLSELFIFAIPLWVAVAIGVLVGWVWKPKWASNLSREMLLDA  60

Query  792   sfvsssTGINLQQVFSGFSSIPALKLQIPKC---------FSWIseetsssltpnssspl  944
                   +  +L  +     S+  LK Q+P C             S     +L    SS  
Sbjct  61    KQGGEFSATSLSTMIP---SLNILKFQLPSCVFRAADDGGIQTDSFSVRRTLNSKCSSSK  117

Query  945   QENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSR  1124
              E +K+ +V E+DL HL +LVE KD GPAWIQMMDRS   M+YQAWRRDPETGPPQYRSR
Sbjct  118   MEKEKTNLVMEDDLEHLCKLVEVKDGGPAWIQMMDRSTPTMNYQAWRRDPETGPPQYRSR  177

Query  1125  TVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREY  1304
             TV+EDATPEMVRDFFWDDEFRAKWDDML+HAETLE+ P+ GTMVVQWVRKFPFFCSDREY
Sbjct  178   TVFEDATPEMVRDFFWDDEFRAKWDDMLVHAETLEECPTRGTMVVQWVRKFPFFCSDREY  237

Query  1305  IIGRR  1319
             IIGRR
Sbjct  238   IIGRR  242



>ref|XP_002278777.1| PREDICTED: uncharacterized protein LOC100247984 [Vitis vinifera]
Length=438

 Score =   281 bits (719),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 149/251 (59%), Positives = 178/251 (71%), Gaps = 16/251 (6%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL------CAs  776
             M LVS LLEI +RP+IGDV+ ELM+F  P+W+AVV+GVLVGW WKP+WANL      C+S
Sbjct  1     MMLVSVLLEILRRPTIGDVLAELMMFMAPLWIAVVVGVLVGWTWKPKWANLGREMLDCSS  60

Query  777   rdsfdsfvsssTGINLQQVFSGFS-SIP---ALKLQIPKCFSWI------seetsssltp  926
               S  S    +   +     S  S SIP   +LKLQ+P C SWI          + +   
Sbjct  61    VPSNSSPAPPAASSSTVAAPSSVSASIPCLNSLKLQLPSCISWIGDDGIDKSLMAPTGDS  120

Query  927   nsssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGP  1106
             + S    + + S VV E+DL HL QLVE KD GPAWIQMMDRS   MSY+AWRRDP+TGP
Sbjct  121   DCSPSQLKAENSVVVAEDDLEHLCQLVEVKDGGPAWIQMMDRSTPTMSYKAWRRDPDTGP  180

Query  1107  PQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFF  1286
             PQYRS T++EDATPE+VRDFFWDD FR KWDDMLI+A TLE+ P+TGTM+V WVRKFPFF
Sbjct  181   PQYRSSTIFEDATPELVRDFFWDDGFRLKWDDMLIYAATLEECPTTGTMLVHWVRKFPFF  240

Query  1287  CSDREYIIGRR  1319
             CSDREY+IGRR
Sbjct  241   CSDREYMIGRR  251



>ref|XP_010104915.1| hypothetical protein L484_024117 [Morus notabilis]
 gb|EXC02151.1| hypothetical protein L484_024117 [Morus notabilis]
Length=440

 Score =   279 bits (713),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 142/252 (56%), Positives = 172/252 (68%), Gaps = 17/252 (7%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             MA+VS LLEIF+RP+I +V+ EL+ F  P+W+AV +GVLVGWAWKP+WANL     +  S
Sbjct  1     MAVVSVLLEIFRRPTIVEVLGELVFFIAPLWIAVFVGVLVGWAWKPKWANLVGRDIADYS  60

Query  795   fvsssTGINLQ--------QVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQ-  947
                  T  +            F     + +LK Q+P C  WIS+        +  +P+  
Sbjct  61    VSKQETSSSSSSSSLLTSSMCFGSLPGLNSLKFQLPSCIPWISDYGVQEKVLSLPAPVNS  120

Query  948   --------ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETG  1103
                     + + S +V   DL HL +LVEEKD GP+WIQMMDRS   M YQAWRRDPETG
Sbjct  121   SDSSSSQLDRESSSLVTGEDLEHLCRLVEEKDGGPSWIQMMDRSTPTMGYQAWRRDPETG  180

Query  1104  PPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPF  1283
             PPQYRSRTV+EDATPE+VRDFFWDDEFR KWDDMLIHA TLE+ P+TG +VVQWVRKFPF
Sbjct  181   PPQYRSRTVFEDATPELVRDFFWDDEFRMKWDDMLIHASTLEECPTTGAIVVQWVRKFPF  240

Query  1284  FCSDREYIIGRR  1319
             FCSDREY+IGRR
Sbjct  241   FCSDREYLIGRR  252



>ref|XP_009348226.1| PREDICTED: uncharacterized protein LOC103939842 [Pyrus x bretschneideri]
 ref|XP_009348228.1| PREDICTED: uncharacterized protein LOC103939851 [Pyrus x bretschneideri]
Length=440

 Score =   278 bits (712),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 139/250 (56%), Positives = 171/250 (68%), Gaps = 15/250 (6%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL-------CA  773
             MAL SA LEI +RP+I +V+ ELM+F TP+W+AVV+GV VGWAWKP+WANL       C 
Sbjct  1     MALASAFLEILRRPTIVEVLGELMMFVTPLWIAVVVGVFVGWAWKPKWANLVGRELLDCP  60

Query  774   srdsfdsfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQ--  947
                  +S  SSS+  +          + +LK Q+P C  W +++ +     +        
Sbjct  61    ITKQKESSSSSSSSQSSSTCIGLIPGLSSLKFQLPSCIPWPADDRNPKEALSLPPTTNPD  120

Query  948   ------ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPP  1109
                   E + S  V+  DL H+ QLVEEKD GPAWI MMDRS + M YQAWRRDPETGPP
Sbjct  121   FSSSKIERESSGHVNNEDLRHICQLVEEKDGGPAWIHMMDRSTSTMRYQAWRRDPETGPP  180

Query  1110  QYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFC  1289
             QYRS T+YED TPE++RDFFWDDEFR KWDDML+HA TLE+ P+TGTM+V WVRKFPFFC
Sbjct  181   QYRSSTIYEDCTPELLRDFFWDDEFRVKWDDMLVHASTLEECPTTGTMLVHWVRKFPFFC  240

Query  1290  SDREYIIGRR  1319
             SDREY+IGRR
Sbjct  241   SDREYLIGRR  250



>ref|XP_004146518.1| PREDICTED: uncharacterized protein LOC101209389 [Cucumis sativus]
 gb|KGN53329.1| Phosphatidylcholine transfer protein [Cucumis sativus]
Length=432

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/243 (59%), Positives = 169/243 (70%), Gaps = 8/243 (3%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             MAL+S L EI  RP I DV  ELM+   P+W+AV++GVLVGW WKP+WANL         
Sbjct  1     MALLSILAEILGRPRIVDVFGELMILIAPLWIAVIVGVLVGWTWKPKWANLGREMMDSSV  60

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIPKCF--------SWIseetsssltpnsssplQE  950
                S +      +   F S  +L  Q+P C            +    SS   +SSS   E
Sbjct  61    SDDSKSSSTSFSLLGSFPSFNSLNFQMPSCILSSFDGKDEKETSSMPSSSDSDSSSTELE  120

Query  951   NDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTV  1130
              +  RVV+E+DL +L +LVEEKD GPAWI+MMDRS +NMSYQAWRRDPETGPPQYRSRTV
Sbjct  121   GENLRVVNEDDLEYLCKLVEEKDGGPAWIKMMDRSTSNMSYQAWRRDPETGPPQYRSRTV  180

Query  1131  YEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYII  1310
             YE+ATPE+VRDFFWDD+FR+KWDDMLI A TL + P+TGTMVV WVRKFPFFCSDREYII
Sbjct  181   YENATPEIVRDFFWDDDFRSKWDDMLISATTLAECPTTGTMVVHWVRKFPFFCSDREYII  240

Query  1311  GRR  1319
             GRR
Sbjct  241   GRR  243



>ref|XP_009344057.1| PREDICTED: uncharacterized protein LOC103935948 [Pyrus x bretschneideri]
Length=440

 Score =   277 bits (708),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/250 (55%), Positives = 171/250 (68%), Gaps = 15/250 (6%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL-------CA  773
             MAL SA LEI +RP+I +V+ ELM+F TP+W+AVV+GV VGWAWKP+WANL       C 
Sbjct  1     MALASAFLEILRRPTIVEVLGELMMFITPLWIAVVVGVFVGWAWKPKWANLVGRELLDCP  60

Query  774   srdsfdsfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQ--  947
                  +S  SSS+  +          + +LK Q+P C  W +++ +     +        
Sbjct  61    ITKQKESSSSSSSSQSSSTCIGLIPGLSSLKFQLPSCIPWPADDRNPKEALSLPPTTNPD  120

Query  948   ------ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPP  1109
                   E + S  V+ +DL H+ QLVEEKD GP WI MMDRS + M YQAWRRDPETGPP
Sbjct  121   FSSSKIERESSGHVNNDDLRHICQLVEEKDGGPTWIHMMDRSTSTMRYQAWRRDPETGPP  180

Query  1110  QYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFC  1289
             QYRS T+YED TPE++RDFFWDDEFR KWDDML+HA TLE+ P+TGTM+V WVRKFPFFC
Sbjct  181   QYRSSTIYEDCTPELLRDFFWDDEFRVKWDDMLVHASTLEECPTTGTMLVHWVRKFPFFC  240

Query  1290  SDREYIIGRR  1319
             SDREY+IGRR
Sbjct  241   SDREYLIGRR  250



>ref|XP_007039336.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Theobroma cacao]
 gb|EOY23837.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Theobroma cacao]
Length=433

 Score =   276 bits (707),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 140/246 (57%), Positives = 175/246 (71%), Gaps = 11/246 (4%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             M +VS  LEI ++P+IGDV+ ELM+F  P+WVAV++GVLVGWAWKP+WA+L        S
Sbjct  1     MGVVSVFLEILRKPTIGDVLSELMMFIAPLWVAVIVGVLVGWAWKPKWASLGREMLMDCS  60

Query  795   fvsssT---GINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQEN----  953
                 ST     +    F   SS+  +K Q+P C  WI+++ +   + +    +  N    
Sbjct  61    GSKDSTPAASESSSSGFGSISSLNLIKFQLPSCIPWITDDGAQKDSFSLPPTIDSNCSSS  120

Query  954   ----DKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRS  1121
                 +K+  V + DL HL +LVEEKD GPAWIQMMDRS   M YQAWRRDP+TGPPQYRS
Sbjct  121   QIGKEKTGFVTDEDLEHLCKLVEEKDGGPAWIQMMDRSTPTMGYQAWRRDPQTGPPQYRS  180

Query  1122  RTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDRE  1301
             RTV++DATPEMVRDFFWDDEFRAKWDDML+ + T+E+ P+TGTMVV WVRKFPFFCSDRE
Sbjct  181   RTVFDDATPEMVRDFFWDDEFRAKWDDMLVSSATMEECPTTGTMVVHWVRKFPFFCSDRE  240

Query  1302  YIIGRR  1319
             Y+IGRR
Sbjct  241   YVIGRR  246



>ref|XP_006439191.1| hypothetical protein CICLE_v10020224mg [Citrus clementina]
 gb|ESR52431.1| hypothetical protein CICLE_v10020224mg [Citrus clementina]
Length=432

 Score =   276 bits (706),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/245 (58%), Positives = 169/245 (69%), Gaps = 10/245 (4%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             M L S LLEI Q+PS+ DVI ELM+   P+W+AV++GVLVGWAWKP+WANL     S   
Sbjct  1     MGLASVLLEILQKPSMVDVIRELMMLMAPLWIAVIVGVLVGWAWKPKWANLGLMDSSVSI  60

Query  795   fvsssTGINLQQVFSGFSSIPAL-KLQIPKCFSW---------Iseetsssltpnssspl  944
                S +        + F+      K Q+P C S          +   ++S    +SS   
Sbjct  61    SKDSHSRTEDDDSATTFTVFRNFFKFQLPTCISATSDYGIQKDVPSTSNSISPCSSSQAH  120

Query  945   QENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSR  1124
             +  ++S  V E+DL HL +LVEEKD GP WIQMMDRS   M+YQAWRRDPE GPPQYRSR
Sbjct  121   RRMEQSSFVTEDDLEHLCRLVEEKDGGPVWIQMMDRSTPTMAYQAWRRDPENGPPQYRSR  180

Query  1125  TVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREY  1304
             TVYED TPEMVRDFFWDD+FR KWDDMLI+A TLE+ P+TGTMVVQWVRKFPFFCSDREY
Sbjct  181   TVYEDVTPEMVRDFFWDDDFRLKWDDMLIYASTLEECPTTGTMVVQWVRKFPFFCSDREY  240

Query  1305  IIGRR  1319
             IIGRR
Sbjct  241   IIGRR  245



>ref|XP_002317053.1| hypothetical protein POPTR_0011s15470g [Populus trichocarpa]
 gb|EEE97665.1| hypothetical protein POPTR_0011s15470g [Populus trichocarpa]
Length=398

 Score =   275 bits (702),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 140/236 (59%), Positives = 159/236 (67%), Gaps = 25/236 (11%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWA-NLCAsrdsfd  791
             MAL S LLEI  RP+ G V+ EL +F  P+WVAV IGVLVGW WKP+WA NL        
Sbjct  1     MALGSVLLEILHRPTTGQVLSELFIFAIPLWVAVAIGVLVGWVWKPKWASNLSREMLLDA  60

Query  792   sfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVV  971
                   +  +L  +     S+  LK    K                      E +K  +V
Sbjct  61    KQGGEFSATSLSTMIP---SLNILKFHSSK---------------------MEKEKPNLV  96

Query  972   DENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPE  1151
              E+DL HL +LVE KD GPAWIQMMDRS   M+YQAWRRDPETGPPQYR+RTV+EDATPE
Sbjct  97    MEDDLEHLCKLVEVKDGGPAWIQMMDRSTPTMNYQAWRRDPETGPPQYRTRTVFEDATPE  156

Query  1152  MVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             MVRDFFWDDEFRAKWDDML+HAETLE+ P+ GTMVVQWVRKFPFFCSDREYIIGRR
Sbjct  157   MVRDFFWDDEFRAKWDDMLVHAETLEECPTRGTMVVQWVRKFPFFCSDREYIIGRR  212



>ref|XP_006476268.1| PREDICTED: uncharacterized protein LOC102627263 [Citrus sinensis]
Length=432

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/247 (58%), Positives = 170/247 (69%), Gaps = 14/247 (6%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             M L S LLEI Q+PS+ DVI ELM+   P+W+AV++GVLVGWAWKP+WANL     S   
Sbjct  1     MGLASVLLEILQKPSMVDVIRELMMLMAPLWIAVIVGVLVGWAWKPKWANLGLMDSSVSI  60

Query  795   fvsssTGI---NLQQVFSGFSSIPALKLQIPKCFSW---------Iseetsssltpnsss  938
                S +     +    F+ F +    K Q+P C S          +   ++S    +SS 
Sbjct  61    SKESHSRTEDDDSTTTFTAFRNF--FKFQLPTCISATSDYGIQKDVPSTSNSISPCSSSQ  118

Query  939   plQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYR  1118
               +  ++S  V E+DL HL +LVEEKD GP WIQMMDRS   M+YQAWRRDPE GPPQYR
Sbjct  119   AHRRMEQSSFVTEDDLEHLCRLVEEKDGGPVWIQMMDRSTPTMAYQAWRRDPENGPPQYR  178

Query  1119  SRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDR  1298
             SRTVYED TPEMVRDFFWDD+ R KWDDMLI+A TLE+ P+TGTMVVQWVRKFPFFCSDR
Sbjct  179   SRTVYEDVTPEMVRDFFWDDDSRLKWDDMLIYASTLEECPNTGTMVVQWVRKFPFFCSDR  238

Query  1299  EYIIGRR  1319
             EYIIGRR
Sbjct  239   EYIIGRR  245



>gb|KDO76778.1| hypothetical protein CISIN_1g014046mg [Citrus sinensis]
Length=432

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/247 (58%), Positives = 170/247 (69%), Gaps = 14/247 (6%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             M L S LLEI Q+PS+ DVI ELM+   P+W+AV++GVLVGWAWKP+WANL     S   
Sbjct  1     MGLASVLLEILQKPSMVDVIRELMMLMAPLWIAVIVGVLVGWAWKPKWANLGLMDSSVSI  60

Query  795   fvsssTGI---NLQQVFSGFSSIPALKLQIPKCFSW---------Iseetsssltpnsss  938
                S +     +    F+ F +    K Q+P C S          +   ++S    +SS 
Sbjct  61    SKESHSRTEDDDSTTTFTAFRNF--FKFQLPTCISATSDYGIQKDVPSTSNSISPCSSSQ  118

Query  939   plQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYR  1118
               +  ++S  V E+DL HL +LVEEKD GP WIQMMDRS   M+YQAWRRDPE GPPQYR
Sbjct  119   AHRRMEQSSFVTEDDLEHLCRLVEEKDGGPVWIQMMDRSTPTMAYQAWRRDPENGPPQYR  178

Query  1119  SRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDR  1298
             SRTVYED TPEMVRDFFWDD+ R KWDDMLI+A TLE+ P+TGTMVVQWVRKFPFFCSDR
Sbjct  179   SRTVYEDVTPEMVRDFFWDDDSRLKWDDMLIYASTLEECPNTGTMVVQWVRKFPFFCSDR  238

Query  1299  EYIIGRR  1319
             EYIIGRR
Sbjct  239   EYIIGRR  245



>ref|XP_008452046.1| PREDICTED: uncharacterized protein LOC103493171 [Cucumis melo]
Length=432

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 141/243 (58%), Positives = 168/243 (69%), Gaps = 8/243 (3%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             MAL+S L EI  RP I DV  ELM+   P+W+AV++GVLVGW WKP+WANL         
Sbjct  1     MALLSILAEILGRPRIVDVFGELMILIAPLWIAVIVGVLVGWTWKPKWANLGREMMDSSV  60

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIPKCF--------SWIseetsssltpnsssplQE  950
                S +      +   F S  +L  Q+P              +    SS   +SSS   E
Sbjct  61    SDDSKSSSTSFSLLGSFPSFNSLNFQMPSSILSSFDGKDEKETSSMPSSSDSDSSSTELE  120

Query  951   NDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTV  1130
              +  RVV+E+DL +L +LVEEKD GPAWI+MMDRS +NMSYQAWRRDPETGPPQYRSRTV
Sbjct  121   GENLRVVNEDDLEYLCKLVEEKDGGPAWIKMMDRSTSNMSYQAWRRDPETGPPQYRSRTV  180

Query  1131  YEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYII  1310
             YE+ATPE+VRDFFWDD+FR+KWDDMLI A TL + P+TGTMVV WVRKFPFFCSDREY+I
Sbjct  181   YENATPEIVRDFFWDDDFRSKWDDMLISATTLAECPTTGTMVVHWVRKFPFFCSDREYVI  240

Query  1311  GRR  1319
             GRR
Sbjct  241   GRR  243



>ref|XP_008392651.1| PREDICTED: uncharacterized protein LOC103454832 [Malus domestica]
Length=440

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/250 (55%), Positives = 168/250 (67%), Gaps = 15/250 (6%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAs------  776
             MAL SA LEI +RP+I +V+ ELM+F TP+W+AVV+GV VGWAWKP+WANL         
Sbjct  1     MALASAFLEILRRPTIVEVLGELMMFITPLWIAVVVGVFVGWAWKPKWANLVGRELLDSP  60

Query  777   -rdsfdsfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQ--  947
                  +S  SSS+  +          + +LK Q+P C  W ++E +     +        
Sbjct  61    ITKQKESSSSSSSSQSSSTCIGLIPGLSSLKFQLPSCIPWPADERNPKEALSLPPTTNPD  120

Query  948   ------ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPP  1109
                   E + S  V+  DL H+ QLVEEKD GPAWI MMDRS   M YQAWRRDPETGPP
Sbjct  121   FSSSKIERESSGHVNNEDLRHICQLVEEKDGGPAWIHMMDRSTPTMRYQAWRRDPETGPP  180

Query  1110  QYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFC  1289
             QYRS T+YED TPE++RDFFWDDEFR KWDDML+HA TLE+ P+TG M+V WVRKFPFFC
Sbjct  181   QYRSSTIYEDCTPELLRDFFWDDEFRVKWDDMLVHASTLEECPTTGAMLVHWVRKFPFFC  240

Query  1290  SDREYIIGRR  1319
             SDREY+IGRR
Sbjct  241   SDREYLIGRR  250



>ref|XP_008245786.1| PREDICTED: uncharacterized protein LOC103343932 [Prunus mume]
Length=435

 Score =   271 bits (693),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 139/247 (56%), Positives = 172/247 (70%), Gaps = 12/247 (5%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrds---  785
             MALVSA LEIF+RP+I +V+ EL++F TP+W+AV++GV VGWAWKP+WA+L         
Sbjct  1     MALVSAFLEIFRRPTIVEVLGELIMFITPLWIAVMVGVFVGWAWKPKWASLVGRDLLDCP  60

Query  786   -fdsfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpns--------ss  938
                   SSS+       F    S+ +L+  +P    W +++ +     +         SS
Sbjct  61    ISKQKESSSSSQTSSTCFGPIPSLSSLRFLLPSYLPWAADDRNQKEALSMPPTTNPDFSS  120

Query  939   plQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYR  1118
               +E +KS  V   DL H+ QLVEEKD GPAWI MMDRS   M YQAWRRDPETGPPQYR
Sbjct  121   SQKEKEKSGRVTNQDLRHICQLVEEKDGGPAWIHMMDRSTPTMRYQAWRRDPETGPPQYR  180

Query  1119  SRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDR  1298
             S T+YEDATPE +RDFFWDDEFR+KWDDMLI+A TLE+ P+TGTM+V WVRKFPFFCSDR
Sbjct  181   SSTIYEDATPEQLRDFFWDDEFRSKWDDMLIYASTLEECPTTGTMLVHWVRKFPFFCSDR  240

Query  1299  EYIIGRR  1319
             EY+IGRR
Sbjct  241   EYLIGRR  247



>ref|XP_009360210.1| PREDICTED: uncharacterized protein LOC103950711 [Pyrus x bretschneideri]
Length=438

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/248 (54%), Positives = 167/248 (67%), Gaps = 13/248 (5%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrds---  785
             MAL SA LEI +RP+I +V+ ELM+F  P+W+ V++GV VGWAWKP+WA+L         
Sbjct  1     MALPSAFLEILRRPTIVEVLGELMMFIIPLWIGVIVGVFVGWAWKPKWASLVGRDLLDCP  60

Query  786   --fdsfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQ----  947
                     SS+  +  + F     + +LK Q+P C  W ++  +    P+          
Sbjct  61    ISKQKESPSSSSQSSSKCFGSIPGLSSLKFQLPSCIPWPADYRNPEDAPSLPPTTNPDFS  120

Query  948   ----ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQY  1115
                 E + S  V++ DL H+ QLVEEKD GP WI MMDRS   M YQAWRRDPETGPPQY
Sbjct  121   TSKIERESSGHVNKEDLQHICQLVEEKDGGPTWIHMMDRSTAAMRYQAWRRDPETGPPQY  180

Query  1116  RSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSD  1295
             RS T+YED TPE++RDFFWDDEFRAKWDDML+HA TLE+ P+TGTM+V WVRKFPFFCSD
Sbjct  181   RSSTIYEDCTPELLRDFFWDDEFRAKWDDMLVHASTLEECPTTGTMLVHWVRKFPFFCSD  240

Query  1296  REYIIGRR  1319
             REY+IGRR
Sbjct  241   REYLIGRR  248



>ref|XP_011038005.1| PREDICTED: uncharacterized protein LOC105135031 [Populus euphratica]
Length=433

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 150/247 (61%), Positives = 177/247 (72%), Gaps = 12/247 (5%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             MAL S LLEI QRP+IG+V+ E+++F  P+WVAV +GVLVGWAWKP+WA+  +     DS
Sbjct  1     MALGSVLLEILQRPTIGEVLSEILIFVIPLWVAVAVGVLVGWAWKPKWASNLSREILLDS  60

Query  795   fvsssTGINLQQVFSGFSSIPA---LKLQIPKCFSWIs---------eetsssltpnsss  938
              VS       +   +  S IP+   LK Q+P C SW++              +L    SS
Sbjct  61    KVSKEAKKGGEFSATTSSVIPSFNILKFQLPSCVSWVADDGGFQKDSLSLPPTLNSECSS  120

Query  939   plQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYR  1118
                +  K  +V E+DL HL +LVE  D GPAWIQMMDRS   MSYQAWRRDPETGPPQYR
Sbjct  121   SKMKKQKPDLVMEDDLEHLSKLVEVTDGGPAWIQMMDRSTPTMSYQAWRRDPETGPPQYR  180

Query  1119  SRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDR  1298
             SRTVYED TPE+VRDFFWDDEFRAKWDDML+HAETL+D P+TGTM+VQWVRKFPFFCSDR
Sbjct  181   SRTVYEDVTPELVRDFFWDDEFRAKWDDMLLHAETLQDCPTTGTMLVQWVRKFPFFCSDR  240

Query  1299  EYIIGRR  1319
             EYIIGRR
Sbjct  241   EYIIGRR  247



>ref|XP_002300509.2| hypothetical protein POPTR_0001s45410g [Populus trichocarpa]
 gb|EEE85314.2| hypothetical protein POPTR_0001s45410g [Populus trichocarpa]
Length=435

 Score =   269 bits (687),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 148/248 (60%), Positives = 174/248 (70%), Gaps = 13/248 (5%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWA-NLCAsrdsfd  791
             MAL S LLEI QRP+IG+V+ E+++F  P+WVAV +GVLVGWAWKP+WA NL        
Sbjct  1     MALRSVLLEILQRPTIGEVLSEILIFVIPLWVAVAVGVLVGWAWKPKWASNLSREMLLDS  60

Query  792   sfvsssTGINLQQVFSGFSSIPA---LKLQIPKCFSWIs---------eetsssltpnss  935
                  +         +  S IP+   LK Q+P C SW++              +L    S
Sbjct  61    KVSKEAKKEGEFSATTRSSVIPSFNILKFQLPSCVSWVADDGGFQKDSLSVPPTLNSECS  120

Query  936   splQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQY  1115
             S   + +K  +V E+DL HL +LVE  D GPAWIQMMDRS   MSYQAWRRDPETGPPQY
Sbjct  121   SSKMKKEKPDLVMEDDLEHLSKLVEVTDGGPAWIQMMDRSTPTMSYQAWRRDPETGPPQY  180

Query  1116  RSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSD  1295
             RSRTVYED TPE++RDFFWDDEFRAKWDDML+HAETLED P+TGTM+VQWVRKFPFFCSD
Sbjct  181   RSRTVYEDVTPELMRDFFWDDEFRAKWDDMLLHAETLEDCPTTGTMLVQWVRKFPFFCSD  240

Query  1296  REYIIGRR  1319
             REYIIGRR
Sbjct  241   REYIIGRR  248



>ref|XP_008346656.1| PREDICTED: uncharacterized protein LOC103409627 [Malus domestica]
Length=438

 Score =   268 bits (686),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 169/248 (68%), Gaps = 13/248 (5%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfd-  791
             MAL SA LEI + P+I +V+ ELM+F TP+W+ V++GV VGWAWKP+WA+L         
Sbjct  1     MALQSAFLEILRLPTIVEVLGELMMFITPLWIGVIVGVFVGWAWKPKWASLVGRDLLDCP  60

Query  792   -sfvsssTGINLQQVFSGFSSIP---ALKLQIPKCFSWIseetsssltpnsssplQ----  947
              S    S+  + Q   + F SIP   +LK Q+P C  W +++ +     +          
Sbjct  61    ISKQKESSSSSSQSSSTCFGSIPGLSSLKFQLPSCIPWPADDRNPEDALSLPPTTNPDFS  120

Query  948   ----ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQY  1115
                 E + S  V+  DL H+ QLVEEKD GPAWI MMDRS   M  QAWRRDPETGPPQY
Sbjct  121   TSKIERESSGYVNNEDLQHICQLVEEKDGGPAWIHMMDRSTAAMRCQAWRRDPETGPPQY  180

Query  1116  RSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSD  1295
             RS T+YED TPE++RDFFWDDEFRAKWDDML+HA TLE+ P+TGTM+V WVRKFPFFCSD
Sbjct  181   RSSTIYEDCTPELLRDFFWDDEFRAKWDDMLVHASTLEECPTTGTMLVHWVRKFPFFCSD  240

Query  1296  REYIIGRR  1319
             REY+IGRR
Sbjct  241   REYLIGRR  248



>ref|XP_010053047.1| PREDICTED: uncharacterized protein LOC104441594 [Eucalyptus grandis]
 gb|KCW77297.1| hypothetical protein EUGRSUZ_D01658 [Eucalyptus grandis]
Length=432

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/252 (56%), Positives = 171/252 (68%), Gaps = 23/252 (9%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             MAL+S L EI QRP+I  V+ ELM+F  P+W+AV++GVLVGWAWKP+WANL         
Sbjct  1     MALISILSEILQRPTIWGVLGELMLFVAPVWIAVIVGVLVGWAWKPKWANL------GKD  54

Query  795   fvsssTGINLQQVFS---GFSSIPAL---KLQIPKCFSWIseetsssltpns--------  932
             F     G +L+ +     G S +P+L   KLQ+    S ++ + +               
Sbjct  55    FFDCPKGNSLESLMPSCLGRSLVPSLNSSKLQLTSFISSVANDGAEKEASAVPPTMSSDC  114

Query  933   ---ssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETG  1103
                 S   E + S +V ++DL H+ +LVE  D GPAW+QMMDRS   M YQAWRRDPETG
Sbjct  115   SSSHSSQGERELSGLVGDDDLEHICRLVEVTDGGPAWVQMMDRSTATMGYQAWRRDPETG  174

Query  1104  PPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPF  1283
             PPQYRS TV+EDATPE+VRDFFWDD FR KWDDMLIHA TLE+ P+TGTM+VQWVRKFPF
Sbjct  175   PPQYRSSTVFEDATPELVRDFFWDDSFRPKWDDMLIHATTLEECPTTGTMMVQWVRKFPF  234

Query  1284  FCSDREYIIGRR  1319
             FCSDREYIIGRR
Sbjct  235   FCSDREYIIGRR  246



>gb|KCW77296.1| hypothetical protein EUGRSUZ_D01658 [Eucalyptus grandis]
Length=433

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 140/252 (56%), Positives = 171/252 (68%), Gaps = 23/252 (9%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             MAL+S L EI QRP+I  V+ ELM+F  P+W+AV++GVLVGWAWKP+WANL         
Sbjct  1     MALISILSEILQRPTIWGVLGELMLFVAPVWIAVIVGVLVGWAWKPKWANL------GKD  54

Query  795   fvsssTGINLQQVFS---GFSSIPAL---KLQIPKCFSWIseetsssltpns--------  932
             F     G +L+ +     G S +P+L   KLQ+    S ++ + +               
Sbjct  55    FFDCPKGNSLESLMPSCLGRSLVPSLNSSKLQLTSFISSVANDGAEKEASAVPPTMSSDC  114

Query  933   ---ssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETG  1103
                 S   E + S +V ++DL H+ +LVE  D GPAW+QMMDRS   M YQAWRRDPETG
Sbjct  115   SSSHSSQGERELSGLVGDDDLEHICRLVEVTDGGPAWVQMMDRSTATMGYQAWRRDPETG  174

Query  1104  PPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPF  1283
             PPQYRS TV+EDATPE+VRDFFWDD FR KWDDMLIHA TLE+ P+TGTM+VQWVRKFPF
Sbjct  175   PPQYRSSTVFEDATPELVRDFFWDDSFRPKWDDMLIHATTLEECPTTGTMMVQWVRKFPF  234

Query  1284  FCSDREYIIGRR  1319
             FCSDREYIIGRR
Sbjct  235   FCSDREYIIGRR  246



>emb|CDP12249.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   263 bits (673),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 145/255 (57%), Positives = 175/255 (69%), Gaps = 22/255 (9%)
 Frame = +3

Query  615   MALVSALLEIFQRPS--IGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsf  788
             M LVSALLEIFQ PS  I DVI +LM+F  P+W+AV++GVLVGW WKPRWAN        
Sbjct  1     MVLVSALLEIFQGPSFSILDVITQLMMFAAPLWIAVLVGVLVGWTWKPRWANFNGDFSVS  60

Query  789   dsfvsssTGIN------LQQVFSGFSSIPALK----LQIPKCFSWIs--------eetss  914
              S  SSS+         + Q  SGF  +P+      LQ+  C   +S           + 
Sbjct  61    ASVSSSSSTSFSSIRGMVAQHLSGF--VPSFNSFKILQLHSCIPGVSDDDGFDKQNPPAL  118

Query  915   sltpnsssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDP  1094
               + +S       +KS +V+E+DL H+  L +EKD GP+W+QMM+RS  NMS +AWRRDP
Sbjct  119   PSSSSSPPSSSNVEKSSLVNEDDLKHVCLLTKEKDGGPSWVQMMNRSNDNMSCEAWRRDP  178

Query  1095  ETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRK  1274
             ETGPPQYR+RTVYE+ATPE+VRDFFWDDEFR KWDDML HAETLED P+TGTMVVQWVRK
Sbjct  179   ETGPPQYRTRTVYENATPELVRDFFWDDEFRLKWDDMLSHAETLEDCPTTGTMVVQWVRK  238

Query  1275  FPFFCSDREYIIGRR  1319
             FPFFCSDREYI+ RR
Sbjct  239   FPFFCSDREYIMARR  253



>gb|KHG16904.1| StAR-related lipid transfer 7, mitochondrial [Gossypium arboreum]
Length=433

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/250 (53%), Positives = 166/250 (66%), Gaps = 19/250 (8%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL-------CA  773
             M LVS  LEI ++P+IGDV+ ELM+F  P+W+AV++GVLVGWAWKP+WAN+       CA
Sbjct  1     MVLVSVFLEILRKPTIGDVLKELMIFIAPLWIAVIVGVLVGWAWKPKWANIGREMMIDCA  60

Query  774   srdsfdsfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQEN  953
                      S S+       F+  SS+ ++K  +P C SWI+++ + S   +    +  N
Sbjct  61    VSKDSTPASSDSS----STSFNLISSLNSIKFLLPSCISWITDDEAQSDPFSLLPTVDSN  116

Query  954   --------DKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPP  1109
                      K+  V   DL H   LVEEKD GPAWI MMD S   M YQAW+RD E GP 
Sbjct  117   CSSSQIPKGKTSFVTNEDLEHFVNLVEEKDGGPAWIHMMDCSTPTMFYQAWQRDLEAGPT  176

Query  1110  QYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFC  1289
             +YRSRTV+ED TPEMVRDFFWDDEFR KWD+ML+ A T+E+ P+TGTMVV WVRKFPFFC
Sbjct  177   EYRSRTVFEDTTPEMVRDFFWDDEFRPKWDNMLVSAATMEECPTTGTMVVHWVRKFPFFC  236

Query  1290  SDREYIIGRR  1319
             SDREY+ GRR
Sbjct  237   SDREYVFGRR  246



>gb|KJB39548.1| hypothetical protein B456_007G018700 [Gossypium raimondii]
Length=433

 Score =   258 bits (659),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 165/246 (67%), Gaps = 11/246 (4%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrd---s  785
             M LVS  LEI ++P+IGDV+ ELM+F  P+W+AV++GVLVGWAWKP+WAN+        S
Sbjct  1     MVLVSVFLEILRKPTIGDVLKELMIFIAPLWIAVIVGVLVGWAWKPKWANIGREMMIDCS  60

Query  786   fdsfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQEN----  953
                  + S+  +  + F+  SS+ ++K  +P C SWI ++ + S   +    +  N    
Sbjct  61    VSKDSTPSSSDSSSKSFNLISSLNSIKFLLPSCISWIIDDEAQSDPFSLPPTVDSNCSSS  120

Query  954   ----DKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRS  1121
                  K+  V   DL H   LVEEKD GPAWI MMD S   M YQAW+RD E GP +YRS
Sbjct  121   QIPKGKTSFVTNEDLEHFVNLVEEKDGGPAWIHMMDCSTPTMFYQAWQRDLEAGPTEYRS  180

Query  1122  RTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDRE  1301
             RTV+ED TPE VRDFFWDDEFR KWD+ML+ A T+E+ P+TGTMVV WVRKFPFFCSDRE
Sbjct  181   RTVFEDTTPETVRDFFWDDEFRPKWDNMLVSAATMEECPTTGTMVVHWVRKFPFFCSDRE  240

Query  1302  YIIGRR  1319
             Y+ GRR
Sbjct  241   YVFGRR  246



>ref|XP_010267382.1| PREDICTED: uncharacterized protein LOC104604645 [Nelumbo nucifera]
Length=449

 Score =   258 bits (658),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 148/262 (56%), Positives = 181/262 (69%), Gaps = 27/262 (10%)
 Frame = +3

Query  615   MALVSALLEIFQR-PSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfd  791
             MA+VSALLEI +R P+IGDV +ELMVF  P+W+AV++G++VGW+WKP+WANL   + +  
Sbjct  1     MAVVSALLEILERSPTIGDVFVELMVFFGPLWIAVLVGLVVGWSWKPKWANLGRDKLASS  60

Query  792   sfvsssTGINLQQVFSGFSS-IPALKL-----------------QIPKCFSWIseetsss  917
                SSS+  +     S  SS  PAL L                 Q+P C SWIS+++   
Sbjct  61    ISTSSSSSSSSSSSSSSPSSFFPALILSLSSGFGSMSSLSSLKSQLPSCISWISDDSLEK  120

Query  918   ltpnsssplQ--------ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSY  1073
              T +  S           E + S VV   DL HL QLVE KD GPAWI MMDRS   MSY
Sbjct  121   ETFSLPSTTNPDCGSSQLERETSVVVTGEDLEHLSQLVEVKDGGPAWIHMMDRSTPTMSY  180

Query  1074  QAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTM  1253
             QAWRRDPETGPP+YRSRTV+EDATPEMVRDFFWDDEFR+KWDDMLI++ T+++  +TGTM
Sbjct  181   QAWRRDPETGPPEYRSRTVFEDATPEMVRDFFWDDEFRSKWDDMLIYSATVDECSTTGTM  240

Query  1254  VVQWVRKFPFFCSDREYIIGRR  1319
             +V W+RKFPFFCSDREYIIGRR
Sbjct  241   IVHWIRKFPFFCSDREYIIGRR  262



>ref|XP_004145876.1| PREDICTED: uncharacterized protein LOC101209462 [Cucumis sativus]
Length=427

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 163/243 (67%), Gaps = 11/243 (5%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             MA+ S +LE  +  +I D++ ++++F   +WV +++GVLVGW WKP+WAN   S     +
Sbjct  1     MAVDSYVLETAEASTIYDLVFKVLMFVARLWVGIIVGVLVGWIWKPKWAN---SGRDLFN  57

Query  795   fvsssTGINLQQVFSG-FSSIPALKLQIPKCFSWIseetsssltpnsssplQ-------E  950
                    +     F G  S + +LK Q+P+C +  S           S           E
Sbjct  58    SSKLKDNLPSSSCFVGSISRLNSLKTQLPRCLNLTSNCGDEKEALADSPTPSISSSSKLE  117

Query  951   NDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTV  1130
              +K   + E DL +LY+LVEEKD GP+WIQMMDRS   MSYQAWRRDP+TGPPQYRSRTV
Sbjct  118   GEKLARLTEEDLKNLYRLVEEKDGGPSWIQMMDRSTATMSYQAWRRDPQTGPPQYRSRTV  177

Query  1131  YEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYII  1310
             +EDATP+MVRDFFWDDEFR KWDDMLI A+TLED  +TGTM V+WVRKFPFFCSDREY+I
Sbjct  178   FEDATPQMVRDFFWDDEFRKKWDDMLISAQTLEDCSATGTMAVRWVRKFPFFCSDREYVI  237

Query  1311  GRR  1319
             GRR
Sbjct  238   GRR  240



>ref|XP_008437458.1| PREDICTED: uncharacterized protein LOC103482874 [Cucumis melo]
Length=427

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/243 (53%), Positives = 163/243 (67%), Gaps = 11/243 (5%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             MA+ S +LE  +  +  D++ ++++F   +WV +++GVLVGW WKP+WAN   S     +
Sbjct  1     MAVDSYVLETAEASTAYDLVFKVLMFVARLWVGIIVGVLVGWIWKPKWAN---SGRVLFN  57

Query  795   fvsssTGINLQQVFSG-FSSIPALKLQIPKCFSWIseetsssltpnsssplQ-------E  950
                    +     F G  S + +LK+Q+P+C +  S           S           E
Sbjct  58    SSKLKNNLPSSSCFVGSISRLNSLKIQLPRCLNLTSNCGDEKEVLADSPTPSISSSSKLE  117

Query  951   NDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTV  1130
              +K   + E DL +LY+LVEEKD GP+WIQMMDRS   MSYQAWRRDP+TGPPQYRSRTV
Sbjct  118   GEKIARLTEEDLKNLYRLVEEKDGGPSWIQMMDRSTATMSYQAWRRDPQTGPPQYRSRTV  177

Query  1131  YEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYII  1310
             +EDATP+MVRDFFWDDEFR KWDDMLI A+TLED  +TGTM V+WVRKFPFFCSDREY+I
Sbjct  178   FEDATPQMVRDFFWDDEFRMKWDDMLISAQTLEDCSATGTMAVRWVRKFPFFCSDREYVI  237

Query  1311  GRR  1319
             GRR
Sbjct  238   GRR  240



>gb|KJB37444.1| hypothetical protein B456_006G204800 [Gossypium raimondii]
 gb|KJB37445.1| hypothetical protein B456_006G204800 [Gossypium raimondii]
Length=436

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 172/249 (69%), Gaps = 14/249 (6%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsr----d  782
             M LVS   EI ++P+IGDV+ EL++F  P+WVAV++GVLVGWAWKP+WA +         
Sbjct  1     MGLVSVFWEILKKPTIGDVVRELLIFIAPLWVAVIVGVLVGWAWKPKWATIGREMFMDCS  60

Query  783   sfdsfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssl------tpnssspl  944
                    + +  +    F    S+  +K Q+P   SWIS++ +         T +S+   
Sbjct  61    GSKDSAPAESSESSFSGFGSLPSLNLIKFQLPSVISWISDDGAQKDSFFLSPTLHSNCSS  120

Query  945   QENDKSRV--VDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYR  1118
              +N+K ++  + ++DL HLY+LVEEKD GPAWI MMD+S   + YQAW+RD E GP QYR
Sbjct  121   SQNEKQKLGFLTDDDLEHLYKLVEEKDGGPAWIHMMDKSTPTIGYQAWQRDLEIGPTQYR  180

Query  1119  SRTVYEDATPEMVRDFFWDDEFRA--KWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCS  1292
             SRTV++DATPEMVRDFFWDDEFR+  KWD+ML+ AETLE  P+ GTMVVQWVRKFPFFCS
Sbjct  181   SRTVFDDATPEMVRDFFWDDEFRSKLKWDEMLLSAETLESSPTDGTMVVQWVRKFPFFCS  240

Query  1293  DREYIIGRR  1319
             DREY+IGRR
Sbjct  241   DREYLIGRR  249



>ref|XP_006840600.1| PREDICTED: uncharacterized protein LOC18430430 [Amborella trichopoda]
 gb|ERN02275.1| hypothetical protein AMTR_s00084p00028620 [Amborella trichopoda]
Length=410

 Score =   255 bits (651),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 129/241 (54%), Positives = 168/241 (70%), Gaps = 22/241 (9%)
 Frame = +3

Query  621   LVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfv  800
             + ++L EI Q PS+G+V++EL     P+W+AV++G+LVGW WKP+WA+            
Sbjct  1     MAASLFEIVQSPSLGNVVVELGSVLGPLWIAVLVGLLVGWVWKPKWAD------------  48

Query  801   sssTGINLQQV----FSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSR-  965
               S G+ +Q +    F+ FS + +LK+Q+P C +   +E ++     + +    + +S  
Sbjct  49    --SAGLLVQPICGFGFNSFSRLNSLKVQLPDCITRKHDERAAPEEILTVNSENNSSQSNR  106

Query  966   ---VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYE  1136
                VV   DL HL QLVE KD GPAWI MMDRS   M+YQAWRRDPET PPQYRSRTV+E
Sbjct  107   DEPVVTTEDLEHLCQLVEVKDGGPAWIHMMDRSTPTMNYQAWRRDPETAPPQYRSRTVFE  166

Query  1137  DATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGR  1316
             DATPE+VRDFFWDDEFRA WDDMLI++ TLE+ P TGTM+V W+RKFPFFCSDREY+IGR
Sbjct  167   DATPELVRDFFWDDEFRANWDDMLIYSATLEECPVTGTMMVHWIRKFPFFCSDREYMIGR  226

Query  1317  R  1319
             R
Sbjct  227   R  227



>gb|KHG30399.1| StAR-related lipid transfer 7, mitochondrial [Gossypium arboreum]
Length=436

 Score =   255 bits (651),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 138/252 (55%), Positives = 172/252 (68%), Gaps = 20/252 (8%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL-------CA  773
             M LVS   EI ++P+IGDV+ EL++F  P+WVAV++GVLVGWAWKP+WAN+       C+
Sbjct  1     MGLVSVFWEILKKPTIGDVVRELLIFIAPLWVAVIVGVLVGWAWKPKWANIGREMFMDCS  60

Query  774   srdsfdsfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseet--------sssltpn  929
                +     SS +  +        + I   K Q+    SWIS++         S +L  N
Sbjct  61    GSKNSAPAESSESSSSGFGSLPSLNLI---KFQLSSAISWISDDGPQKDSFFLSPTLHSN  117

Query  930   sssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPP  1109
              SS   E +K   + ++DL HLY+LVEEKD GPAWI MMD+S   M YQAW+RD E GP 
Sbjct  118   CSSSQNEKEKLGFLTDDDLEHLYKLVEEKDGGPAWIHMMDKSTPTMGYQAWQRDLEIGPT  177

Query  1110  QYRSRTVYEDATPEMVRDFFWDDEFRA--KWDDMLIHAETLEDHPSTGTMVVQWVRKFPF  1283
             QYRSRTV++DATPEMVRDFFWDDEFR+  KWD+ML+ AETLE  P+ GTMVVQWVRKFPF
Sbjct  178   QYRSRTVFDDATPEMVRDFFWDDEFRSKLKWDEMLLSAETLESSPTDGTMVVQWVRKFPF  237

Query  1284  FCSDREYIIGRR  1319
             FCSDREY+IGRR
Sbjct  238   FCSDREYLIGRR  249



>ref|XP_010251494.1| PREDICTED: uncharacterized protein LOC104593390 [Nelumbo nucifera]
Length=424

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 165/243 (68%), Gaps = 13/243 (5%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             MA+VSAL EI +RP+IGD+ +ELM F  P+W+AV++G++VGW+WKP+WA+L       D 
Sbjct  1     MAVVSALFEILERPNIGDIFMELMGFFGPLWIAVLVGIVVGWSWKPKWASL-----GRDK  55

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIPKCFSWI--------seetsssltpnsssplQE  950
               SS +        S    + +LK   P C S I        +  +  +      S   E
Sbjct  56    LDSSISNPPSLLPSSSSPRLSSLKATNPSCNSLIPDDGLEKETFSSPPTTDSVCGSSQLE  115

Query  951   NDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTV  1130
              +KS  + E DL  L QL E KD GPAW+ MMDRS  NMSYQAW+RDPE GPPQYR RTV
Sbjct  116   MEKSVAMTEEDLEFLCQLAEMKDGGPAWMHMMDRSTPNMSYQAWQRDPENGPPQYRFRTV  175

Query  1131  YEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYII  1310
             YEDATPEMVRDF+WDD+FR+KWDDML ++ TLE  P+TGTMVV W+RKFPFFCSDREYII
Sbjct  176   YEDATPEMVRDFYWDDDFRSKWDDMLKYSATLEQCPTTGTMVVHWIRKFPFFCSDREYII  235

Query  1311  GRR  1319
             GRR
Sbjct  236   GRR  238



>ref|XP_010553581.1| PREDICTED: uncharacterized protein LOC104823628 [Tarenaya hassleriana]
Length=430

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 138/247 (56%), Positives = 169/247 (68%), Gaps = 18/247 (7%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             M LVSAL EI +R + GD++ EL++F +P+W AVV+GVLVGW WKP+WAN    + +  S
Sbjct  1     MGLVSALPEIMRRHATGDMLSELIMFVSPLWAAVVLGVLVGWIWKPKWANFGVEKLTSSS  60

Query  795   fvsssTGINLQQVFSGFSSIPALK-LQIPKCFSWIseetsssltpnsssplQ--------  947
                +S+     +      SIP+L  L++P    WI +    + + +S S           
Sbjct  61    SPHASSDSTTSKF--NLCSIPSLNSLKLP----WIVDYGVRNDSLSSQSSQNSSFNSSLP  114

Query  948   ---ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYR  1118
                  ++S  V E+DL HL++LVE KD GPAWIQMMDR+    SYQAWRRDPE GPPQYR
Sbjct  115   SQVAKERSGFVTEDDLRHLWKLVEVKDGGPAWIQMMDRTNPTFSYQAWRRDPENGPPQYR  174

Query  1119  SRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDR  1298
             SRT +EDATPEMVRDFFWDD FRAKWDDMLI+A T E+   TGTMVVQWVRKFPFFCSDR
Sbjct  175   SRTFFEDATPEMVRDFFWDDGFRAKWDDMLIYASTHEECLETGTMVVQWVRKFPFFCSDR  234

Query  1299  EYIIGRR  1319
             EYIIGRR
Sbjct  235   EYIIGRR  241



>ref|XP_008778542.1| PREDICTED: uncharacterized protein LOC103698325 [Phoenix dactylifera]
 ref|XP_008778543.1| PREDICTED: uncharacterized protein LOC103698325 [Phoenix dactylifera]
Length=415

 Score =   247 bits (630),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 161/240 (67%), Gaps = 16/240 (7%)
 Frame = +3

Query  615   MALV-SALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfd  791
             MAL+  AL+EI ++P++GDV+ EL +F  P+W+AV++G+ VGWAW+PRWA      +   
Sbjct  1     MALILDALIEILRKPTVGDVVTELALFAAPLWIAVLVGLFVGWAWRPRWAAGLLGGEKAI  60

Query  792   sfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSR--  965
                   T           S + +LK Q+P   +      SS       +    + +S   
Sbjct  61    LGGRPVT-----------SRVDSLKAQLPGSVTCSVSGESSGNEAKMVAVCPPDAESENL  109

Query  966   VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDAT  1145
              V E DL HLY+LVE  D GP W +MMDR+  NMSYQAWRRDPETGPPQYRSRTV+EDAT
Sbjct  110   AVTEEDLEHLYKLVEVTDGGPVWHKMMDRTLPNMSYQAWRRDPETGPPQYRSRTVFEDAT  169

Query  1146  PEMVRDFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             PE+VRDFFWDDEFR K  WDDML++ +TL++ P+TGTMVV W+RKFP FCS+REYIIGRR
Sbjct  170   PEIVRDFFWDDEFRIKNGWDDMLLYHDTLKECPTTGTMVVHWIRKFPLFCSNREYIIGRR  229



>ref|XP_010934199.1| PREDICTED: uncharacterized protein LOC105054408 [Elaeis guineensis]
Length=419

 Score =   247 bits (630),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 129/240 (54%), Positives = 164/240 (68%), Gaps = 12/240 (5%)
 Frame = +3

Query  615   MALV-SALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfd  791
             MAL+  AL+EI ++P++G+V+ EL +F  P+W+AV++G+ VGWAW+PRWA   A      
Sbjct  1     MALILDALIEILRKPTVGNVVAELALFAAPLWIAVLVGLFVGWAWRPRWA---AGLVGGQ  57

Query  792   sfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSR--  965
             +       ++L +  S    + + K Q+P   S    + SS    +       + KS   
Sbjct  58    NVTLGGRRVHLSETLS----VDSFKAQLPSSISSSISDKSSGEEASMVVVRPPDGKSEEV  113

Query  966   VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDAT  1145
              V E DL HL QLVE  D GP W QMMDRS  NMSYQAWRRDP+TGPPQYRSRTV+EDAT
Sbjct  114   AVMEEDLEHLIQLVEVTDGGPMWHQMMDRSLPNMSYQAWRRDPKTGPPQYRSRTVFEDAT  173

Query  1146  PEMVRDFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             PE+VRDFFWDDEFR K  WDDML++ ETL++ P+TGTM+V W+RKFPFFCSDREY IGRR
Sbjct  174   PEIVRDFFWDDEFRIKNGWDDMLLYHETLKECPTTGTMLVHWIRKFPFFCSDREYTIGRR  233



>ref|XP_010920227.1| PREDICTED: uncharacterized protein LOC105044130 [Elaeis guineensis]
Length=419

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 167/248 (67%), Gaps = 28/248 (11%)
 Frame = +3

Query  615   MALV-SALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfd  791
             MAL+  AL+EI ++P+IGDV+ EL +F  P+W+AV++G+ VGWAW+PRWA          
Sbjct  1     MALILDALIEILRKPTIGDVVTELALFAAPLWIAVLVGLFVGWAWRPRWA----------  50

Query  792   sfvsssTGINLQQVFSG-------FSSIPALKLQIP---KCFSWIseetsssltpnsssp  941
                +   G+  + +  G        S + +L+ Q P    C  +             SSP
Sbjct  51    ---AGLVGVG-EAILGGRRVPPSETSRVNSLEAQPPGSISCSVFDECSGKVDKMVAVSSP  106

Query  942   lQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRS  1121
               E++K  V  E DL HL +LVEE D GP W ++MDR+   MSYQAWRRDPETGPPQYRS
Sbjct  107   DVESEKLAVTGE-DLEHLSKLVEETDGGPVWHKLMDRTLPTMSYQAWRRDPETGPPQYRS  165

Query  1122  RTVYEDATPEMVRDFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSD  1295
             RTV+EDATPE+VRDFFWDDEFR K  WD+ML+H ETL++ P+TGTMVVQW+RKFPFFCSD
Sbjct  166   RTVFEDATPEIVRDFFWDDEFRMKNGWDNMLLHHETLKECPTTGTMVVQWIRKFPFFCSD  225

Query  1296  REYIIGRR  1319
             REYIIGRR
Sbjct  226   REYIIGRR  233



>ref|XP_004309518.1| PREDICTED: uncharacterized protein LOC101297897 [Fragaria vesca 
subsp. vesca]
Length=438

 Score =   245 bits (626),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 131/254 (52%), Positives = 160/254 (63%), Gaps = 22/254 (9%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             M L SAL+EI  RP   +V  EL+ F TPIW+AV++GV VGWAW+P+W  +        S
Sbjct  1     MGLASALVEILGRP---EVFWELVKFITPIWIAVIVGVFVGWAWRPKWVTVVGRELLDSS  57

Query  795   fvsssTGINLQQVFSGFSSIPALKLQI-----------PKCFSWIseetsssltpnsssp  941
                 S+  +     S  SS P                 P C  W +++T           
Sbjct  58    SQKESSSSSSSSSASSSSSSPPAPATCGISISSLSSLLPNCIPWAADDTVEDRALTLPPT  117

Query  942   lQ--------ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPE  1097
                       E ++S  V++ DL H+ QLVEEKD GPAWI MM++S   M YQAWRRDP+
Sbjct  118   TNTDSSCSQIEKEESCSVNDEDLRHICQLVEEKDGGPAWIHMMNKSTPTMGYQAWRRDPQ  177

Query  1098  TGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKF  1277
             TGPPQYRSRTV+EDA+PE VRDFFWDDEFRAKWDDMLIHA TLE+ P+TGTM+V WVRKF
Sbjct  178   TGPPQYRSRTVFEDASPETVRDFFWDDEFRAKWDDMLIHASTLEECPTTGTMLVHWVRKF  237

Query  1278  PFFCSDREYIIGRR  1319
             PFFCSDR+Y+IGRR
Sbjct  238   PFFCSDRDYMIGRR  251



>ref|XP_002886329.1| hypothetical protein ARALYDRAFT_892929 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62588.1| hypothetical protein ARALYDRAFT_892929 [Arabidopsis lyrata subsp. 
lyrata]
Length=383

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 154/235 (66%), Gaps = 32/235 (14%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             M L+S+L  +F  P++G    +L+VF  P+W+AV  GVLVGW W+P+WA L         
Sbjct  1     MGLLSSL--VF--PALG--FSDLLVFVAPLWIAVAAGVLVGWFWRPKWAYL---------  45

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVVD  974
                               + P L    PK F   +    +S    SS    E +KS  V 
Sbjct  46    -----------------DTKPFLSDSSPKFFKLPTSILKTSSHSLSSPQADEKEKSGFVT  88

Query  975   ENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEM  1154
             ++D  HL++LVE KD GPAWIQMMDRS    SYQAWRRDPE GPPQYRSRTV+EDATPEM
Sbjct  89    DDDFRHLWKLVEVKDGGPAWIQMMDRSTPTFSYQAWRRDPENGPPQYRSRTVFEDATPEM  148

Query  1155  VRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             VRDFFWDDEFR+KWDDML+++ TLE   STGTMVVQWVRKFPFFCSDREYIIGRR
Sbjct  149   VRDFFWDDEFRSKWDDMLLYSSTLERCKSTGTMVVQWVRKFPFFCSDREYIIGRR  203



>ref|XP_007209198.1| hypothetical protein PRUPE_ppa006451mg [Prunus persica]
 gb|EMJ10397.1| hypothetical protein PRUPE_ppa006451mg [Prunus persica]
Length=411

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 151/223 (68%), Gaps = 12/223 (5%)
 Frame = +3

Query  687   VFTTPIWVAVVIGVLVGWAWKPRWANLCAsrds----fdsfvsssTGINLQQVFSGFSSI  854
             +F TP+W+AV++GV VGWAWKP+WA+L               SSS+       F    S+
Sbjct  1     MFITPLWIAVIVGVFVGWAWKPKWASLVGRDLLDCPISKQKESSSSSQTSSTCFGPIPSL  60

Query  855   PALKLQIPKCFSWIseetsssltpns--------ssplQENDKSRVVDENDLYHLYQLVE  1010
              +L+  +P    W +++ +     +         SS   E +KS +V   DL H+ QLVE
Sbjct  61    SSLRFLLPSYLPWAADDRNQKEALSMPPTTNPDFSSSQNEREKSGLVTNQDLRHICQLVE  120

Query  1011  EKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRA  1190
             EKD GPAWI MMDRS   M YQAWRRDPETGPPQYRS T+YEDATPE +RDFFWDDEFR+
Sbjct  121   EKDGGPAWIHMMDRSTPTMRYQAWRRDPETGPPQYRSSTIYEDATPEQLRDFFWDDEFRS  180

Query  1191  KWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             KWDDMLI+A TLE+ P+TGTM+V WVRKFPFFCSDREY+IGRR
Sbjct  181   KWDDMLIYASTLEECPTTGTMLVHWVRKFPFFCSDREYLIGRR  223



>ref|XP_009757290.1| PREDICTED: uncharacterized protein LOC104210169 [Nicotiana sylvestris]
Length=410

 Score =   241 bits (616),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 157/236 (67%), Gaps = 17/236 (7%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             MALV   L+IF R +IG + +E++    P+W+A  +G++VGW WKP+WA L         
Sbjct  1     MALVEEFLDIFGRSTIGAIFVEMVFCLGPVWIAFFVGIVVGWFWKPKWATLG--------  52

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQEND-KSRVV  971
                     N +  FS  SS  AL L            +S       S PLQ+N  ++  V
Sbjct  53    --------NRKFDFSMPSSPTALVLSPSNSSENEHFASSPQYDSAKSRPLQQNKFENLTV  104

Query  972   DENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPE  1151
              + D  HL+QLVE+KD GP W  MMDRS  +MSYQAW+RDPETGPPQY SRTVYEDATPE
Sbjct  105   TDEDFEHLFQLVEKKDGGPPWKHMMDRSVPHMSYQAWQRDPETGPPQYCSRTVYEDATPE  164

Query  1152  MVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             ++RDFFWDDEFR KWDDM+++AET+E+ P+TG MVV WVRKFPFFCSDREYIIGRR
Sbjct  165   LLRDFFWDDEFRLKWDDMIVNAETIEECPTTGMMVVHWVRKFPFFCSDREYIIGRR  220



>ref|XP_006391589.1| hypothetical protein EUTSA_v10023504mg [Eutrema salsugineum]
 gb|ESQ28875.1| hypothetical protein EUTSA_v10023504mg [Eutrema salsugineum]
Length=398

 Score =   241 bits (614),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 154/235 (66%), Gaps = 17/235 (7%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             M L S L E+   P   D    L+V   P+W+AV  GVLVGW W+P+WA L +       
Sbjct  1     MGLSSLLFEL-HIPGFSD----LLVLAAPLWIAVAAGVLVGWVWRPKWAYLTSGDVKLQ-  54

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVVD  974
                    ++    F  F+  P L LQ+P     + + +S      S  P  E +KS  V 
Sbjct  55    -------LSDSPNFFSFTFNP-LNLQLPTS---VLKTSSPDPPSLSPQPQAEKEKSGFVT  103

Query  975   ENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEM  1154
             E+D  HL++LVE KD GPAWIQMMDRS    SYQAWRRDPE GPPQYRSRT++EDATPEM
Sbjct  104   EDDFRHLWKLVEVKDGGPAWIQMMDRSTPTFSYQAWRRDPENGPPQYRSRTLFEDATPEM  163

Query  1155  VRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             VRDFFWDDEFR+KWDDML+++ TLE    TGTMVVQWVRKFPFFCSDREYIIGRR
Sbjct  164   VRDFFWDDEFRSKWDDMLLYSSTLEHCKDTGTMVVQWVRKFPFFCSDREYIIGRR  218



>ref|XP_010666130.1| PREDICTED: uncharacterized protein LOC104883331 [Beta vulgaris 
subsp. vulgaris]
Length=439

 Score =   242 bits (617),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 127/253 (50%), Positives = 171/253 (68%), Gaps = 18/253 (7%)
 Frame = +3

Query  615   MALVSALLEIFQRPSI--GDVILELMVFTTPIWVAVVIGVLVGWAWKPRW---------A  761
             M L+     I +RP+   G +++++M+F TPIW A ++G+++GW W+PRW          
Sbjct  1     MGLIEGFWGILERPTSIGGGLMIDIMLFITPIWTAFLVGLVIGWLWRPRWWESLDKNKFD  60

Query  762   NLCAsrdsfdsfvsssTGINLQQVFSGF------SSIPALKLQIPKCFSWIseetssslt  923
             +  +    F +  S+S G    Q F+ F      S   A++  I      +S + +   +
Sbjct  61    SFISKILDFSAPSSTSIGFPFIQSFTPFTMKFSSSKGQAVEEDISSNNENLSLQPTFGDS  120

Query  924   pnsssplQENDKSR-VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPET  1100
                SS L+  ++   VVD+ DL HL+++VEEKD GP+W+QMMDRS + MSY+AWRRDPET
Sbjct  121   SCRSSKLKGKEQEHPVVDQGDLVHLFKIVEEKDGGPSWMQMMDRSTSTMSYRAWRRDPET  180

Query  1101  GPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFP  1280
             GPPQYRS T++EDATPEMVRDFFWDDEFR KWD+MLIH+ETLE+  + GTMVVQWVRKFP
Sbjct  181   GPPQYRSSTIFEDATPEMVRDFFWDDEFRPKWDNMLIHSETLEESHTIGTMVVQWVRKFP  240

Query  1281  FFCSDREYIIGRR  1319
             FFCSDREYI+GRR
Sbjct  241   FFCSDREYIVGRR  253



>ref|XP_009798509.1| PREDICTED: uncharacterized protein LOC104244732 [Nicotiana sylvestris]
Length=425

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 156/242 (64%), Gaps = 15/242 (6%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWA-------NLCA  773
             M LV A +EI +RP+IG V +E+M+F  P+W+A ++G+ VGW WKP+WA       +  A
Sbjct  1     MVLVEAFMEILERPTIGAVFIEIMMFLGPVWIAFLLGITVGWIWKPKWASWKNCKFDFSA  60

Query  774   srdsfdsfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQEN  953
                      S S  + L +  S  SS    K   P   S++   +      +  S L   
Sbjct  61    PSSPTALVPSPSKSLELTETKSFHSS----KAHTPSFGSYVDAPSEIEQFESGPSQLN--  114

Query  954   DKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVY  1133
               +  + + DL HL+ LVE KD GP W  MMD S   MSYQAW+RDPE+GPP+Y SRTVY
Sbjct  115   --TLPITDEDLKHLWHLVERKDGGPPWKHMMDGSTPTMSYQAWQRDPESGPPEYCSRTVY  172

Query  1134  EDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIG  1313
             EDATPE++RDFFWDDEFR KWDDML+HAET+E+ P TGTM+V WVRKFPFFCSDREY+ G
Sbjct  173   EDATPELLRDFFWDDEFRLKWDDMLVHAETIEECPITGTMIVHWVRKFPFFCSDREYLFG  232

Query  1314  RR  1319
             RR
Sbjct  233   RR  234



>ref|XP_011084568.1| PREDICTED: uncharacterized protein LOC105166783 [Sesamum indicum]
Length=436

 Score =   239 bits (611),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 161/244 (66%), Gaps = 9/244 (4%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             MALV A LEI +RP+I  +I+ ++ F  P+W+A ++G++VGW WKPRWA+L   +  F +
Sbjct  1     MALVEAFLEILKRPTIWGMIIGMIQFLGPVWIAFLVGIMVGWVWKPRWASLGNCKFEFSA  60

Query  795   fvsssTGI-NLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQ--------  947
               S +  I +  Q F    S+ + K ++    S+ S+         S +           
Sbjct  61    PSSPAAVIPSPVQGFGSTQSLDSCKAKVANFGSYASDNGMGKEQIASQAVDDPVCSSSEL  120

Query  948   ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRT  1127
               + S ++   DL HL  LVE KD GP W  +MDRS  NM YQAW+R+PETGPPQY SRT
Sbjct  121   GKEDSVLITYEDLEHLCHLVERKDAGPPWKHVMDRSTQNMRYQAWQREPETGPPQYCSRT  180

Query  1128  VYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYI  1307
             VYEDATPE++RDFFWDDEFR +WDDML+HA  LE+ P+TGTM+V W+RKFPFFCSDREYI
Sbjct  181   VYEDATPELLRDFFWDDEFRLRWDDMLVHASILEECPTTGTMMVHWIRKFPFFCSDREYI  240

Query  1308  IGRR  1319
             IGRR
Sbjct  241   IGRR  244



>ref|XP_009604589.1| PREDICTED: uncharacterized protein LOC104099338 isoform X1 [Nicotiana 
tomentosiformis]
Length=425

 Score =   239 bits (609),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 156/242 (64%), Gaps = 15/242 (6%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWA-------NLCA  773
             M LV A  EI +RP+IG V +E+M+F  P+W+A ++G+ VGW WKP+WA       +  A
Sbjct  1     MVLVEAFTEILERPTIGAVFVEIMMFLGPVWIAFLLGITVGWIWKPKWASWKNCKFDFSA  60

Query  774   srdsfdsfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQEN  953
                      S    + L +  S  SS    K   P   S+ S   + S          + 
Sbjct  61    PSSPTVLVPSPPKNLELTETKSFHSS----KAHTP---SFGSCMDAPSEIEQFDIGPSQL  113

Query  954   DKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVY  1133
             +   + DE DL +L+ LVE KD GP W  MMDRS   MSYQAW+RDP++GPPQY SRTVY
Sbjct  114   NTLPITDE-DLEYLWHLVERKDGGPPWKHMMDRSTPTMSYQAWQRDPQSGPPQYCSRTVY  172

Query  1134  EDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIG  1313
             EDATPE++RDFFWDDEFR KWDDML+HAET+E+ P+TGTM+V WVRKFPFFCSDREYI G
Sbjct  173   EDATPELLRDFFWDDEFRLKWDDMLVHAETIEECPTTGTMIVHWVRKFPFFCSDREYIFG  232

Query  1314  RR  1319
             RR
Sbjct  233   RR  234



>ref|XP_010496633.1| PREDICTED: uncharacterized protein LOC104773688 [Camelina sativa]
Length=398

 Score =   236 bits (603),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 146/221 (66%), Gaps = 15/221 (7%)
 Frame = +3

Query  657   SIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGINLQQVF  836
             ++G    +L VF  P+W+AV  GVLVGW W+P+WA L        S   S    N    F
Sbjct  13    ALGFSSTDLFVFAAPLWIAVAAGVLVGWFWRPKWAYLSGDDSKLLSDSDSPKVFN----F  68

Query  837   SGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVVDENDLYHLYQLVEEK  1016
             + F  +P   L+ P            +    SS    E +KS  V ++D  HL++LVE K
Sbjct  69    TSFK-LPTSILKAPS----------HAKPSLSSPQAAEKEKSGFVTDDDFRHLWKLVEVK  117

Query  1017  DDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKW  1196
             D GP+WIQMMDRS    SYQAWRRDPE GPPQYRSRTV+EDATPEMVRDFFWDDEFR+KW
Sbjct  118   DGGPSWIQMMDRSTPTFSYQAWRRDPENGPPQYRSRTVFEDATPEMVRDFFWDDEFRSKW  177

Query  1197  DDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             DDML+++ TLE    TGTMVVQWVRKFPFFCSDREYIIGRR
Sbjct  178   DDMLLYSSTLERCKDTGTMVVQWVRKFPFFCSDREYIIGRR  218



>emb|CDP04991.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   237 bits (605),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 158/245 (64%), Gaps = 16/245 (7%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             MA+  A LEI  RP++G +++ +++   P+WVA ++GV++GWAWKPRWA+L   +  F +
Sbjct  1     MAVADAFLEILTRPTMGGMVVGVIMLLGPVWVAFLLGVMLGWAWKPRWASLGNCKFDFSA  60

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSR---  965
               S  + +    V S F + P      P   SW  + +          P  +   S    
Sbjct  61    PSSPCSSLLPSNVLS-FGAPPP-----PTFASWSPDTSVEQRQDTLPPPTDDAISSGFSQ  114

Query  966   -------VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSR  1124
                     V   DL HL  LV  +D GP W  MM+RS + MSYQAW+RDPETGPPQY SR
Sbjct  115   LKEEVPVAVTNEDLEHLCHLVGRRDGGPPWKHMMERSTSEMSYQAWQRDPETGPPQYCSR  174

Query  1125  TVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREY  1304
             TVYEDATPE++RDFFWDDEFR KWDDMLIHAETLE+ P++GTM+V W+RKFPFFCSDREY
Sbjct  175   TVYEDATPELLRDFFWDDEFRLKWDDMLIHAETLEECPTSGTMIVHWIRKFPFFCSDREY  234

Query  1305  IIGRR  1319
             IIGRR
Sbjct  235   IIGRR  239



>ref|XP_006347513.1| PREDICTED: uncharacterized protein LOC102587815 [Solanum tuberosum]
Length=419

 Score =   236 bits (603),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 152/239 (64%), Gaps = 15/239 (6%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             M LV   LEI +RP+IG V +E+MVF  P+W+A ++G+ VGW WKP+WA     +  F  
Sbjct  1     MVLVEEFLEILERPTIGAVFVEIMVFLGPVWIAFLVGITVGWIWKPKWAAWKNCKFDFSV  60

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRV--  968
               S S  +       GF S  A     P   S+    +             ++  SR+  
Sbjct  61    PSSPSASVPSTSKPLGFQSSEA---PTPSFASYADAGSEIEQF--------DSGPSRLNT  109

Query  969   --VDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDA  1142
               + + DL HL+ LVE KD GP W  MMD S  NMSYQAW+R PETGPPQY SRTVYEDA
Sbjct  110   LPISDEDLDHLWHLVERKDGGPTWKHMMDHSTPNMSYQAWQRHPETGPPQYCSRTVYEDA  169

Query  1143  TPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             TPE++RDFFWDDEFR KWDDML+HAET+E+ P+TG MVV WVRKFPFFCSDREYI  RR
Sbjct  170   TPELLRDFFWDDEFRVKWDDMLVHAETIEECPTTGMMVVHWVRKFPFFCSDREYIFARR  228



>ref|XP_010473737.1| PREDICTED: uncharacterized protein LOC104753141 [Camelina sativa]
Length=396

 Score =   235 bits (600),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 146/223 (65%), Gaps = 21/223 (9%)
 Frame = +3

Query  657   SIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGINLQQVF  836
             ++G    +L VF  P+W+AV  GVLVGW W+P+WA L                ++    F
Sbjct  13    ALGFSSTDLFVFAAPLWIAVAAGVLVGWFWRPKWAYLSGDDSKL---------LSDSPKF  63

Query  837   SGFSS--IPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVVDENDLYHLYQLVE  1010
               F+S  +P   L+ P            +    SS    E +KS  V ++D  HL++LVE
Sbjct  64    FNFTSFKLPTSILKTPS----------HAKPSLSSPQAAEKEKSGFVTDDDFRHLWKLVE  113

Query  1011  EKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRA  1190
              KD GP+WIQMMDRS    SYQAWRRDPE GPPQYRSRTV+EDATPEMVRDFFWDDEFR+
Sbjct  114   VKDGGPSWIQMMDRSTPTFSYQAWRRDPENGPPQYRSRTVFEDATPEMVRDFFWDDEFRS  173

Query  1191  KWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             KWDDML+++ TLE    TGTMVVQWVRKFPFFCSDREYIIGRR
Sbjct  174   KWDDMLLYSSTLERCKDTGTMVVQWVRKFPFFCSDREYIIGRR  216



>gb|ACJ84293.1| unknown [Medicago truncatula]
Length=249

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 154/222 (69%), Gaps = 24/222 (11%)
 Frame = +3

Query  660   IGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGINLQQVFS  839
             + D++  L+ F  P+W+AV+ GV+VGWAWKP+WA             + S   NL     
Sbjct  9     VMDILGNLVTFIAPLWIAVIFGVVVGWAWKPKWA---------IEPNNYSWSTNL-----  54

Query  840   GFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKS--RVVDENDLYHLYQLVEE  1013
                     K +IP  F++   +    L  +++S   E++K    +V E+DL +L +LVEE
Sbjct  55    -------FKFRIP-WFNYSELQNQPGLEYSATSSSGESEKGLRSIVTEHDLQNLCKLVEE  106

Query  1014  KDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAK  1193
             KD GPAWIQMMDRS  NM+YQAWRRD E GPPQYRSRTV+EDA+PE+VRDFFWDDEFR++
Sbjct  107   KDGGPAWIQMMDRSTPNMTYQAWRRDQENGPPQYRSRTVFEDASPELVRDFFWDDEFRSR  166

Query  1194  WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             WDDMLIHA T+++   TGTM+VQWVRKFPFFCSDREYIIGRR
Sbjct  167   WDDMLIHASTIQECEVTGTMMVQWVRKFPFFCSDREYIIGRR  208



>ref|XP_007039199.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Theobroma cacao]
 gb|EOY23700.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Theobroma cacao]
Length=437

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/237 (51%), Positives = 156/237 (66%), Gaps = 20/237 (8%)
 Frame = +3

Query  669   VILELMVFTTPIWVAVVIGVLVGWAWKPRWANL------CAsrdsfdsfvsssTGINLQQ  830
             +  E+MV+  P+W+A ++G++VGWAWKP+WA+       CA   S +  +  S   +   
Sbjct  1     MCTEMMVYMGPLWIAFLVGIIVGWAWKPKWASQGTQKLSCAVSKSLELSLPPSPSKSPMS  60

Query  831   VFSGFSSIP---ALKLQIPKCFSWIseetsssltpnsssplQEN-----------DKSRV  968
                   S P   +LK Q      W+ +  +   TP+ S    +N            +S V
Sbjct  61    PLKSIGSAPCLNSLKTQSQASKYWVIKNGAQGKTPSVSLSEYDNCSTCCSSQLIEGRSSV  120

Query  969   VDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATP  1148
             V E DL HL+QLVE +D GP+WI MMDRS  NMSYQAWRRDP+TGPPQYRS+TV+ED T 
Sbjct  121   VTEEDLKHLWQLVEMRDGGPSWIHMMDRSTPNMSYQAWRRDPKTGPPQYRSKTVFEDVTT  180

Query  1149  EMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             +MVRDFFWDDEFR KWDDML ++ T+E+ P+TGTMVVQW+RKFPFFCSDREYIIGRR
Sbjct  181   KMVRDFFWDDEFRPKWDDMLAYSATIEECPTTGTMVVQWIRKFPFFCSDREYIIGRR  237



>ref|XP_008234648.1| PREDICTED: uncharacterized protein LOC103333570 isoform X2 [Prunus 
mume]
Length=439

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 159/253 (63%), Gaps = 18/253 (7%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--------C  770
             MAL+ AL E+ +RP+       LMVF  PIW+ +++GV++GW+WKP+WA          C
Sbjct  1     MALIEALPELLERPANTMEYTGLMVFLCPIWMVLLVGVVIGWSWKPKWAPFGNGKDKFGC  60

Query  771   AsrdsfdsfvsssTGINLQQVFSGFSSIPALK---LQIPKCFSWIseetsssltpnsssp  941
             +    FD  + SS   +L     GFSS P L    L    C +   +      T  S S 
Sbjct  61    SVSKGFDFSLPSSPSRSLMSPLKGFSSAPCLNSFDLASQGCEALFMDRGFERTTSASPSE  120

Query  942   lQEN-------DKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPET  1100
               E        +KS VV E DL  L  LV+ KD GP WIQMM+RS   M+YQ W RDPE 
Sbjct  121   FDEGSTSQLNEEKSNVVTEEDLDLLCTLVDMKDGGPTWIQMMERSTPTMNYQGWCRDPEI  180

Query  1101  GPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFP  1280
             GPPQYRSRTVYEDATPE+VRDFFWDDEFR +WDDML H+ T+E+ P+TGTMVVQW+RKFP
Sbjct  181   GPPQYRSRTVYEDATPEIVRDFFWDDEFRLRWDDMLRHSTTIEECPTTGTMVVQWIRKFP  240

Query  1281  FFCSDREYIIGRR  1319
              FC DREYIIGRR
Sbjct  241   LFCKDREYIIGRR  253



>ref|XP_008234647.1| PREDICTED: uncharacterized protein LOC103333570 isoform X1 [Prunus 
mume]
Length=446

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 159/253 (63%), Gaps = 18/253 (7%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--------C  770
             MAL+ AL E+ +RP+       LMVF  PIW+ +++GV++GW+WKP+WA          C
Sbjct  1     MALIEALPELLERPANTMEYTGLMVFLCPIWMVLLVGVVIGWSWKPKWAPFGNGKDKFGC  60

Query  771   AsrdsfdsfvsssTGINLQQVFSGFSSIPALK---LQIPKCFSWIseetsssltpnsssp  941
             +    FD  + SS   +L     GFSS P L    L    C +   +      T  S S 
Sbjct  61    SVSKGFDFSLPSSPSRSLMSPLKGFSSAPCLNSFDLASQGCEALFMDRGFERTTSASPSE  120

Query  942   lQEN-------DKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPET  1100
               E        +KS VV E DL  L  LV+ KD GP WIQMM+RS   M+YQ W RDPE 
Sbjct  121   FDEGSTSQLNEEKSNVVTEEDLDLLCTLVDMKDGGPTWIQMMERSTPTMNYQGWCRDPEI  180

Query  1101  GPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFP  1280
             GPPQYRSRTVYEDATPE+VRDFFWDDEFR +WDDML H+ T+E+ P+TGTMVVQW+RKFP
Sbjct  181   GPPQYRSRTVYEDATPEIVRDFFWDDEFRLRWDDMLRHSTTIEECPTTGTMVVQWIRKFP  240

Query  1281  FFCSDREYIIGRR  1319
              FC DREYIIGRR
Sbjct  241   LFCKDREYIIGRR  253



>ref|XP_006302371.1| hypothetical protein CARUB_v10020442mg [Capsella rubella]
 gb|EOA35269.1| hypothetical protein CARUB_v10020442mg [Capsella rubella]
Length=388

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 142/222 (64%), Gaps = 22/222 (10%)
 Frame = +3

Query  654   PSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGINLQQV  833
             P++G    +L+VF  P+W+AV  GVLVGW W+P+WA L A      S           ++
Sbjct  9     PALG--FSDLLVFAAPLWIAVAAGVLVGWVWRPKWAYLSAHDSKLFSDSPKFFNFTSFKL  66

Query  834   FSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVVDENDLYHLYQLVEE  1013
              S      +  L  P+                      E +KS  V ++D  HL++LVE 
Sbjct  67    PSSILKTSSPSLSSPQA--------------------AEKEKSGFVTDDDFRHLWKLVEV  106

Query  1014  KDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAK  1193
             KD GP+WI MMDRS    SYQAWRRDPE GPPQYRSRTV+EDATPEMVRDFFWDDEFR+K
Sbjct  107   KDGGPSWIPMMDRSTPTFSYQAWRRDPENGPPQYRSRTVFEDATPEMVRDFFWDDEFRSK  166

Query  1194  WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             WDDML+++ TLE    TGTMVVQWVRKFPFFCSDREYIIGRR
Sbjct  167   WDDMLLYSSTLERCKDTGTMVVQWVRKFPFFCSDREYIIGRR  208



>ref|XP_007220046.1| hypothetical protein PRUPE_ppa026850mg [Prunus persica]
 gb|EMJ21245.1| hypothetical protein PRUPE_ppa026850mg [Prunus persica]
Length=409

 Score =   234 bits (597),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 152/243 (63%), Gaps = 28/243 (12%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--------C  770
             MAL+ AL E+ +RP+       LMVF  PIW+ +++GV++GW+WKP+WA          C
Sbjct  1     MALIEALPELSERPANTMEYTGLMVFLCPIWMVLLLGVVIGWSWKPKWAPFGNGKDKFGC  60

Query  771   AsrdsfdsfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQE  950
             +    FD  + SS   +L     GFSS P L                     +  +    
Sbjct  61    SVSKGFDFSLPSSPSRSLMSPLKGFSSAPCLN--------------------SFDTSQLN  100

Query  951   NDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTV  1130
              +KS  V E DL  L  LV+ KD GP WIQMM+RS   M+YQ W RDPE GPPQYRSRT+
Sbjct  101   EEKSNAVTEEDLDLLCTLVDMKDGGPTWIQMMERSTPTMNYQGWCRDPEIGPPQYRSRTI  160

Query  1131  YEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYII  1310
             YEDATPEMVRDFFWDDEFR +WDDML H+ T+E+ P+TGTMVVQW+RKFP FC DREYII
Sbjct  161   YEDATPEMVRDFFWDDEFRLRWDDMLRHSTTIEECPTTGTMVVQWIRKFPLFCKDREYII  220

Query  1311  GRR  1319
             GRR
Sbjct  221   GRR  223



>ref|XP_009397003.1| PREDICTED: uncharacterized protein LOC103981952 [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   234 bits (596),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 156/235 (66%), Gaps = 16/235 (7%)
 Frame = +3

Query  621   LVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfv  800
             +V AL E+ ++P++G V+ EL +   P+W+A ++G+L+GWAW+PRWA   A+     +  
Sbjct  4     VVDALTEVLRKPTMGGVVAELAILAAPLWIAALVGLLLGWAWRPRWATGIAAGGEKAADS  63

Query  801   sssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVVDEN  980
               +            SS P+  L  P         +  S +  SS P Q + +   V E 
Sbjct  64    VVA------------SSPPSDGLGGPSLDP--PMASLLSCSGGSSVPQQPDGEKSAVTEK  109

Query  981   DLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVR  1160
             DL HL +LVE  D GPAW +MM++S  NMSYQAW+RDP+TGPPQYRS +V+EDATPEMVR
Sbjct  110   DLQHLCKLVEMTDGGPAWRKMMEKSLPNMSYQAWQRDPQTGPPQYRSSSVFEDATPEMVR  169

Query  1161  DFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             DFFWDDEFR K  WDDML+   TLE+ PSTG MVVQWVRKFPFFCSDREYIIGRR
Sbjct  170   DFFWDDEFRIKNGWDDMLLQYSTLEECPSTGAMVVQWVRKFPFFCSDREYIIGRR  224



>ref|NP_176653.1| membrane related protein CP5 [Arabidopsis thaliana]
 gb|AAD38248.1|AC006193_4 Putative membrane related protein [Arabidopsis thaliana]
 gb|AEE34278.1| membrane related protein CP5 [Arabidopsis thaliana]
Length=385

 Score =   232 bits (592),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 123/236 (52%), Positives = 148/236 (63%), Gaps = 31/236 (13%)
 Frame = +3

Query  612   IMALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfd  791
             +M L S +   F      D    L+VF  P+W+AV  GVLVGW W+P+WA L +   S  
Sbjct  1     MMGLSSLVFTEFHSLGFSD----LIVFVAPLWIAVAAGVLVGWVWRPKWAYLDSKLLS--  54

Query  792   sfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVV  971
                               +S   L LQ+P            + + + +  L   +K+  V
Sbjct  55    ------------------NSPKFLNLQLPTSI-------LKTSSHHVNPSLSSKEKTGFV  89

Query  972   DENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPE  1151
              ++D  HL++LVE KD GP WIQMMDRS    SYQAWRRDPE GPPQYRSRTV+EDATPE
Sbjct  90    TDDDFRHLWKLVEVKDGGPCWIQMMDRSTPTFSYQAWRRDPENGPPQYRSRTVFEDATPE  149

Query  1152  MVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             MVRDFFWDDEFR+KWDDML+++ TLE    TGTMVVQWVRKFPFFCSDREYIIGRR
Sbjct  150   MVRDFFWDDEFRSKWDDMLLYSSTLERCKDTGTMVVQWVRKFPFFCSDREYIIGRR  205



>gb|AAM91533.1| membrane related protein CP5, putative [Arabidopsis thaliana]
 gb|AAN15331.1| membrane related protein CP5, putative [Arabidopsis thaliana]
Length=385

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/236 (52%), Positives = 148/236 (63%), Gaps = 31/236 (13%)
 Frame = +3

Query  612   IMALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfd  791
             +M L S +   F      D    L+VF  P+W+AV  GVLVGW W+P+WA L +   S  
Sbjct  1     MMGLSSLVFTEFHSLGFSD----LIVFVAPLWIAVAAGVLVGWVWRPKWAYLDSKLLS--  54

Query  792   sfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVV  971
                               +S   L LQ+P            + + + +  L   +K+  V
Sbjct  55    ------------------NSPKFLNLQLPTSI-------LKTSSHHVNPSLSSKEKTGFV  89

Query  972   DENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPE  1151
              ++D  HL++LVE KD GP WIQMMDRS    SYQAWRRDPE GPPQYRSRTV+EDATPE
Sbjct  90    TDDDFRHLWKLVEVKDGGPCWIQMMDRSTPTFSYQAWRRDPENGPPQYRSRTVFEDATPE  149

Query  1152  MVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             MVRDFFWDDEFR+KWDDML+++ TLE    TGTMVVQWVRKFPFFCSDREYIIGRR
Sbjct  150   MVRDFFWDDEFRSKWDDMLLYSSTLERCKDTGTMVVQWVRKFPFFCSDREYIIGRR  205



>ref|XP_004235020.1| PREDICTED: uncharacterized protein LOC101249155 [Solanum lycopersicum]
Length=419

 Score =   233 bits (594),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 153/239 (64%), Gaps = 15/239 (6%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             M LV    EI +RP+IG V +E+MVF  P+W+A ++G+ VGW WKP+WA     +  F  
Sbjct  1     MVLVEEFFEILERPTIGAVFVEIMVFLGPVWIAFLLGITVGWIWKPKWAAWKNCKFDFSL  60

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRV--  968
               S S  +       GF S  A     P   S++   +             ++  SR+  
Sbjct  61    PSSPSASVPSTSKPQGFHSDEA---PTPSFASYVDAGSEIEQF--------DSGPSRLNT  109

Query  969   --VDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDA  1142
               + + DL HL+ LVE KD GP W QMMD S +NMSYQAW+R  ETGPPQY SRTVYEDA
Sbjct  110   LPISDEDLDHLWHLVERKDGGPTWKQMMDHSTSNMSYQAWQRHLETGPPQYCSRTVYEDA  169

Query  1143  TPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             TPE++RDFF DDEFR KWDDML+HAET+E+ P+TGTMVV WVRKFPFFCSDREYI  RR
Sbjct  170   TPELLRDFFGDDEFRVKWDDMLVHAETVEECPTTGTMVVHWVRKFPFFCSDREYIFARR  228



>gb|KEH42916.1| mammalian STARD2 lipid-binding START domain protein [Medicago 
truncatula]
Length=395

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 149/219 (68%), Gaps = 22/219 (10%)
 Frame = +3

Query  666   DVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGINLQQVFSGF  845
             D++  L+ F  P+W+AV+ GV+VGWAWKP+WA             + S   NL       
Sbjct  11    DILGNLVTFIAPLWIAVIFGVVVGWAWKPKWA---------IEPNNYSWSTNL-------  54

Query  846   SSIPALKLQIP-KCFSWIseetsssltpnsssplQENDKSRVVDENDLYHLYQLVEEKDD  1022
                   K +IP   +S +  +     +  SSS   E     +V E+DL +L +LVEEKD 
Sbjct  55    -----FKFRIPWFNYSELQNQPGLEYSATSSSGESEKGLRSIVTEHDLQNLCKLVEEKDG  109

Query  1023  GPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDD  1202
             GPAWIQMMDRS  NM+YQAWRRD E GPPQYRSRTV+EDA+PE+VRDFFWDDEFR++WDD
Sbjct  110   GPAWIQMMDRSTPNMTYQAWRRDQENGPPQYRSRTVFEDASPELVRDFFWDDEFRSRWDD  169

Query  1203  MLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             MLIHA T+++   TGTM+VQWVRKFPFFCSDREYIIGRR
Sbjct  170   MLIHASTIQECEVTGTMMVQWVRKFPFFCSDREYIIGRR  208



>ref|XP_008785106.1| PREDICTED: stAR-related lipid transfer protein 7, mitochondrial-like 
[Phoenix dactylifera]
Length=419

 Score =   231 bits (590),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/236 (52%), Positives = 152/236 (64%), Gaps = 11/236 (5%)
 Frame = +3

Query  624   VSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvs  803
             + AL+ I  +P++GD + EL +   P+W+AV++G+ VGWAW+PRWA             +
Sbjct  5     LDALIGILGKPAVGDGVAELALVAAPLWIAVLVGLFVGWAWRPRWA-----ASLVGGEKA  59

Query  804   ssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSR--VVDE  977
             S  G  L    S  SS+ +LK Q+P   S      S     N +     + +S    V E
Sbjct  60    SLGGRRLPP--SKTSSVDSLKAQLPSSISSPVSGKSFGKEENMAVVSPADGESEKLAVTE  117

Query  978   NDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMV  1157
              DL HL QLVE  D GP W +MMDRS  +MSYQAWRRDP+ GP QYRSRTV+EDATPE+V
Sbjct  118   EDLEHLCQLVEVTDGGPVWHKMMDRSLPSMSYQAWRRDPKVGPSQYRSRTVFEDATPEIV  177

Query  1158  RDFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             RDFFWDDEFR K  WDDML++ E L++ P TGT VV W+RKFPFFCSDREY IGRR
Sbjct  178   RDFFWDDEFRIKNGWDDMLLYHEILKECPKTGTAVVHWIRKFPFFCSDREYTIGRR  233



>ref|XP_009413766.1| PREDICTED: uncharacterized protein LOC103995005 [Musa acuminata 
subsp. malaccensis]
Length=390

 Score =   231 bits (588),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 150/238 (63%), Gaps = 35/238 (15%)
 Frame = +3

Query  612   IMALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfd  791
             ++ ++ AL+EI +RP++ DV +EL  F  P+W+AV  G+L+GWAW+P WA   +     +
Sbjct  1     MVLILEALVEILRRPTVADVAVELAAFVAPLWIAVFAGLLLGWAWRPGWAAGLSGAVKTE  60

Query  792   sfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVV  971
             S  S              S+ P++K                       +  +   +   V
Sbjct  61    SAPS----------LGPHSAAPSMK-----------------------AVEERRSEKLAV  87

Query  972   DENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPE  1151
              E DL HL++LVE  D GP W +MMD+S  NM YQAWRRDPETGPPQYRS T+YED TPE
Sbjct  88    TEEDLQHLFRLVEVTDGGPEWHKMMDKSLPNMRYQAWRRDPETGPPQYRSSTLYEDVTPE  147

Query  1152  MVRDFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             +VRDFFWDDEFR K  WDDML+   TLE+ P+TGTMVVQWVRKFPFFCS+REYIIGRR
Sbjct  148   IVRDFFWDDEFRIKNGWDDMLLEHTTLEECPTTGTMVVQWVRKFPFFCSNREYIIGRR  205



>ref|XP_007143962.1| hypothetical protein PHAVU_007G117200g [Phaseolus vulgaris]
 gb|ESW15956.1| hypothetical protein PHAVU_007G117200g [Phaseolus vulgaris]
Length=396

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 150/220 (68%), Gaps = 33/220 (15%)
 Frame = +3

Query  678   ELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGINLQQVFSGFSSIP  857
             +L VF TP+W+AV++GV++GWAWKP+WA                           F    
Sbjct  18    DLAVFITPLWIAVIVGVILGWAWKPKWA---------------------------FDPKH  50

Query  858   AL-KLQIPKCFS---WIseetsssltpnsssplQENDKS--RVVDENDLYHLYQLVEEKD  1019
             AL KL+ P+  +     +   S++ T   SS  +E D S   VV E+DL HL++LVEEKD
Sbjct  51    ALQKLRPPRSPNPPDHTAFTYSTTSTSAGSSSAREKDASGNAVVTEHDLLHLWKLVEEKD  110

Query  1020  DGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWD  1199
              GPAWIQMMDRS   MSYQAWRRDPETGPPQYRSRTV+EDA+PE+VRDFFWDDEFR  WD
Sbjct  111   GGPAWIQMMDRSTPTMSYQAWRRDPETGPPQYRSRTVFEDASPELVRDFFWDDEFRLNWD  170

Query  1200  DMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             DMLIHA T+++   TG M+V WVRKFPFFCSDREYIIGRR
Sbjct  171   DMLIHASTIQECALTGAMMVHWVRKFPFFCSDREYIIGRR  210



>ref|XP_006652076.1| PREDICTED: uncharacterized protein LOC102712157 [Oryza brachyantha]
Length=407

 Score =   228 bits (582),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 151/238 (63%), Gaps = 19/238 (8%)
 Frame = +3

Query  612   IMALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfd  791
             + ALV  L  +F++P++  + +EL     P+WVAV++G+L+GWAW+PRWA          
Sbjct  1     MSALVDLLTAVFRQPTLKGLAVELASLAAPLWVAVLVGLLIGWAWRPRWA----------  50

Query  792   sfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVV  971
                 +  G N Q      +  PAL  +     S      +       ++   E D+   V
Sbjct  51    ---VAVVGDNDQAP----AGTPALPRRAAADDSCRKNGAAVVPRAAMAAAAPEEDEQLAV  103

Query  972   DENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPE  1151
                DL HL +LVEEKD GP+WI MM+++   M YQAWRRDPE GPPQYRS T++EDA+PE
Sbjct  104   GTGDLMHLRRLVEEKDGGPSWIHMMEKTQPEMRYQAWRRDPEGGPPQYRSSTIFEDASPE  163

Query  1152  MVRDFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             +VRDFFWDDEFR K  WDDML+  ETLE+   TGTMVV+WVRKFPFFCSDREYIIGRR
Sbjct  164   VVRDFFWDDEFRIKNTWDDMLLQHETLEECTRTGTMVVRWVRKFPFFCSDREYIIGRR  221



>ref|XP_010056033.1| PREDICTED: uncharacterized protein LOC104444124 [Eucalyptus grandis]
 gb|KCW72612.1| hypothetical protein EUGRSUZ_E01072 [Eucalyptus grandis]
Length=382

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/232 (52%), Positives = 148/232 (64%), Gaps = 34/232 (15%)
 Frame = +3

Query  624   VSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvs  803
             ++ +LEI +  + G  + E +V    + ++V++GVLVGW+W+P W +  A          
Sbjct  1     MAVVLEILRGAASGAFLGEALVLVACVGISVILGVLVGWSWRPGWVSRSAEDK-------  53

Query  804   ssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVVDEND  983
                           S  P      P   S            +SSS   E +KS +V+ +D
Sbjct  54    --------------SEAPTFA-DPPTAIS------------DSSSSRGEREKSGLVNGDD  86

Query  984   LYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRD  1163
             L HL +LVE KD GPAWIQMM++S   MSYQAWRRDPETGPPQYRSRTV+EDATPEMVRD
Sbjct  87    LEHLCRLVEVKDGGPAWIQMMEKSVPTMSYQAWRRDPETGPPQYRSRTVFEDATPEMVRD  146

Query  1164  FFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             FFWDDE R KWDDML+ A  LE+ P+TGTMVVQWVRKFPFFCSDREYIIGRR
Sbjct  147   FFWDDESRLKWDDMLVKASILEECPTTGTMVVQWVRKFPFFCSDREYIIGRR  198



>ref|XP_010544864.1| PREDICTED: uncharacterized protein LOC104817383 [Tarenaya hassleriana]
Length=419

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 165/243 (68%), Gaps = 23/243 (9%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             M L S L++I +R + GD+  E+++   P+W AVV+GV+VGW WKP+WA L     +  +
Sbjct  1     MGLTSGLVDIMRRQATGDMFAEVVMVVAPLWAAVVVGVVVGWIWKPKWAELGGETLTSST  60

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnssspl--------QE  950
                             F SIP+LKLQ+     WI++    + + +S +           E
Sbjct  61    SKF------------NFCSIPSLKLQL---LPWIADYGVGNYSQSSQNASFNRSLPPQVE  105

Query  951   NDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTV  1130
              ++S +V E+DL HL++LVE  D GPAWIQMMDRS    +YQAWRR+P+ GPPQYRSRTV
Sbjct  106   KERSGLVAEDDLRHLWKLVEVTDGGPAWIQMMDRSTPTFAYQAWRREPQNGPPQYRSRTV  165

Query  1131  YEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYII  1310
             +EDATPEMVRDFFWDDEFRAKWDDML+++ T E+   TGTMVVQWVRKFPFFCSDREYII
Sbjct  166   FEDATPEMVRDFFWDDEFRAKWDDMLLYSSTHEECRDTGTMVVQWVRKFPFFCSDREYII  225

Query  1311  GRR  1319
             GRR
Sbjct  226   GRR  228



>ref|XP_009382005.1| PREDICTED: phosphatidylcholine transfer protein-like [Musa acuminata 
subsp. malaccensis]
Length=396

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/240 (51%), Positives = 153/240 (64%), Gaps = 33/240 (14%)
 Frame = +3

Query  615   MALV-SALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfd  791
             MAL+  AL+EI ++P+  DV +EL +F  P+W+AV+ G+L+GWAW+P WA          
Sbjct  1     MALILEALVEISRKPNFADVAVELAMFAAPLWIAVLAGLLLGWAWRPGWA----------  50

Query  792   sfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSR--  965
                       L +  +  S+ P      P C +          +  ++    + D+S   
Sbjct  51    --------AGLVRALNPDSAPPPQ----PSCSA------GPDSSVATAPTKADGDRSEKL  92

Query  966   VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDAT  1145
              V E DL HL +LVE  D GP W +MMD+S  NM Y AWRRDPETGPPQYRS TVYEDAT
Sbjct  93    AVTEEDLEHLCRLVEVTDGGPVWHKMMDKSLPNMRYLAWRRDPETGPPQYRSSTVYEDAT  152

Query  1146  PEMVRDFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             PE++RDFFWDDEFR K  WDDML+   TL++ P+TGTMVVQWVRKFPFFCSDREYIIGRR
Sbjct  153   PEILRDFFWDDEFRIKNGWDDMLLQHTTLKECPTTGTMVVQWVRKFPFFCSDREYIIGRR  212



>ref|XP_004495515.1| PREDICTED: uncharacterized protein LOC101494889 [Cicer arietinum]
Length=399

 Score =   225 bits (573),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 122/233 (52%), Positives = 155/233 (67%), Gaps = 25/233 (11%)
 Frame = +3

Query  630   ALLEIFQRPSI--GDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvs  803
             +L+ +F + S+   D+I  L+ F  P+W+AV+ GV+VGWAWKP+WA              
Sbjct  2     SLIGVFHQSSVVVMDIIGSLVTFIAPLWIAVIFGVVVGWAWKPKWA-------------I  48

Query  804   ssTGINLQQVFSGFSSIPALKLQIP-KCFSWIseetsssltpnsssplQENDKSRVVDEN  980
                  +  Q F         K ++P    S +  +  SS + +S S   E     VV E+
Sbjct  49    DPNNYSWTQFF---------KFRVPWNTDSDLQSQPGSSYSTSSGSSESEKGLKCVVTEH  99

Query  981   DLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVR  1160
             DL +L +LVEEKD GPAWIQMMDRS   MSYQAWRRD E+GPPQYRSRTV+E+A+PE+VR
Sbjct  100   DLRYLSKLVEEKDGGPAWIQMMDRSTPTMSYQAWRRDQESGPPQYRSRTVFENASPELVR  159

Query  1161  DFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             DFFWDDE+R +WDDMLIHA T+++   TGTM+V WVRKFPFFCSDREYIIGRR
Sbjct  160   DFFWDDEYRLRWDDMLIHASTIQECEVTGTMIVHWVRKFPFFCSDREYIIGRR  212



>ref|XP_010035315.1| PREDICTED: uncharacterized protein LOC104424552 [Eucalyptus grandis]
Length=440

 Score =   225 bits (573),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/231 (52%), Positives = 150/231 (65%), Gaps = 17/231 (7%)
 Frame = +3

Query  678   ELMVFTTPIWVAVVIGVLVGWAWKPRWANL------CAsrdsfdsfvsssTGINLQQVFS  839
             ++ +F  P+WVA ++GV+VGWAWKP+WA+L      C      DS        ++     
Sbjct  7     DVALFLVPVWVAFLVGVVVGWAWKPKWASLGRVELSCPVLGQPDSSFPFLPSKSVMSPLK  66

Query  840   GFSSIPAL---KLQIPKC-FSWIseetsssltpnss-------splQENDKSRVVDENDL  986
             GF S P L   K+Q P   F  I    +     + S       S  +  + S ++ E D+
Sbjct  67    GFGSDPCLNPFKVQWPSFDFRSIDAVATKKEPMSQSPALFEDCSTSEAGEISTLLSEEDM  126

Query  987   YHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDF  1166
               L+ LVE KD GP+WI MMDR   +MSYQAWRRDP+TGPPQYRS+TV+EDATPEMVRDF
Sbjct  127   TQLWHLVEMKDGGPSWIHMMDRYTLSMSYQAWRRDPKTGPPQYRSQTVFEDATPEMVRDF  186

Query  1167  FWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             FWDD+FR+KWDDML  +  ++D PSTGTMVV W+RKFPFFCSDREYIIGRR
Sbjct  187   FWDDDFRSKWDDMLASSTNVDDCPSTGTMVVHWIRKFPFFCSDREYIIGRR  237



>gb|KCW46620.1| hypothetical protein EUGRSUZ_K00428 [Eucalyptus grandis]
Length=428

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/231 (52%), Positives = 150/231 (65%), Gaps = 17/231 (7%)
 Frame = +3

Query  678   ELMVFTTPIWVAVVIGVLVGWAWKPRWANL------CAsrdsfdsfvsssTGINLQQVFS  839
             ++ +F  P+WVA ++GV+VGWAWKP+WA+L      C      DS        ++     
Sbjct  7     DVALFLVPVWVAFLVGVVVGWAWKPKWASLGRVELSCPVLGQPDSSFPFLPSKSVMSPLK  66

Query  840   GFSSIPAL---KLQIPKC-FSWIseetsssltpnss-------splQENDKSRVVDENDL  986
             GF S P L   K+Q P   F  I    +     + S       S  +  + S ++ E D+
Sbjct  67    GFGSDPCLNPFKVQWPSFDFRSIDAVATKKEPMSQSPALFEDCSTSEAGEISTLLSEEDM  126

Query  987   YHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDF  1166
               L+ LVE KD GP+WI MMDR   +MSYQAWRRDP+TGPPQYRS+TV+EDATPEMVRDF
Sbjct  127   TQLWHLVEMKDGGPSWIHMMDRYTLSMSYQAWRRDPKTGPPQYRSQTVFEDATPEMVRDF  186

Query  1167  FWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             FWDD+FR+KWDDML  +  ++D PSTGTMVV W+RKFPFFCSDREYIIGRR
Sbjct  187   FWDDDFRSKWDDMLASSTNVDDCPSTGTMVVHWIRKFPFFCSDREYIIGRR  237



>ref|XP_010676932.1| PREDICTED: uncharacterized protein LOC104892647 [Beta vulgaris 
subsp. vulgaris]
Length=442

 Score =   224 bits (572),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 135/252 (54%), Positives = 168/252 (67%), Gaps = 18/252 (7%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             MAL++   E+ QRPSI D++L+LM+ T P+W+A+ +GV++GWAW+P WA+          
Sbjct  1     MALIALFFEVLQRPSIWDMLLDLMLLTVPLWIAIFVGVVLGWAWRPNWAHFGGGNGGEKG  60

Query  795   fvsssTGINLQQVFSG----FSSIPAL---KLQIPKCFSWIseetsss----------lt  923
                       +  FSG    F+SIP+L   K  +P   +W   ++               
Sbjct  61    ESQGFLISKNKSCFSGSVKGFNSIPSLTSLKSLLPN-LTWNLSDSCLEDANFNEQPGVSQ  119

Query  924   pnsssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETG  1103
              NSS    E +    V+E DL HLYQLVE +D GPAWI MMDRS  NM+YQAWRRDP TG
Sbjct  120   SNSSLSNYERNMPSAVNEADLRHLYQLVEVQDGGPAWIHMMDRSLANMTYQAWRRDPPTG  179

Query  1104  PPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPF  1283
             PPQYRSRTV+EDATPEMVRDFFWDD+FR KWDDMLIH  TLE+  +TGTM++QWVRKFPF
Sbjct  180   PPQYRSRTVFEDATPEMVRDFFWDDDFRFKWDDMLIHHATLEESQATGTMILQWVRKFPF  239

Query  1284  FCSDREYIIGRR  1319
             FCSDREY+IGRR
Sbjct  240   FCSDREYVIGRR  251



>ref|XP_006493201.1| PREDICTED: uncharacterized protein LOC102612642 [Citrus sinensis]
Length=383

 Score =   223 bits (567),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 144/215 (67%), Gaps = 18/215 (8%)
 Frame = +3

Query  675   LELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGINLQQVFSGFSSI  854
             +E++++   +WVA ++G+ +GW WKP+WA                +     ++    SS 
Sbjct  1     MEMILYLGAVWVAFLLGLFIGWLWKPKWA---------------ISRTKRHKLCESESST  45

Query  855   PALKLQIPKCFSWIseetsssltpnsssplQENDKSRVVDENDLYHLYQLVEEKDDGPAW  1034
             P  +LQI K         SS    NS +    + +S VV E DL HL++LVE KD GP W
Sbjct  46    PTQRLQIEKPRP---PPVSSPEFDNSCTSELNHGQSNVVTEEDLEHLWRLVEMKDGGPTW  102

Query  1035  IQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIH  1214
             I+MMDRS   MSYQAW RDP+TGPPQYR+ TVYED TPE+VRDFFWDD FR+KWDDML +
Sbjct  103   IKMMDRSTETMSYQAWGRDPKTGPPQYRTSTVYEDVTPELVRDFFWDDVFRSKWDDMLAY  162

Query  1215  AETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             + TLE+ P+TGTMVVQW+RKFPFFCSDREYIIGRR
Sbjct  163   STTLEECPTTGTMVVQWIRKFPFFCSDREYIIGRR  197



>gb|KGN49968.1| hypothetical protein Csa_5G146910 [Cucumis sativus]
Length=399

 Score =   223 bits (568),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 148/228 (65%), Gaps = 11/228 (5%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             MA+ S +LE  +  +I D++ ++++F   +WV +++GVLVGW WKP+WAN   S     +
Sbjct  1     MAVDSYVLETAEASTIYDLVFKVLMFVARLWVGIIVGVLVGWIWKPKWAN---SGRDLFN  57

Query  795   fvsssTGINLQQVFSG-FSSIPALKLQIPKCFSWIseetsssltpnsssplQ-------E  950
                    +     F G  S + +LK Q+P+C +  S           S           E
Sbjct  58    SSKLKDNLPSSSCFVGSISRLNSLKTQLPRCLNLTSNCGDEKEALADSPTPSISSSSKLE  117

Query  951   NDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTV  1130
              +K   + E DL +LY+LVEEKD GP+WIQMMDRS   MSYQAWRRDP+TGPPQYRSRTV
Sbjct  118   GEKLARLTEEDLKNLYRLVEEKDGGPSWIQMMDRSTATMSYQAWRRDPQTGPPQYRSRTV  177

Query  1131  YEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRK  1274
             +EDATP+MVRDFFWDDEFR KWDDMLI A+TLED  +TGTM V+WVRK
Sbjct  178   FEDATPQMVRDFFWDDEFRKKWDDMLISAQTLEDCSATGTMAVRWVRK  225



>ref|XP_002321959.2| hypothetical protein POPTR_0015s00730g [Populus trichocarpa]
 gb|EEF06086.2| hypothetical protein POPTR_0015s00730g [Populus trichocarpa]
Length=405

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/237 (50%), Positives = 150/237 (63%), Gaps = 27/237 (11%)
 Frame = +3

Query  615   MALVSALLEIFQRPS-IGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfd  791
             MAL+ AL E+ + PS +  V  E++    P+WVA +IG+++GW+WKP+W           
Sbjct  1     MALIEALYEVLENPSSMLGVCTEMVGLLGPLWVAFLIGLVLGWSWKPKWVT---------  51

Query  792   sfvsssTGINLQQVFSGFSSIPALKLQIP-KCFSWIseetsssltpnsssplQENDKSRV  968
                   T    + + S   S P   L  P K F                S  Q N   +V
Sbjct  52    RESDKLTCCVSKILDSSLPSSPCRSLMSPLKTFG---------------SFSQWNSFIQV  96

Query  969   VDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATP  1148
              +E DL HLYQLVE KD GP W+ MMDRS   MSY+AWRRDP+TGPPQYRS TV+E+A+P
Sbjct  97    TEE-DLEHLYQLVEVKDGGPTWMHMMDRSTPTMSYKAWRRDPKTGPPQYRSSTVFENASP  155

Query  1149  EMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             E+VRDFFWDD+FR KWDDML ++  L++ P+TGTM+V W+RKFPFFCSDREYIIGRR
Sbjct  156   EIVRDFFWDDDFRPKWDDMLSYSAILDECPTTGTMLVHWMRKFPFFCSDREYIIGRR  212



>ref|XP_010099429.1| hypothetical protein L484_003253 [Morus notabilis]
 gb|EXB78391.1| hypothetical protein L484_003253 [Morus notabilis]
Length=389

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 142/217 (65%), Gaps = 18/217 (8%)
 Frame = +3

Query  669   VILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGINLQQVFSGFS  848
             V   +++F  PIWVA ++GV+VGWAWKP+WA+     +   S   S +   L +     S
Sbjct  4     VCTGMIMFLVPIWVAFIVGVMVGWAWKPKWASFGNDNNLDFSSSPSKS---LDKKNLSLS  60

Query  849   SIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVVDENDLYHLYQLVEEKDDGP  1028
             S P  K   P  F+            N S+   +   S VV E DL HL  LVE KD GP
Sbjct  61    STPTDK---PSGFN------------NYSTLHIDEGNSSVVTEEDLEHLCLLVEMKDGGP  105

Query  1029  AWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDML  1208
              WI+MMDRS   M Y+ WRRDP+TGPPQYRS T++E+A PE+VRDFFWDD FR+KWDDML
Sbjct  106   TWIEMMDRSTPTMRYKGWRRDPKTGPPQYRSSTIFENAMPEIVRDFFWDDHFRSKWDDML  165

Query  1209  IHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
              ++ET+ + P+TGTMVVQW+RKFPFFC DREYIIGRR
Sbjct  166   AYSETISECPTTGTMVVQWIRKFPFFCKDREYIIGRR  202



>ref|XP_004307892.1| PREDICTED: uncharacterized protein LOC101306175 [Fragaria vesca 
subsp. vesca]
Length=439

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 151/258 (59%), Gaps = 32/258 (12%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             M L+ AL EI +   I     + ++   P+W A +IG+++GWAWKP+WA           
Sbjct  1     MGLIGALHEILEMVKIE--YTDFVMLLGPLWTAFLIGIVIGWAWKPKWATF----GQEKL  54

Query  795   fvsssTGINLQQV------------FSGFSSIPALKLQIPKCFSWIseetsssltpns--  932
               S S  ++L  +              GFSS P L        +WI      +       
Sbjct  55    NSSVSKALDLSSMPTSPARSVMSPPLKGFSSAPCL---FQGYEAWIINNAVHNAVQKRLS  111

Query  933   --------ssplQENDK-SRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWR  1085
                      S  Q N+K S VV + D+ HL QLV+ KD GP+WI MMDRS   M+ Q WR
Sbjct  112   PSPIEFDDQSTSQMNEKKSDVVAQEDVEHLCQLVDMKDGGPSWIHMMDRSTPTMTCQVWR  171

Query  1086  RDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQW  1265
             RDP+ GPPQYRSRTVYED TPE+VRDFFWDDEFR KWDDML  A TL++ P+TGTMVVQW
Sbjct  172   RDPKIGPPQYRSRTVYEDVTPELVRDFFWDDEFRLKWDDMLSEATTLDECPTTGTMVVQW  231

Query  1266  VRKFPFFCSDREYIIGRR  1319
             ++KFPFFC DREYIIGRR
Sbjct  232   IKKFPFFCKDREYIIGRR  249



>ref|XP_006441237.1| hypothetical protein CICLE_v10020581mg [Citrus clementina]
 gb|ESR54477.1| hypothetical protein CICLE_v10020581mg [Citrus clementina]
Length=383

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 142/215 (66%), Gaps = 18/215 (8%)
 Frame = +3

Query  675   LELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGINLQQVFSGFSSI  854
             +E++++   +WVA ++G+ +GW WKP+WA                +     ++    SS 
Sbjct  1     MEMILYLGAVWVAFLLGLFIGWLWKPKWA---------------ISRTKRHKLCESESST  45

Query  855   PALKLQIPKCFSWIseetsssltpnsssplQENDKSRVVDENDLYHLYQLVEEKDDGPAW  1034
             P  +LQI K         SS    NS +    + +S VV E DL HL++L E KD GP W
Sbjct  46    PTQRLQIEKPRP---PPVSSPEFDNSCTSELNHGQSNVVTEEDLEHLWRLAEMKDGGPTW  102

Query  1035  IQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIH  1214
             I+MMD S   MSYQAW RDP+TGPPQYR+ TVYED TPE+VRDFFWDD FR+KWDDML +
Sbjct  103   IKMMDHSTETMSYQAWGRDPKTGPPQYRTSTVYEDVTPELVRDFFWDDVFRSKWDDMLAY  162

Query  1215  AETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             + TLE+ P+TGTMV+QW+RKFPFFCSDREYIIGRR
Sbjct  163   STTLEECPTTGTMVIQWIRKFPFFCSDREYIIGRR  197



>gb|KJB52500.1| hypothetical protein B456_008G265200 [Gossypium raimondii]
Length=411

 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 146/231 (63%), Gaps = 22/231 (10%)
 Frame = +3

Query  684   MVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGINLQ---------QVF  836
             M++  P W+A ++G+LVGWAWKP+WA L   + S     S    +            + F
Sbjct  1     MLYLVPFWIAFLVGILVGWAWKPKWAELLTQKLSSVVSKSLELSLPSSSSMSPMFCLKNF  60

Query  837   SGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDK----------SRVVDENDL  986
                S + +L LQ P+  +W+ +      T + S    +N            S  + E DL
Sbjct  61    GSSSCLNSLNLQ-PE--AWVIDNGEQGKTLSVSPSEYDNSSTSRSVVNEGCSSAITEEDL  117

Query  987   YHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDF  1166
              HL QLVE +D GP W+ MMDRS  NMSYQAWRRDP+TGPPQYRSRTV+E+AT  +VRDF
Sbjct  118   KHLCQLVEMRDGGPTWMHMMDRSTPNMSYQAWRRDPKTGPPQYRSRTVFENATARIVRDF  177

Query  1167  FWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             FWDDEFR KWD ML ++ T+E+  +TGTMVV+W+RKFPFFCSDREYIIGRR
Sbjct  178   FWDDEFRPKWDHMLAYSATIEECSTTGTMVVRWIRKFPFFCSDREYIIGRR  228



>gb|EYU19693.1| hypothetical protein MIMGU_mgv1a0075021mg, partial [Erythranthe 
guttata]
Length=245

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 150/242 (62%), Gaps = 13/242 (5%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL----CAsrd  782
             MA V A LEI +RP+I      +M F  P+W A V+GV++GW W+PRWA      C    
Sbjct  1     MASVEAFLEILKRPTI----WGMMQFLGPVWFAFVLGVIMGWVWRPRWARASLGNCKFDV  56

Query  783   sfdsfvsssTGINLQQVFSGFSSIPALKLQ---IPKCFSWIseetsssltpnsssplQEN  953
             S  S  S+       + F    S+ +  L    + K    +          + S  ++E+
Sbjct  57    SAPSSPSTFVPAAPVKDFGMNQSLDSCLLDDNGLNKEQKALPAAVDGGAVCSQSELIKED  116

Query  954   DKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVY  1133
                 +V   D  HL QLVE KD GP W  MMDRS  NM +Q+ +RDPETGPPQY SRTVY
Sbjct  117   --GVLVMYEDFEHLRQLVERKDGGPPWKHMMDRSTQNMIFQSLQRDPETGPPQYCSRTVY  174

Query  1134  EDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIG  1313
             EDATPE++RDFFWDDEFR KWDDM++HA  +E+ P+TGTM+V W+RKFPFFCSDREYIIG
Sbjct  175   EDATPELLRDFFWDDEFRTKWDDMIVHAAIIEECPTTGTMMVHWIRKFPFFCSDREYIIG  234

Query  1314  RR  1319
             RR
Sbjct  235   RR  236



>ref|XP_006606420.1| PREDICTED: uncharacterized protein LOC100788121 [Glycine max]
 gb|KHN04990.1| StAR-related lipid transfer protein 7, mitochondrial [Glycine 
soja]
Length=392

 Score =   217 bits (553),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 126/229 (55%), Positives = 155/229 (68%), Gaps = 26/229 (11%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssT  812
             L  IFQ PS  D+I +L +F TP+W+AV++GV+VGWAWKP+WA                 
Sbjct  3     LFGIFQIPSFMDIITDLAMFITPLWIAVIVGVVVGWAWKPKWA-----------------  45

Query  813   GINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVVDENDLYH  992
               + +     F S      Q    F++           +SS+  ++   S VV E+DL H
Sbjct  46    -FHPKDALLKFRSPRPPNPQNDTAFTY--------SATSSSAREKDASGSPVVTEDDLLH  96

Query  993   LYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFW  1172
             L++LVEEKD G AWIQMMDRS   M+YQAWRRDPE+GPPQYRSRTV+EDA+PE+VRDFFW
Sbjct  97    LWKLVEEKDGGRAWIQMMDRSTPTMTYQAWRRDPESGPPQYRSRTVFEDASPELVRDFFW  156

Query  1173  DDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             DDEFR KWDDMLIHA T+++   TGTM+V WVRKFPFFCSDREYIIGRR
Sbjct  157   DDEFRLKWDDMLIHASTIQECVLTGTMMVHWVRKFPFFCSDREYIIGRR  205



>emb|CBI34612.3| unnamed protein product [Vitis vinifera]
Length=384

 Score =   216 bits (551),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 126/167 (75%), Gaps = 9/167 (5%)
 Frame = +3

Query  846   SSIP---ALKLQIPKCFSWI------seetsssltpnsssplQENDKSRVVDENDLYHLY  998
             +SIP   +LKLQ+P C SWI          + +   + S    + + S VV E+DL HL 
Sbjct  31    ASIPCLNSLKLQLPSCISWIGDDGIDKSLMAPTGDSDCSPSQLKAENSVVVAEDDLEHLC  90

Query  999   QLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDD  1178
             QLVE KD GPAWIQMMDRS   MSY+AWRRDP+TGPPQYRS T++EDATPE+VRDFFWDD
Sbjct  91    QLVEVKDGGPAWIQMMDRSTPTMSYKAWRRDPDTGPPQYRSSTIFEDATPELVRDFFWDD  150

Query  1179  EFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
              FR KWDDMLI+A TLE+ P+TGTM+V WVRKFPFFCSDREY+IGRR
Sbjct  151   GFRLKWDDMLIYAATLEECPTTGTMLVHWVRKFPFFCSDREYMIGRR  197



>ref|XP_011014759.1| PREDICTED: uncharacterized protein LOC105118489 isoform X2 [Populus 
euphratica]
Length=453

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/260 (46%), Positives = 164/260 (63%), Gaps = 26/260 (10%)
 Frame = +3

Query  615   MALVSALLEIFQRPS--IGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL-------  767
             MAL+ AL +I + PS  IG +  E + F  P+W++ +IG+++GW+WKP+W          
Sbjct  1     MALIEALYDILEHPSSMIG-LCTETVGFLGPLWISFLIGLIIGWSWKPKWVTRESDKLTS  59

Query  768   CAsrdsfdsfvss--sTGINLQQVFSGFSSIPALKLQIPKC-FSWIseetsssltpn---  929
             CAS+    S  SS   + +++ + F  FS   +  ++   C  SW+ +  ++    N   
Sbjct  60    CASKILESSLPSSPCRSLMSVLKSFGSFSQWNSFLVRSSNCEASWVVDNNNNLEHQNLSH  119

Query  930   ----------sssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQA  1079
                       S    ++++ + +V E DL HL QLVE KD G  WI MMDRS   M YQA
Sbjct  120   VPPTEYEDCRSQLNEEQSNIASLVTEEDLKHLNQLVEVKDGGSTWIHMMDRSTPTMRYQA  179

Query  1080  WRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVV  1259
             WRRDP+TGPPQYRS TV+EDA+PE+VRDFFWDD+FR KWDDML ++  L++   TGTM+V
Sbjct  180   WRRDPKTGPPQYRSSTVFEDASPEIVRDFFWDDDFRTKWDDMLAYSAILDECSITGTMLV  239

Query  1260  QWVRKFPFFCSDREYIIGRR  1319
              W+RKFPFFCSDREYIIGRR
Sbjct  240   HWIRKFPFFCSDREYIIGRR  259



>ref|XP_011014758.1| PREDICTED: uncharacterized protein LOC105118489 isoform X1 [Populus 
euphratica]
Length=454

 Score =   217 bits (553),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 120/261 (46%), Positives = 164/261 (63%), Gaps = 27/261 (10%)
 Frame = +3

Query  615   MALVSALLEIFQRPS--IGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL-------  767
             MAL+ AL +I + PS  IG +  E + F  P+W++ +IG+++GW+WKP+W          
Sbjct  1     MALIEALYDILEHPSSMIG-LCTETVGFLGPLWISFLIGLIIGWSWKPKWVTRESDKLTS  59

Query  768   CAsrdsfdsfvss--sTGINLQQVFSGFSSIPALKLQIPKC-FSWIseetsssltpn---  929
             CAS+    S  SS   + +++ + F  FS   +  ++   C  SW+ +  ++    N   
Sbjct  60    CASKILESSLPSSPCRSLMSVLKSFGSFSQWNSFLVRSSNCEASWVVDNNNNLEHQNLSH  119

Query  930   -----------sssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQ  1076
                        S    ++++ + +V E DL HL QLVE KD G  WI MMDRS   M YQ
Sbjct  120   VPPTEYEDCSRSQLNEEQSNIASLVTEEDLKHLNQLVEVKDGGSTWIHMMDRSTPTMRYQ  179

Query  1077  AWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMV  1256
             AWRRDP+TGPPQYRS TV+EDA+PE+VRDFFWDD+FR KWDDML ++  L++   TGTM+
Sbjct  180   AWRRDPKTGPPQYRSSTVFEDASPEIVRDFFWDDDFRTKWDDMLAYSAILDECSITGTML  239

Query  1257  VQWVRKFPFFCSDREYIIGRR  1319
             V W+RKFPFFCSDREYIIGRR
Sbjct  240   VHWIRKFPFFCSDREYIIGRR  260



>ref|NP_001052066.1| Os04g0119500 [Oryza sativa Japonica Group]
 emb|CAE01295.2| OSJNBa0020P07.12 [Oryza sativa Japonica Group]
 dbj|BAF13980.1| Os04g0119500 [Oryza sativa Japonica Group]
 gb|EAY92847.1| hypothetical protein OsI_14648 [Oryza sativa Indica Group]
 gb|EAZ29518.1| hypothetical protein OsJ_13592 [Oryza sativa Japonica Group]
 dbj|BAG88167.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89333.1| unnamed protein product [Oryza sativa Japonica Group]
Length=400

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/238 (48%), Positives = 149/238 (63%), Gaps = 26/238 (11%)
 Frame = +3

Query  612   IMALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfd  791
             + AL+  L+ +F++P++G V LEL     P+W+A ++G+L+GWAW+PRWA +        
Sbjct  1     MSALLDLLMGVFRQPTLGGVALELASLAAPLWLAALVGLLIGWAWRPRWALVVVGEAPPP  60

Query  792   sfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVV  971
                ++       ++ +      A+    P                       E D+   V
Sbjct  61    PRAAAEDSCRKNELVAAVPRT-AMAAAAP-----------------------EEDEGLAV  96

Query  972   DENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPE  1151
             D  DL HL +LVEEKD GPAWI MMD++   M YQAWRRDPE GPPQYRS T++EDA+PE
Sbjct  97    DTGDLMHLRRLVEEKDGGPAWIHMMDKTLPTMRYQAWRRDPEGGPPQYRSSTIFEDASPE  156

Query  1152  MVRDFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             +VRDFFWDDEFR K  WDDML+  +TLE+   TGTMV++WVRKFPFFCSDREYIIGRR
Sbjct  157   VVRDFFWDDEFRIKNTWDDMLLQHDTLEECTKTGTMVLRWVRKFPFFCSDREYIIGRR  214



>emb|CAH65950.1| H0716A07.8 [Oryza sativa Indica Group]
Length=400

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/238 (48%), Positives = 149/238 (63%), Gaps = 26/238 (11%)
 Frame = +3

Query  612   IMALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfd  791
             + AL+  L+ +F++P++G V LEL     P+W+A ++G+L+GWAW+PRWA +        
Sbjct  1     MSALLDLLMGVFRQPTLGGVALELAFLAAPLWLAALVGLLIGWAWRPRWALVVVGEAPPP  60

Query  792   sfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVV  971
                ++       ++ +      A+    P                       E D+   V
Sbjct  61    PRAAAEDSCRKNELVAAVPRT-AMAAAAP-----------------------EEDEGLAV  96

Query  972   DENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPE  1151
             D  DL HL +LVEEKD GPAWI MMD++   M YQAWRRDPE GPPQYRS T++EDA+PE
Sbjct  97    DTGDLMHLRRLVEEKDGGPAWIHMMDKTLPTMRYQAWRRDPEGGPPQYRSSTIFEDASPE  156

Query  1152  MVRDFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             +VRDFFWDDEFR K  WDDML+  +TLE+   TGTMV++WVRKFPFFCSDREYIIGRR
Sbjct  157   VVRDFFWDDEFRIKNTWDDMLLQHDTLEECTKTGTMVLRWVRKFPFFCSDREYIIGRR  214



>emb|CAG27307.1| membrane related protein [Oryza sativa Japonica Group]
Length=400

 Score =   215 bits (547),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 113/238 (47%), Positives = 151/238 (63%), Gaps = 26/238 (11%)
 Frame = +3

Query  612   IMALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfd  791
             + AL+  L+ +F++P++G V LEL     P+W+A ++G+L+GWAW+PRWA +        
Sbjct  1     MSALLDLLMGVFRQPTLGGVALELASLAAPLWLAALVGLLIGWAWRPRWALVVVGEAPPP  60

Query  792   sfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVV  971
                ++       ++ +           +P+                 ++   E D+   V
Sbjct  61    PRAAAEDSCRKNELVA----------VVPR--------------TAMAAAAPEEDEGLAV  96

Query  972   DENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPE  1151
             D  DL HL +LVEEKD GPAWI MMD++   M YQAWRRDPE GPPQYRS T++EDA+PE
Sbjct  97    DTGDLMHLRRLVEEKDGGPAWIHMMDKTLPTMCYQAWRRDPEGGPPQYRSSTIFEDASPE  156

Query  1152  MVRDFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             +VRDFFWDDEFR K  WDDML+  +TLE+   TGTMV++WVRKFPFFCSDREYIIGRR
Sbjct  157   VVRDFFWDDEFRIKNTWDDMLLQHDTLEECTKTGTMVLRWVRKFPFFCSDREYIIGRR  214



>ref|XP_002317804.2| hypothetical protein POPTR_0012s02830g [Populus trichocarpa]
 gb|EEE96024.2| hypothetical protein POPTR_0012s02830g [Populus trichocarpa]
Length=402

 Score =   214 bits (546),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 111/236 (47%), Positives = 145/236 (61%), Gaps = 29/236 (12%)
 Frame = +3

Query  615   MALVSALLEIFQRPS-IGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfd  791
             MAL+ AL +I + PS +  V  E + F  P+W++ +IG+++GW+WKP+W           
Sbjct  1     MALIEALYDILEHPSSMLGVRTETVGFLGPLWISFLIGLIIGWSWKPKWVTR--------  52

Query  792   sfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVV  971
                         ++ S  S I    L    C   IS+              ++++ + +V
Sbjct  53    ---------ESDKLASCVSKILESSLPSSPCRFLISQLNE-----------EQSNIASLV  92

Query  972   DENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPE  1151
              E DL HL QLVE KD G  WI MMDRS   M YQAWRRDP+TGPPQYRS TV+EDA+PE
Sbjct  93    TEEDLKHLNQLVEVKDGGSTWIHMMDRSTPTMRYQAWRRDPKTGPPQYRSSTVFEDASPE  152

Query  1152  MVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             +VRD FWDD+FR KWDDML ++  L++   TGTM+V W+RKFPFFCSDREYIIGRR
Sbjct  153   IVRDLFWDDDFRTKWDDMLAYSAILDECSITGTMLVHWIRKFPFFCSDREYIIGRR  208



>gb|KFK33976.1| hypothetical protein AALP_AA5G086000 [Arabis alpina]
Length=398

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 141/214 (66%), Gaps = 12/214 (6%)
 Frame = +3

Query  678   ELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGINLQQVFSGFSSIP  857
             +L +F TPIW+AV  GVLVGW W+P+WA L    D  D  VS +   +        S   
Sbjct  16    DLFLFVTPIWIAVAAGVLVGWVWRPKWAYLTGDGDDVDHKVSDNDDADKLSSSKLLSLFN  75

Query  858   ALKLQIPKCFSWIseetsssltpnsssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWI  1037
              L LQ+P             L  NS  P QE      V + D  HL++LVE KD GPAWI
Sbjct  76    PLNLQLP------------ILRTNSVPPPQEQSSGGFVTDEDFRHLWRLVEVKDGGPAWI  123

Query  1038  QMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHA  1217
              MMDRS  + SYQAWRRDP+ GPPQYRSRTV+EDATPEMVRDFFWDDEFR+ WDDML+ +
Sbjct  124   PMMDRSTPSFSYQAWRRDPQNGPPQYRSRTVFEDATPEMVRDFFWDDEFRSHWDDMLLLS  183

Query  1218  ETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
              TL+    TGTM+VQWVRKFPFFCSDREY+IGRR
Sbjct  184   STLDSSTDTGTMLVQWVRKFPFFCSDREYVIGRR  217



>ref|XP_003602373.1| StAR-related lipid transfer protein [Medicago truncatula]
Length=259

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 146/223 (65%), Gaps = 12/223 (5%)
 Frame = +3

Query  687   VFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGINLQQVFSGFSSI--PA  860
             +F +P+ +   +G++VGW WKP+W +  A      S +S S   +  + +S  S     +
Sbjct  13    MFMSPMLLVFFLGIIVGWLWKPKWISSLAKSFDLASPISDSPIFSPLKFYSSLSPCVNSS  72

Query  861   LKLQIPKCFSWI----------seetsssltpnsssplQENDKSRVVDENDLYHLYQLVE  1010
             + +Q P   S            S  + ++   ++SS     D S  V  +DL+HLY+LVE
Sbjct  73    ITMQTPNPDSLCINKEINKKGSSSSSPTNFDSSTSSNKSGEDTSNGVTIDDLHHLYKLVE  132

Query  1011  EKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRA  1190
             EKD G  WIQMMD+S   MSYQAWRR+P+ GPPQYRS T++EDATPEMVRD FWDD+FR 
Sbjct  133   EKDGGLPWIQMMDKSTPTMSYQAWRREPKDGPPQYRSSTIFEDATPEMVRDLFWDDQFRP  192

Query  1191  KWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             KWDDML+++ TLE+ P+TGTM VQW+RKFPFFC DREYIIGRR
Sbjct  193   KWDDMLVNSTTLEECPTTGTMKVQWIRKFPFFCKDREYIIGRR  235



>ref|XP_011043689.1| PREDICTED: uncharacterized protein LOC105139073 isoform X2 [Populus 
euphratica]
Length=456

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/263 (43%), Positives = 161/263 (61%), Gaps = 29/263 (11%)
 Frame = +3

Query  615   MALVSALLEIFQRPS--IGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsf  788
             MAL+ AL +I + PS  IG +  E + F  P+W++ +IG+++GW+WKP+W    + + + 
Sbjct  1     MALIEALYDILEHPSSMIG-LCTETVGFLGPLWISFLIGLIIGWSWKPKWVTRESDKLTS  59

Query  789   dsfvsssTGI---------NLQQVFSGFSSIPALKLQIPKC-FSWIseetsssltpnsss  938
                    + +         ++ + F  FS   +  ++   C  SW+ + ++++      +
Sbjct  60    CVSKILESSLLSSPCRSLMSVLESFGSFSQWNSFLVRSSNCEASWVVDNSNNNNNLEHQN  119

Query  939   pl----------------QENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMS  1070
                               ++++ + +V E DL HL QLVE KD G  WI MMDRS   M 
Sbjct  120   LSHVPPTEYEDCRSQLNEEQSNIATLVTEEDLKHLNQLVEVKDGGSTWIHMMDRSTPTMR  179

Query  1071  YQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGT  1250
             YQAWRRDP+TGPPQYRS TV+EDA+PE+VRDFFWDD+FR KWDDML ++  L++   TGT
Sbjct  180   YQAWRRDPKTGPPQYRSSTVFEDASPEIVRDFFWDDDFRTKWDDMLAYSAILDECSITGT  239

Query  1251  MVVQWVRKFPFFCSDREYIIGRR  1319
             M+V W+RKFPFFCSDREYIIGRR
Sbjct  240   MLVHWIRKFPFFCSDREYIIGRR  262



>ref|XP_011043688.1| PREDICTED: uncharacterized protein LOC105139073 isoform X1 [Populus 
euphratica]
Length=457

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/264 (43%), Positives = 158/264 (60%), Gaps = 30/264 (11%)
 Frame = +3

Query  615   MALVSALLEIFQRPS--IGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsf  788
             MAL+ AL +I + PS  IG +  E + F  P+W++ +IG+++GW+WKP+W    + + + 
Sbjct  1     MALIEALYDILEHPSSMIG-LCTETVGFLGPLWISFLIGLIIGWSWKPKWVTRESDKLTS  59

Query  789   dsfvsssTGI---------NLQQVFSGFSSIPALKLQIPKC-FSWIsee-----------  905
                    + +         ++ + F  FS   +  ++   C  SW+ +            
Sbjct  60    CVSKILESSLLSSPCRSLMSVLESFGSFSQWNSFLVRSSNCEASWVVDNSNNNNNLEHQN  119

Query  906   ------tsssltpnsssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNM  1067
                   T       S    ++++ + +V E DL HL QLVE KD G  WI MMDRS   M
Sbjct  120   LSHVPPTEYEDCSRSQLNEEQSNIATLVTEEDLKHLNQLVEVKDGGSTWIHMMDRSTPTM  179

Query  1068  SYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTG  1247
              YQAWRRDP+TGPPQYRS TV+EDA+PE+VRDFFWDD+FR KWDDML ++  L++   TG
Sbjct  180   RYQAWRRDPKTGPPQYRSSTVFEDASPEIVRDFFWDDDFRTKWDDMLAYSAILDECSITG  239

Query  1248  TMVVQWVRKFPFFCSDREYIIGRR  1319
             TM+V W+RKFPFFCSDREYIIGRR
Sbjct  240   TMLVHWIRKFPFFCSDREYIIGRR  263



>gb|KHG09152.1| StAR-related lipid transfer 7, mitochondrial [Gossypium arboreum]
 gb|KHG24117.1| StAR-related lipid transfer 7, mitochondrial [Gossypium arboreum]
Length=447

 Score =   214 bits (544),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 112/255 (44%), Positives = 159/255 (62%), Gaps = 28/255 (11%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             L+E+ ++ SI + +++++++  PIW+AV IG+ VGW+W+PRW  L   A R  F    ++
Sbjct  8     LMELLKKQSITETVVDILIYAVPIWLAVTIGLAVGWSWRPRWTGLVLLAFRSKFRFIWTA  67

Query  807   sTGINLQQVFSGFSSIPALK------------------------LQIPKCFSWIseetss  914
               G   ++++  F+++ A                          LQ P   +WIS E+ +
Sbjct  68    PPGFGARRLWLAFTALSAFSVFRTIFCNFIKRRFKESASDSSVPLQSPPPTAWISPESVA  127

Query  915   sltpnsssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDP  1094
                        E  +  +V ENDL HL  L+E KD    W +MM+R+ +NMSYQAWR++P
Sbjct  128   DAVSPGGRA--EEREQDIVTENDLAHLLHLLEGKDGEMEWQRMMERTTSNMSYQAWRQEP  185

Query  1095  ETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRK  1274
             E+GP  YRSRTV+EDATPE+VRDFFWDDEFR KWD ML + +TL++ P TG M+V W+RK
Sbjct  186   ESGPAIYRSRTVFEDATPEVVRDFFWDDEFRPKWDTMLAYFKTLDECPCTGLMIVHWIRK  245

Query  1275  FPFFCSDREYIIGRR  1319
             FPFFCSDR+YIIGRR
Sbjct  246   FPFFCSDRDYIIGRR  260



>gb|KDO45896.1| hypothetical protein CISIN_1g013902mg [Citrus sinensis]
Length=434

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/243 (44%), Positives = 157/243 (65%), Gaps = 14/243 (6%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsf---vs  803
             ++E  +RPSI + ++++++   PIW+AV+IG+++GW+W+PRW  L              +
Sbjct  8     MMEFLKRPSITETLVDILLCAVPIWLAVMIGLVIGWSWRPRWTGLVFLGLRSKFRFIWTA  67

Query  804   ssTGINLQQVFSGFSSIPAL----------KLQIPKCFSWIseetsssltpnsssplQEN  953
             +  G   ++++  F+++ A           K +  K  +  +      +  ++S   +  
Sbjct  68    APPGFGARRLWLAFTALSAFSACRVLWNNFKGKGTKSDAASAAAAGEGVDGDASPGARTA  127

Query  954   DKSR-VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTV  1130
             +K + VV ENDL HL QL+E KD    W  +M++S  NM+YQAWR +PETGP  YR+RTV
Sbjct  128   EKEQHVVTENDLEHLLQLLERKDGEIEWQTLMEKSTPNMTYQAWRSEPETGPAVYRTRTV  187

Query  1131  YEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYII  1310
             +E ATPE+VRDFFWDDEFR KWD ML + +TLE+ P TGTM+VQW++KFPFFCSDREYII
Sbjct  188   FEGATPELVRDFFWDDEFRRKWDHMLAYVKTLEECPLTGTMIVQWIKKFPFFCSDREYII  247

Query  1311  GRR  1319
             GRR
Sbjct  248   GRR  250



>ref|XP_006376667.1| hypothetical protein POPTR_0012s02830g [Populus trichocarpa]
 gb|ERP54464.1| hypothetical protein POPTR_0012s02830g [Populus trichocarpa]
Length=453

 Score =   213 bits (541),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/259 (43%), Positives = 156/259 (60%), Gaps = 24/259 (9%)
 Frame = +3

Query  615   MALVSALLEIFQRPS-IGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfd  791
             MAL+ AL +I + PS +  V  E + F  P+W++ +IG+++GW+WKP+W    + + +  
Sbjct  1     MALIEALYDILEHPSSMLGVRTETVGFLGPLWISFLIGLIIGWSWKPKWVTRESDKLASC  60

Query  792   sfvsssTGI---------NLQQVFSGFSSIPALKLQIPKC-FSWIseetsssltpn----  929
                   + +         +  + F  FS   +  ++   C  SW+ +  ++         
Sbjct  61    VSKILESSLPSSPCRFLMSPLKSFGSFSQWNSFLVRSSNCEASWVVDNNNNLEHQKPSHV  120

Query  930   ---------sssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAW  1082
                      S    ++++ + +V E DL HL QLVE KD G  WI MMDRS   M YQAW
Sbjct  121   PPTEYEDCRSQLNEEQSNIASLVTEEDLKHLNQLVEVKDGGSTWIHMMDRSTPTMRYQAW  180

Query  1083  RRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQ  1262
             RRDP+TGPPQYRS TV+EDA+PE+VRD FWDD+FR KWDDML ++  L++   TGTM+V 
Sbjct  181   RRDPKTGPPQYRSSTVFEDASPEIVRDLFWDDDFRTKWDDMLAYSAILDECSITGTMLVH  240

Query  1263  WVRKFPFFCSDREYIIGRR  1319
             W+RKFPFFCSDREYIIGRR
Sbjct  241   WIRKFPFFCSDREYIIGRR  259



>gb|AAD28760.1|AF130253_1 membrane related protein CP5 [Arabidopsis thaliana]
Length=387

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/237 (48%), Positives = 139/237 (59%), Gaps = 33/237 (14%)
 Frame = +3

Query  612   IMALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfd  791
             +M L S +   F      D    L+VF  P+W+AV  GVLVGW W+P+WA L +      
Sbjct  1     MMGLSSLVFTEFHSLGFSD----LIVFVAPLWIAVAAGVLVGWVWRPKWAYLDSKL----  52

Query  792   sfvsssTGINLQQVFSGFSSIPA-LKLQIPKCFSWIseetsssltpnsssplQENDKSRV  968
                               S+ P  L LQ+P            + + + +  L   +K+  
Sbjct  53    -----------------LSNSPKFLNLQLPTSI-------LKTSSHHVNPSLSSKEKTGF  88

Query  969   VDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATP  1148
             V ++D  HL++LVE KD GP WIQMMDRS    SYQAWRRDPE GPPQYRSRTV+EDATP
Sbjct  89    VTDDDFRHLWKLVEVKDGGPCWIQMMDRSTPTFSYQAWRRDPENGPPQYRSRTVFEDATP  148

Query  1149  EMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             EMVRDFFWDDEFR+KWDDML+++ TLE    TGTM      K P  CSDREYIIGRR
Sbjct  149   EMVRDFFWDDEFRSKWDDMLLYSSTLERCKDTGTMGCAMGAKVPLLCSDREYIIGRR  205



>ref|XP_006489530.1| PREDICTED: uncharacterized protein LOC102620401 [Citrus sinensis]
Length=434

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/243 (44%), Positives = 157/243 (65%), Gaps = 14/243 (6%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsf---vs  803
             ++E  +RPSI + ++++++   PIW+AV+IG+++GW+W+PRW  L              +
Sbjct  8     MMEFLKRPSITETLVDILLCAVPIWLAVMIGLVIGWSWRPRWTGLVFLGLRSKFRFIWTA  67

Query  804   ssTGINLQQVFSGFSSIPAL----------KLQIPKCFSWIseetsssltpnsssplQEN  953
             +  G   ++++  F+++ A           K +  K  +  +      +  ++S   +  
Sbjct  68    APPGFGARRLWLAFTALSAFSACRVLWNNFKGKGTKSDAASAAAAGEGVDGDASPGARTA  127

Query  954   DKSR-VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTV  1130
             +K + VV ENDL HL QL+E KD    W  +M++S  NM+YQAWR +PETGP  YR+RTV
Sbjct  128   EKEQHVVTENDLEHLLQLLERKDGEMEWQTLMEKSTPNMTYQAWRCEPETGPAVYRTRTV  187

Query  1131  YEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYII  1310
             +E ATPE+VRDFFWDDEFR KWD ML + +TLE+ P TGTM+VQW++KFPFFCSDREYII
Sbjct  188   FEGATPELVRDFFWDDEFRRKWDHMLAYVKTLEECPLTGTMIVQWIKKFPFFCSDREYII  247

Query  1311  GRR  1319
             GRR
Sbjct  248   GRR  250



>gb|AAL57201.1|AF355597_1 putative nodule membrane protein [Medicago sativa]
Length=424

 Score =   211 bits (537),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 145/223 (65%), Gaps = 12/223 (5%)
 Frame = +3

Query  687   VFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGINLQQVFSGFSSI--PA  860
             +F +P+ +   +GV+VGW WKP+W    A      S +S S   +  + +S  S     +
Sbjct  13    MFMSPMLLVFFLGVIVGWLWKPKWIVSLAKSFDLASPISDSPIFSPLKFYSSLSPCVNSS  72

Query  861   LKLQIPKCFSWIseetsssltpnsssplQ----------ENDKSRVVDENDLYHLYQLVE  1010
             + +Q P   S    +  +    +SSSP +            D S  V  NDL+HLY+LVE
Sbjct  73    ITMQNPNPDSLCINKEINKKGSSSSSPTKFDSSTSSQKSGEDTSNGVTINDLHHLYKLVE  132

Query  1011  EKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRA  1190
             EKD G  WIQMMD+S   MSYQAWRR+P+ GPPQYRS T++EDATPEMVRD FWDD+FR 
Sbjct  133   EKDGGLPWIQMMDKSTPTMSYQAWRREPKDGPPQYRSSTIFEDATPEMVRDLFWDDQFRP  192

Query  1191  KWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             KWDDML+++ TLE+ P+TGTM VQW+RKFPFFC DREYIIGRR
Sbjct  193   KWDDMLVNSTTLEECPTTGTMKVQWIRKFPFFCKDREYIIGRR  235



>ref|XP_003602372.1| StAR-related lipid transfer protein [Medicago truncatula]
 gb|AES72623.1| membrane-related protein CP5, putative [Medicago truncatula]
Length=424

 Score =   211 bits (536),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 147/223 (66%), Gaps = 12/223 (5%)
 Frame = +3

Query  687   VFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGINLQQVFSGFSSI--PA  860
             +F +P+ +   +G++VGW WKP+W +  A      S +S S   +  + +S  S     +
Sbjct  13    MFMSPMLLVFFLGIIVGWLWKPKWISSLAKSFDLASPISDSPIFSPLKFYSSLSPCVNSS  72

Query  861   LKLQIPK----CFS------WIseetsssltpnsssplQENDKSRVVDENDLYHLYQLVE  1010
             + +Q P     C +        S  + ++   ++SS     D S  V  +DL+HLY+LVE
Sbjct  73    ITMQTPNPDSLCINKEINKKGSSSSSPTNFDSSTSSNKSGEDTSNGVTIDDLHHLYKLVE  132

Query  1011  EKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRA  1190
             EKD G  WIQMMD+S   MSYQAWRR+P+ GPPQYRS T++EDATPEMVRD FWDD+FR 
Sbjct  133   EKDGGLPWIQMMDKSTPTMSYQAWRREPKDGPPQYRSSTIFEDATPEMVRDLFWDDQFRP  192

Query  1191  KWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             KWDDML+++ TLE+ P+TGTM VQW+RKFPFFC DREYIIGRR
Sbjct  193   KWDDMLVNSTTLEECPTTGTMKVQWIRKFPFFCKDREYIIGRR  235



>ref|XP_004952047.1| PREDICTED: uncharacterized protein LOC101765043 isoform X2 [Setaria 
italica]
Length=421

 Score =   210 bits (534),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 103/235 (44%), Positives = 152/235 (65%), Gaps = 3/235 (1%)
 Frame = +3

Query  621   LVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfv  800
             ++SA+  + ++P+    + E+ +   P+W A +IG+L+GWAW+PRWA    +     +  
Sbjct  4     VLSAVARVLEQPTAWGAVWEMALLAGPLWAAALIGLLLGWAWRPRWAAGLVATADGSAAA  63

Query  801   sssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVVDEN  980
              +        +    + +PA +L+ P  ++  + +        +    +  ++   V + 
Sbjct  64    PAPAQAPFATLDFWKAQLPA-RLRAPLGYAGTAVQQREEDKAAAQGSSEMANEELAVGKE  122

Query  981   DLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVR  1160
             DL +L++LVE +D GPAWI+MM++S   M+YQAWRRD +TGPPQY+S T++E+ATPE VR
Sbjct  123   DLVNLWRLVEGRDGGPAWIKMMEKSLPTMTYQAWRRDAQTGPPQYQSSTIFENATPEEVR  182

Query  1161  DFFWDDEFRA--KWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             DFF DDEFR   KWDDMLI+ +TLE+  +TGTM V WVRKFPFFCSDREYIIGRR
Sbjct  183   DFFGDDEFRMSNKWDDMLIYHKTLEECQTTGTMKVHWVRKFPFFCSDREYIIGRR  237



>ref|XP_003526760.1| PREDICTED: uncharacterized protein LOC100802806 [Glycine max]
Length=443

 Score =   210 bits (535),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 155/258 (60%), Gaps = 23/258 (9%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             M    +  ++F+ P+I  +   + +F +P+WV    GV+VGW WKP+WA L   + +   
Sbjct  1     MFFSQSFYDLFENPAILGLCSVIGMFFSPLWVTFFFGVIVGWLWKPKWARLGKEKLTTSL  60

Query  795   fvs-------------ssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnss  935
               S              S  ++  +  S    + ++K+  P   S + ++       +SS
Sbjct  61    AKSLDFASPSSASSPLKSALVSPMKSCSSSPCLNSIKMLPPNLESLLLKKGVDKKASSSS  120

Query  936   splQ----------ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWR  1085
             SP++            + S  V   DL+HL+QLVEEKD G  WIQMMDRS   MSY+AWR
Sbjct  121   SPVKFASSVSSPKSCEETSDAVTIADLHHLWQLVEEKDGGLPWIQMMDRSTPTMSYKAWR  180

Query  1086  RDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQW  1265
             R+P+ GPPQYRS T++EDATPEMVRD FWDDEFR +WDDML  +  +E+ P+TGTM VQW
Sbjct  181   REPKDGPPQYRSSTIFEDATPEMVRDLFWDDEFRPRWDDMLASSSIIEECPTTGTMKVQW  240

Query  1266  VRKFPFFCSDREYIIGRR  1319
             +RKFPFFC DREYIIGRR
Sbjct  241   IRKFPFFCKDREYIIGRR  258



>ref|XP_006420124.1| hypothetical protein CICLE_v10005003mg [Citrus clementina]
 gb|ESR33364.1| hypothetical protein CICLE_v10005003mg [Citrus clementina]
Length=434

 Score =   210 bits (534),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 107/243 (44%), Positives = 157/243 (65%), Gaps = 14/243 (6%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsf---vs  803
             ++E  +RPSI + ++++++   PIW+AV+IG+++GW+W+PRW  L              +
Sbjct  8     MMEFLKRPSITETLVDILLCAVPIWLAVMIGLVIGWSWRPRWTGLVFLGLRSKFRFIWTA  67

Query  804   ssTGINLQQVFSGFSSIPAL----------KLQIPKCFSWIseetsssltpnsssplQEN  953
             +  G   ++++  F+++ A           K +  K  +  +      +  ++S   +  
Sbjct  68    APPGFGARRLWLAFTALSAFSACRVLWNNFKGKGAKSDAASAAAAGEGVDGDASPGARTA  127

Query  954   DKSR-VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTV  1130
             +K + VV ENDL HL QL+E KD    W  +M++S  NM+YQAWR +PETGP  YR+RTV
Sbjct  128   EKEQHVVTENDLEHLLQLLERKDGEMEWQTLMEKSTPNMTYQAWRCEPETGPAVYRTRTV  187

Query  1131  YEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYII  1310
             +E ATPE+VRDFFWDDEFR KWD ML + +TLE+ P TGTM+VQW++KFPFFCSDREYII
Sbjct  188   FEGATPELVRDFFWDDEFRRKWDHMLAYVKTLEECPHTGTMIVQWIKKFPFFCSDREYII  247

Query  1311  GRR  1319
             GRR
Sbjct  248   GRR  250



>ref|XP_006589231.1| PREDICTED: uncharacterized protein LOC100810331 [Glycine max]
Length=398

 Score =   209 bits (532),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 154/230 (67%), Gaps = 23/230 (10%)
 Frame = +3

Query  633   LLEIFQRP-SIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsss  809
             L  IFQ P S+ D+I +L +F TP+W+AV++GV+VGWAWKP+WA                
Sbjct  4     LFRIFQIPTSLMDIITDLAMFITPLWIAVIVGVVVGWAWKPKWA----------------  47

Query  810   TGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVVDENDLY  989
                + +     F S      Q    F++    +++S +            S +V E DL 
Sbjct  48    --FHPKDALLKFRSPRPSNPQNDTAFTF----STTSSSAREKDASASASASHLVTEYDLL  101

Query  990   HLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFF  1169
             HL++LVEEKD GPAWIQMMDRS   M YQAWRRDPE+GPPQYRSRTV+EDA+PE+VRDFF
Sbjct  102   HLWKLVEEKDGGPAWIQMMDRSTPTMRYQAWRRDPESGPPQYRSRTVFEDASPELVRDFF  161

Query  1170  WDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             WDD++R KWDDMLIHA T+++   TGTM+V WVRKFPFFCSDREYIIGRR
Sbjct  162   WDDDYRLKWDDMLIHASTIQECVLTGTMMVHWVRKFPFFCSDREYIIGRR  211



>ref|XP_009361280.1| PREDICTED: uncharacterized protein LOC103951585 [Pyrus x bretschneideri]
Length=425

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 144/244 (59%), Gaps = 40/244 (16%)
 Frame = +3

Query  675   LELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGINLQQVF------  836
             L+LMV    I +A ++GVL+GW+WKP+WA                 G  + + F      
Sbjct  6     LDLMVLLG-ISMAFLVGVLIGWSWKPKWA--------LSGNDKDKLGCPVPKDFDFSQPS  56

Query  837   -------SGFSSIPALKL----------------QIPKCFSWIseetsssltpnsssplQ  947
                     GFSS P L                   I K  S     T      ++S   +
Sbjct  57    SPPRSPLKGFSSAPCLNCFESFVSQGCEACCMGKGIQKTTSVSPPATEFDEGSSTSQLNE  116

Query  948   ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRT  1127
             E  K +VV E DL  L +LV+ KD GP WIQMMDRS   M+YQ WRRDP+ GPPQYRSRT
Sbjct  117   E--KPKVVTEEDLEVLSELVDMKDGGPPWIQMMDRSTPTMTYQGWRRDPKVGPPQYRSRT  174

Query  1128  VYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYI  1307
             VYEDATPE+VRDFFWDDEFR +WDDML +A+T+E+ P+TGTMV QW++KFPFFC DREYI
Sbjct  175   VYEDATPELVRDFFWDDEFRLRWDDMLSYAKTIEECPTTGTMVTQWIKKFPFFCKDREYI  234

Query  1308  IGRR  1319
             IGRR
Sbjct  235   IGRR  238



>ref|XP_003523319.1| PREDICTED: uncharacterized protein LOC100785446 [Glycine max]
 gb|KHN19560.1| StAR-related lipid transfer protein 7, mitochondrial [Glycine 
soja]
Length=442

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/257 (44%), Positives = 153/257 (60%), Gaps = 22/257 (9%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             M L  +  ++ + P+I  +   + +  +P+WV    GV+VGW WKP+WA L   + +   
Sbjct  1     MVLSQSFYDMLENPAILGLCTVIGMLFSPLWVTFFFGVIVGWLWKPKWARLGEKKLATTL  60

Query  795   fvss------------sTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsss  938
               S                ++  +  S    + ++K+  P   S + ++       +SSS
Sbjct  61    AKSLDFASPSSASSPSKFPVSPMKSCSSSPCLNSIKMLPPNPESLLLKKGVDKKASSSSS  120

Query  939   plQ----------ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRR  1088
             P++            + S  V   DL+HL+QLVEEKD G  WIQMMDRS   MSY+AWRR
Sbjct  121   PVKFASSVSSPKSCEETSEAVTMADLHHLWQLVEEKDGGLPWIQMMDRSTPTMSYKAWRR  180

Query  1089  DPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWV  1268
             +P+ GPPQYRS T++EDATPEMVRD FWDDEFR +WDDML  +  +E+ P+TGTM VQW+
Sbjct  181   EPKDGPPQYRSSTIFEDATPEMVRDLFWDDEFRPRWDDMLASSSIIEECPTTGTMKVQWI  240

Query  1269  RKFPFFCSDREYIIGRR  1319
             RKFPFFC DREYIIGRR
Sbjct  241   RKFPFFCKDREYIIGRR  257



>ref|XP_012092681.1| PREDICTED: stAR-related lipid transfer protein 7, mitochondrial-like 
[Jatropha curcas]
 gb|KDP20295.1| hypothetical protein JCGZ_08307 [Jatropha curcas]
Length=320

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/251 (43%), Positives = 156/251 (62%), Gaps = 22/251 (9%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfdsfvss  806
             L+E +++PS+ +  +++++   PIW+AV+IG+++GW+W+PRW  L     R  F    ++
Sbjct  8     LMEFWKKPSVIETFVDILLCAVPIWLAVMIGLVIGWSWRPRWTGLIFLGLRSKFRFLWTA  67

Query  807   sTGINLQQVFSGFSSIPAL----------KLQIPKCFSWIseetsssltpnsssplQEND  956
               G   ++++  F+++ A           K +  K  +  +   S+S     +S  + +D
Sbjct  68    PPGFGARRLWLAFTALSAFSVCRTIWSNFKGKNGKSAAMATSLASTSAASAINSEAESSD  127

Query  957   K----------SRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGP  1106
                          +V E DL HL  L E KD    W  MM+RS +NM+YQAWR DP+TGP
Sbjct  128   SISSPREPQEGEEIVTERDLEHLLHLFEGKDGQMEWQSMMERSTSNMAYQAWRHDPQTGP  187

Query  1107  PQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFF  1286
               YRSRTV+EDATPE+VRDFFWDDEFR KWD ML + + LE+ P TGTM+V W++KFPFF
Sbjct  188   TMYRSRTVFEDATPELVRDFFWDDEFRLKWDAMLAYFKILEEFPHTGTMIVHWIKKFPFF  247

Query  1287  CSDREYIIGRR  1319
             CSDREYIIGRR
Sbjct  248   CSDREYIIGRR  258



>gb|KJB12570.1| hypothetical protein B456_002G024700 [Gossypium raimondii]
Length=445

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/255 (42%), Positives = 155/255 (61%), Gaps = 28/255 (11%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfv--ss  806
             L+E+  + SI + +++++++  PIW+AV IG+ +GW+W+PRW  L             ++
Sbjct  8     LMELLMKQSITETVVDVLIYAVPIWLAVTIGLAIGWSWRPRWTGLVLLGFRSKFRFIWTA  67

Query  807   sTGINLQQVFSGFSSIPALK------------------------LQIPKCFSWIseetss  914
               G   ++++  F+++ A                          LQ P   +WIS E+ +
Sbjct  68    PPGFGARRLWLAFTALSAFSVFRTIFSNFIKRRFKEAASDSSVPLQSPPPTAWISPESVA  127

Query  915   sltpnsssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDP  1094
                        E  +  +V ENDL HL  L+E KD    W +MM+R+ +NMSYQAWR++P
Sbjct  128   DAVSPGGRA--EEREQDIVTENDLAHLLHLLEGKDGEMEWQRMMERTTSNMSYQAWRQEP  185

Query  1095  ETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRK  1274
              +GP  YRSRTV+EDATPE+VRDFFWDDEFR KWD ML + +TL++ P TG+M+V W+RK
Sbjct  186   VSGPAIYRSRTVFEDATPEVVRDFFWDDEFRPKWDTMLAYFKTLDECPCTGSMIVHWIRK  245

Query  1275  FPFFCSDREYIIGRR  1319
             FPFFCSDR+YIIGRR
Sbjct  246   FPFFCSDRDYIIGRR  260



>ref|XP_002870309.1| hypothetical protein ARALYDRAFT_493456 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46568.1| hypothetical protein ARALYDRAFT_493456 [Arabidopsis lyrata subsp. 
lyrata]
Length=429

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 159/246 (65%), Gaps = 21/246 (9%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfdsfvss  806
             LL  F+ PS  +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R       ++
Sbjct  8     LLNFFKNPSFTETFVDILLCAVPIWLAVMIGLLIGWSWRPRWTGLIYLGFRSKLRFLWTA  67

Query  807   sTGINLQQVFSGFSSIPALKLQIPKCFS-WIseetsssltpnsssplQENDKSR------  965
               G   ++++  F+++ A  +    C + W   +T ++ +   S+P++E+D+S       
Sbjct  68    PPGFGARRLWLAFTALSAFSV----CRTIWSRNDTRANKSATGSAPVEESDESGLVSRGS  123

Query  966   --------VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRS  1121
                     +V ENDL HL QL+E  +    W  MMD++  NMSYQAWR +PETGP  YRS
Sbjct  124   DNMRVTEDIVTENDLEHLLQLLEVGNAAMEWQSMMDKTTPNMSYQAWRHEPETGPVIYRS  183

Query  1122  RTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDRE  1301
             RTV+EDA+P++VRDFFWDDEFR KWD ML + +TLE+   TGTM+VQW +KFPFFCSDRE
Sbjct  184   RTVFEDASPDIVRDFFWDDEFRPKWDFMLANFKTLEEDTQTGTMIVQWRKKFPFFCSDRE  243

Query  1302  YIIGRR  1319
             YIIGRR
Sbjct  244   YIIGRR  249



>ref|XP_011003261.1| PREDICTED: uncharacterized protein LOC105110056 isoform X2 [Populus 
euphratica]
Length=429

 Score =   207 bits (528),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 149/230 (65%), Gaps = 23/230 (10%)
 Frame = +3

Query  699   PIWVAVVIGVLVGWAWKPRWAN------LCAsrdsfdsfvsssTGINLQ---QVFSGFSS  851
             P+WVA  IG+++GW+WKP+W         C      DS + SS   +L    + F  FS 
Sbjct  7     PLWVAFFIGLVLGWSWKPKWVTRESDKLTCCVSKILDSSLPSSPCRSLMSPLKTFGSFSQ  66

Query  852   IPALKLQIPKC-FSWIseetsssltpnsss---plQENDKSRV----------VDENDLY  989
               +  L+   C  SW+ +  ++ +  N S       E+ +SR+          V E DL 
Sbjct  67    WNSFMLRSSTCDGSWLVDNNNNLVHQNLSPVPPTEYEDCRSRLNEEQSNVASQVTEGDLE  126

Query  990   HLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFF  1169
             HLYQLVE KD GP W+ MMDRS   M+Y+AWRRDP+TGPPQYRS TV+E+A+PE+VRDFF
Sbjct  127   HLYQLVEVKDGGPTWMHMMDRSTPTMTYKAWRRDPKTGPPQYRSSTVFENASPEIVRDFF  186

Query  1170  WDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             WDD+FR KWDDML ++  L++ P+TGTM+V W+RKFPFFCSDREYIIGRR
Sbjct  187   WDDDFRPKWDDMLSYSAILDECPTTGTMLVHWMRKFPFFCSDREYIIGRR  236



>ref|XP_011003260.1| PREDICTED: uncharacterized protein LOC105110056 isoform X1 [Populus 
euphratica]
Length=430

 Score =   207 bits (527),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 150/231 (65%), Gaps = 24/231 (10%)
 Frame = +3

Query  699   PIWVAVVIGVLVGWAWKPRWAN------LCAsrdsfdsfvsssTGINLQ---QVFSGFSS  851
             P+WVA  IG+++GW+WKP+W         C      DS + SS   +L    + F  FS 
Sbjct  7     PLWVAFFIGLVLGWSWKPKWVTRESDKLTCCVSKILDSSLPSSPCRSLMSPLKTFGSFSQ  66

Query  852   IPALKLQIPKC-FSWIseetsssltpnss----splQENDKSRV----------VDENDL  986
               +  L+   C  SW+ +  ++ +  N S    +  ++  +SR+          V E DL
Sbjct  67    WNSFMLRSSTCDGSWLVDNNNNLVHQNLSPVPPTEYEDCSRSRLNEEQSNVASQVTEGDL  126

Query  987   YHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDF  1166
              HLYQLVE KD GP W+ MMDRS   M+Y+AWRRDP+TGPPQYRS TV+E+A+PE+VRDF
Sbjct  127   EHLYQLVEVKDGGPTWMHMMDRSTPTMTYKAWRRDPKTGPPQYRSSTVFENASPEIVRDF  186

Query  1167  FWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             FWDD+FR KWDDML ++  L++ P+TGTM+V W+RKFPFFCSDREYIIGRR
Sbjct  187   FWDDDFRPKWDDMLSYSAILDECPTTGTMLVHWMRKFPFFCSDREYIIGRR  237



>ref|NP_567433.1| polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Arabidopsis thaliana]
 gb|AAL16115.1|AF428283_1 AT4g14500/dl3290w [Arabidopsis thaliana]
 gb|AAM97025.1| expressed protein [Arabidopsis thaliana]
 gb|AAP49510.1| At4g14500 [Arabidopsis thaliana]
 gb|AEE83451.1| polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Arabidopsis thaliana]
Length=433

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/250 (45%), Positives = 157/250 (63%), Gaps = 25/250 (10%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfdsfvss  806
             LL  F+ PS  +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R       ++
Sbjct  8     LLNFFKNPSFTETFVDILLCAVPIWLAVMIGLLIGWSWRPRWTGLIYLGFRSKLRFLWTA  67

Query  807   sTGINLQQVFSGFSSIPALKLQIPKCFS-WIseetsssltpnsssplQ----ENDKSR--  965
               G   ++++  F+++ A  +    C + W   +T ++ +   S+  Q    +ND+S   
Sbjct  68    PPGFGARRLWLAFTALSAFSV----CRTIWSRNDTRANKSATGSASSQTPVEDNDESGLA  123

Query  966   ------------VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPP  1109
                         +V ENDL HL QL+E  +    W  MMD++  NMSYQAWR +PETGP 
Sbjct  124   SRGSDNGTVTEDIVTENDLEHLLQLLEVGNAALEWQSMMDKTTPNMSYQAWRHEPETGPV  183

Query  1110  QYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFC  1289
              YRSRTV+EDATP++VRDFFWDDEFR KWD ML + +TLE+   TGTM+VQW +KFPFFC
Sbjct  184   IYRSRTVFEDATPDIVRDFFWDDEFRPKWDFMLANFKTLEEDTQTGTMIVQWRKKFPFFC  243

Query  1290  SDREYIIGRR  1319
             SDREYIIGRR
Sbjct  244   SDREYIIGRR  253



>ref|XP_012069777.1| PREDICTED: uncharacterized protein LOC105632095 [Jatropha curcas]
 gb|KDP40284.1| hypothetical protein JCGZ_02282 [Jatropha curcas]
Length=442

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/251 (43%), Positives = 156/251 (62%), Gaps = 22/251 (9%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfdsfvss  806
             L+E +++PS+ +  +++++   PIW+AV+IG+++GW+W+PRW  L     R  F    ++
Sbjct  8     LMEFWKKPSVIETFVDILLCAVPIWLAVMIGLVIGWSWRPRWTGLIFLGLRSKFRFLWTA  67

Query  807   sTGINLQQVFSGFSSIPAL----------KLQIPKCFSWIseetsssltpnsssplQEND  956
               G   ++++  F+++ A           K +  K  +  +   S+S     +S  + +D
Sbjct  68    PPGFGARRLWLAFTALSAFSVCRTIWSNFKGKNGKSAAMATSLASTSAASAINSEAESSD  127

Query  957   K----------SRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGP  1106
                          +V E DL HL  L E KD    W  MM+RS +NM+YQAWR DP+TGP
Sbjct  128   SISSPREPQEGEEIVTERDLEHLLHLFEGKDGQMEWQSMMERSTSNMAYQAWRHDPQTGP  187

Query  1107  PQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFF  1286
               YRSRTV+EDATPE+VRDFFWDDEFR KWD ML + + LE+ P TGTM+V W++KFPFF
Sbjct  188   TMYRSRTVFEDATPELVRDFFWDDEFRLKWDAMLAYFKILEEFPHTGTMIVHWIKKFPFF  247

Query  1287  CSDREYIIGRR  1319
             CSDREYIIGRR
Sbjct  248   CSDREYIIGRR  258



>gb|ABK24392.1| unknown [Picea sitchensis]
Length=426

 Score =   205 bits (522),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/238 (44%), Positives = 154/238 (65%), Gaps = 10/238 (4%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvs--s  806
             + +IF++P++ +  +++ +   P+W+AV+IG+LVGWAWKPRWA L           +  +
Sbjct  8     IYQIFRKPALVETFVDIAMCLVPLWLAVMIGLLVGWAWKPRWAGLICLGMKSKIRFAWTA  67

Query  807   sTGINLQQVFSGFSSIPALKLQIPKCFSWIseetss-------sltpnsssplQENDKSR  965
               G   ++++   +++ A  + + K +S  S+  +               +P +   +  
Sbjct  68    PPGFGARRLWFAITALTAFPV-LRKLWSNFSDSKAKGDDPTLQEPASTELTPPERGKEQA  126

Query  966   VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDAT  1145
             VV + DL +L  +++ KD GPAW Q+M+RS   M+YQAWR +PETGP  Y SRTV ED T
Sbjct  127   VVSDEDLENLLHMLQVKDKGPAWQQIMNRSTPTMTYQAWRYEPETGPTAYCSRTVMEDVT  186

Query  1146  PEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             PE++RDFFWDD+FR +WDDML + +TLE+ P TGTM+V W+RKFPFFCSDREYIIGRR
Sbjct  187   PELMRDFFWDDDFRPRWDDMLTYFKTLEECPLTGTMIVHWIRKFPFFCSDREYIIGRR  244



>ref|XP_006414699.1| hypothetical protein EUTSA_v10025252mg [Eutrema salsugineum]
 gb|ESQ56152.1| hypothetical protein EUTSA_v10025252mg [Eutrema salsugineum]
Length=432

 Score =   205 bits (522),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 105/247 (43%), Positives = 157/247 (64%), Gaps = 17/247 (7%)
 Frame = +3

Query  627   SALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfdsfv  800
             S L++  ++PS  +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R       
Sbjct  6     SDLMDFLKKPSFTETFVDILLCAVPIWLAVMIGLLIGWSWRPRWTGLIYLGFRSKLRYLW  65

Query  801   sssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQEN---------  953
             ++  G   ++++  F+++ A  +     +S + +  + S +  +   ++E+         
Sbjct  66    TAPPGFGARRLWLAFTALSAFSV-CRTIWSRLDKSANGSASSQTPEVVEESTQIDETGAS  124

Query  954   -----DKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYR  1118
                   K  +V ENDL HL +L+E  ++   W  MM+++  NMSYQAWR +PETGP  YR
Sbjct  125   DNTTVKKEEIVTENDLEHLLKLLEVGNEAMEWQSMMNKTTPNMSYQAWRHEPETGPVVYR  184

Query  1119  SRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDR  1298
             SRTV+EDATP++VRDFFWDDEFR KWD ML + +TLE+   TGTM+VQW +KFPFFCSDR
Sbjct  185   SRTVFEDATPDIVRDFFWDDEFRPKWDFMLANFKTLEEDTQTGTMIVQWRKKFPFFCSDR  244

Query  1299  EYIIGRR  1319
             EYIIGRR
Sbjct  245   EYIIGRR  251



>ref|XP_002977388.1| hypothetical protein SELMODRAFT_228472 [Selaginella moellendorffii]
 gb|EFJ21392.1| hypothetical protein SELMODRAFT_228472 [Selaginella moellendorffii]
Length=435

 Score =   205 bits (522),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 104/235 (44%), Positives = 147/235 (63%), Gaps = 7/235 (3%)
 Frame = +3

Query  636   LEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssT-  812
               +  +P + + + +L+    PIWVA+  G+++GW+WKPRWA+         + +  ST 
Sbjct  10    FSVLGKPVVLETMADLLAAMMPIWVAIAFGIVLGWSWKPRWASFLVFGLRSRTRLLWSTP  69

Query  813   -GINLQQVFSGFSSIPALKLQIP-----KCFSWIseetsssltpnsssplQENDKSRVVD  974
              G+  ++++   +++ A  +          + W   + S   T +SSSP  +   +  V 
Sbjct  70    PGLGARRLWLAITAVTACSMLKELWLKFSAWRWPRTDFSGKETQSSSSPGDQQQANCAVS  129

Query  975   ENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEM  1154
             + DL     L+EE+D GPAW  MMDRS T M+YQAWRRDP  GP QY+SRTV E  TP++
Sbjct  130   DEDLRKFLLLLEERDGGPAWQMMMDRSTTGMAYQAWRRDPSNGPTQYKSRTVIEGITPQL  189

Query  1155  VRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             +RDFFWDDEFR +WDDML+ A+TL++ P TG M+V WVRKFPFFC DREY IGRR
Sbjct  190   MRDFFWDDEFRVEWDDMLLSAKTLDECPETGYMLVHWVRKFPFFCKDREYTIGRR  244



>ref|XP_002974969.1| hypothetical protein SELMODRAFT_267823 [Selaginella moellendorffii]
 gb|EFJ23754.1| hypothetical protein SELMODRAFT_267823 [Selaginella moellendorffii]
Length=418

 Score =   205 bits (521),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 106/235 (45%), Positives = 150/235 (64%), Gaps = 7/235 (3%)
 Frame = +3

Query  636   LEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssT-  812
               +  +P + + + +L+    PIWVA+  G+++GW+WKPRWA+         + +  ST 
Sbjct  10    FSVLGKPVVLETMADLLAAMMPIWVAIAFGIVLGWSWKPRWASFLVFGLRSRTRLLWSTP  69

Query  813   -GINLQQVFSGFSSIPALKL--QIPKCFS---WIseetsssltpnsssplQENDKSRVVD  974
              G+  ++++   +++ A  +  Q+   FS   W   + S   T +SSSP  +   +  V 
Sbjct  70    PGLGARRLWLAITAVTACSMLKQLWLKFSAWRWPRTDFSGKETQSSSSPGDQQQANCAVS  129

Query  975   ENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEM  1154
             + DL     L+E++D GPAW  MMDRS T M+YQAWRRDP  GP QY+SRTV E  TP++
Sbjct  130   DEDLRKFLLLLEDRDGGPAWQMMMDRSTTGMAYQAWRRDPSNGPTQYKSRTVIEGITPQL  189

Query  1155  VRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             +RDFFWDDEFR +WDDML+ A+TL++ P TG M+V WVRKFPFFC DREY IGRR
Sbjct  190   MRDFFWDDEFRVEWDDMLLSAKTLDECPETGYMLVHWVRKFPFFCKDREYTIGRR  244



>ref|XP_008376819.1| PREDICTED: uncharacterized protein LOC103439947 [Malus domestica]
Length=419

 Score =   204 bits (520),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 143/220 (65%), Gaps = 6/220 (3%)
 Frame = +3

Query  675   LELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGINLQQVFSGFSSI  854
             L LMV    I +A+++GVL+GW+WKP+WA     +D     V ++   +     + F S+
Sbjct  6     LYLMVLLG-ISLALLVGVLIGWSWKPKWAFSGNDKDKLGCPVPNAFDFSSALCLNCFESL  64

Query  855   PALKLQIPKCFSWIseetsssltpn-----sssplQENDKSRVVDENDLYHLYQLVEEKD  1019
              +   +       I +  S S         SS+     +K  VV E DL  L +LV+ KD
Sbjct  65    VSQGCEARCMGKGIQKTPSVSPPATEFDEGSSTSQLNEEKPTVVTEEDLEVLSELVDMKD  124

Query  1020  DGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWD  1199
              GP WIQMMDRS   M+YQ WRRDP+ GPPQYRSRTVYEDATPE+VRDFFWDDEFR +WD
Sbjct  125   GGPPWIQMMDRSTPTMTYQGWRRDPKVGPPQYRSRTVYEDATPELVRDFFWDDEFRLRWD  184

Query  1200  DMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             DML +A+T+E+ P+TGTMV  W++KFPFFC DREYIIGRR
Sbjct  185   DMLSYAKTIEECPTTGTMVTLWIKKFPFFCKDREYIIGRR  224



>gb|KHN14765.1| StAR-related lipid transfer protein 7, mitochondrial [Glycine 
soja]
Length=379

 Score =   203 bits (517),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +3

Query  960   SRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYED  1139
             S +V E DL HL++LVEEKD GPAWIQMMDRS   M YQAWRRDPE+GPPQYRSRTV+ED
Sbjct  73    SHLVTEYDLLHLWKLVEEKDGGPAWIQMMDRSTPTMRYQAWRRDPESGPPQYRSRTVFED  132

Query  1140  ATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             A+PE+VRDFFWDD++R KWDDMLIHA T+++   TGTM+V WVRKFPFFCSDREYIIGRR
Sbjct  133   ASPELVRDFFWDDDYRLKWDDMLIHASTIQECVLTGTMMVHWVRKFPFFCSDREYIIGRR  192



>ref|XP_002885543.1| hypothetical protein ARALYDRAFT_319027 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61802.1| hypothetical protein ARALYDRAFT_319027 [Arabidopsis lyrata subsp. 
lyrata]
Length=427

 Score =   204 bits (520),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 108/242 (45%), Positives = 151/242 (62%), Gaps = 13/242 (5%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
              ++ F +PS+ +  +++++   PIWVAV+IG+L+GW+W+PRW  L     R      +++
Sbjct  4     FMDFFNKPSVTETFVDILLCAVPIWVAVMIGLLIGWSWRPRWTGLVYLGFRSKLRFLLTA  63

Query  807   sTGINLQQV---FSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSR----  965
               G   +++   F+  S     +    K  S     + ++    SS P++E   S     
Sbjct  64    PPGFGARRIWLAFTALSVFSVCRTLWSKIGSTSKRSSVNNGLAPSSKPVEEEAVSDIVTE  123

Query  966   ----VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVY  1133
                 VV E DL HL  L+++ +    W  MMD+S  NMSYQAWR +PETGP  YRSRTV+
Sbjct  124   KEQDVVTEKDLEHLLYLLKDGNANLEWQSMMDKSTPNMSYQAWRHEPETGPVVYRSRTVF  183

Query  1134  EDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIG  1313
             EDATP++VRDFFWDDEFR KWD ML + +TLE+ P TGT +V W++KFPFFCSDREYIIG
Sbjct  184   EDATPDIVRDFFWDDEFRPKWDPMLAYFKTLEEDPHTGTTIVHWIKKFPFFCSDREYIIG  243

Query  1314  RR  1319
             RR
Sbjct  244   RR  245



>ref|XP_007034990.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein isoform 4 [Theobroma cacao]
 gb|EOY05916.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein isoform 4 [Theobroma cacao]
Length=450

 Score =   205 bits (522),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 108/257 (42%), Positives = 155/257 (60%), Gaps = 28/257 (11%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             L+E  ++P+I +  +++++   PIW+AV+IG+++GWAW+PRW +L     R  F    ++
Sbjct  8     LMEFLKKPTITETFVDILLCAVPIWLAVMIGLVIGWAWRPRWTSLVFLGLRSKFRFIWTA  67

Query  807   sTGINLQQVFSGFSSIPAL-------------------------KLQIPKCFSWIseets  911
               G   ++++  F+++ AL                          + +P+  S ++  + 
Sbjct  68    PPGFGARRLWLAFTALSALPVCRTIFSNFIKGRSKKSTASASNSAVPLPRPSSPVARISQ  127

Query  912   ssltpnsssplQ-ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRR  1088
                    S   Q E  +  +V ENDL HL  L E KD    W  MM+R+  N+SYQAWR 
Sbjct  128   EGAADAVSLSSQDEEGEQDIVTENDLAHLLHLFEGKDREMEWQSMMERTTPNLSYQAWRL  187

Query  1089  DPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWV  1268
             +PE+GP   RSRTV+EDATPE+VRDFFWDDEFR KWD ML + + L++ P TGTMVV W+
Sbjct  188   EPESGPAVLRSRTVFEDATPEVVRDFFWDDEFRPKWDPMLAYVKILKECPHTGTMVVHWI  247

Query  1269  RKFPFFCSDREYIIGRR  1319
             +KFPFFCSDREYIIGRR
Sbjct  248   KKFPFFCSDREYIIGRR  264



>ref|XP_007034988.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein isoform 2 [Theobroma cacao]
 ref|XP_007034989.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY05914.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY05915.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein isoform 2 [Theobroma cacao]
Length=448

 Score =   205 bits (521),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 108/257 (42%), Positives = 155/257 (60%), Gaps = 28/257 (11%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             L+E  ++P+I +  +++++   PIW+AV+IG+++GWAW+PRW +L     R  F    ++
Sbjct  8     LMEFLKKPTITETFVDILLCAVPIWLAVMIGLVIGWAWRPRWTSLVFLGLRSKFRFIWTA  67

Query  807   sTGINLQQVFSGFSSIPAL-------------------------KLQIPKCFSWIseets  911
               G   ++++  F+++ AL                          + +P+  S ++  + 
Sbjct  68    PPGFGARRLWLAFTALSALPVCRTIFSNFIKGRSKKSTASASNSAVPLPRPSSPVARISQ  127

Query  912   ssltpnsssplQ-ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRR  1088
                    S   Q E  +  +V ENDL HL  L E KD    W  MM+R+  N+SYQAWR 
Sbjct  128   EGAADAVSLSSQDEEGEQDIVTENDLAHLLHLFEGKDREMEWQSMMERTTPNLSYQAWRL  187

Query  1089  DPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWV  1268
             +PE+GP   RSRTV+EDATPE+VRDFFWDDEFR KWD ML + + L++ P TGTMVV W+
Sbjct  188   EPESGPAVLRSRTVFEDATPEVVRDFFWDDEFRPKWDPMLAYVKILKECPHTGTMVVHWI  247

Query  1269  RKFPFFCSDREYIIGRR  1319
             +KFPFFCSDREYIIGRR
Sbjct  248   KKFPFFCSDREYIIGRR  264



>gb|KHN23303.1| StAR-related lipid transfer protein 7, mitochondrial [Glycine 
soja]
Length=433

 Score =   204 bits (519),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/234 (47%), Positives = 144/234 (62%), Gaps = 23/234 (10%)
 Frame = +3

Query  687   VFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvs-------------ssTGINLQ  827
             +F +P+WV    GV+VGW WKP+WA L   + +     S              S  ++  
Sbjct  1     MFFSPLWVTFFFGVIVGWLWKPKWARLGKEKLTTSLAKSLDFASPSSASSPLKSALVSPM  60

Query  828   QVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQ----------ENDKSRVVDE  977
             +  S    + ++K+  P   S + ++       +SSSP++            + S  V  
Sbjct  61    KSCSSSPCLNSIKMLPPNLESLLLKKGVDKKASSSSSPVKFASSVSSPKSCEETSDAVTI  120

Query  978   NDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMV  1157
              DL+HL+QLVEEKD G  WIQMMDRS   MSY+AWRR+P+ GPPQYRS T++EDATPEMV
Sbjct  121   ADLHHLWQLVEEKDGGLPWIQMMDRSTPTMSYKAWRREPKDGPPQYRSSTIFEDATPEMV  180

Query  1158  RDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             RD FWDDEFR +WDDML  +  +E+ P+TGTM VQW+RKFPFFC DREYIIGRR
Sbjct  181   RDLFWDDEFRPRWDDMLASSSIIEECPTTGTMKVQWIRKFPFFCKDREYIIGRR  234



>gb|KHG25656.1| StAR-related lipid transfer protein 7, mitochondrial [Gossypium 
arboreum]
Length=447

 Score =   204 bits (519),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/258 (42%), Positives = 148/258 (57%), Gaps = 31/258 (12%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvs---  803
             L+E  ++P+I +  +++++   PIW+AV+IG+ +GWAW+PRW +L               
Sbjct  8     LMEFLKKPTITETFVDILLCAVPIWLAVMIGLFIGWAWRPRWTSLVFLGLRSKFRFVWTA  67

Query  804   -----------ssTGIN----LQQVFSGF-----------SSIPALKLQIPKCFSWIsee  905
                        + T ++     + VFS F           +S  A+ LQ P     +   
Sbjct  68    PPGFGARRLWLAFTALSAFSVCRTVFSNFIKGRARKSTAETSNSAVPLQSPS--PTVRIS  125

Query  906   tsssltpnsssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWR  1085
                +    S +   E  +  +V ENDL HL  L+E K+    W  MM+R+  NMSYQAWR
Sbjct  126   PEGAAGTVSPTTKAEERQQDIVTENDLAHLLHLLEGKEGEMEWQNMMERTTPNMSYQAWR  185

Query  1086  RDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQW  1265
              +PE  P  YRSRTV+EDATPE+VRDFFWDDEFR KWD ML + + LE+ P TGTM+V W
Sbjct  186   HEPENAPAIYRSRTVFEDATPELVRDFFWDDEFRPKWDTMLSYVKVLEECPRTGTMIVHW  245

Query  1266  VRKFPFFCSDREYIIGRR  1319
             ++KFPFFCSDREYII RR
Sbjct  246   IKKFPFFCSDREYIIARR  263



>ref|XP_010087789.1| hypothetical protein L484_016360 [Morus notabilis]
 gb|EXB29870.1| hypothetical protein L484_016360 [Morus notabilis]
Length=435

 Score =   204 bits (518),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 151/246 (61%), Gaps = 17/246 (7%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             L+E  +RPSI +  +++++   PIW+AV+IG+ +GW+W+PRW  L     R  F    ++
Sbjct  7     LVEFLRRPSITETFVDILLCAVPIWLAVMIGMAIGWSWRPRWTGLVFLGLRSKFRFLWTA  66

Query  807   sTGINLQQVFSGFSSIPALKL--QIPKCFSWIseetsssltpnsssplQEND--------  956
               G   ++++  F+++ A  L  +I   F    + +  S   ++ +   EN         
Sbjct  67    PPGFGARRLWLAFTALSAFSLCRKIWSNFRSKGKVSPPSPPESAVALSAENGGDAIDLCT  126

Query  957   -----KSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRS  1121
                  +  V+ +NDL HL Q +  +D    W  MM+RS  NMSYQAWR +PETGP  YRS
Sbjct  127   KSVEREQDVITDNDLEHLLQFLSGRDGEMEWQSMMERSTQNMSYQAWRHEPETGPTVYRS  186

Query  1122  RTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDRE  1301
             RTV+EDATPE+VRDFFWDDEFR KWD ML     LE+ P TG M+V W++KFPFFCSDRE
Sbjct  187   RTVFEDATPELVRDFFWDDEFRPKWDPMLAFFIILEECPHTGIMIVHWIKKFPFFCSDRE  246

Query  1302  YIIGRR  1319
             YIIGRR
Sbjct  247   YIIGRR  252



>ref|XP_010650006.1| PREDICTED: uncharacterized protein LOC100263172 [Vitis vinifera]
Length=439

 Score =   203 bits (517),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/263 (43%), Positives = 157/263 (60%), Gaps = 30/263 (11%)
 Frame = +3

Query  591   LFLDFLGIMALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC  770
             +F DF+  M          ++PS+ + +L++++   PIWVAV+IG+++GW+W+PRW  L 
Sbjct  4     IFFDFMDFM----------KKPSVIETLLDILLCAVPIWVAVMIGLVIGWSWRPRWTGLV  53

Query  771   --AsrdsfdsfvsssTGINLQQVFSGFSSIPALKL--------QIPKCFSWIseetsssl  920
                 R  F    ++  G   ++++  F+++ A  +        ++ +     +  +SS  
Sbjct  54    YLGLRSKFRFLWTAPPGFGARRLWLAFTALSAFSVGRTIWSNFKVRRKGPTAAAASSSPA  113

Query  921   tpnsssplQENDKS----------RVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMS  1070
                 S      D S           +V ENDL HL  ++E KD   AW  MM+RS  NMS
Sbjct  114   GTARSVEGNGGDVSLDTRPAEIEQDIVTENDLDHLLHVLERKDGEMAWQGMMERSTPNMS  173

Query  1071  YQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGT  1250
             YQAWR +PE GP  YRSRTV+EDATPE+VRDFFWDDEFR KWD ML + + LE+ P T T
Sbjct  174   YQAWRHEPENGPTVYRSRTVFEDATPEVVRDFFWDDEFRPKWDPMLAYFKILEEFPHTAT  233

Query  1251  MVVQWVRKFPFFCSDREYIIGRR  1319
             M+V W++KFPFFCSDREYIIGRR
Sbjct  234   MIVHWIKKFPFFCSDREYIIGRR  256



>ref|XP_010440453.1| PREDICTED: uncharacterized protein LOC104723752 [Camelina sativa]
Length=428

 Score =   203 bits (516),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/244 (45%), Positives = 158/244 (65%), Gaps = 15/244 (6%)
 Frame = +3

Query  627   SALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfdsfv  800
             S LL  F+ PS  +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R       
Sbjct  6     SDLLHFFKNPSFTETFVDVLLCAVPIWLAVMIGLLIGWSWRPRWTGLIYLGFRSKLRFLW  65

Query  801   sssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSR-----  965
             ++  G   ++++  F+++ A    + +     ++  ++  +  S+SP++E D+S      
Sbjct  66    TAPPGFGARRLWLAFTALSAF--SVCRTIWSRNDNRANKSSVGSASPVEETDESGGSNNT  123

Query  966   ------VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRT  1127
                   +V ENDL HL QL+E  +    W  MMD++  NMSYQAWR +PE+GP  YRS+T
Sbjct  124   TLVTEDIVTENDLEHLLQLLEVGNANMEWQPMMDKTTPNMSYQAWRHEPESGPVIYRSQT  183

Query  1128  VYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYI  1307
             V+EDATP++VRDFFWDDEFR KWD ML + +TLE+   TGTM+VQW +KFPFFCSDREYI
Sbjct  184   VFEDATPDIVRDFFWDDEFRPKWDFMLANFKTLEEDTQTGTMIVQWRKKFPFFCSDREYI  243

Query  1308  IGRR  1319
             IGRR
Sbjct  244   IGRR  247



>gb|EPS63012.1| hypothetical protein M569_11775, partial [Genlisea aurea]
Length=419

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 141/233 (61%), Gaps = 15/233 (6%)
 Frame = +3

Query  621   LVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfv  800
             ++S ++EI  RP+I  +++ +M F  P+W+A ++G+L GW W+PR  N            
Sbjct  2     IISEVMEILGRPTILAILIWMMEFLLPLWIAFLVGLLAGWVWRPRSFN------------  49

Query  801   sssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVVDEN  980
                 G  +      +  +           S  S+E  ++      +   E +   ++ ++
Sbjct  50    ---CGFRISVPCLSYGLVNHRSKGSDSAQSLDSDEALAAAAERLDASETEKEIGSLLTDD  106

Query  981   DLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVR  1160
             D  HL+ LVE     P W ++MDRS +NMSYQAW+RD   GPPQY SRTVYEDATPE++R
Sbjct  107   DFEHLHHLVESFGQSPPWKRVMDRSTSNMSYQAWQRDIPNGPPQYCSRTVYEDATPELLR  166

Query  1161  DFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             DFFWDDEFR KWDDM++ A+ LE+   TG MVV W+RKFPFFCSDREYIIGRR
Sbjct  167   DFFWDDEFRLKWDDMIVQADILEESAITGAMVVHWIRKFPFFCSDREYIIGRR  219



>gb|KDO52781.1| hypothetical protein CISIN_1g0167531mg, partial [Citrus sinensis]
Length=314

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +3

Query  948   ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRT  1127
              + +S VV E DL HL++L E KD GP WI+MMDRS   MSYQAW RDP+TGPPQYR+ T
Sbjct  5     NHGQSNVVTEEDLEHLWRLAEMKDGGPTWIKMMDRSTETMSYQAWGRDPKTGPPQYRTST  64

Query  1128  VYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYI  1307
             VYED TPE+VRDFFWDD FR+KWDDML ++ TLE+ P+TGTMV+QW+RKFPFFCSDREYI
Sbjct  65    VYEDVTPELVRDFFWDDVFRSKWDDMLAYSTTLEECPTTGTMVIQWIRKFPFFCSDREYI  124

Query  1308  IGRR  1319
             IGRR
Sbjct  125   IGRR  128



>ref|XP_006283754.1| hypothetical protein CARUB_v10004845mg [Capsella rubella]
 gb|EOA16652.1| hypothetical protein CARUB_v10004845mg [Capsella rubella]
Length=434

 Score =   203 bits (516),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 110/250 (44%), Positives = 154/250 (62%), Gaps = 25/250 (10%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfdsfvss  806
             LL  F+ PS  +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R       ++
Sbjct  8     LLHFFKNPSFTETFVDILLCAVPIWLAVMIGLLIGWSWRPRWTGLIYLGFRSKLRFLWTA  67

Query  807   sTGINLQQVFSGFSSIPALKLQIPKCFS-WIseetsssltpnsssplQ----ENDKSR--  965
               G   ++++  F+++ A  +    C + W   +   + +   S+  Q    E D+S   
Sbjct  68    PPGFGARRLWLAFTALSAFSV----CRTIWSRNDNRGNKSSVGSASSQTPVEETDESGLV  123

Query  966   ------------VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPP  1109
                         +V ENDL HL QL+E  +    W  MMD++  NMSYQAWR +PETGP 
Sbjct  124   SRGSDVTTVTEDIVTENDLEHLLQLLEVGNATREWQSMMDKTTPNMSYQAWRHEPETGPV  183

Query  1110  QYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFC  1289
              YRS+TV+EDATP++VRDFFWDDEFR KWD ML + +TLE+   TGTM+VQW +KFPFFC
Sbjct  184   IYRSQTVFEDATPDIVRDFFWDDEFRPKWDFMLANFKTLEEDTQTGTMIVQWRKKFPFFC  243

Query  1290  SDREYIIGRR  1319
             SDREYIIGRR
Sbjct  244   SDREYIIGRR  253



>ref|XP_007034987.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY05913.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein isoform 1 [Theobroma cacao]
Length=553

 Score =   205 bits (522),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 108/257 (42%), Positives = 155/257 (60%), Gaps = 28/257 (11%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             L+E  ++P+I +  +++++   PIW+AV+IG+++GWAW+PRW +L     R  F    ++
Sbjct  8     LMEFLKKPTITETFVDILLCAVPIWLAVMIGLVIGWAWRPRWTSLVFLGLRSKFRFIWTA  67

Query  807   sTGINLQQVFSGFSSIPAL-------------------------KLQIPKCFSWIseets  911
               G   ++++  F+++ AL                          + +P+  S ++  + 
Sbjct  68    PPGFGARRLWLAFTALSALPVCRTIFSNFIKGRSKKSTASASNSAVPLPRPSSPVARISQ  127

Query  912   ssltpnsssplQ-ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRR  1088
                    S   Q E  +  +V ENDL HL  L E KD    W  MM+R+  N+SYQAWR 
Sbjct  128   EGAADAVSLSSQDEEGEQDIVTENDLAHLLHLFEGKDREMEWQSMMERTTPNLSYQAWRL  187

Query  1089  DPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWV  1268
             +PE+GP   RSRTV+EDATPE+VRDFFWDDEFR KWD ML + + L++ P TGTMVV W+
Sbjct  188   EPESGPAVLRSRTVFEDATPEVVRDFFWDDEFRPKWDPMLAYVKILKECPHTGTMVVHWI  247

Query  1269  RKFPFFCSDREYIIGRR  1319
             +KFPFFCSDREYIIGRR
Sbjct  248   KKFPFFCSDREYIIGRR  264



>ref|XP_006406092.1| hypothetical protein EUTSA_v10020751mg [Eutrema salsugineum]
 gb|ESQ47545.1| hypothetical protein EUTSA_v10020751mg [Eutrema salsugineum]
Length=439

 Score =   202 bits (515),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/250 (42%), Positives = 149/250 (60%), Gaps = 21/250 (8%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfdsfvss  806
             L +  +RPS+ +  +++++   PIW+AV+IG+++GW+W+PRW  L     R       ++
Sbjct  8     LTDFLRRPSVTETFVDILLCAVPIWLAVMIGLVIGWSWRPRWTGLIYLGFRSKLRFLWTA  67

Query  807   sTGINLQQVFSGFSSIPALKL------------------QIPKCFSWIseetsssltpns  932
               G   ++++  F+++ A  +                    P   S      +      S
Sbjct  68    PPGFGARRLWLAFTALSAFSVCRTLWSRLGTSAKKSATGSAPSSASVEETLPNGETDAFS  127

Query  933   ssplQENDKSR-VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPP  1109
              +  +  +K + +V E DL HL  L+E  +    W  MMD+S  NMSYQAWR +PETGP 
Sbjct  128   RTSDKNAEKEKDIVTEKDLEHLMYLLEAGNANIEWQSMMDKSTPNMSYQAWRHEPETGPV  187

Query  1110  QYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFC  1289
              YRSRTV+EDATP++VRDFFWDDEFR KWD ML + +TLE+ P TGT +V W++KFPFFC
Sbjct  188   VYRSRTVFEDATPDIVRDFFWDDEFRPKWDPMLAYFKTLEEDPQTGTTIVHWIKKFPFFC  247

Query  1290  SDREYIIGRR  1319
             SDREYIIGRR
Sbjct  248   SDREYIIGRR  257



>ref|XP_009107776.1| PREDICTED: uncharacterized protein LOC103833443 [Brassica rapa]
Length=434

 Score =   202 bits (514),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 104/248 (42%), Positives = 150/248 (60%), Gaps = 17/248 (7%)
 Frame = +3

Query  627   SALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfdsfv  800
             S +++I ++PS  +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R       
Sbjct  6     SYIMQILKKPSFTETFVDILLCAVPIWLAVMIGLLIGWSWRPRWTGLIYLGFRSKLRFLW  65

Query  801   sssTGINLQQVFSGFSSIPALKL-------------QIPKCFSWIseetsssltpnsssp  941
             ++  G   ++++  F+++ A  +             +     +   +        +  + 
Sbjct  66    TAPPGFGARRLWLAFTALSAFSVCRTVWSRRDTSANKSANGLAPTQQAPGEESPQSDETG  125

Query  942   lQENDKSR--VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQY  1115
               +N   R  +V ENDL HL QL+E  +    W  MMD++  NMSYQAWR +PETGP  Y
Sbjct  126   ASDNTTVREEIVTENDLEHLLQLLEVGNASREWQSMMDKTTPNMSYQAWRHEPETGPVIY  185

Query  1116  RSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSD  1295
             RSR+V+EDATP++VRDFFWDDEFR KWD ML    TLE+   TGTM+VQW +KFPFFCSD
Sbjct  186   RSRSVFEDATPDIVRDFFWDDEFRPKWDFMLAKFRTLEEDTQTGTMIVQWRKKFPFFCSD  245

Query  1296  REYIIGRR  1319
             REYIIGRR
Sbjct  246   REYIIGRR  253



>emb|CDY47149.1| BnaA08g05340D [Brassica napus]
Length=434

 Score =   202 bits (514),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 110/252 (44%), Positives = 158/252 (63%), Gaps = 25/252 (10%)
 Frame = +3

Query  627   SALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfdsfv  800
             S L++I ++PS  +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R       
Sbjct  6     SYLMQILKKPSFTETFVDILLCAVPIWLAVMIGLLIGWSWRPRWTGLIYLGFRSKLRFLW  65

Query  801   sssTGINLQQVFSGFSSIPALKLQIPKCFS-WIseetsssltpnsssplQE---------  950
             ++  G   ++++  F+++ A  +    C + W   +TS++ + N S+P Q+         
Sbjct  66    TAPPGFGARRLWLAFTALSAFSV----CRTVWSRRDTSANKSANGSAPTQQAPVDESPQS  121

Query  951   ---------NDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETG  1103
                        +  +V ENDL HL QL+E  +    W  MMD++  NMSYQAWR +P+TG
Sbjct  122   DETGASDNTTVREEIVTENDLEHLLQLLEVGNASREWQSMMDKTTPNMSYQAWRHEPQTG  181

Query  1104  PPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPF  1283
             P  YRSR+V+EDATP++VRDFFWDDEFR KWD ML    TLE+   TGTM+VQW +KFPF
Sbjct  182   PVIYRSRSVFEDATPDIVRDFFWDDEFRPKWDFMLAKFRTLEEDTQTGTMIVQWRKKFPF  241

Query  1284  FCSDREYIIGRR  1319
             FCSDREYIIGRR
Sbjct  242   FCSDREYIIGRR  253



>gb|KJB34524.1| hypothetical protein B456_006G070300 [Gossypium raimondii]
Length=447

 Score =   202 bits (514),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/258 (41%), Positives = 148/258 (57%), Gaps = 31/258 (12%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvs---  803
             L+E  ++P+I +  +++++   PIW+AV+IG+ +GWAW+PRW +L               
Sbjct  8     LMEFLKKPTITETFVDILLCAVPIWLAVMIGLFIGWAWRPRWTSLVFLGLRSKFRFVWTA  67

Query  804   -----------ssTGIN----LQQVFSGF-----------SSIPALKLQIPKCFSWIsee  905
                        + T ++     + VFS F           +S  A+ LQ P     +   
Sbjct  68    PPGFGARRLWLAFTALSAFSVCRTVFSNFIKGRARKSTAETSNSAVPLQSPS--PTVRIS  125

Query  906   tsssltpnsssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWR  1085
                +    S +   E  +  +V ENDL HL  L+E K+    W  MM+R+  NMSYQAWR
Sbjct  126   PEGAAGTVSPTTKAEERQQDIVTENDLAHLLHLLEGKEGEMEWQNMMERTTPNMSYQAWR  185

Query  1086  RDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQW  1265
              +PE  P  YRSRTV+EDATPE+VRDFFWDDEFR KWD ML + + L++ P TGTM+V W
Sbjct  186   HEPENAPAIYRSRTVFEDATPELVRDFFWDDEFRPKWDTMLSYVKILDECPRTGTMIVHW  245

Query  1266  VRKFPFFCSDREYIIGRR  1319
             ++KFPFFCSDREYII RR
Sbjct  246   IKKFPFFCSDREYIIARR  263



>gb|KHG25655.1| StAR-related lipid transfer protein 7, mitochondrial [Gossypium 
arboreum]
Length=510

 Score =   203 bits (517),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/258 (42%), Positives = 148/258 (57%), Gaps = 31/258 (12%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvs---  803
             L+E  ++P+I +  +++++   PIW+AV+IG+ +GWAW+PRW +L               
Sbjct  8     LMEFLKKPTITETFVDILLCAVPIWLAVMIGLFIGWAWRPRWTSLVFLGLRSKFRFVWTA  67

Query  804   -----------ssTGIN----LQQVFSGF-----------SSIPALKLQIPKCFSWIsee  905
                        + T ++     + VFS F           +S  A+ LQ P     +   
Sbjct  68    PPGFGARRLWLAFTALSAFSVCRTVFSNFIKGRARKSTAETSNSAVPLQSPS--PTVRIS  125

Query  906   tsssltpnsssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWR  1085
                +    S +   E  +  +V ENDL HL  L+E K+    W  MM+R+  NMSYQAWR
Sbjct  126   PEGAAGTVSPTTKAEERQQDIVTENDLAHLLHLLEGKEGEMEWQNMMERTTPNMSYQAWR  185

Query  1086  RDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQW  1265
              +PE  P  YRSRTV+EDATPE+VRDFFWDDEFR KWD ML + + LE+ P TGTM+V W
Sbjct  186   HEPENAPAIYRSRTVFEDATPELVRDFFWDDEFRPKWDTMLSYVKVLEECPRTGTMIVHW  245

Query  1266  VRKFPFFCSDREYIIGRR  1319
             ++KFPFFCSDREYII RR
Sbjct  246   IKKFPFFCSDREYIIARR  263



>ref|XP_009114221.1| PREDICTED: uncharacterized protein LOC103839466 [Brassica rapa]
Length=382

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +3

Query  951   NDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTV  1130
              +KS  V  +D  HL+ LVE KD GPAWIQMMDRS T  SYQAWRRDP  GPPQYRSRTV
Sbjct  78    KEKSGFVTGDDFRHLWNLVEVKDGGPAWIQMMDRSTTTFSYQAWRRDPHDGPPQYRSRTV  137

Query  1131  YEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYII  1310
             +EDATPEMVRDFFWDD+FR+ WDDML+ + TLE    TGTMVVQWVRKFPFFCSDREYII
Sbjct  138   FEDATPEMVRDFFWDDDFRSNWDDMLLFSSTLEACKDTGTMVVQWVRKFPFFCSDREYII  197

Query  1311  GRR  1319
             GRR
Sbjct  198   GRR  200



>ref|XP_010435117.1| PREDICTED: uncharacterized protein LOC104718985 [Camelina sativa]
Length=429

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 158/244 (65%), Gaps = 15/244 (6%)
 Frame = +3

Query  627   SALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfdsfv  800
             S LL  F+ PS  +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R       
Sbjct  7     SDLLHFFKNPSFTETFVDVLLCAVPIWLAVMIGLLIGWSWRPRWTGLIYLGFRSKLRFLW  66

Query  801   sssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSR-----  965
             ++  G   ++++  F+++ A    + +     ++  ++  +  S+SP++E D+S      
Sbjct  67    TAPPGFGARRLWLAFTALSAF--SVCRTIWSRNDNRANKSSVGSASPVEETDESGGSNNT  124

Query  966   ------VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRT  1127
                   +V ENDL HL QL+E  +    W  MMD++  NMSYQAWR +PE+GP  YRS+T
Sbjct  125   TLVTEDIVTENDLEHLLQLLEVGNANMEWQPMMDKTTPNMSYQAWRHEPESGPVIYRSQT  184

Query  1128  VYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYI  1307
             V+EDATP++VRDFFWDDEFR KWD ML + +TLE+   TGTM+VQW +KFPFFCSDR+YI
Sbjct  185   VFEDATPDVVRDFFWDDEFRPKWDFMLANFKTLEEDTQTGTMIVQWRKKFPFFCSDRDYI  244

Query  1308  IGRR  1319
             IGRR
Sbjct  245   IGRR  248



>gb|KFK32485.1| hypothetical protein AALP_AA6G248600 [Arabis alpina]
Length=423

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/242 (43%), Positives = 153/242 (63%), Gaps = 13/242 (5%)
 Frame = +3

Query  621   LVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfds  794
             + S ++   + PS  +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R     
Sbjct  4     IYSDVMYYLKNPSFTETFVDILLCAVPIWLAVMIGLLIGWSWRPRWTGLIYLGFRSKLRF  63

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIPKCFS-WIseetsssltpnsssplQENDKSR--  965
               ++  G   ++++  F+++ A  +    C + W   +T++  +         +D +R  
Sbjct  64    LWTAPPGFGARRLWLAFTALSAFSV----CRTIWSRRDTTADKSTTGEETRGSDDDNRRV  119

Query  966   ----VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVY  1133
                 +V E+DL HL +L+E  +    W   MD++  NMSYQAWR +PETGP  YRSRTV+
Sbjct  120   KEEEIVTESDLEHLLKLLEVGNAAMEWQSFMDKTTPNMSYQAWRHEPETGPVVYRSRTVF  179

Query  1134  EDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIG  1313
             EDATP++VRDFFWDDEFR KWD ML + +TLE+   TGTM+VQW +KFPFFCSDREYIIG
Sbjct  180   EDATPDIVRDFFWDDEFRPKWDFMLANFKTLEEDSQTGTMIVQWRKKFPFFCSDREYIIG  239

Query  1314  RR  1319
             RR
Sbjct  240   RR  241



>ref|XP_010466606.1| PREDICTED: uncharacterized protein LOC104746781 [Camelina sativa]
Length=426

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/249 (45%), Positives = 144/249 (58%), Gaps = 26/249 (10%)
 Frame = +3

Query  636   LEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL------------CAsr  779
             +++F++P+  DV+L       PIWVAV+IGVL+GW+W+PRW  L            C + 
Sbjct  1     MDLFKKPTFVDVLL----CAVPIWVAVMIGVLIGWSWRPRWTGLVYLGFRSKLRFLCTAP  56

Query  780   dsfdsfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetssslt---------pns  932
                              VFS F ++  L L      S +   ++ S              
Sbjct  57    PPGFGARRLWLAFTALSVFSIFRTL-WLSLGSSSKNSTVISGSAPSSKPVDEEEEAFSRG  115

Query  933   ssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQ  1112
             S    E ++  VV E DL HL QL+E ++    W  MMD+S  NMSYQAWR DP  GP  
Sbjct  116   SDKGTEKEEGVVVTEKDLEHLLQLLEARNANFEWQSMMDKSTPNMSYQAWRHDPAAGPVV  175

Query  1113  YRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCS  1292
             YRSRTV+EDATP++VRDFFWDDEFR KWD ML + +TLE+ P TGT + +W++KFPFFCS
Sbjct  176   YRSRTVFEDATPDIVRDFFWDDEFRPKWDPMLAYFKTLEEDPKTGTTIARWIKKFPFFCS  235

Query  1293  DREYIIGRR  1319
             DREYIIGRR
Sbjct  236   DREYIIGRR  244



>ref|XP_010527394.1| PREDICTED: uncharacterized protein LOC104804749 [Tarenaya hassleriana]
Length=439

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/251 (41%), Positives = 150/251 (60%), Gaps = 23/251 (9%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             L++  ++PS+ +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R       ++
Sbjct  8     LMDFLRKPSVTETFVDILLCAVPIWLAVMIGLLIGWSWRPRWTGLVYLGFRSKLRFLWTA  67

Query  807   sTGINLQQVFSGFSSIPALKL--------------------QIPKCFSWIseetsssltp  926
               G   ++++  F+++ A  +                      P             +  
Sbjct  68    PPGFGARRLWLAFTALSAFSVCRTIWSRLGSRANKSVGGPASTPATVEDALPIDGPGIVS  127

Query  927   nsssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGP  1106
               S    EN++  VV ENDL HL  L+E ++    W  MM+++  NMSYQAWR +PETGP
Sbjct  128   RRSDESAENEQD-VVTENDLEHLLNLLEVRNVDREWQSMMEKNTGNMSYQAWRHEPETGP  186

Query  1107  PQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFF  1286
               YRSRTV+EDATPE+VRDFFWDDEFR KWD ML + +TLE+ P +G ++V W++KFPFF
Sbjct  187   VVYRSRTVFEDATPEIVRDFFWDDEFRPKWDPMLSYFKTLEEDPQSGAIIVHWIKKFPFF  246

Query  1287  CSDREYIIGRR  1319
             CSDREYIIGRR
Sbjct  247   CSDREYIIGRR  257



>gb|KFK39597.1| hypothetical protein AALP_AA3G264700 [Arabis alpina]
Length=429

 Score =   200 bits (509),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/235 (44%), Positives = 144/235 (61%), Gaps = 12/235 (5%)
 Frame = +3

Query  651   RPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--AsrdsfdsfvsssTGINL  824
             RP + +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R       ++  G   
Sbjct  13    RPYVTETFVDVLLCAFPIWLAVMIGLLIGWSWRPRWTGLVYLGFRSKLRFLCTAPPGFGA  72

Query  825   QQVFSGFSSIPAL--------KLQIPKCFSWIseetsssltp--nsssplQENDKSRVVD  974
             ++++  F+++ A         +L   K  +  +   S         +       K  +V 
Sbjct  73    RRLWLAFTALSAFSICRTLWSRLGTKKSVTSGTGSASVEEITPIGETEAFSREKKLDIVI  132

Query  975   ENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEM  1154
             E DL HL +L++  +    W  MMD+S  NMSYQAWR +PETGP  YRSRTV+EDATPE+
Sbjct  133   EKDLEHLLRLLQVGNATMEWQSMMDKSTPNMSYQAWRHEPETGPVVYRSRTVFEDATPEI  192

Query  1155  VRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             VRDFFWDDEFR KWD ML + +TLE+H  TGT +V W++KFPFFCSDREYIIGRR
Sbjct  193   VRDFFWDDEFRPKWDTMLAYFKTLEEHLQTGTTIVHWIKKFPFFCSDREYIIGRR  247



>emb|CDY62128.1| BnaC08g47370D [Brassica napus]
Length=434

 Score =   200 bits (509),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 111/252 (44%), Positives = 161/252 (64%), Gaps = 25/252 (10%)
 Frame = +3

Query  627   SALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfdsfv  800
             S L++I ++PS  +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R       
Sbjct  6     SYLMQILKKPSFTETFVDVLLCAVPIWLAVMIGLLIGWSWRPRWTGLIYLGFRSKLRFLW  65

Query  801   sssTGINLQQVFSGFSSIPALKLQIPKCFS-WIseetsssltpnsssplQ--------EN  953
             ++  G   ++++  F+++ A  +    C + W   +TS++ + N S+P Q        ++
Sbjct  66    TAPPGFGARRLWLAFTALSAFSV----CRTVWSRRDTSANKSGNGSAPTQLAPVEESPQS  121

Query  954   DKS----------RVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETG  1103
             D++           +V ENDL HL QL+E  +    W  MMD++  NMSYQAWR +P+TG
Sbjct  122   DETGASDNTTVREEIVTENDLEHLLQLLEVGNATREWQSMMDKTTPNMSYQAWRHEPQTG  181

Query  1104  PPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPF  1283
             P  YRSR+V+EDATP++VRDFFWDDEFR KWD ML    TLE+   TGTM+VQW +KFPF
Sbjct  182   PVIYRSRSVFEDATPDIVRDFFWDDEFRPKWDFMLAKFRTLEEDTQTGTMIVQWRKKFPF  241

Query  1284  FCSDREYIIGRR  1319
             FCSDREYIIGRR
Sbjct  242   FCSDREYIIGRR  253



>emb|CDY16287.1| BnaC01g23220D [Brassica napus]
Length=435

 Score =   200 bits (509),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 107/251 (43%), Positives = 157/251 (63%), Gaps = 18/251 (7%)
 Frame = +3

Query  621   LVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfds  794
             ++S ++   + PS  +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R     
Sbjct  4     MLSDIMYFLKNPSFTETFVDIILCAVPIWLAVMIGLLIGWSWRPRWTGLIYLGFRSKLRF  63

Query  795   fvsssTGINLQQVFSGFSSIPALKLQI---PKCFSWIseetsssltpnsssplQENDKSR  965
               ++  G   ++++  F+++ A  +      K  +  ++ TS S +   +  LQ ++ SR
Sbjct  64    LWTAPPGFGARRLWLAFTALSAFSVCRTLWSKLDTRANKSTSGSASSQQTESLQSDEVSR  123

Query  966   -------------VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGP  1106
                          +V ENDL HL QL+E  +    W  MMD++  NMSYQAWR +PETGP
Sbjct  124   PSSDDNTTAREQEIVTENDLEHLLQLLEVGNATREWQSMMDKTTPNMSYQAWRHEPETGP  183

Query  1107  PQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFF  1286
               YRSRT++EDA+P++VRDFFWDDEFR KWD ML + +TL+D   TGTM+V W +KFPFF
Sbjct  184   VVYRSRTIFEDASPDIVRDFFWDDEFRPKWDFMLANFKTLDDDTRTGTMIVHWRKKFPFF  243

Query  1287  CSDREYIIGRR  1319
             CSDREYIIGRR
Sbjct  244   CSDREYIIGRR  254



>ref|XP_010450029.1| PREDICTED: uncharacterized protein LOC104732193 [Camelina sativa]
Length=428

 Score =   200 bits (508),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 107/242 (44%), Positives = 156/242 (64%), Gaps = 15/242 (6%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfdsfvss  806
             L   F+ PS  +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R       ++
Sbjct  8     LSHFFKNPSFTETFVDILLCAVPIWLAVMIGLLIGWSWRPRWTGLIYLGFRSKLRFLWTA  67

Query  807   sTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSR-------  965
               G   ++++  F+++ A    + +     ++  ++  +  S+SP++E D+S        
Sbjct  68    PPGFGARRLWLAFTALSAF--SVCRTIWSRNDNRANKSSVGSASPVEETDESGGSNNTTT  125

Query  966   ----VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVY  1133
                 +V ENDL HL QL+E  +    W  MMD++  NMSYQAWR +PE+GP  YRS+TV+
Sbjct  126   VTEDIVTENDLEHLLQLLEVGNANMEWQPMMDKTTPNMSYQAWRHEPESGPVIYRSQTVF  185

Query  1134  EDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIG  1313
             EDATP++VRDFFWDDEFR KWD ML + +TLE+   TGTM+VQW +KFPFFCSDREYIIG
Sbjct  186   EDATPDVVRDFFWDDEFRPKWDFMLANFKTLEEDTQTGTMIVQWRKKFPFFCSDREYIIG  245

Query  1314  RR  1319
             RR
Sbjct  246   RR  247



>ref|XP_010274161.1| PREDICTED: stAR-related lipid transfer protein 7, mitochondrial-like 
[Nelumbo nucifera]
Length=440

 Score =   200 bits (508),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 149/251 (59%), Gaps = 25/251 (10%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsf--------  788
              +E  +RP + + ++++++   PIWVAV+IG+++GW+W+PRW  L               
Sbjct  8     FMEFMKRPVVVETLVDILLCAVPIWVAVMIGLVIGWSWRPRWTGLVFLGLRSKFRFIWTA  67

Query  789   -------------dsfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpn  929
                           +  + S G  L   F G     A+    P   +   E +SS +  +
Sbjct  68    PPGFGARRLWLAFTALSAFSVGRKLWSNFKGKGEESAVSESSPLAPAQSVERSSSGVDLS  127

Query  930   sssplQENDKSRVVDENDLYHLYQLVEEK-DDGPAWIQMMDRSATNMSYQAWRRDPETGP  1106
             S S   E D   +V E DL HL  L+E + +D  AW  MM+RS TNM+YQAWR +PETGP
Sbjct  128   SMSSDVEQD---IVTEKDLEHLLYLLERRAEDTTAWQSMMERSTTNMAYQAWRHEPETGP  184

Query  1107  PQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFF  1286
               Y S+TV+EDATPE+VRDFFWDDEFR KWD ML + + LE+ P  GTM+V WV+KFPFF
Sbjct  185   TIYCSKTVFEDATPELVRDFFWDDEFRPKWDPMLAYCKVLEECPHKGTMIVHWVKKFPFF  244

Query  1287  CSDREYIIGRR  1319
             CSDREYIIGRR
Sbjct  245   CSDREYIIGRR  255



>ref|XP_006838839.1| PREDICTED: uncharacterized protein LOC18429490 [Amborella trichopoda]
 gb|ERN01408.1| hypothetical protein AMTR_s00002p00263850 [Amborella trichopoda]
Length=433

 Score =   199 bits (507),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 107/248 (43%), Positives = 153/248 (62%), Gaps = 16/248 (6%)
 Frame = +3

Query  621   LVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfds  794
             L S  ++  + P I +  L++++ + PIWVAV+IG+++GW+W+PRW  L     +  F  
Sbjct  4     LNSDAVQFLRNPLIVETFLDVLICSVPIWVAVMIGLVIGWSWRPRWTGLIFLGLKSRFRL  63

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQE--NDKSR-  965
               +   G+  ++++  F+++ A  + + + FS             SS+ L E  ND +  
Sbjct  64    AWTVPPGLGARRLWLAFTALSAFSV-LRRMFSDSRAPNKKVHASLSSNSLAEDMNDGNSD  122

Query  966   ----------VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQY  1115
                       VV+E DL +L  L+E KD    W   M+ S  NM+YQAWR +PE GP +Y
Sbjct  123   TVHGSIREEPVVNEKDLEYLVHLLEGKDGETTWQSFMEHSTPNMTYQAWRHEPEVGPTEY  182

Query  1116  RSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSD  1295
             RSRTV+EDA PE+VRDFFWDD+FR KWD ML + + LE+ P TGTM+V W++KFPFFCSD
Sbjct  183   RSRTVFEDAAPELVRDFFWDDDFRPKWDPMLSYFKILEECPLTGTMIVHWIKKFPFFCSD  242

Query  1296  REYIIGRR  1319
             REYIIGRR
Sbjct  243   REYIIGRR  250



>ref|XP_008661910.1| PREDICTED: CP5 isoform X1 [Zea mays]
Length=427

 Score =   199 bits (506),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 110/240 (46%), Positives = 153/240 (64%), Gaps = 10/240 (4%)
 Frame = +3

Query  612   IMALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAs-rdsf  788
             + AL+  L+ IF++ ++G   LEL     P+ +A ++G+L+GWAW+PRWA +        
Sbjct  1     MSALLDLLMGIFRQQTLGGAALELAALAAPLSLAALVGLLIGWAWRPRWAGVVTVDNAQQ  60

Query  789   dsfvsssTGINLQQVFSGFSSIPALKLQIPK-CFSWIseetsssltpnsssplQENDKSR  965
              + + ++     +   +   S       +P+ C + +     +          ++  +  
Sbjct  61    MAQLPAAAPPPDRATATAVVSRNEAAAVVPRICCAGVCRTVVAHAAA------EDEQQQL  114

Query  966   VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDAT  1145
              V+  DL HL++LV+EKD GP+WI MMDR+   M YQAWRRDP +GPPQYRS T++EDA+
Sbjct  115   AVNTGDLLHLWRLVDEKDGGPSWIHMMDRTLPTMRYQAWRRDPPSGPPQYRSSTIFEDAS  174

Query  1146  PEMVRDFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             PE+VRDFFWDDEFR K  WDDML+  ETLE+   TGTMVV+WVRKFPFFCSDREYIIGRR
Sbjct  175   PEVVRDFFWDDEFRMKNSWDDMLLQHETLEECTETGTMVVRWVRKFPFFCSDREYIIGRR  234



>ref|XP_010667651.1| PREDICTED: uncharacterized protein LOC104884663 [Beta vulgaris 
subsp. vulgaris]
Length=433

 Score =   199 bits (506),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/242 (45%), Positives = 148/242 (61%), Gaps = 13/242 (5%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfdsfvss  806
             L E  ++P+I +  +++++ T PIW+AV IG+++GW+W+PRW  L     +     F  +
Sbjct  9     LTEFLKQPAIMETFVDILLCTVPIWLAVSIGLVIGWSWRPRWTGLIFLGLQSKLSFFWPA  68

Query  807   sTGINLQQV---FSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRV---  968
               G   +++   F+  S+  AL    P    +  +  SSS + +S   L  +D S     
Sbjct  69    PPGFGARRLWLAFTALSAFTALPTIWPSLMGYTKQPHSSSQSSSSLPQLGTDDFSDCQAS  128

Query  969   -----VDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVY  1133
                  V ENDL HL  ++E KD   +W  MM+R+ +NMSYQAWR DPE GP  YRSRTV+
Sbjct  129   EAEHDVTENDLEHLLHILEGKDGEFSWQSMMERTTSNMSYQAWRHDPENGPTIYRSRTVF  188

Query  1134  EDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIG  1313
             ED T E+VRDFFWDDEFR KWD ML +   LED   TG M+V W++KFPFFCSDREYII 
Sbjct  189   EDTTAELVRDFFWDDEFRPKWDPMLTYFNILEDCSDTGRMIVHWIKKFPFFCSDREYIIA  248

Query  1314  RR  1319
             RR
Sbjct  249   RR  250



>emb|CDY04099.1| BnaA09g18770D [Brassica napus]
Length=380

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +3

Query  951   NDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTV  1130
              +KS  V  +D  HL+ LVE KD GPAWIQMMDRS    SYQAWRRDP  GPPQYRSRTV
Sbjct  76    KEKSGFVTGDDFRHLWNLVEVKDGGPAWIQMMDRSTPTFSYQAWRRDPHDGPPQYRSRTV  135

Query  1131  YEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYII  1310
             +EDATPEMVRDFFWDD+FR+ WDDML+ + TLE    TGTMVVQWVRKFPFFCSDREYII
Sbjct  136   FEDATPEMVRDFFWDDDFRSNWDDMLLFSSTLEACKDTGTMVVQWVRKFPFFCSDREYII  195

Query  1311  GRR  1319
             GRR
Sbjct  196   GRR  198



>gb|AAM65221.1| membrane related protein-like [Arabidopsis thaliana]
Length=449

 Score =   199 bits (506),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 134/233 (58%), Gaps = 30/233 (13%)
 Frame = +3

Query  705   WVAVVIGVLVGWAWKPRWAN----------LCAsrdsfdsfvsssTGINLQQVFSGFSSI  854
             W+A VIG+++GWAWKPRW +            A R    S  SSS    +     GF S 
Sbjct  15    WLAFVIGLVIGWAWKPRWVSSSNNRQVKLQCSAPRSFDLSLPSSSPSSVVTSPLKGFGSA  74

Query  855   PALKLQIPKCFSWIseetsssltp------------------nsssplQENDKSRVVDEN  980
             P LK  +  C +W         T                    S     E      V E 
Sbjct  75    PCLKALV--CDTWTMALRQQRQTVSPDSSSSSYDSSEQHLDLVSRVKKTEERLPNTVTEL  132

Query  981   DLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVR  1160
             DL HL QLVE KD G AWIQMMDR  + M YQAW R+P+ GP +YRSRTV+EDATP M+R
Sbjct  133   DLRHLVQLVERKDGGQAWIQMMDRFTSGMRYQAWLREPKNGPTEYRSRTVFEDATPVMLR  192

Query  1161  DFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             DFFWDDEFR  WD ML ++ T+E+ PSTGTM+V+W+RKFPFFCSDREY+IGRR
Sbjct  193   DFFWDDEFRPTWDTMLSNSTTVEECPSTGTMIVRWIRKFPFFCSDREYVIGRR  245



>ref|XP_009604590.1| PREDICTED: phosphatidylcholine transfer protein isoform X2 [Nicotiana 
tomentosiformis]
Length=317

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +3

Query  960   SRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYED  1139
             + +  + DL +L+ LVE KD GP W  MMDRS   MSYQAW+RDP++GPPQY SRTVYED
Sbjct  7     NNLTSDEDLEYLWHLVERKDGGPPWKHMMDRSTPTMSYQAWQRDPQSGPPQYCSRTVYED  66

Query  1140  ATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             ATPE++RDFFWDDEFR KWDDML+HAET+E+ P+TGTM+V WVRKFPFFCSDREYI GRR
Sbjct  67    ATPELLRDFFWDDEFRLKWDDMLVHAETIEECPTTGTMIVHWVRKFPFFCSDREYIFGRR  126



>ref|XP_009757654.1| PREDICTED: uncharacterized protein LOC104210451 [Nicotiana sylvestris]
Length=453

 Score =   199 bits (506),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/259 (39%), Positives = 146/259 (56%), Gaps = 29/259 (11%)
 Frame = +3

Query  630   ALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsss  809
              L+E+  +P+I +  ++++V   PIWVA++IG+++GW+W+PRW  L              
Sbjct  8     GLVELINKPAIMETFVDILVCIVPIWVAIMIGLMIGWSWRPRWTGLVFLGLRSKLNRFVW  67

Query  810   T---GINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVVD--  974
             T   G   ++++  F+++ A  +     F++       S      S  +    S V D  
Sbjct  68    TIPPGFGARRLWLAFTALSAFSVGRKLWFNFQGRTPKPSADSGQVSVDEFGSSSAVSDPG  127

Query  975   ------------------------ENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAW  1082
                                     E DL H   L++ KD   AW  MMDRS +N +YQAW
Sbjct  128   PGEGNNDSITRHITGTSENEDIVTEKDLEHFLHLLDGKDGEMAWQTMMDRSTSNFTYQAW  187

Query  1083  RRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQ  1262
             R +PE GP  YR++TV+EDATPE+VRDFFWDDEFR KWD ML + + L++ P TG+M++ 
Sbjct  188   RHEPEMGPTIYRTKTVFEDATPELVRDFFWDDEFRPKWDPMLAYFKILQESPHTGSMIIH  247

Query  1263  WVRKFPFFCSDREYIIGRR  1319
             W++KFPFFCSDREYIIGRR
Sbjct  248   WIKKFPFFCSDREYIIGRR  266



>ref|XP_007136439.1| hypothetical protein PHAVU_009G045400g [Phaseolus vulgaris]
 gb|ESW08433.1| hypothetical protein PHAVU_009G045400g [Phaseolus vulgaris]
Length=442

 Score =   198 bits (504),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/257 (43%), Positives = 156/257 (61%), Gaps = 22/257 (9%)
 Frame = +3

Query  615   MALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfds  794
             M L  +L ++ + P+   +   + +F +P+  A  +GV+VGW WKP+WA L   + +   
Sbjct  1     MPLPQSLYDMLENPATLGLCTLVGMFLSPLCAAFFVGVIVGWLWKPKWARLGKEKLTTSL  60

Query  795   fvss----------sTGINLQQVFSGFSS--IPALKLQIPKCFSWIseetsssltpnsss  938
               S            +   +  + S +SS  + ++K+Q P   S   ++ +   T +SSS
Sbjct  61    VKSLDFASPSSASSPSKSVVSTIKSCYSSPCLSSIKMQRPNPESLALKKGTEKKTSSSSS  120

Query  939   plQ---ENDKSRVVDEN-------DLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRR  1088
             P++        + ++E        DL+HL+ LVEEKD    WIQMMDRS   M Y+AW R
Sbjct  121   PVKFASSVSSPKAIEETPDAVTTRDLHHLWLLVEEKDGSLPWIQMMDRSTPTMCYKAWHR  180

Query  1089  DPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWV  1268
             +P+ GPPQYRS T++EDATPEMVRD FWDDEFR +WDDML  +  +E+ P+TGTM VQW+
Sbjct  181   EPKDGPPQYRSSTIFEDATPEMVRDLFWDDEFRPRWDDMLASSSIIEECPTTGTMKVQWI  240

Query  1269  RKFPFFCSDREYIIGRR  1319
             RKFPFFC DREYIIGRR
Sbjct  241   RKFPFFCKDREYIIGRR  257



>ref|XP_006280456.1| hypothetical protein CARUB_v10026389mg [Capsella rubella]
 gb|EOA13354.1| hypothetical protein CARUB_v10026389mg [Capsella rubella]
Length=450

 Score =   199 bits (505),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 139/231 (60%), Gaps = 28/231 (12%)
 Frame = +3

Query  705   WVAVVIGVLVGWAWKPRWAN---------LCAsrdsfdsfvsssTGINLQQVFSGFSSIP  857
             W+A VIG+++GW WKPRW +          C++  SFD  + S +  ++     GF S P
Sbjct  15    WLAFVIGLIIGWVWKPRWVSSSGDREVKLRCSAPRSFDLSLPSPSSSSVSSPLKGFGSAP  74

Query  858   ALKLQIPKCFSWIseetsssltpnsssplQE-------NDKSRV----------VDENDL  986
              LK  +  C +W              S           N  SRV          V E DL
Sbjct  75    CLKALV--CDTWTMALRQQRTVSPDCSSSSSDSSEQHLNLVSRVKKTEERLPNTVTELDL  132

Query  987   YHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDF  1166
              HL QLVE KD G AWIQMMDR  + M YQAW R+P+ GP +YRSRTV+EDATPE++RDF
Sbjct  133   RHLVQLVERKDGGQAWIQMMDRFTSGMRYQAWLREPKNGPTEYRSRTVFEDATPEILRDF  192

Query  1167  FWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             FWDDEFR  WD ML ++ T+E+  STGTM+V+W+RKFPFFCSDREY+IGRR
Sbjct  193   FWDDEFRPTWDTMLSNSTTVEECTSTGTMIVRWIRKFPFFCSDREYVIGRR  243



>emb|CDY17454.1| BnaC09g20830D [Brassica napus]
Length=379

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +3

Query  951   NDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTV  1130
              +KS  V  +D  HL+ LVE KD GP+WIQMMDRS    SYQAWRRDP  GPPQYRSRTV
Sbjct  75    KEKSGFVTGDDFRHLWNLVEVKDGGPSWIQMMDRSTPTFSYQAWRRDPHDGPPQYRSRTV  134

Query  1131  YEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYII  1310
             +EDATPEMVRDFFWDD+FR+ WDDML+ + TLE    TGTMVVQWVRKFPFFCSDREYII
Sbjct  135   FEDATPEMVRDFFWDDDFRSNWDDMLLFSSTLEACKDTGTMVVQWVRKFPFFCSDREYII  194

Query  1311  GRR  1319
             GRR
Sbjct  195   GRR  197



>dbj|BAB11579.1| membrane related protein-like [Arabidopsis thaliana]
Length=400

 Score =   197 bits (501),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 129/206 (63%), Gaps = 25/206 (12%)
 Frame = +3

Query  705   WVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGINLQQVFSGFSSIPALKLQIPKC  884
             W+A VIG+++GWAWKPRW                 +  N +QV         L+   P+ 
Sbjct  15    WLAFVIGLVIGWAWKPRWV----------------SSSNNRQV--------KLQCSAPRS  50

Query  885   FSWIseetsssltpnsssplQENDK-SRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSAT  1061
             F      +S S    S      +++    V E DL HL QLVE KD G AWIQMMDR   
Sbjct  51    FDLSLPSSSPSSVVTSPLKGFGSERLPNTVTELDLRHLVQLVERKDGGQAWIQMMDRFTP  110

Query  1062  NMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPS  1241
              M YQAW R+P+ GP +YRSRTV+EDATP M+RDFFWDDEFR  WD ML ++ T+E+ PS
Sbjct  111   GMRYQAWLREPKNGPTEYRSRTVFEDATPVMLRDFFWDDEFRPTWDTMLSNSTTVEECPS  170

Query  1242  TGTMVVQWVRKFPFFCSDREYIIGRR  1319
             TGTM+V+W+RKFPFFCSDREY+IGRR
Sbjct  171   TGTMIVRWIRKFPFFCSDREYVIGRR  196



>ref|XP_006401611.1| hypothetical protein EUTSA_v10013518mg [Eutrema salsugineum]
 gb|ESQ43064.1| hypothetical protein EUTSA_v10013518mg [Eutrema salsugineum]
Length=451

 Score =   198 bits (504),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 141/246 (57%), Gaps = 30/246 (12%)
 Frame = +3

Query  666   DVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsss------------  809
             D+++ +++     W+A V+G+++GWAWKPRW +  +S +       S+            
Sbjct  2     DLLVSIILGLIVGWLAFVVGLIIGWAWKPRWVSSSSSNNLKVKLQCSAPRSFDLSLPSSP  61

Query  810   TGINLQQVFSGFSSIPALKLQIPKCFSWIseetssslt----------------pnsssp  941
             +  +      GF S P LK  +  C +W                            +   
Sbjct  62    SPRSATSPLKGFGSAPCLKALV--CDTWTMALRQQKTISPVSSSSSCDSSDHVDVIAGGK  119

Query  942   lQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRS  1121
               E      V E DL HL QLVE KD G AWIQ+MDR    M YQAW R+P++GP +YRS
Sbjct  120   KTEERLPNTVTELDLRHLVQLVERKDGGQAWIQIMDRFTPGMRYQAWLREPKSGPTEYRS  179

Query  1122  RTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDRE  1301
             RTV+EDATPE++RDFFWDDEFR  WD ML ++ T+E+ P+TGTM+V+W+RKFPFFCSDRE
Sbjct  180   RTVFEDATPEVLRDFFWDDEFRPTWDTMLSNSTTVEECPTTGTMIVRWIRKFPFFCSDRE  239

Query  1302  YIIGRR  1319
             Y+IGRR
Sbjct  240   YVIGRR  245



>dbj|BAJ94056.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=458

 Score =   198 bits (503),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/242 (42%), Positives = 145/242 (60%), Gaps = 25/242 (10%)
 Frame = +3

Query  621   LVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfv  800
             ++SA+  + ++P+      E+ +   P+W A ++G+L+GWAW+PRWA             
Sbjct  49    VLSAVARVLEQPTAWGAACEMALLAGPLWAAALVGLLLGWAWRPRWA-------------  95

Query  801   sssTGINLQQVFSGFSSIPALKLQIPK-------CFSWIseetsssltpnsssplQENDK  959
                 GI         +S+   + Q+P          +   ++       +     +   +
Sbjct  96    ---AGIVAPADPPQLASLDFWRAQLPARIRAPLDYLAGARQQQEDDDEASLHGSSEMGKE  152

Query  960   SRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYED  1139
                V ++DL +L++LVE  D GPAWI+MM+++  NM+YQAWRRDP+ GPPQY+S T++E+
Sbjct  153   ELAVGKDDLVNLWRLVEGNDGGPAWIKMMEKALPNMTYQAWRRDPQNGPPQYQSSTIFEN  212

Query  1140  ATPEMVRDFFWDDEFR--AKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIG  1313
             ATP+ VRDFF DDEFR   KWDDMLI  +TLE+  +TGTM V WVRKFPFFCSDREYII 
Sbjct  213   ATPDEVRDFFGDDEFRMSNKWDDMLISHQTLEECQTTGTMKVHWVRKFPFFCSDREYIIA  272

Query  1314  RR  1319
             RR
Sbjct  273   RR  274



>ref|NP_568805.1| lipid-binding START domain-containing protein [Arabidopsis thaliana]
 gb|AED96462.1| lipid-binding START domain-containing protein [Arabidopsis thaliana]
Length=449

 Score =   198 bits (503),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 113/233 (48%), Positives = 137/233 (59%), Gaps = 30/233 (13%)
 Frame = +3

Query  705   WVAVVIGVLVGWAWKPRWAN----------LCAsrdsfdsfvsssTGINLQQVFSGFSSI  854
             W+A VIG+++GWAWKPRW +            A R    S  SSS    +     GF S 
Sbjct  15    WLAFVIGLVIGWAWKPRWVSSSNNRQVKLQCSAPRSFDLSLPSSSPSSVVTSPLKGFGSA  74

Query  855   PALKLQIPKCFSWIseetsssltpnsssplQ---------------ENDKSRV---VDEN  980
             P LK  +  C +W         T +  S                  +  K R+   V E 
Sbjct  75    PCLKALV--CDTWTMALRQQRQTVSPDSSSSSYDSSEQHLDLVSRVKKTKERLPNTVTEL  132

Query  981   DLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVR  1160
             DL HL QLVE KD G AWIQMMDR    M YQAW R+P+ GP +YRSRTV+EDATP M+R
Sbjct  133   DLRHLVQLVERKDGGQAWIQMMDRFTPGMRYQAWLREPKNGPTEYRSRTVFEDATPVMLR  192

Query  1161  DFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             DFFWDDEFR  WD ML ++ T+E+ PSTGTM+V+W+RKFPFFCSDREY+IGRR
Sbjct  193   DFFWDDEFRPTWDTMLSNSTTVEECPSTGTMIVRWIRKFPFFCSDREYVIGRR  245



>ref|XP_009627905.1| PREDICTED: uncharacterized protein LOC104118382 [Nicotiana tomentosiformis]
Length=455

 Score =   198 bits (503),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/262 (39%), Positives = 149/262 (57%), Gaps = 32/262 (12%)
 Frame = +3

Query  630   ALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsss  809
              L+E+  +P+I +  ++++V   PIWVA++IG+++GW+W+PRW  L              
Sbjct  8     GLVELINKPAIMETFVDILVCIVPIWVAIMIGLMIGWSWRPRWTGLVFLGFRSKLNRFVW  67

Query  810   T---GINLQQVFSGFSSIPALKLQIPKCFSW------------------Iseetsssltp  926
             T   G   ++++  F+++ A  +     F++                  + E  SSS   
Sbjct  68    TVPPGFGARRLWLAFTALSAFSVGRKLWFNFQGRTRKPSAVAADSGQVSVDEFGSSSAIS  127

Query  927   nsssplQEND-----------KSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSY  1073
                     ND              +V E DL H   L++ KD   AW  MMDRS +N +Y
Sbjct  128   GPGPGEGNNDSVTRHITGTSENEGIVTEKDLEHFLHLLDGKDGEMAWQTMMDRSTSNFTY  187

Query  1074  QAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTM  1253
             QAWR +PE GP  YR++TV+EDATPE+VRDFFWDDEFR KWD ML + + L++ P TG+M
Sbjct  188   QAWRHEPEMGPTIYRTKTVFEDATPELVRDFFWDDEFRLKWDPMLAYFKILQESPHTGSM  247

Query  1254  VVQWVRKFPFFCSDREYIIGRR  1319
             ++ W++KFPFFCSDREYIIGRR
Sbjct  248   IIHWIKKFPFFCSDREYIIGRR  269



>ref|XP_010482825.1| PREDICTED: uncharacterized protein LOC104761442 [Camelina sativa]
Length=451

 Score =   197 bits (501),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 107/233 (46%), Positives = 138/233 (59%), Gaps = 30/233 (13%)
 Frame = +3

Query  705   WVAVVIGVLVGWAWKPRWAN---------LCAsrdsfdsfvsssTGINLQQVFSGFSSIP  857
             W A V+G+++GWAWKP+W +          C++  SFD  + S +  ++     GF S P
Sbjct  15    WFAFVVGLIIGWAWKPKWVSSSSDGEVKLRCSAPRSFDLSLPSPSSSSVSSPLKGFGSAP  74

Query  858   ALKLQIPKCFSWIseetsssltp-------------------nsssplQENDKSRVVDEN  980
              LK  +  C +W         T                     S     E      V E 
Sbjct  75    CLKALV--CDTWTMALRQQRTTVSPDSSSSSSSDTSEQHGGLVSRVKKTEERLPNTVTEL  132

Query  981   DLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVR  1160
             DL HL QLVE KD G AWIQMMDR  + M YQAW R+P+ GP +YRSRTV+EDATP+++R
Sbjct  133   DLRHLVQLVERKDGGQAWIQMMDRFTSGMRYQAWLREPKNGPTEYRSRTVFEDATPQILR  192

Query  1161  DFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             DFFWDDEFR  WD ML ++ T+E+ PS+GTM+V+W+RKFPFFCSDREY+IGRR
Sbjct  193   DFFWDDEFRPTWDTMLSNSTTVEECPSSGTMIVRWIRKFPFFCSDREYVIGRR  245



>ref|XP_002866025.1| hypothetical protein ARALYDRAFT_918536 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42284.1| hypothetical protein ARALYDRAFT_918536 [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   197 bits (500),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/235 (46%), Positives = 131/235 (56%), Gaps = 32/235 (14%)
 Frame = +3

Query  705   WVAVVIGVLVGWAWKPRWA-------------NLCAsrdsfdsfvsssTGINLQQVFSGF  845
             W+A V+G+++GW WKPRW                 A R    S  SSS    +     GF
Sbjct  15    WLAFVVGLIIGWTWKPRWVSSSSSSNNRQVKLQCSAPRSFDLSLPSSSPSSVVTSPLKGF  74

Query  846   SSIPALKLQIPKCFSWIseetsssl-----------------tpnsssplQENDKSRVVD  974
              S P LK  +  C +W                             S     E      V 
Sbjct  75    GSAPCLKALV--CDTWTMALRQQRTVSPDSSSSSSDSSEQHVGLVSRLKKTEERLPNTVT  132

Query  975   ENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEM  1154
             E DL HL QLVE KD G AWIQMMDR  + M YQAW R+P+ GP +YRSRTV+EDATPE+
Sbjct  133   ELDLRHLVQLVERKDGGQAWIQMMDRFTSGMRYQAWLREPKNGPTEYRSRTVFEDATPEI  192

Query  1155  VRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             +RDFFWDDEFR  WD ML  + T+E+ PSTGTM+V+W+RKFPFFCSDREY+IGRR
Sbjct  193   LRDFFWDDEFRPTWDTMLSSSTTVEECPSTGTMIVRWIRKFPFFCSDREYVIGRR  247



>ref|XP_010442992.1| PREDICTED: uncharacterized protein LOC104725938 [Camelina sativa]
Length=454

 Score =   197 bits (500),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 137/235 (58%), Gaps = 32/235 (14%)
 Frame = +3

Query  705   WVAVVIGVLVGWAWKPRWANL-----------CAsrdsfdsfvsssTGINLQQVFSGFSS  851
             W A V+G+++GWAWKP+W +            C++  SFD    S +  ++     GF S
Sbjct  15    WFAFVVGLIIGWAWKPKWVSSSSSSDGEVKLRCSAPRSFDLSFPSPSPSSVSSPLKGFGS  74

Query  852   IPALKLQIPKCFSWIseetsssltp-------------------nsssplQENDKSRVVD  974
              P LK  +  C +W         T                     S     E      V 
Sbjct  75    APCLKALV--CDTWTMALRQQRTTVSPDSSSSSSSDTSEQHVGLVSRVKKNEERIPNTVT  132

Query  975   ENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEM  1154
             E DL HL QLVE KD G AWIQMMDR  + M YQAW R+P+ GP +YRSRTV+EDATP++
Sbjct  133   ELDLRHLVQLVERKDGGQAWIQMMDRFTSGMRYQAWLREPKNGPTEYRSRTVFEDATPQI  192

Query  1155  VRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             +RDFFWDDEFR  WD ML ++ T+E+ PS+GTM+V+W+RKFPFFCSDREY+IGRR
Sbjct  193   LRDFFWDDEFRPTWDTMLSNSTTVEECPSSGTMIVRWIRKFPFFCSDREYVIGRR  247



>ref|XP_010532604.1| PREDICTED: uncharacterized protein LOC104808596 [Tarenaya hassleriana]
Length=497

 Score =   197 bits (502),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/249 (42%), Positives = 150/249 (60%), Gaps = 21/249 (8%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             L++  + PS+ +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R        +
Sbjct  67    LMDFLRNPSVTETFVDILLCAVPIWLAVMIGLLIGWSWRPRWTGLVYLGFRSKLRFLWIA  126

Query  807   sTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQE------------  950
                   +Q++  FS++ A  +     +S +      S    + +  +E            
Sbjct  127   PPVFGARQLWLAFSALSAFSV-CRTIWSRLRPSADKSAAGPTPASTEEALPIDGTGPVPR  185

Query  951   ------NDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQ  1112
                    +K  VV ENDL HL  L+E  +    W  MM+++  NMSYQAWR +PETG   
Sbjct  186   NGHGSREEKQEVVVENDLKHLLNLLEVGNAEREWQYMMEKTTGNMSYQAWRHEPETGHVA  245

Query  1113  YRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCS  1292
             YRSRTV+EDATPE+VRDFFWDDEFR KWD ML + E+LE+ P +GTM+V+W++KFPFFCS
Sbjct  246   YRSRTVFEDATPEIVRDFFWDDEFRPKWDPMLSYFESLEEDPRSGTMIVRWIKKFPFFCS  305

Query  1293  DREYIIGRR  1319
             +REYIIGRR
Sbjct  306   NREYIIGRR  314



>ref|XP_009119952.1| PREDICTED: uncharacterized protein LOC103844879 [Brassica rapa]
Length=449

 Score =   196 bits (498),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 134/244 (55%), Gaps = 29/244 (12%)
 Frame = +3

Query  669   VILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGINLQQV-----  833
             +++ L++     W+A V+G+++GWAW+PRW +            + +   +L        
Sbjct  3     LLVSLILGLIAGWLAFVVGLVIGWAWRPRWVSSSDKERVKLECSAPTRSFDLSLPSSPSP  62

Query  834   ------FSGFSSIPALKLQIPKCFSWIseetsssltpn----------------sssplQ  947
                     GF S P LK  +  C +W           +                +     
Sbjct  63    RSATSPLKGFGSAPCLKALV--CDTWTMALRQQKTVSHVSSSSSSSSCDSSDVIAGGKKT  120

Query  948   ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRT  1127
             E      V E DL  L QLVE KD G AWIQMMDR    M YQAW R+P+ GP +YRSRT
Sbjct  121   EERLPNTVTELDLRQLVQLVERKDGGQAWIQMMDRFTPGMRYQAWLREPKNGPTEYRSRT  180

Query  1128  VYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYI  1307
             V+EDATPEM+RDFFWDDEFR  WD ML  + T+E+  STGTM+V+W+RKFPFFCSDREY+
Sbjct  181   VFEDATPEMLRDFFWDDEFRPTWDTMLASSTTVEECTSTGTMIVRWIRKFPFFCSDREYV  240

Query  1308  IGRR  1319
             IGRR
Sbjct  241   IGRR  244



>gb|EMT15608.1| hypothetical protein F775_30865 [Aegilops tauschii]
Length=410

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/235 (45%), Positives = 146/235 (62%), Gaps = 17/235 (7%)
 Frame = +3

Query  621   LVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfv  800
             L   L E+F+ P++  V  EL     P+W+A ++G+L+GWAW+PRWA   A         
Sbjct  4     LADMLAEVFREPTLAGVARELATLAAPLWLAALVGLLIGWAWRPRWAAAVAGHQQPVLAA  63

Query  801   sssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVVDEN  980
             +++     Q   +  ++   L + +P+                ++S +   ++   V   
Sbjct  64    AAAAQAPAQPSLTQATAADHLAV-VPRA--------------KAASSVAPVEEELAVSTP  108

Query  981   DLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVR  1160
             DL HL ++VEEKD GPAW  MMDR+     YQAW+R+P+ GPPQYRS T++EDA+P++VR
Sbjct  109   DLMHLRRVVEEKDGGPAWTHMMDRTLPTFRYQAWKREPQNGPPQYRSSTIFEDASPDVVR  168

Query  1161  DFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             DFFWDD+FR    WDDML+  ETLE+   TGTMVV+WVRKFPFFCSDREY+IGRR
Sbjct  169   DFFWDDDFRISNTWDDMLLEHETLEECAKTGTMVVRWVRKFPFFCSDREYVIGRR  223



>ref|XP_008362030.1| PREDICTED: uncharacterized protein LOC103425717 [Malus domestica]
Length=441

 Score =   196 bits (497),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/253 (42%), Positives = 153/253 (60%), Gaps = 20/253 (8%)
 Frame = +3

Query  621   LVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfds  794
             ++SALLE F +PSI +   ++++   PIW+AV+IG+++GW+W+PRW  L     R  F  
Sbjct  4     MLSALLEFFVKPSITETFXDILLCAVPIWLAVMIGLVIGWSWRPRWTGLLYLGLRSKFRF  63

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIP-----KCFSWIseetsssltpnsssplQENDK  959
               ++  G   ++++  F+++ A  L        K    ++  ++     + S+    +D 
Sbjct  64    LWTAPPGFGARRLWLAFTALSAFSLCRTIWSNFKGKGKVAPPSAGDSAASGSAATAGSDT  123

Query  960   SRV-------------VDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPET  1100
               V             V E DL HL  L+  +D    W  +M+RS  +M+Y+AWR DPET
Sbjct  124   DIVGPIAKGAERLQDVVTETDLEHLVNLIGGRDGEMEWQSLMERSTPSMAYKAWRHDPET  183

Query  1101  GPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFP  1280
             GP  Y SRTV+EDATPE+VRDFFWDDEFR KWD ML + + L + P TGTM+V W++KFP
Sbjct  184   GPTVYCSRTVFEDATPELVRDFFWDDEFRPKWDPMLTYFKILXECPQTGTMIVHWIKKFP  243

Query  1281  FFCSDREYIIGRR  1319
             FFCSDREY+IGRR
Sbjct  244   FFCSDREYLIGRR  256



>ref|XP_009347795.1| PREDICTED: stAR-related lipid transfer protein 7, mitochondrial-like 
[Pyrus x bretschneideri]
Length=441

 Score =   195 bits (496),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/253 (42%), Positives = 155/253 (61%), Gaps = 20/253 (8%)
 Frame = +3

Query  621   LVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfds  794
             ++S L+E F +PSI +  +++++   PIW+AV+IG+++GW+W+PRW  L     R  F  
Sbjct  4     MLSDLMEFFVKPSITETFVDILLCAVPIWLAVMIGLVIGWSWRPRWTGLLYLGLRSKFRF  63

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIP-----KCFSWIseetsssltpnsssplQENDK  959
               ++  G   ++++  F+++ A  L        K    ++  ++     + S+   E+D 
Sbjct  64    LWTAPPGFGARRLWLAFTALSAFSLCRTIWSNFKGKGKVAPPSAGDSAASGSAATAESDT  123

Query  960   SRV-------------VDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPET  1100
               V             V E DL HL  L+  +D    W  +M+RS  +M+Y+AWR DPET
Sbjct  124   DIVGPIAKGAERLQDVVTETDLEHLVNLIGGRDGEMQWQSLMERSTPSMAYKAWRHDPET  183

Query  1101  GPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFP  1280
             GP  Y SRTV+EDATPE+VRDFFWDDEFR KWD ML + + LE+ P TGTM+V W++KFP
Sbjct  184   GPTVYCSRTVFEDATPELVRDFFWDDEFRPKWDPMLTYFKILEECPQTGTMIVHWIKKFP  243

Query  1281  FFCSDREYIIGRR  1319
             FFCSDREY+IGRR
Sbjct  244   FFCSDREYLIGRR  256



>ref|XP_004134093.1| PREDICTED: uncharacterized protein LOC101216617 [Cucumis sativus]
Length=439

 Score =   195 bits (496),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/249 (39%), Positives = 150/249 (60%), Gaps = 20/249 (8%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             L+E  ++PSI +  +++++   PIW+AV+IG+++GW+W+PRW  L     R  F    ++
Sbjct  8     LVEFLKKPSIAETFVDILLCAVPIWLAVMIGLVIGWSWRPRWTGLVFLGFRSKFRLLWTA  67

Query  807   sTGINLQQVFSGFSSIPALKLQIPKCFSWIseets------------------ssltpns  932
               G   ++++  F+++ A  +      ++  +  +                  +  + + 
Sbjct  68    PPGFGARRLWLAFTALSAFSVCRTLWSNFYGKRKAPPVPPTPDSPVSSTLVHSAEGSGDV  127

Query  933   ssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQ  1112
              +  +E  +  ++ ENDL HL QL+E +     W  MM RS  N +Y+AWR +PE  P  
Sbjct  128   IANKEEGKEQDIITENDLDHLLQLLEGRHGEAEWQSMMQRSTPNFAYEAWRLEPENRPTV  187

Query  1113  YRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCS  1292
             YRSRTV+EDATPEMVRDFFWDDEFR KWD ML + + L++ P TGTM+V W++KFPFFCS
Sbjct  188   YRSRTVFEDATPEMVRDFFWDDEFRTKWDPMLTYFKILDECPHTGTMIVHWIKKFPFFCS  247

Query  1293  DREYIIGRR  1319
             DREY+ GRR
Sbjct  248   DREYVYGRR  256



>emb|CDY14327.1| BnaA10g07280D [Brassica napus]
Length=374

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/244 (42%), Positives = 133/244 (55%), Gaps = 29/244 (12%)
 Frame = +3

Query  669   VILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGINLQQV-----  833
             +++ L++     W+A V+G+++GWAW+PRW +            + +   +L        
Sbjct  3     LLVSLILGLIAGWLAFVVGLVIGWAWRPRWVSSSDKERVKLECSAPTRSFDLSLPSSPSP  62

Query  834   ------FSGFSSIPALKLQIPKCFSWIseetsssltpn----------------sssplQ  947
                     GF S P LK  +  C +W           +                +     
Sbjct  63    RSATSPLKGFGSAPCLKALV--CDTWTMALRQQKTVSHVSSSSSSSSCDSSDVIAGGKKT  120

Query  948   ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRT  1127
             E      V E DL  L  LVE KD G AWIQMMDR    M YQAW R+P+ GP +YRSRT
Sbjct  121   EERLPNTVTELDLRQLVHLVERKDGGQAWIQMMDRFTPGMRYQAWLREPKNGPTEYRSRT  180

Query  1128  VYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYI  1307
             V+EDATPEM+RDFFWDDEFR  WD ML  + T+E+  STGTM+V+W+RKFPFFCSDREY+
Sbjct  181   VFEDATPEMLRDFFWDDEFRPTWDTMLASSTTVEECTSTGTMIVRWIRKFPFFCSDREYV  240

Query  1308  IGRR  1319
             IGRR
Sbjct  241   IGRR  244



>ref|XP_009378796.1| PREDICTED: stAR-related lipid transfer protein 7, mitochondrial-like 
[Pyrus x bretschneideri]
Length=441

 Score =   195 bits (495),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 106/253 (42%), Positives = 155/253 (61%), Gaps = 20/253 (8%)
 Frame = +3

Query  621   LVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfds  794
             ++S L+E F +PSI +  +++++   PIW+AV+IG+++GW+W+PRW  L     R  F  
Sbjct  4     MLSDLMEFFVKPSITETFVDILLCAVPIWLAVMIGLVIGWSWRPRWTGLLYLGLRSKFRF  63

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIP-----KCFSWIseetsssltpnsssplQENDK  959
               ++  G   ++++  F+++ A  L        K    ++  ++     + S+   E+D 
Sbjct  64    LWTAPPGFGARRLWLAFTALSAFSLCRTIWSNFKGKGKVAPPSAGDSAASGSAATAESDT  123

Query  960   SRV-------------VDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPET  1100
               V             V E DL HL  L+  +D    W  +M+RS  +M+Y+AWR DPET
Sbjct  124   DIVGPIAKGADRLQDVVTETDLEHLVNLIGGRDGEMQWQSLMERSTPSMAYKAWRHDPET  183

Query  1101  GPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFP  1280
             GP  Y SRTV+EDATPE+VRDFFWDDEFR KWD ML + + LE+ P TGTM+V W++KFP
Sbjct  184   GPTVYCSRTVFEDATPELVRDFFWDDEFRPKWDPMLTYFKILEECPQTGTMIVHWIKKFP  243

Query  1281  FFCSDREYIIGRR  1319
             FFCSDREY+IGRR
Sbjct  244   FFCSDREYLIGRR  256



>ref|NP_001148371.1| CP5 [Zea mays]
 gb|ACG31170.1| CP5 [Zea mays]
Length=421

 Score =   194 bits (494),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 108/238 (45%), Positives = 149/238 (63%), Gaps = 12/238 (5%)
 Frame = +3

Query  612   IMALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfd  791
             + AL+  L+ IF++ ++G   LEL     P+ +A ++G+L+GWAW+PRWA +    ++  
Sbjct  1     MSALLDLLMGIFRQQTLGGAALELAALAAPLSLAALVGLLIGWAWRPRWAGVVVVDNAQQ  60

Query  792   sfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVV  971
                  +      +  +  +++           S          T  + +  ++  +   V
Sbjct  61    MAQLPAAAAPPDRATATTTAV----------VSRNEAAAVVPRTVVAHAAAEDEQQQLAV  110

Query  972   DENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPE  1151
             +  DL HL++LV+EKD GP+WI MMDR+   M YQAWRRDP +GPPQYRS T+ EDA+PE
Sbjct  111   NTGDLMHLWRLVDEKDGGPSWIHMMDRTLPTMRYQAWRRDPPSGPPQYRSSTILEDASPE  170

Query  1152  MVRDFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             +VRDFFWDDEFR    WDDML+  ETLE+   TGTMVV+WVRKFPFFCSDREYIIGRR
Sbjct  171   VVRDFFWDDEFRMNNSWDDMLLQHETLEECTETGTMVVRWVRKFPFFCSDREYIIGRR  228



>ref|XP_002312574.2| hypothetical protein POPTR_0008s16250g [Populus trichocarpa]
 gb|EEE89941.2| hypothetical protein POPTR_0008s16250g [Populus trichocarpa]
Length=440

 Score =   195 bits (495),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 109/249 (44%), Positives = 159/249 (64%), Gaps = 20/249 (8%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             L+E  + PSI + ++++++   PIW++V+IG+++GW+W+PRW  L     R  F    ++
Sbjct  8     LMEFLKTPSITETLVDILLCAVPIWLSVMIGLVIGWSWRPRWTGLVFLGLRSKFRFLWTA  67

Query  807   sTGINLQQVFSGFSSIPALKL--QIPKCFSWIseetsssltpnsssplQEN---------  953
               G   ++++  F++I A  +   I   F   + +++ +   +SS+  Q N         
Sbjct  68    PPGFGARRLWLAFTAISAFSVCRTIWSNFQGKNRKSAPAAAASSSATSQRNPGGRSGGSI  127

Query  954   -------DKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQ  1112
                    D+  +V ENDL HL  L+E KD    W  MM+RS +NM YQAWR +P+ GP  
Sbjct  128   SSSGELEDREDIVTENDLEHLLHLLEGKDRQMEWQCMMERSTSNMRYQAWRHEPQEGPTV  187

Query  1113  YRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCS  1292
             YRSR+V+EDATPE+VRDFFWDDEFR KWD ML + + LE++P TGTM+V W++KFPFFCS
Sbjct  188   YRSRSVFEDATPELVRDFFWDDEFRPKWDTMLAYFKILEEYPHTGTMIVHWIKKFPFFCS  247

Query  1293  DREYIIGRR  1319
             DREYIIGRR
Sbjct  248   DREYIIGRR  256



>ref|NP_001168384.1| hypothetical protein [Zea mays]
 gb|ACN28038.1| unknown [Zea mays]
 tpg|DAA38705.1| TPA: hypothetical protein ZEAMMB73_284509 [Zea mays]
Length=408

 Score =   194 bits (493),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 113/238 (47%), Positives = 146/238 (61%), Gaps = 21/238 (9%)
 Frame = +3

Query  612   IMALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfd  791
             + AL+  L+ IF++ ++G   LEL     P+W+A ++G+L+GWAW+PRWA +     +  
Sbjct  1     MSALLDLLMGIFRQQTLGGAALELAALAAPLWLAALVGLLIGWAWRPRWAGVVVGDHNAQ  60

Query  792   sfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVV  971
                          V    +  PA+  +                     +P    D+   V
Sbjct  61    QAAQLPPPPAAAAVVP-RNEAPAVVTRT------------------VVAPAAPEDEQLAV  101

Query  972   DENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPE  1151
             +  DL HL++LV+EKD GP+WI MMDR+   M YQAWRRDP  GPPQYRS T++EDA+PE
Sbjct  102   NTRDLMHLWRLVQEKDGGPSWIHMMDRTLPTMRYQAWRRDPPNGPPQYRSSTIFEDASPE  161

Query  1152  MVRDFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             +VRDFFWDDEFR K  WDDML+  ETLE    TGTMVV+WVRKFPFFCSDREYIIGRR
Sbjct  162   VVRDFFWDDEFRVKNSWDDMLLQYETLEQCAKTGTMVVRWVRKFPFFCSDREYIIGRR  219



>ref|XP_003537648.1| PREDICTED: stAR-related lipid transfer protein 7, mitochondrial-like 
[Glycine max]
Length=434

 Score =   194 bits (494),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/243 (41%), Positives = 147/243 (60%), Gaps = 14/243 (6%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             ++E  ++PS+ +  +++++   PIW+AV+IG+++GW+W+PRW  L     R  F    ++
Sbjct  8     VVEFLKKPSLTETFVDILLCAVPIWLAVMIGLMIGWSWRPRWTGLVFLGLRSKFRFLWTA  67

Query  807   sTGINLQQVFSGFSSIPAL------------KLQIPKCFSWIseetsssltpnsssplQE  950
               G   ++++  F+++ A             K Q P      + ++++      SS   E
Sbjct  68    PPGFGARRLWLAFTALSAFTYWFNFKGKTKAKAQDPSPSQPDATDSNAISRAARSSDRAE  127

Query  951   NDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTV  1130
               +   V + DL H   L+E KD    W   M+RS  NM Y+AWR DPETGP  YRSRTV
Sbjct  128   EREQDTVTQADLEHFLHLLEGKDGVMDWQSFMERSTPNMQYKAWRYDPETGPTVYRSRTV  187

Query  1131  YEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYII  1310
             ++DATPE+VRDFFWDD+FR KWD ML + + LE+ P  GTM+  W++KFPFFCSDREYII
Sbjct  188   FDDATPELVRDFFWDDDFRPKWDAMLAYCKVLEECPHNGTMISHWIKKFPFFCSDREYII  247

Query  1311  GRR  1319
              RR
Sbjct  248   ARR  250



>gb|AAL07016.1| unknown protein [Arabidopsis thaliana]
Length=419

 Score =   194 bits (493),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/234 (44%), Positives = 147/234 (63%), Gaps = 5/234 (2%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
              ++ F +PS+ +  +++++   PIWV V+IG+L+GW+W+PRW +L     R       + 
Sbjct  4     FMDFFNKPSVTETFVDVLLCAVPIWVTVMIGLLIGWSWRPRWTSLVYLGFRSKLRFLCTV  63

Query  807   sTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSR---VVDE  977
               G   ++++  F+++ A  +      S ++  +S  +   + S   +    +   VV E
Sbjct  64    PPGFGARRIWLAFTALSAFSVCSTSNKSSVNNGSSKPVEEEAFSRASDKVTGKEKDVVTE  123

Query  978   NDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMV  1157
              DL HL  L+E  +    W  MMD+S  NMSYQAWR +PE GP  YRSRTV+ED TP++V
Sbjct  124   KDLEHLLHLLEAGNASFEWQSMMDKSTPNMSYQAWRHEPEIGPVVYRSRTVFEDVTPDIV  183

Query  1158  RDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             RDFFWDDEFR KWD ML + +TLE+ P TGT +V W++KFPFFCSDREYIIGRR
Sbjct  184   RDFFWDDEFRPKWDTMLAYFKTLEEDPKTGTTIVHWIKKFPFFCSDREYIIGRR  237



>ref|NP_566722.1| polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Arabidopsis thaliana]
 dbj|BAB02099.1| membrane related protein-like [Arabidopsis thaliana]
 gb|AAN13021.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76713.1| polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Arabidopsis thaliana]
Length=419

 Score =   194 bits (493),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 102/234 (44%), Positives = 147/234 (63%), Gaps = 5/234 (2%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
              ++ F +PS+ +  +++++   PIWV V+IG+L+GW+W+PRW +L     R       + 
Sbjct  4     FMDFFNKPSVTETFVDVLLCAVPIWVTVMIGLLIGWSWRPRWTSLVYLGFRSKLRFLCTV  63

Query  807   sTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQEN---DKSRVVDE  977
               G   ++++  F+++ A  +      S ++  +S  +   + S   +     +  VV E
Sbjct  64    PPGFGARRIWLAFTALSAFSVCSTSNKSSVNNGSSKPVEEEAFSRASDKVTEKEKDVVTE  123

Query  978   NDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMV  1157
              DL HL  L+E  +    W  MMD+S  NMSYQAWR +PE GP  YRSRTV+ED TP++V
Sbjct  124   KDLEHLLHLLEAGNASFEWQSMMDKSTPNMSYQAWRHEPEIGPVVYRSRTVFEDVTPDIV  183

Query  1158  RDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             RDFFWDDEFR KWD ML + +TLE+ P TGT +V W++KFPFFCSDREYIIGRR
Sbjct  184   RDFFWDDEFRPKWDTMLAYFKTLEEDPKTGTTIVHWIKKFPFFCSDREYIIGRR  237



>gb|ACG40939.1| CP5 [Zea mays]
Length=421

 Score =   194 bits (493),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 108/238 (45%), Positives = 149/238 (63%), Gaps = 12/238 (5%)
 Frame = +3

Query  612   IMALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfd  791
             + AL+  L+ IF++ ++G   LEL     P+ +A ++G+L+GWAW+PRWA +    ++  
Sbjct  1     MSALLDLLMGIFRQQTLGGAALELAALAAPLSLAALVGLLIGWAWRPRWAGVVVFDNAQQ  60

Query  792   sfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVV  971
                  +      +  +  +++           S          T  + +  ++  +   V
Sbjct  61    MAQLPAAAAPPDRATATTTAV----------VSRNEAAAVVPRTVVAHAAAEDEQQQLAV  110

Query  972   DENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPE  1151
             +  DL HL++LV+EKD GP+WI MMDR+   M YQAWRRDP +GPPQYRS T+ EDA+PE
Sbjct  111   NTGDLIHLWRLVDEKDGGPSWIHMMDRTLPTMRYQAWRRDPPSGPPQYRSSTILEDASPE  170

Query  1152  MVRDFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             +VRDFFWDDEFR    WDDML+  ETLE+   TGTMVV+WVRKFPFFCSDREYIIGRR
Sbjct  171   VVRDFFWDDEFRMNNSWDDMLLQHETLEECTETGTMVVRWVRKFPFFCSDREYIIGRR  228



>ref|XP_004241025.1| PREDICTED: uncharacterized protein LOC101253385 [Solanum lycopersicum]
Length=454

 Score =   194 bits (494),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 98/262 (37%), Positives = 147/262 (56%), Gaps = 32/262 (12%)
 Frame = +3

Query  630   ALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsss  809
               +E+  +P+I +  ++++V   PIWVA++IG+L+GW+W+PRW  L              
Sbjct  8     GFVELMNKPAIMETFVDILVCVVPIWVAIMIGLLIGWSWRPRWTGLIFLGLRSKINRFVW  67

Query  810   T---GINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQE----------  950
             T   G   ++++  F+++ A  +     F++        +    S  + E          
Sbjct  68    TLPPGFGARRLWLAFTALSAFSVGRKLWFNFQGRTRKPPVAAADSGSVDEFGSSSVVSGP  127

Query  951   -------------------NDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSY  1073
                                ++   +V E DL H   L++ KD   AW  MMDRS +N +Y
Sbjct  128   GSVSFAQRNDDCIIRHITGSENEDIVTERDLEHFLHLLDGKDGEMAWQTMMDRSTSNFTY  187

Query  1074  QAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTM  1253
             QAWR +PE GP  YR++TV+EDATP++VRDFFWDDEFR KWD ML + + L++ P TG+M
Sbjct  188   QAWRHEPEVGPTIYRTKTVFEDATPDLVRDFFWDDEFRPKWDPMLGYFKILQEWPHTGSM  247

Query  1254  VVQWVRKFPFFCSDREYIIGRR  1319
             ++ W++KFPFFCSDREYIIGRR
Sbjct  248   IIHWIKKFPFFCSDREYIIGRR  269



>ref|XP_009132450.1| PREDICTED: uncharacterized protein LOC103857054 [Brassica rapa]
 emb|CDY43050.1| BnaA03g11970D [Brassica napus]
Length=443

 Score =   194 bits (493),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 102/219 (47%), Positives = 128/219 (58%), Gaps = 16/219 (7%)
 Frame = +3

Query  705   WVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssT----GINLQQVFSGFSSIPALKLQ  872
             W+A V+G+L+GWAW+PRW +  +         +  +      +      GF S P  K  
Sbjct  15    WLAFVVGLLIGWAWRPRWVSSPSEEKVQSQCSAPRSFELSSPSSPSPLKGFGSAPCFKTL  74

Query  873   IPKCFSWIseetsssltpnsssplQ----------ENDKSRVVDENDLYHLYQLVEEKDD  1022
             +  C +W             SS  Q          E      V E DL +L QLVE KD 
Sbjct  75    V--CGTWNMALRQQKTISPVSSSEQVHVLDGGKKTEERLPNTVTELDLRNLVQLVERKDG  132

Query  1023  GPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDD  1202
             G  WIQMMD+    M YQAW R+P+ GP +YRSRTV+EDATPE+VRDFFWDDEFR  WD 
Sbjct  133   GLPWIQMMDQFIPGMRYQAWLREPKNGPTEYRSRTVFEDATPEVVRDFFWDDEFRPTWDT  192

Query  1203  MLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             ML  + T+E+  STGTM+V+W+RKFPFFCSDREY+IGRR
Sbjct  193   MLASSTTVEECTSTGTMIVRWIRKFPFFCSDREYVIGRR  231



>ref|XP_003517561.1| PREDICTED: stAR-related lipid transfer protein 7, mitochondrial-like 
isoform 1 [Glycine max]
Length=434

 Score =   193 bits (491),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/243 (40%), Positives = 147/243 (60%), Gaps = 14/243 (6%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             ++E  ++PS+ +  +++++   PIW+AV+IG+++GW+W+PRW  L     R  F    ++
Sbjct  8     VVEFLKKPSLTETFVDILLCAVPIWLAVMIGLVIGWSWRPRWTGLVFLGLRSKFRFLWTA  67

Query  807   sTGINLQQVFSGFSSIPAL------------KLQIPKCFSWIseetsssltpnsssplQE  950
               G   ++++  F+++ A             K Q P      + ++++      S  + E
Sbjct  68    PPGFGARRLWLAFTALSAFTYWFNFKGKTKAKTQDPSPSQSDTADSNAISLTARSGDMAE  127

Query  951   NDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTV  1130
               +   V + DL H   L+E KD+   W   M+RS  NM Y+AWR DPETGP  Y SRTV
Sbjct  128   EREQDTVTQADLEHFLHLLEGKDEMMDWQSFMERSTPNMQYKAWRHDPETGPTVYCSRTV  187

Query  1131  YEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYII  1310
             ++DATPE+VRDFFWDD+FR KWD ML + + LE+ P  GTM+  W++KFPFFCSDREYII
Sbjct  188   FDDATPELVRDFFWDDDFRPKWDAMLAYCKVLEECPRNGTMISHWIKKFPFFCSDREYII  247

Query  1311  GRR  1319
              RR
Sbjct  248   ARR  250



>ref|XP_008438574.1| PREDICTED: uncharacterized protein LOC103483641 [Cucumis melo]
Length=439

 Score =   193 bits (491),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/249 (39%), Positives = 149/249 (60%), Gaps = 20/249 (8%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             L+E  ++PSI +  +++++   PIW+AV+IG+++GW+W+PRW  L     R  F    ++
Sbjct  8     LVEFLKKPSIAETFVDILLCAVPIWLAVMIGLVIGWSWRPRWTGLVFLGFRSKFRLLWTA  67

Query  807   sTGINLQQVFSGFSSIPALKLQIPKCFSWIseets------------------ssltpns  932
               G   ++++  F+++ A  +      ++  +  +                  +  + + 
Sbjct  68    PPGFGARRLWLAFTALSAFSVCRTLWSNFYGKRKAPPVPPTPDSPVSSTLVHSAEGSGDV  127

Query  933   ssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQ  1112
              +   E  +  +V ENDL HL QL+E +     W  MM RS  N +Y+AWR +PE  P  
Sbjct  128   IANKDEGKEQDIVTENDLDHLLQLLEGRHGEAEWQSMMQRSTPNFAYEAWRLEPENRPTV  187

Query  1113  YRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCS  1292
             YRSRTV+EDATPEMVRDFFWDDEFR KWD ML + + L++ P +GTM+V W++KFPFFCS
Sbjct  188   YRSRTVFEDATPEMVRDFFWDDEFRTKWDPMLTYFKILDECPHSGTMIVHWIKKFPFFCS  247

Query  1293  DREYIIGRR  1319
             DREY+ GRR
Sbjct  248   DREYVYGRR  256



>ref|XP_010233743.1| PREDICTED: uncharacterized protein LOC100824806 [Brachypodium 
distachyon]
Length=417

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/242 (42%), Positives = 147/242 (61%), Gaps = 21/242 (9%)
 Frame = +3

Query  621   LVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfv  800
             ++SA+  + Q+P+      E+ +   P+W A ++G+L+GWAW+PRWA             
Sbjct  4     VLSAVARVLQQPTAWGAACEMALLAGPLWAAALVGLLLGWAWRPRWA-----------AG  52

Query  801   sssTGINLQQVFSGF--SSIPALKLQIPKCF-----SWIseetsssltpnsssplQENDK  959
               +T    Q   + F    +PA +L+ P  +     +  +         +     +  ++
Sbjct  53    IVATADPPQFATAEFWRGQLPA-RLRAPLDYFAGGTAATAAAQQEEEETSLQGSSEMANE  111

Query  960   SRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYED  1139
                V ++DL  L++LVE  D GP+WI+MM+++  +M+YQAWRRDP+ GPPQY+S T++E+
Sbjct  112   ELAVGKDDLVKLWRLVEGNDGGPSWIKMMEKALPDMTYQAWRRDPQNGPPQYQSSTIFEN  171

Query  1140  ATPEMVRDFFWDDEFRA--KWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIG  1313
             ATPE VRDFF DDEFR   KWDDMLI  +TLE+  +TG M V WVRKFPFFCSDREYII 
Sbjct  172   ATPEEVRDFFGDDEFRMSNKWDDMLISHKTLEECQTTGMMKVHWVRKFPFFCSDREYIIA  231

Query  1314  RR  1319
             RR
Sbjct  232   RR  233



>ref|XP_010527384.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104804742 
[Tarenaya hassleriana]
Length=455

 Score =   193 bits (491),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/248 (45%), Positives = 137/248 (55%), Gaps = 45/248 (18%)
 Frame = +3

Query  705   WVAVVIGVLVGWAWKPRWAN-------LCAsrdsfdsfvsssTGINLQQVFSGFSSIPAL  863
             WVA V+GVL+GW WKPR A+        C      D  V  S  +++     GF S P L
Sbjct  15    WVAFVVGVLIGWTWKPRRASHGGKAKLRCLVPKPLDLSVPPSPSLSVSSPLKGFGSAPCL  74

Query  864   KLQIPKCFSWIseetsssltpnsssplQENDKS---------------------------  962
                I  C  W       +  P+ +S   E  K                            
Sbjct  75    NALI--CDPWAMPIRQETRIPSVASSKPEESKXLPRIPXDSTNWYKGLVFSFXIXLLLCR  132

Query  963   ---------RVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQY  1115
                        V E DL HL +LVE+KD GP W+Q+MDRS + M YQAW R+ +TGP +Y
Sbjct  133   MNQTDERLPNTVTEEDLGHLVRLVEKKDGGPPWMQLMDRSTSGMQYQAWWRETKTGPTEY  192

Query  1116  RSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSD  1295
             RSRTV+EDATPE+VRDFFWDDEFR KWD+ML  +  LE+ P TGTM+V+W+RKFPFFCSD
Sbjct  193   RSRTVFEDATPELVRDFFWDDEFRPKWDNMLADSCILEECPKTGTMIVKWIRKFPFFCSD  252

Query  1296  REYIIGRR  1319
             REYIIGRR
Sbjct  253   REYIIGRR  260



>gb|EEC81632.1| hypothetical protein OsI_25162 [Oryza sativa Indica Group]
Length=442

 Score =   192 bits (488),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/247 (38%), Positives = 145/247 (59%), Gaps = 22/247 (9%)
 Frame = +3

Query  642   IFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssT-GI  818
             + +RP++ ++ +++++   PIW AV+IG+++GWAW+PRW  L          +     G+
Sbjct  11    LLRRPAVAEMAVDVLLCAVPIWAAVMIGLVIGWAWRPRWTGLLYLGFRSRLRLLYVPPGL  70

Query  819   NLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQE----------------  950
               ++++   +++ A  +  P+  S            +++    +                
Sbjct  71    GARRLWLACTALSAFSVA-PRLLSTAFGSRGKHQRKDAALADDDDAADASGDAGDCVDGR  129

Query  951   ---NDKSRVVDENDLYHLYQLVEEKDDG-PAWIQMMDRSATNMSYQAWRRDPETGPPQYR  1118
                     VV E DL HL QL++ K+ G   W  +M+R+ +NM+Y+AWRR+PE GP  Y 
Sbjct  130   TFFEGGHHVVTEKDLEHLVQLLDNKESGDTTWQHLMERTTSNMTYKAWRREPEVGPIMYC  189

Query  1119  SRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDR  1298
             SRT++EDATPE+VRDFFWDDEFR KWD ML + + LE+ P  GTM++ W++KFPFFCSDR
Sbjct  190   SRTIFEDATPELVRDFFWDDEFRLKWDPMLAYFKILEEFPQNGTMIIHWIKKFPFFCSDR  249

Query  1299  EYIIGRR  1319
             EYI GRR
Sbjct  250   EYIFGRR  256



>ref|XP_007222114.1| hypothetical protein PRUPE_ppa005679mg [Prunus persica]
 gb|EMJ23313.1| hypothetical protein PRUPE_ppa005679mg [Prunus persica]
Length=448

 Score =   192 bits (488),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 104/259 (40%), Positives = 146/259 (56%), Gaps = 23/259 (9%)
 Frame = +3

Query  612   IMALVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrds  785
             I  LV  ++E F +PSI +  +++++   PIW+AV+IG+++GW+W+PRW  L     R  
Sbjct  5     IYDLVEYVVEFFTKPSITETFVDILLCAVPIWLAVMIGLVIGWSWRPRWTGLLFLGLRSK  64

Query  786   fdsfvsssTGINLQQVFSGFSSIPALKL------------------QIPKCFSWIseets  911
                  ++  G   ++++  F+++ A  L                        S       
Sbjct  65    VRFLWTAPPGFGARRLWLAFTALSAFSLCRTIWSNFKSKGKLAPSSAPDSAASASLAAPK  124

Query  912   ssltpnsssplQENDKSRVVD---ENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAW  1082
              S +             RV D   E DL HL  L+  +D    W  +M+RS  +M+Y+AW
Sbjct  125   LSASGTDIVGSITRGAERVQDVVTETDLEHLVNLIGGRDGEMEWQSLMERSTPSMAYKAW  184

Query  1083  RRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQ  1262
             R DPETGP  Y SRTV+EDAT E+VRDFFWDDEFR KWD ML + + LE+ P TGTM+V 
Sbjct  185   RHDPETGPTVYCSRTVFEDATHELVRDFFWDDEFRPKWDPMLTYCKILEECPQTGTMIVH  244

Query  1263  WVRKFPFFCSDREYIIGRR  1319
             W++KFPFFCSDREY+IGRR
Sbjct  245   WIKKFPFFCSDREYLIGRR  263



>ref|XP_006350666.1| PREDICTED: uncharacterized protein LOC102588037 [Solanum tuberosum]
Length=461

 Score =   192 bits (487),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 103/267 (39%), Positives = 148/267 (55%), Gaps = 37/267 (14%)
 Frame = +3

Query  630   ALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsss  809
               +E+  +P+I +  ++++V   PIWVA++IG+L+GW+W+PRW  L              
Sbjct  8     GFVELINKPAIMETFVDILVCVVPIWVAIMIGLLIGWSWRPRWTGLVFLGLRSKINRFVW  67

Query  810   T---GINLQQVFSGFSSIPALKLQIPKCFSW-----------------------Iseets  911
             T   G   ++++  F+++ A  +     F++                        S    
Sbjct  68    TVPPGFGARRLWLAFTALSAFSVGSKLWFNFQGRTRKPSAPAAADSGSVSADEFGSSSVV  127

Query  912   ssltpnsssplQENDKSRV-----------VDENDLYHLYQLVEEKDDGPAWIQMMDRSA  1058
             S     S S  Q ND S +           V E DL H   L++ KD   AW  MMDRS 
Sbjct  128   SGPALGSVSFAQRNDDSIIRHITGSENEDTVTERDLEHFLHLLDGKDGEMAWQTMMDRST  187

Query  1059  TNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHP  1238
             +N +YQAWR +PE GP  YR++TV+EDATP++VRDFFWDDEFR KWD ML + + L++ P
Sbjct  188   SNFTYQAWRHEPEMGPTIYRTKTVFEDATPDLVRDFFWDDEFRPKWDPMLGYFKILQEWP  247

Query  1239  STGTMVVQWVRKFPFFCSDREYIIGRR  1319
              TG+M++ W++KFPFFCSDREYII RR
Sbjct  248   HTGSMIIHWIKKFPFFCSDREYIISRR  274



>ref|XP_009108270.1| PREDICTED: uncharacterized protein LOC103833968 isoform X2 [Brassica 
rapa]
Length=425

 Score =   191 bits (485),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 107/239 (45%), Positives = 147/239 (62%), Gaps = 10/239 (4%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             L +  +R S+ +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R       ++
Sbjct  4     LTDFIRRTSVPETFVDILLCAVPIWLAVMIGLLIGWSWRPRWTGLVYLGFRSKLRFLWTA  63

Query  807   sTGINLQQVFSGFSSIPAL--------KLQIPKCFSWIseetsssltpnsssplQENDKS  962
               G   ++V+  F+++ A         +L      S I EE         S      ++ 
Sbjct  64    PPGFGARRVWLAFTALSAFSVCRTLWSRLASGAKKSDIEEEIIPPSGDAVSRDKDAEEEK  123

Query  963   RVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDA  1142
              VV E DL HL  L+E  +D   W  MMD+S  NMSYQAWR +P+TGP  YRSRTV+EDA
Sbjct  124   DVVREKDLEHLLHLLEAGNDKMEWQSMMDKSTPNMSYQAWRHEPQTGPVVYRSRTVFEDA  183

Query  1143  TPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             TP++VRDFFWDDEFR KWD ML + +TLE+ P TG  +V W++KFPFFCSDREYIIGRR
Sbjct  184   TPDIVRDFFWDDEFRPKWDPMLAYFKTLEEDPQTGATIVHWIKKFPFFCSDREYIIGRR  242



>ref|XP_002517011.1| phosphatidylcholine transfer protein, putative [Ricinus communis]
 gb|EEF45174.1| phosphatidylcholine transfer protein, putative [Ricinus communis]
Length=442

 Score =   191 bits (486),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/251 (43%), Positives = 149/251 (59%), Gaps = 22/251 (9%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             L+E  +RPSI +  +++++   PIW+AV+IG+++GW+W+PRW  L     R  F    ++
Sbjct  8     LMEFLKRPSITETFVDILLCAVPIWLAVMIGLVIGWSWRPRWTGLVFLGLRSRFRFLWTA  67

Query  807   sTGINLQQVFSGFSSIPALK-------------------LQIPKCFSWIseetsssltpn  929
               G   ++++  F+++ A                     +  P   +             
Sbjct  68    PPGFGARRLWLAFTALSAFSVCRTVWSNFKGKNVKLAPTMATPASMAPTRNSADGGGGGE  127

Query  930   sssplQE-NDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGP  1106
             S S   E  +   VV ENDL HL  L+E KD    W  MM+RS +NM+YQAWR +P+  P
Sbjct  128   SVSSCGEPQEGEDVVTENDLEHLLHLLEGKDGQMEWQFMMERSTSNMAYQAWRHEPQNAP  187

Query  1107  PQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFF  1286
               YRSRTV+EDATPE+VRDFFWDDEFR KWD ML + + LE+ P +GTM+V W++KFPFF
Sbjct  188   TVYRSRTVFEDATPELVRDFFWDDEFRLKWDPMLAYFKILEEFPHSGTMIVHWIKKFPFF  247

Query  1287  CSDREYIIGRR  1319
             CSDREYIIGRR
Sbjct  248   CSDREYIIGRR  258



>emb|CDY00704.1| BnaC03g36880D [Brassica napus]
Length=455

 Score =   191 bits (485),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/243 (42%), Positives = 134/243 (55%), Gaps = 28/243 (12%)
 Frame = +3

Query  669   VILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGINLQQV-----  833
             +++ L++     W+A V+G+++GWAW+PRW +            + +   +L        
Sbjct  3     LLVSLILGLIAGWLAFVVGLVIGWAWRPRWVSSSDKERVKLECSAPTRSFDLSLPSSPSP  62

Query  834   ------FSGFSSIPALKLQIPKCFSWIseetsssltpn---------------sssplQE  950
                     GF S P LK  +  C +W           +               +     E
Sbjct  63    RSATSPLKGFGSAPCLKALV--CDTWTMALRQQKTVSHVSSSSSSSCDSSDVIAGGKKTE  120

Query  951   NDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTV  1130
                   V E DL +L QLVE KD G  WIQMMD+    M YQAW R+P+ GP +YRSRTV
Sbjct  121   ERLPNTVTELDLRNLVQLVERKDGGLPWIQMMDQFIPGMRYQAWLREPKNGPTEYRSRTV  180

Query  1131  YEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYII  1310
             +EDATPE+VRDFFWDDEFR  WD ML  + T+E+  STGTM+V+W+RKFPFFCSDREY+I
Sbjct  181   FEDATPEVVRDFFWDDEFRPTWDTMLASSTTVEECTSTGTMIVRWIRKFPFFCSDREYVI  240

Query  1311  GRR  1319
             GRR
Sbjct  241   GRR  243



>gb|AFK33815.1| unknown [Lotus japonicus]
Length=356

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +3

Query  945   QENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSR  1124
             +  + S  V   DL HL QL+EEKD G  WIQMMDRS   M Y+AWRR+P+ GPPQYRS 
Sbjct  47    RSEETSDSVTTEDLNHLCQLLEEKDGGLPWIQMMDRSTPTMGYKAWRREPKDGPPQYRSS  106

Query  1125  TVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREY  1304
             T++EDATPEMVRD FWDD+FR KWDD+L ++ TLE+ P+TGTM VQW+RKFPFFC DREY
Sbjct  107   TIFEDATPEMVRDLFWDDQFRPKWDDLLTNSTTLEECPTTGTMKVQWIRKFPFFCKDREY  166

Query  1305  IIGRR  1319
             IIGRR
Sbjct  167   IIGRR  171



>ref|XP_004502755.1| PREDICTED: uncharacterized protein LOC101512743 [Cicer arietinum]
Length=425

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 143/241 (59%), Gaps = 15/241 (6%)
 Frame = +3

Query  642   IFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGIN  821
             + + P I  +   + +  +P+WV   +GV+VGW WKP+WA+L   + +     S      
Sbjct  1     MVENPEIWGLCSTMSLLLSPMWVVFFLGVVVGWCWKPKWASLGTEKLTTSLAKSFDFASP  60

Query  822   LQQVFSGFSSI---PALKLQIPKCFSWIseetsssltpnssspl------------QEND  956
                     SS     ++ +Q P   S +     ++   +SSS                 D
Sbjct  61    SSGSPGFSSSPFVNSSITMQTPNPESLVISNKDTNKKASSSSSSPTKFVSSTSSPKSSED  120

Query  957   KSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYE  1136
              S  V  +D +HLY+LVEEKD G  WIQ+MDRS   MSYQAWRR+P+ GPPQYRS T++E
Sbjct  121   NSNYVTVDDFHHLYKLVEEKDGGLPWIQVMDRSTPTMSYQAWRREPKDGPPQYRSSTIFE  180

Query  1137  DATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGR  1316
             DATPE VRD FWDD+FR  WDDMLI + TLE+ P+TGTM + W+RKFPFFC DREYIIGR
Sbjct  181   DATPETVRDLFWDDQFRPNWDDMLIKSTTLEECPTTGTMKMLWIRKFPFFCKDREYIIGR  240

Query  1317  R  1319
             R
Sbjct  241   R  241



>ref|XP_002314649.1| hypothetical protein POPTR_0010s08690g [Populus trichocarpa]
 gb|EEF00820.1| hypothetical protein POPTR_0010s08690g [Populus trichocarpa]
Length=429

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/237 (44%), Positives = 150/237 (63%), Gaps = 8/237 (3%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvs-ss  809
             L+E  ++PSI +  +++++   PIW+AV+IG+++GW+W+PRW  L             + 
Sbjct  8     LMEFLKKPSITETFVDILLCAVPIWLAVMIGLVIGWSWRPRWTGLVFLGLRGKFRFLWAP  67

Query  810   TGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSR-------V  968
              G   ++++  F+++ AL +      ++  ++  S     +SS    + + R       +
Sbjct  68    PGFGARRLWLAFTALSALSVCRTIWSNFKGKDGKSVPAAAASSSGANSGERRDGSVREDI  127

Query  969   VDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATP  1148
             V E DL HL  L+E KD    W  MM+RS +NM YQAWR +P+ GP  YRSRTV+EDATP
Sbjct  128   VTEKDLEHLLHLLEGKDGRKEWQCMMERSTSNMRYQAWRHEPQEGPTVYRSRTVFEDATP  187

Query  1149  EMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             E+VRDFFWDDEFR KWD ML + + LE+ P TG M+V W++KFPFFCSDREYIIGRR
Sbjct  188   ELVRDFFWDDEFRPKWDPMLAYFKILEECPHTGRMIVHWIKKFPFFCSDREYIIGRR  244



>emb|CDY63033.1| BnaCnng41290D [Brassica napus]
Length=430

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 152/240 (63%), Gaps = 11/240 (5%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             L++  +R S+ +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R       ++
Sbjct  8     LMDFIRRTSVPETFVDILLCAVPIWLAVMIGLLIGWSWRPRWTGLVYLGFRSKLRFLWTA  67

Query  807   sTGINLQQVFSGFSSIPAL--------KLQIPKCFSWIseetsssltpnsssplQENDKS  962
               G   ++V+  F+++ A         +L      S I EE   S    S    ++ ++ 
Sbjct  68    PPGFGARRVWLAFTALSAFSVCRTLWSRLGSGAKKSDIEEEIPPSGDAVSRGSDKKTEEE  127

Query  963   R-VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYED  1139
             + VV E DL HL  L+E  +D   W  MMD+S  NMSYQAWR +P+TGP  YRSRTV+ED
Sbjct  128   KDVVMEKDLEHLLHLLEAGNDKMEWQSMMDKSTPNMSYQAWRHEPQTGPVVYRSRTVFED  187

Query  1140  ATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             ATP++VRDFFWDDEFR KWD ML + +TLE+ P TG  +V W++KFPFFCSDREYIIGRR
Sbjct  188   ATPDIVRDFFWDDEFRPKWDPMLAYFKTLEEDPQTGITIVHWIKKFPFFCSDREYIIGRR  247



>ref|XP_003557464.1| PREDICTED: uncharacterized protein LOC100828419 isoform X2 [Brachypodium 
distachyon]
Length=440

 Score =   190 bits (482),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/246 (38%), Positives = 149/246 (61%), Gaps = 23/246 (9%)
 Frame = +3

Query  642   IFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--AsrdsfdsfvsssTG  815
             + +RP++ ++ +++++   PIW AV+IG+L+GWAW+PRW  L     R      +    G
Sbjct  12    LLRRPAVAEMAVDVLLCAVPIWAAVMIGLLIGWAWRPRWTGLLFLGFRSRLRIPLYMPPG  71

Query  816   INLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQEND-------------  956
             +  ++++   +++ A  +  P+  S  S         +  +  +E D             
Sbjct  72    LGARRLWLACTALSAFSVA-PQLLS--SAFRRHGKNQHKDASHEETDARGDAGACADGRS  128

Query  957   ----KSRVVDENDLYHLYQLVEEKDDG-PAWIQMMDRSATNMSYQAWRRDPETGPPQYRS  1121
                 K  +V E DL HL QL++ K+ G   W  +M+R+ +NM+Y+AWR +PE GP  + S
Sbjct  129   FFMGKHDIVTEKDLEHLVQLLDNKESGDTTWQHLMERTTSNMTYKAWRHEPEVGPIMHCS  188

Query  1122  RTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDRE  1301
             +T++EDATPE+VRDFFWDD+FR KWD ML++ +TL++ P  GT ++ W++KFPFFCSDRE
Sbjct  189   QTIFEDATPELVRDFFWDDDFRLKWDPMLVYFKTLDEFPQNGTTIIHWIKKFPFFCSDRE  248

Query  1302  YIIGRR  1319
             YI GRR
Sbjct  249   YIFGRR  254



>ref|XP_011030550.1| PREDICTED: stAR-related lipid transfer protein 7, mitochondrial 
[Populus euphratica]
Length=436

 Score =   189 bits (481),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 104/245 (42%), Positives = 148/245 (60%), Gaps = 16/245 (7%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvs-ss  809
             L+E  ++PSI +  +++++   PIW+AV+IG+++GW+W+PRW  L             + 
Sbjct  8     LMEFLKKPSITETFVDILLCAVPIWLAVMIGLVIGWSWRPRWTGLVFLGLRSKFRFLWAP  67

Query  810   TGINLQQVFSGFSSIPALKL---------------QIPKCFSWIseetsssltpnssspl  944
              G   ++++  F+++ AL +                     S    ++      + SS  
Sbjct  68    PGFGARRLWLAFTALSALSVCRTIWSNFKGKDGKSVPAAAASSSGAKSGERRDGSVSSTG  127

Query  945   QENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSR  1124
             +  D+  +V E DL HL  L+E KD    W  MM+RS +NM YQAWR +P+ GP  YRSR
Sbjct  128   ELEDREDIVTEKDLEHLLHLLEGKDGQKEWQCMMERSTSNMRYQAWRHEPQEGPIIYRSR  187

Query  1125  TVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREY  1304
             TV+EDATPE+VRDFFWDDEFR KWD ML + + LE+ P TG M+V W++KFPFFCSDREY
Sbjct  188   TVFEDATPELVRDFFWDDEFRPKWDPMLAYFKILEECPHTGRMIVHWIKKFPFFCSDREY  247

Query  1305  IIGRR  1319
             IIGRR
Sbjct  248   IIGRR  252



>ref|XP_010228266.1| PREDICTED: uncharacterized protein LOC100828419 isoform X1 [Brachypodium 
distachyon]
Length=441

 Score =   189 bits (481),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/247 (38%), Positives = 149/247 (60%), Gaps = 24/247 (10%)
 Frame = +3

Query  642   IFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--AsrdsfdsfvsssTG  815
             + +RP++ ++ +++++   PIW AV+IG+L+GWAW+PRW  L     R      +    G
Sbjct  12    LLRRPAVAEMAVDVLLCAVPIWAAVMIGLLIGWAWRPRWTGLLFLGFRSRLRIPLYMPPG  71

Query  816   INLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQEND-------------  956
             +  ++++   +++ A  +  P+  S  S         +  +  +E D             
Sbjct  72    LGARRLWLACTALSAFSVA-PQLLS--SAFRRHGKNQHKDASHEETDARGDAGACADGSR  128

Query  957   -----KSRVVDENDLYHLYQLVEEKDDG-PAWIQMMDRSATNMSYQAWRRDPETGPPQYR  1118
                  K  +V E DL HL QL++ K+ G   W  +M+R+ +NM+Y+AWR +PE GP  + 
Sbjct  129   SFFMGKHDIVTEKDLEHLVQLLDNKESGDTTWQHLMERTTSNMTYKAWRHEPEVGPIMHC  188

Query  1119  SRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDR  1298
             S+T++EDATPE+VRDFFWDD+FR KWD ML++ +TL++ P  GT ++ W++KFPFFCSDR
Sbjct  189   SQTIFEDATPELVRDFFWDDDFRLKWDPMLVYFKTLDEFPQNGTTIIHWIKKFPFFCSDR  248

Query  1299  EYIIGRR  1319
             EYI GRR
Sbjct  249   EYIFGRR  255



>ref|XP_002447442.1| hypothetical protein SORBIDRAFT_06g001130 [Sorghum bicolor]
 gb|EES11770.1| hypothetical protein SORBIDRAFT_06g001130 [Sorghum bicolor]
Length=425

 Score =   189 bits (479),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 101/124 (81%), Gaps = 2/124 (2%)
 Frame = +3

Query  954   DKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVY  1133
             D+   V+  DL HL++LVEEKD GP+WI MMDR+   M YQAWRRDP  GPPQYRS T++
Sbjct  114   DEQLAVNTGDLMHLWRLVEEKDGGPSWIHMMDRTLPTMRYQAWRRDPPNGPPQYRSSTIF  173

Query  1134  EDATPEMVRDFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYI  1307
             EDA+PE+VRDFFWDDEFR K  WDDML+  ETLE+   TGT+VV+WVRKFPFFCSDREYI
Sbjct  174   EDASPEVVRDFFWDDEFRIKNSWDDMLLQHETLEECTRTGTLVVRWVRKFPFFCSDREYI  233

Query  1308  IGRR  1319
             IGRR
Sbjct  234   IGRR  237



>ref|NP_001154233.1| polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Arabidopsis thaliana]
 gb|AEE83452.1| polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Arabidopsis thaliana]
Length=294

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 106/252 (42%), Positives = 151/252 (60%), Gaps = 27/252 (11%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfdsfvss  806
             LL  F+ PS  +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R       ++
Sbjct  8     LLNFFKNPSFTETFVDILLCAVPIWLAVMIGLLIGWSWRPRWTGLIYLGFRSKLRFLWTA  67

Query  807   sTGINLQQVFSGFSSIPALKLQIPKCFS-WIseetsssltpnsssplQ----ENDKSR--  965
               G   ++++  F+++ A  +    C + W   +T ++ +   S+  Q    +ND+S   
Sbjct  68    PPGFGARRLWLAFTALSAFSV----CRTIWSRNDTRANKSATGSASSQTPVEDNDESGLA  123

Query  966   ------------VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPP  1109
                         +V ENDL HL QL+E  +    W  MMD++  NMSYQAWR +PETGP 
Sbjct  124   SRGSDNGTVTEDIVTENDLEHLLQLLEVGNAALEWQSMMDKTTPNMSYQAWRHEPETGPV  183

Query  1110  QYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFP--F  1283
              YRSRTV+EDATP++VRDFFWDDEFR KWD ML + +TLE+   TGTM+VQW +K     
Sbjct  184   IYRSRTVFEDATPDIVRDFFWDDEFRPKWDFMLANFKTLEEDTQTGTMIVQWRKKVSGLL  243

Query  1284  FCSDREYIIGRR  1319
                DREYIIGRR
Sbjct  244   ILCDREYIIGRR  255



>ref|XP_007157092.1| hypothetical protein PHAVU_002G042100g [Phaseolus vulgaris]
 gb|ESW29086.1| hypothetical protein PHAVU_002G042100g [Phaseolus vulgaris]
Length=436

 Score =   189 bits (480),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 102/247 (41%), Positives = 145/247 (59%), Gaps = 18/247 (7%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             ++E  ++PSI +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R  F    ++
Sbjct  8     MVEFLKKPSITETFVDILLCAVPIWLAVMIGLLIGWSWRPRWTGLVFLGLRSKFRFLWTA  67

Query  807   sTGINLQQVFSGFSSIPAL----------------KLQIPKCFSWIseetsssltpnsss  938
               G   ++++  F+++ A                 K Q P        +++++   N S 
Sbjct  68    PPGFGARRLWFAFTAVSAFSICRTYWFNFKGRAKAKAQDPSPSQSDISDSNATDRTNRSG  127

Query  939   plQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYR  1118
                E      V + DL H   L+E KD        M+RS  NM Y+AWR DPETGP  YR
Sbjct  128   DWAEERGQDTVTQADLEHFLLLLEGKDGVMDRQCFMERSTPNMQYKAWRHDPETGPTVYR  187

Query  1119  SRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDR  1298
             SRTV+EDATPE+VRDFFWDD+FR KWD ML + + LE+ P  GTM+  W++KFPFFCSDR
Sbjct  188   SRTVFEDATPELVRDFFWDDDFRPKWDPMLAYCKVLEECPRNGTMISHWIKKFPFFCSDR  247

Query  1299  EYIIGRR  1319
             EYII RR
Sbjct  248   EYIIARR  254



>gb|KFK27030.1| hypothetical protein AALP_AA8G325000 [Arabis alpina]
Length=455

 Score =   189 bits (481),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 101/228 (44%), Positives = 125/228 (55%), Gaps = 27/228 (12%)
 Frame = +3

Query  711   AVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGIN------------LQQVFSGFSSI  854
             A V+G+L+GW WKPRW +   S D         +                     GF S 
Sbjct  17    AFVVGLLIGWTWKPRWVSSSNSNDRKVVKKLRCSAPRSFDSSSPSPRSATTSPLKGFGSA  76

Query  855   PALKLQIPKCFSWIseetsssltp-------------nsssplQENDKSRVVDENDLYHL  995
             P LK  +  C +W                               E      V E DL  L
Sbjct  77    PCLKALV--CDTWTMALRQHKTISPFSSSSSSEHVDVIDGVEKTEERLPNTVTEMDLRCL  134

Query  996   YQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWD  1175
              QLVE KD G AWIQ+MDR  + M YQAW R+P+ GP +YRSRTV+EDATPE++RDFFWD
Sbjct  135   VQLVERKDGGHAWIQIMDRFTSGMRYQAWLREPKNGPTEYRSRTVFEDATPEILRDFFWD  194

Query  1176  DEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             DEFR  WD ML ++ T+E+ PSTGTM+V+W+RKFPFFC+DREY+IGRR
Sbjct  195   DEFRPTWDTMLSNSTTVEECPSTGTMIVKWIRKFPFFCTDREYVIGRR  242



>emb|CDY35496.1| BnaA01g24160D [Brassica napus]
Length=430

 Score =   189 bits (479),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 103/245 (42%), Positives = 146/245 (60%), Gaps = 17/245 (7%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             L +  +R S+ +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R       ++
Sbjct  4     LTDFIRRTSVPETFVDILLCAVPIWLAVMIGLLIGWSWRPRWTGLVYLGFRSKLRFLWTA  63

Query  807   sTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVV--DEN  980
               G   ++V+  F+++ A  +     +S ++     S       P   +  SR+V   + 
Sbjct  64    PPGFGARRVWLAFTALSAFSV-CRTLWSRLASGAKKSDIEQEIIPPSGDAVSRLVFGSDK  122

Query  981   DLYHLYQLVEEKD------------DGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSR  1124
             D      +V EKD            D   W  MMD+S  NMSYQAWR +P+TGP  YRSR
Sbjct  123   DAEEEKDVVREKDLEHLLHLLEAGNDKMEWQSMMDKSTPNMSYQAWRHEPQTGPVVYRSR  182

Query  1125  TVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREY  1304
             TV+EDATP++VRDFFWDDEFR KWD ML + +TLE+ P TG  +V W++KFPFFCSDREY
Sbjct  183   TVFEDATPDIVRDFFWDDEFRPKWDPMLAYFKTLEEDPQTGATIVHWIKKFPFFCSDREY  242

Query  1305  IIGRR  1319
             IIGRR
Sbjct  243   IIGRR  247



>ref|XP_010278112.1| PREDICTED: stAR-related lipid transfer protein 7, mitochondrial-like 
[Nelumbo nucifera]
Length=438

 Score =   188 bits (478),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/250 (40%), Positives = 142/250 (57%), Gaps = 24/250 (10%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsf--------  788
              ++  ++P I + ++++++   PIWVAV+IG+++GW+W+PRW  L               
Sbjct  8     FMDFIRKPVIVETLVDILLCAVPIWVAVMIGLVIGWSWRPRWTGLVFLGLRSKFRFIWTA  67

Query  789   -------------dsfvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpn  929
                           +  + S G  L   F G    P +   +    + + E T S    +
Sbjct  68    PLEFGARRLWLAFTALSAFSVGRKLWSNFRGKGDEPPVSESVLAALTQLVERTGSGFDFS  127

Query  930   sssplQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPP  1109
               +   E D   +V E DL HL  L+E +    +W  MM+R   N++YQAW  +PETGP 
Sbjct  128   GITSGAEQD---MVSEKDLEHLLYLLEGRVGDTSWQSMMERFTPNIAYQAWHYEPETGPT  184

Query  1110  QYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFC  1289
              YRSR V+EDATPE+VRDFFWDDEFR KWD ML   + LE++P  G M+VQWV+KFPFFC
Sbjct  185   IYRSRIVFEDATPELVRDFFWDDEFRPKWDPMLACFKVLEEYPHEGKMIVQWVKKFPFFC  244

Query  1290  SDREYIIGRR  1319
             SDREYIIGR+
Sbjct  245   SDREYIIGRQ  254



>ref|XP_009108264.1| PREDICTED: uncharacterized protein LOC103833968 isoform X1 [Brassica 
rapa]
Length=427

 Score =   188 bits (477),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/242 (44%), Positives = 148/242 (61%), Gaps = 14/242 (6%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             L +  +R S+ +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R       ++
Sbjct  4     LTDFIRRTSVPETFVDILLCAVPIWLAVMIGLLIGWSWRPRWTGLVYLGFRSKLRFLWTA  63

Query  807   sTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSR-------  965
               G   ++V+  F+++ A  +     +S ++     S       P   +  SR       
Sbjct  64    PPGFGARRVWLAFTALSAFSV-CRTLWSRLASGAKKSDIEEEIIPPSGDAVSRGSDKDAE  122

Query  966   ----VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVY  1133
                 VV E DL HL  L+E  +D   W  MMD+S  NMSYQAWR +P+TGP  YRSRTV+
Sbjct  123   EEKDVVREKDLEHLLHLLEAGNDKMEWQSMMDKSTPNMSYQAWRHEPQTGPVVYRSRTVF  182

Query  1134  EDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIG  1313
             EDATP++VRDFFWDDEFR KWD ML + +TLE+ P TG  +V W++KFPFFCSDREYIIG
Sbjct  183   EDATPDIVRDFFWDDEFRPKWDPMLAYFKTLEEDPQTGATIVHWIKKFPFFCSDREYIIG  242

Query  1314  RR  1319
             RR
Sbjct  243   RR  244



>tpg|DAA36544.1| TPA: hypothetical protein ZEAMMB73_493286 [Zea mays]
Length=280

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/245 (38%), Positives = 143/245 (58%), Gaps = 17/245 (7%)
 Frame = +3

Query  636   LEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvs-ssT  812
             + + QRP++ ++ +++++   PIW AV+IG++VGW+W+PRW  L          +     
Sbjct  9     VALLQRPAVAEMAVDVLLCAVPIWAAVMIGLVVGWSWRPRWTGLLFLGLRSRLRILWVPP  68

Query  813   GINLQQVFSGFSSIPALKLQ---IPKCFSWIseetsssltpnsssplQENDKSRV-----  968
             G+  ++++   +++ A  +    I   F     +     +P+  +    +   R      
Sbjct  69    GLGARRLWFACTALSACSVATKLISSAFRRCRGKHQDRASPDDDAAATRDGGCRADGRTN  128

Query  969   -------VDENDLYHLYQLVEEKDDG-PAWIQMMDRSATNMSYQAWRRDPETGPPQYRSR  1124
                    V E DL HL QL++ K+ G  AW  +M+R  +NM+Y AWRR+PE GP  Y SR
Sbjct  129   FEGEHDTVTEKDLEHLLQLLDNKESGDTAWQNLMERRTSNMTYNAWRREPEEGPIMYCSR  188

Query  1125  TVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREY  1304
             T++EDATPE+VRDFFWD +FR KWD ML + ++L++ P  G  +V W++KFPFFCSDREY
Sbjct  189   TIFEDATPELVRDFFWDGDFRLKWDPMLAYCKSLDEFPQNGATIVHWIKKFPFFCSDREY  248

Query  1305  IIGRR  1319
             I G R
Sbjct  249   IFGGR  253



>ref|XP_010936383.1| PREDICTED: uncharacterized protein LOC105056016 [Elaeis guineensis]
Length=441

 Score =   187 bits (474),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 102/258 (40%), Positives = 151/258 (59%), Gaps = 35/258 (14%)
 Frame = +3

Query  627   SALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfv  800
             ++ ++  +RP + ++++++++   PIW+AV+IG+++GW+W+PRW  L     R  F    
Sbjct  6     TSFVDFMRRPEVVEMLIDILLCAVPIWLAVMIGLVIGWSWRPRWTGLLFLGMRSRFRFLW  65

Query  801   sssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSR-----  965
             ++  G+  ++++  F+++          FS   +  SS       SP  E+  SR     
Sbjct  66    TAPPGLGARRLWLAFTAL--------SVFSVCRKLWSSFKGKGEGSPAAEDSASRPAVSV  117

Query  966   --------------------VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWR  1085
                                 VV E DL HL  L++ K     W   M+R+  NM YQAWR
Sbjct  118   SSAEEDGGGSFSGAFKGGHDVVAEKDLEHLLYLLDGKAGVAVWQNQMERTTPNMIYQAWR  177

Query  1086  RDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQW  1265
              +PE GP   RSRTV+EDATPE+VRDFFWDD+FR KWD ML++ +TLE+ P +GT +V W
Sbjct  178   HEPEAGPIILRSRTVFEDATPELVRDFFWDDDFRPKWDPMLVYFKTLEEFPQSGTTIVHW  237

Query  1266  VRKFPFFCSDREYIIGRR  1319
             ++KFPFFCSDREYIIGRR
Sbjct  238   IKKFPFFCSDREYIIGRR  255



>ref|XP_011029867.1| PREDICTED: stAR-related lipid transfer protein 7, mitochondrial-like 
[Populus euphratica]
Length=439

 Score =   187 bits (474),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 154/249 (62%), Gaps = 20/249 (8%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             L+E  + PSI + ++++++   PIW++V+IG+++GW+W+PRW  L     R  F    + 
Sbjct  8     LMEFLKTPSITETLVDILLCAVPIWLSVMIGLVIGWSWRPRWTGLVFLGMRSKFRFLWTV  67

Query  807   sTGINLQQVFSGFSSIPALKL--QIPKCFSWIseetsssltpnsssplQEN---------  953
               G   ++++  F++I    +   I   F   + +++ +   +SS+    N         
Sbjct  68    PPGFGARRLWLAFTAISTFSVCRTIWSNFQGKNRKSAPAAVASSSATSPRNPGGRSDGSI  127

Query  954   -------DKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQ  1112
                    D+  +V ENDL HL  L+E KD    W  MM+RS +NM YQAWR +P+ GP  
Sbjct  128   SSSGELEDREDIVTENDLEHLLHLLEGKDGQKEWQCMMERSTSNMRYQAWRHEPQEGPTV  187

Query  1113  YRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCS  1292
             YRSR+V+EDATPE+VRDFFW DE R KWD ML + + LE++P TGTM+V W++KFPFFCS
Sbjct  188   YRSRSVFEDATPELVRDFFWGDEVRPKWDTMLAYFKILEEYPHTGTMIVHWIKKFPFFCS  247

Query  1293  DREYIIGRR  1319
             DREYIIGRR
Sbjct  248   DREYIIGRR  256



>emb|CDY43837.1| BnaC03g14700D [Brassica napus]
Length=1176

 Score =   194 bits (492),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 136/230 (59%), Gaps = 19/230 (8%)
 Frame = +3

Query  669   VILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssT----GINLQQVF  836
             +IL L++     W+A V+G+L+GWAWKPRW +  +         +  +      +     
Sbjct  741   IILGLILG----WLAFVVGLLIGWAWKPRWVSSPSEEKVQSQCSAPRSFELSSPSSPSPL  796

Query  837   SGFSSIPALKLQIPKCFSWIseetsssltpnsssplQEN--DKSR-------VVDENDLY  989
              GF S P  K  +  C +W             SS  Q +  D  +        V E DL 
Sbjct  797   KGFGSAPCFKALV--CGTWNMALRQQKTVSPVSSSEQVHVLDGGKKTERLPNTVTELDLR  854

Query  990   HLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFF  1169
             +L QLVE KD G  WIQMMD+    M YQAW R+P+ GP +YRSRTV+EDATPE+VRDFF
Sbjct  855   NLVQLVERKDGGLPWIQMMDQFIPGMRYQAWLREPKNGPTEYRSRTVFEDATPEVVRDFF  914

Query  1170  WDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             WDDEFR  WD ML  + T+E+  STGTM+V+W+RKFPFFCSDREY+IGRR
Sbjct  915   WDDEFRPTWDTMLASSTTVEECTSTGTMIVRWIRKFPFFCSDREYVIGRR  964



>gb|KCW60440.1| hypothetical protein EUGRSUZ_H03157 [Eucalyptus grandis]
Length=437

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/245 (42%), Positives = 152/245 (62%), Gaps = 16/245 (7%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             L +  ++PS+ + ++++++   PIW+AV+IG+L+GW+W+PRW  L     R  F    ++
Sbjct  9     LADFLRKPSVTETLVDVLLCAVPIWLAVMIGLLIGWSWRPRWTGLVYLGLRSKFRFLWTA  68

Query  807   sTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQ-------------  947
               G   ++++  F+++ A        F++ ++  S+    +   P               
Sbjct  69    PPGFGARRLWLAFTALSAFSALRAIWFNFRNKGKSAGEAASPKGPGSVERSGDPVSLETR  128

Query  948   -ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSR  1124
                 +S +V ENDL HL  L+E ++    W  MM+R   NM+YQAWR +P+TGP  YRSR
Sbjct  129   LAGGQSDIVTENDLEHLLHLLEGREGDMEWQSMMERKTPNMAYQAWRHEPKTGPIIYRSR  188

Query  1125  TVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREY  1304
             TV+EDAT E+VRDFFWDDEFR KWD ML + +TLE+ P TG M++ W++KFPFFCSDREY
Sbjct  189   TVFEDATAEVVRDFFWDDEFRPKWDPMLAYFKTLEECPHTGIMILHWIKKFPFFCSDREY  248

Query  1305  IIGRR  1319
             IIGRR
Sbjct  249   IIGRR  253



>ref|XP_006297728.1| hypothetical protein CARUB_v10013761mg [Capsella rubella]
 gb|EOA30626.1| hypothetical protein CARUB_v10013761mg [Capsella rubella]
Length=428

 Score =   185 bits (470),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 149/244 (61%), Gaps = 16/244 (7%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
              +++F++PS+ +  +++++   PIWVAV IG+L+GW+W+PRW  L     R       ++
Sbjct  4     FMDLFKKPSVTETFVDVLLCAVPIWVAVTIGLLIGWSWRPRWTGLVFLGFRSKLRFLWTA  63

Query  807   sTGINLQQVFSGFSSIPALKL---------QIPKCFSWIseetsssl----tpnsssplQ  947
               G   ++++  F+++    +            K  S I+     S          +  +
Sbjct  64    PPGFGARRLWLAFTALSVFSVCRTLWSRLGTSSKKSSVINGSAPMSKPVDEEEEEEAFSR  123

Query  948   ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRT  1127
              +DK  +V E DL HL  L+E  +    W  MMD+S  NMSYQAWR +PET P  YRSRT
Sbjct  124   ASDKV-IVTEKDLKHLLHLLEAGNANLEWQSMMDKSTPNMSYQAWRHEPETCPVVYRSRT  182

Query  1128  VYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYI  1307
             V+EDATPE+VRDFFWDDEFR KWD ML + +TLE+   TGT +V+W++KFPFFCSDREYI
Sbjct  183   VFEDATPEIVRDFFWDDEFRPKWDPMLAYFKTLEEDSQTGTTIVRWIKKFPFFCSDREYI  242

Query  1308  IGRR  1319
             IGRR
Sbjct  243   IGRR  246



>ref|XP_004289478.1| PREDICTED: uncharacterized protein LOC101293443 [Fragaria vesca 
subsp. vesca]
Length=448

 Score =   186 bits (471),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/254 (39%), Positives = 146/254 (57%), Gaps = 25/254 (10%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfdsfvss  806
             L+E F  P+I +  +++++   PIW+AV+IG+++GW+W+PRW  L     R       ++
Sbjct  8     LVEFFTNPTITETFVDILLCAVPIWLAVMIGLVIGWSWRPRWTGLIFLGLRSKLRWAWTA  67

Query  807   sTGINLQQVFSGFSSIPALKLQIPKCFSW--------------------Iseetsssltp  926
               G   ++++  F++  A  +     F++                     +  +S + + 
Sbjct  68    PPGFGARRLWLAFTAFSAFSICRTIWFNFRGKSKAAAAPAAAGSAGTGSGAAASSLAESG  127

Query  927   nsssplQENDKSRVVD---ENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPE  1097
                +        RV D   E  L HL  L+  +D    W  +M+++   M+Y+AWR DPE
Sbjct  128   GDIAEPSNKGAQRVQDVVTEAGLDHLVNLIGGRDGEMEWQSLMEKTTPTMAYKAWRYDPE  187

Query  1098  TGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKF  1277
             TGP  Y SRTV+EDATPE+VRDFFWDDEFR KWD ML + + LE+ P TGTM+V W++KF
Sbjct  188   TGPTVYCSRTVFEDATPELVRDFFWDDEFRPKWDPMLAYCKILEECPDTGTMIVHWIKKF  247

Query  1278  PFFCSDREYIIGRR  1319
             PFFCSDREYIIGRR
Sbjct  248   PFFCSDREYIIGRR  261



>ref|XP_007157091.1| hypothetical protein PHAVU_002G042100g [Phaseolus vulgaris]
 gb|ESW29085.1| hypothetical protein PHAVU_002G042100g [Phaseolus vulgaris]
Length=437

 Score =   184 bits (467),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 102/248 (41%), Positives = 145/248 (58%), Gaps = 19/248 (8%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             ++E  ++PSI +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R  F    ++
Sbjct  8     MVEFLKKPSITETFVDILLCAVPIWLAVMIGLLIGWSWRPRWTGLVFLGLRSKFRFLWTA  67

Query  807   sTGINLQQVFSGFSSIPAL----------------KLQIPKCFSWIseetsssltpnsss  938
               G   ++++  F+++ A                 K Q P        +++++   N S 
Sbjct  68    PPGFGARRLWFAFTAVSAFSICRTYWFNFKGRAKAKAQDPSPSQSDISDSNATDRTNRSG  127

Query  939   plQENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPE-TGPPQY  1115
                E      V + DL H   L+E KD        M+RS  NM Y+AWR DPE TGP  Y
Sbjct  128   DWAEERGQDTVTQADLEHFLLLLEGKDGVMDRQCFMERSTPNMQYKAWRHDPEQTGPTVY  187

Query  1116  RSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSD  1295
             RSRTV+EDATPE+VRDFFWDD+FR KWD ML + + LE+ P  GTM+  W++KFPFFCSD
Sbjct  188   RSRTVFEDATPELVRDFFWDDDFRPKWDPMLAYCKVLEECPRNGTMISHWIKKFPFFCSD  247

Query  1296  REYIIGRR  1319
             REYII RR
Sbjct  248   REYIIARR  255



>ref|NP_001142403.1| hypothetical protein [Zea mays]
 gb|ACF88412.1| unknown [Zea mays]
 tpg|DAA36545.1| TPA: hypothetical protein ZEAMMB73_493286 [Zea mays]
Length=438

 Score =   184 bits (467),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/245 (38%), Positives = 143/245 (58%), Gaps = 17/245 (7%)
 Frame = +3

Query  636   LEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvs-ssT  812
             + + QRP++ ++ +++++   PIW AV+IG++VGW+W+PRW  L          +     
Sbjct  9     VALLQRPAVAEMAVDVLLCAVPIWAAVMIGLVVGWSWRPRWTGLLFLGLRSRLRILWVPP  68

Query  813   GINLQQVFSGFSSIPALKLQ---IPKCFSWIseetsssltpnsssplQENDKSRV-----  968
             G+  ++++   +++ A  +    I   F     +     +P+  +    +   R      
Sbjct  69    GLGARRLWFACTALSACSVATKLISSAFRRCRGKHQDRASPDDDAAATRDGGCRADGRTN  128

Query  969   -------VDENDLYHLYQLVEEKDDG-PAWIQMMDRSATNMSYQAWRRDPETGPPQYRSR  1124
                    V E DL HL QL++ K+ G  AW  +M+R  +NM+Y AWRR+PE GP  Y SR
Sbjct  129   FEGEHDTVTEKDLEHLLQLLDNKESGDTAWQNLMERRTSNMTYNAWRREPEEGPIMYCSR  188

Query  1125  TVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREY  1304
             T++EDATPE+VRDFFWD +FR KWD ML + ++L++ P  G  +V W++KFPFFCSDREY
Sbjct  189   TIFEDATPELVRDFFWDGDFRLKWDPMLAYCKSLDEFPQNGATIVHWIKKFPFFCSDREY  248

Query  1305  IIGRR  1319
             I G R
Sbjct  249   IFGGR  253



>ref|XP_003580301.1| PREDICTED: uncharacterized protein LOC100841092 [Brachypodium 
distachyon]
Length=407

 Score =   183 bits (465),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 96/119 (81%), Gaps = 2/119 (2%)
 Frame = +3

Query  969   VDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATP  1148
             V+  DL HL ++VEEKD GPAWI MM+R+   M YQAWRRDPE GPPQYRS T++ED +P
Sbjct  102   VNTADLMHLRRVVEEKDGGPAWIHMMERTLPTMRYQAWRRDPENGPPQYRSSTIFEDTSP  161

Query  1149  EMVRDFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             ++VRDFFWDDEFR K  WDDML+  E LE    TGTMVV+WVRKFPFFCSDREYIIGRR
Sbjct  162   DVVRDFFWDDEFRMKNTWDDMLLQHEILEQCTKTGTMVVRWVRKFPFFCSDREYIIGRR  220


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  621  LVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWA  761
            L   L  +F+ P++  V  EL     P+W+AV++G+L+GWAW+PRWA
Sbjct  4    LADLLAGVFREPTLAGVARELATLAAPLWLAVLVGLLIGWAWRPRWA  50



>ref|XP_004977725.1| PREDICTED: uncharacterized protein LOC101783053 [Setaria italica]
Length=805

 Score =   188 bits (477),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 98/120 (82%), Gaps = 2/120 (2%)
 Frame = +3

Query  966   VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDAT  1145
              V+  DL HL++LVEEKD GP+WI MMD +   M YQAWRRDP  GPPQYRS T++EDA+
Sbjct  500   AVNTGDLMHLWRLVEEKDGGPSWIHMMDHTLPTMRYQAWRRDPPNGPPQYRSSTIFEDAS  559

Query  1146  PEMVRDFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             PE+VRDFFWDDEFR K  WDDML+  ETLE+   TGTMVV+WVRKFPFFCSDREYIIGRR
Sbjct  560   PEVVRDFFWDDEFRIKNSWDDMLLQHETLEECKKTGTMVVRWVRKFPFFCSDREYIIGRR  619



>ref|XP_001785300.1| predicted protein [Physcomitrella patens]
 gb|EDQ49891.1| predicted protein [Physcomitrella patens]
Length=429

 Score =   182 bits (463),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 132/226 (58%), Gaps = 6/226 (3%)
 Frame = +3

Query  651   RPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssT--GINL  824
             +P++ +   ++M    P WVA  IG+LVGW WKP+WA++          +   T  G   
Sbjct  15    KPAVMETAADMMFCMVPFWVATAIGLLVGWLWKPQWASILLLGVKSRPRLVWDTPPGFGA  74

Query  825   QQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVVDENDLYHLYQL  1004
             ++ +    ++ AL +      +W S       +  S    +E  K  VV   DL  L  L
Sbjct  75    RRFWLAIMALSALPMWKE---AWKSFNVLECSSMCSEPDAKERTKKEVVTNEDLDKLMTL  131

Query  1005  VEEKDDGPAWIQMMDRSATNMSYQAWRRDPET-GPPQYRSRTVYEDATPEMVRDFFWDDE  1181
                KD GP W   +D+S  ++ YQAWRR+PE  GP +Y++RTV ED +PE++RDFFWDDE
Sbjct  132   ANGKDGGPEWQIFLDKSIHDLKYQAWRREPEHDGPTEYKTRTVVEDTSPELMRDFFWDDE  191

Query  1182  FRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             FR  WD+MLI+ +T E    TG+M+VQWVRKFPFFC DREY+I RR
Sbjct  192   FRCHWDEMLIYTKTWEACEETGSMIVQWVRKFPFFCKDREYVIARR  237



>ref|XP_011073492.1| PREDICTED: uncharacterized protein LOC105158432 [Sesamum indicum]
Length=460

 Score =   183 bits (465),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/265 (40%), Positives = 145/265 (55%), Gaps = 41/265 (15%)
 Frame = +3

Query  636   LEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvsss  809
             LE F  P++ +  ++++V   PIWVAV+IG+  GW+W+PRW  L     R       +  
Sbjct  13    LEFFNSPALMEAFVDILVCAVPIWVAVMIGLACGWSWRPRWTGLVFLGFRSKLRFLWTLP  72

Query  810   TGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQE-------------  950
              G+  ++ +  F+++ A  L    C    S     S     S   QE             
Sbjct  73    PGLGARRFWLAFTALSAFSL----CRGLWSRSRGRSRKLEKSLSAQELVGSASSSAPAAA  128

Query  951   NDKSRVVDENDLYH----------LYQLVEEKD--------DGP----AWIQMMDRSATN  1064
               +  VVD+               L   V EKD        DG     AW  MM+RS +N
Sbjct  129   AQELVVVDDASCGEINPVSGAPDGLSNSVTEKDLEHLLNLLDGKDGEMAWQSMMERSTSN  188

Query  1065  MSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPST  1244
             M+YQAWR +PE GP  YRS+T++E+ATPE+VRDFFWDDEFR KWD ML++ + LE+ P+T
Sbjct  189   MTYQAWRHEPEMGPTVYRSKTIFEEATPELVRDFFWDDEFRPKWDPMLVYVKILEECPNT  248

Query  1245  GTMVVQWVRKFPFFCSDREYIIGRR  1319
             G M+V W++KFPFFCSDREYIIGRR
Sbjct  249   GMMIVHWIKKFPFFCSDREYIIGRR  273



>ref|XP_004955685.1| PREDICTED: uncharacterized protein LOC101781535 [Setaria italica]
Length=438

 Score =   182 bits (463),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 145/245 (59%), Gaps = 17/245 (7%)
 Frame = +3

Query  636   LEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvs-ssT  812
             + + +RP++ ++ +++++   PIW AV+IG++VGW+W+PRW  L          +     
Sbjct  9     VALLRRPAVAEMAVDVLLCAVPIWAAVMIGLVVGWSWRPRWTGLLFLGLRSRLRLLWVPP  68

Query  813   GINLQQVFSGFSSIPA-------LKLQIPKCFSWIseetsssltpnsssplQENDKSRV-  968
             G+  ++++   +++ A       L     +C     E+ S      ++         R  
Sbjct  69    GLGARRLWFACTALSACSVAPRLLSSAFRRCRGKHQEKASPEGDDAAAGADGGCADGRTI  128

Query  969   -------VDENDLYHLYQLVEEKDDG-PAWIQMMDRSATNMSYQAWRRDPETGPPQYRSR  1124
                    V E DL HL QL++ K+ G  AW  +M+R+ +NM+Y+AWR +PE GP  Y SR
Sbjct  129   FEGEQDTVAEKDLEHLLQLLDNKESGDTAWQNLMERTTSNMTYKAWRHEPEEGPIMYCSR  188

Query  1125  TVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREY  1304
             T++EDATPE+VRDFFWD +FR KWD ML H++TL++ P  GT +V W++KFPFFCSDREY
Sbjct  189   TIFEDATPELVRDFFWDGDFRLKWDPMLAHSKTLDEFPQNGTTIVHWIKKFPFFCSDREY  248

Query  1305  IIGRR  1319
             I G R
Sbjct  249   IFGGR  253



>ref|XP_010923463.1| PREDICTED: uncharacterized protein LOC105046548 [Elaeis guineensis]
Length=439

 Score =   182 bits (463),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/256 (40%), Positives = 149/256 (58%), Gaps = 35/256 (14%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
              ++  +RP++ + ++++++   PIWVAV+IG+++GW+W+PRW  L     R  F    ++
Sbjct  8     FVDFMRRPAVVETLIDILLCAVPIWVAVMIGLVIGWSWRPRWTGLLFLGMRSKFRFLWTA  67

Query  807   sTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRV------  968
               G+  ++++  F+++ A        FS   +  SS       SP  E+  SR       
Sbjct  68    PPGLGARRLWLAFTALSA--------FSVCRKLWSSFKGKGEGSPAAEDSGSRSAVSMSS  119

Query  969   VDENDLYHLYQLVEEKDDGPA-------------------WIQMMDRSATNMSYQAWRRD  1091
             V+E+D        E+ DD  A                   W   M+R+  NM YQAWR +
Sbjct  120   VEEDDGGSFSGAFEDGDDVVAEKDLEHLLHLLDGKVGDAVWQNQMERTTPNMIYQAWRHE  179

Query  1092  PETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVR  1271
             PE GP  YRSRT++EDATPE+VRDFFWDD+FR KWD ML H  +L++ P +GTM+V W++
Sbjct  180   PEVGPIIYRSRTIFEDATPELVRDFFWDDDFRLKWDPMLAHFNSLKEFPQSGTMIVHWIK  239

Query  1272  KFPFFCSDREYIIGRR  1319
             KFPFFCSDREYIIGRR
Sbjct  240   KFPFFCSDREYIIGRR  255



>ref|XP_008805969.1| PREDICTED: uncharacterized protein LOC103718779 [Phoenix dactylifera]
Length=439

 Score =   181 bits (460),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 106/260 (41%), Positives = 155/260 (60%), Gaps = 35/260 (13%)
 Frame = +3

Query  621   LVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfds  794
             + + +++  +RP++ + ++++++   PIWVAV+IG+++GW+W+PRW  L     R  F  
Sbjct  4     MYTNIVDFMRRPAVVETLIDILLCAVPIWVAVMIGLVIGWSWRPRWTGLLFLGMRSKFRF  63

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSR---  965
               ++  G+  ++++  F+++ A        FS   +  SS       SP  E+  SR   
Sbjct  64    LWTAPPGLGARRLWLAFTALSA--------FSVCRKLWSSFKGKGEGSPAPEDSASRPAV  115

Query  966   ----------------------VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQA  1079
                                   VV E DL HL  L++ K     W   M+R+  NM YQA
Sbjct  116   SMSSADEDGGGSFSGAFKGGHDVVIEKDLEHLLHLLDGKAGDAVWQNQMERTTPNMIYQA  175

Query  1080  WRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVV  1259
             WR +PE GP  YRSRTV+EDATPE+VRDFFWDD+FR KWD ML++ +TLE+ P +GTM+V
Sbjct  176   WRHEPEVGPIIYRSRTVFEDATPELVRDFFWDDDFRLKWDPMLVYFKTLEEFPESGTMIV  235

Query  1260  QWVRKFPFFCSDREYIIGRR  1319
              W++KFPFFCSDREYIIGRR
Sbjct  236   HWIKKFPFFCSDREYIIGRR  255



>dbj|BAJ95846.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=411

 Score =   180 bits (456),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 2/124 (2%)
 Frame = +3

Query  954   DKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVY  1133
             D    V+  DL HL ++VEEKD GPAW  MMDR+     YQAW+R+PE GPPQYRS T++
Sbjct  101   DDELAVNTPDLMHLRRVVEEKDGGPAWTHMMDRTLPTFRYQAWKREPENGPPQYRSSTIF  160

Query  1134  EDATPEMVRDFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYI  1307
             EDA+P++VRDFFWDD+FR K  WDDML+  ETLE+   TGTMVV+WVRKFPFFCSDREY+
Sbjct  161   EDASPDVVRDFFWDDDFRIKNTWDDMLLKHETLEECTETGTMVVRWVRKFPFFCSDREYV  220

Query  1308  IGRR  1319
             IGRR
Sbjct  221   IGRR  224


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  621  LVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRW  758
            L   L E+F+ P++  V  EL     P+W+A ++G+L+GWAW+PRW
Sbjct  4    LADLLAEVFREPTLAGVARELATLAAPLWLAAIVGLLIGWAWRPRW  49



>emb|CBI26372.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   179 bits (454),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/221 (45%), Positives = 133/221 (60%), Gaps = 20/221 (9%)
 Frame = +3

Query  717   VIGVLVGWAWKPRWANLC--AsrdsfdsfvsssTGINLQQVFSGFSSIPALKL-------  869
             +IG+++GW+W+PRW  L     R  F    ++  G   ++++  F+++ A  +       
Sbjct  1     MIGLVIGWSWRPRWTGLVYLGLRSKFRFLWTAPPGFGARRLWLAFTALSAFSVGRTIWSN  60

Query  870   -QIPKCFSWIseetsssltpnsssplQENDKS----------RVVDENDLYHLYQLVEEK  1016
              ++ +     +  +SS      S      D S           +V ENDL HL  ++E K
Sbjct  61    FKVRRKGPTAAAASSSPAGTARSVEGNGGDVSLDTRPAEIEQDIVTENDLDHLLHVLERK  120

Query  1017  DDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKW  1196
             D   AW  MM+RS  NMSYQAWR +PE GP  YRSRTV+EDATPE+VRDFFWDDEFR KW
Sbjct  121   DGEMAWQGMMERSTPNMSYQAWRHEPENGPTVYRSRTVFEDATPEVVRDFFWDDEFRPKW  180

Query  1197  DDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             D ML + + LE+ P T TM+V W++KFPFFCSDREYIIGRR
Sbjct  181   DPMLAYFKILEEFPHTATMIVHWIKKFPFFCSDREYIIGRR  221



>ref|XP_009409211.1| PREDICTED: uncharacterized protein LOC103991461 [Musa acuminata 
subsp. malaccensis]
Length=448

 Score =   180 bits (456),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/260 (38%), Positives = 153/260 (59%), Gaps = 27/260 (10%)
 Frame = +3

Query  621   LVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfds  794
             L +  +++ ++P++ + ++++++ T PIWVAV+IG+++GW+W+PRW  L     R     
Sbjct  4     LYTDFVDLMKKPAVAETLIDILLCTVPIWVAVMIGLVIGWSWRPRWTGLLFLGLRSKLRF  63

Query  795   fvsssTGINLQQVFSGFSSIPALKLQIPKCFSWIse------------etsssltpnsss  938
               ++  G+  ++++  F+++    +    C S I +             + +    +   
Sbjct  64    LWTAPPGLGARRLWFAFTALSVFSVCHKLCSSSIFKGKAGRSQDVEEDSSVAKTAASQIL  123

Query  939   plQENDKSR-------------VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQA  1079
             P+ E D  R             +V E DL HL  L++ K     W  +M+R+ +NM YQA
Sbjct  124   PVVEGDGGRSSSNIGLSMSEHEIVTEKDLKHLLHLLDGKVGDTVWQNLMERTTSNMIYQA  183

Query  1080  WRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVV  1259
             W  +PE GP  YRSRTV+EDA+PE+VR+FFWDD FR KWD ML H + LE+   +GTM+V
Sbjct  184   WHHEPEMGPIIYRSRTVFEDASPELVREFFWDDNFRLKWDPMLAHFKILEEFAESGTMIV  243

Query  1260  QWVRKFPFFCSDREYIIGRR  1319
              W++KFPFFCSDREYIIGRR
Sbjct  244   HWIKKFPFFCSDREYIIGRR  263



>gb|AFK35199.1| unknown [Medicago truncatula]
Length=436

 Score =   179 bits (454),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/245 (41%), Positives = 143/245 (58%), Gaps = 16/245 (7%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             ++E  ++PSI +  +++++   PIW+AV+IG+++GW+W+PRW  L     R  F    + 
Sbjct  8     VMEFMKKPSITETFVDILLCAVPIWLAVMIGLVIGWSWRPRWTGLLFIGLRSKFRFLWTV  67

Query  807   sTGINLQQVFSGFSSIPAL--------------KLQIPKCFSWIseetsssltpnssspl  944
               G   ++++  F+++ A               K+  P   S   + T ++     S   
Sbjct  68    PPGFGARRLWLAFTALSAFSICRRYWSNFKNREKVLDPSSNSCSDDATDATKHAARSGDK  127

Query  945   QENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSR  1124
              +      V E DL HL  L+E KD    W   M+RS  NM Y+AWR D ETG   YRSR
Sbjct  128   ADERDKDTVREADLEHLLHLLEGKDGEIDWQSFMERSTPNMQYKAWRYDSETGATVYRSR  187

Query  1125  TVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREY  1304
             TV+EDATPE+VRDFFWDD+FR KWD ML H + L++ P  GT +V W++KFPFFCSDREY
Sbjct  188   TVFEDATPELVRDFFWDDDFRPKWDPMLAHCKVLKECPHNGTSIVHWIKKFPFFCSDREY  247

Query  1305  IIGRR  1319
             II RR
Sbjct  248   IIARR  252



>gb|AFW66618.1| hypothetical protein ZEAMMB73_358635, partial [Zea mays]
Length=262

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 98/120 (82%), Gaps = 2/120 (2%)
 Frame = +3

Query  966   VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDAT  1145
              V + DL +L++LVE +D GPAWI+MMDRS   M+YQAWRRD +TGPPQY+S +++EDAT
Sbjct  116   AVGKRDLANLWRLVEGRDGGPAWIKMMDRSLPTMTYQAWRRDAQTGPPQYQSSSIFEDAT  175

Query  1146  PEMVRDFFWDDEFRA--KWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             PE VRDFF DDEFR   KWDDML++ +TLE+  +TGTM V WVRKFPFFCSDREYII RR
Sbjct  176   PEEVRDFFGDDEFRVSNKWDDMLVYHKTLEECQTTGTMKVHWVRKFPFFCSDREYIIARR  235



>ref|XP_003610788.1| Membrane related protein-like protein [Medicago truncatula]
 gb|AES93746.1| mammalian STARD2 lipid-binding START domain protein [Medicago 
truncatula]
Length=436

 Score =   179 bits (454),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/245 (41%), Positives = 143/245 (58%), Gaps = 16/245 (7%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             ++E  ++PSI +  +++++   PIW+AV+IG+++GW+W+PRW  L     R  F    + 
Sbjct  8     VMEFMKKPSITETFVDILLCAVPIWLAVMIGLVIGWSWRPRWTGLLFIGLRSKFRFLWTV  67

Query  807   sTGINLQQVFSGFSSIPAL--------------KLQIPKCFSWIseetsssltpnssspl  944
               G   ++++  F+++ A               K+  P   S   + T ++     S   
Sbjct  68    PPGFGARRLWLAFTALSAFSICRRYWSNFKNKEKVLDPSSNSCSDDATDATKHAARSGDK  127

Query  945   QENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSR  1124
              +      V E DL HL  L+E KD    W   M+RS  NM Y+AWR D ETG   YRSR
Sbjct  128   ADERDKDTVREADLEHLLHLLEGKDGEIDWQSFMERSTPNMQYKAWRYDSETGATVYRSR  187

Query  1125  TVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREY  1304
             TV+EDATPE+VRDFFWDD+FR KWD ML H + L++ P  GT +V W++KFPFFCSDREY
Sbjct  188   TVFEDATPELVRDFFWDDDFRPKWDPMLAHCKVLKECPHNGTSIVHWIKKFPFFCSDREY  247

Query  1305  IIGRR  1319
             II RR
Sbjct  248   IIARR  252



>gb|AFK44283.1| unknown [Medicago truncatula]
Length=436

 Score =   179 bits (454),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/245 (41%), Positives = 143/245 (58%), Gaps = 16/245 (7%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
             ++E  ++PSI +  +++++   PIW+AV+IG+++GW+W+PRW  L     R  F    + 
Sbjct  8     VMEFMKKPSITETFVDILLCAVPIWLAVMIGLVIGWSWRPRWTGLLFIGLRSKFRFLWTV  67

Query  807   sTGINLQQVFSGFSSIPAL--------------KLQIPKCFSWIseetsssltpnssspl  944
               G   ++++  F+++ A               K+  P   S   + T ++     S   
Sbjct  68    PPGFGARRLWLAFTALSAFSICRRYWSNFKNKEKVLDPSSNSCSDDATDATKHAARSGDK  127

Query  945   QENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSR  1124
              +      V E DL HL  L+E KD    W   M+RS  NM Y+AWR D ETG   YRSR
Sbjct  128   ADERDKDTVREADLEHLLHLLEGKDGEIDWQSFMERSTPNMRYKAWRYDSETGATVYRSR  187

Query  1125  TVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREY  1304
             TV+EDATPE+VRDFFWDD+FR KWD ML H + L++ P  GT +V W++KFPFFCSDREY
Sbjct  188   TVFEDATPELVRDFFWDDDFRPKWDPMLAHCKVLKECPHNGTSIVHWIKKFPFFCSDREY  247

Query  1305  IIGRR  1319
             II RR
Sbjct  248   IIARR  252



>emb|CDO99168.1| unnamed protein product [Coffea canephora]
Length=453

 Score =   179 bits (455),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 107/257 (42%), Positives = 149/257 (58%), Gaps = 31/257 (12%)
 Frame = +3

Query  639   EIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--AsrdsfdsfvsssT  812
             ++F+  ++ +  +++++   PIW+AV IG+ +GW+W+PRW  L     R  F    +   
Sbjct  10    DMFRSQTVLETFVDVLLCLVPIWLAVTIGLFIGWSWRPRWTGLLFLGLRSKFRFAWTVPA  69

Query  813   GINLQQVFSGFSSIPALKL----------QIPKCFSWIseetsssltpnsssplQ-----  947
             G   +Q++  F++  A  L          +I K FS  S           S   Q     
Sbjct  70    GFGARQLWFAFTAFSAFSLTRKLLSKLHGRIRKDFSLASARVEQPAVDFPSLSAQTVEAR  129

Query  948   -------------ENDKSRVVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRR  1088
                          E DK+ VV ENDL HL  L++ KD   AW  MM+RS  N++Y+AWR 
Sbjct  130   SSSDDIRPTAGTLETDKN-VVTENDLAHLLHLLDGKDGEMAWQSMMERSTPNLAYRAWRY  188

Query  1089  DPETGPPQYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWV  1268
             + ETGP  +RS+TV+EDATP++VRDFFWDDEFR KWD M++  E LE+ P  GTM+V+W 
Sbjct  189   EAETGPVVFRSKTVFEDATPDLVRDFFWDDEFRLKWDPMILSVEILEECPLNGTMIVRWT  248

Query  1269  RKFPFFCSDREYIIGRR  1319
             +KFPFFCSDREYIIGRR
Sbjct  249   KKFPFFCSDREYIIGRR  265



>gb|EMS48425.1| hypothetical protein TRIUR3_01630 [Triticum urartu]
Length=339

 Score =   176 bits (446),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 95/120 (79%), Gaps = 2/120 (2%)
 Frame = +3

Query  966   VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDAT  1145
              V   DL HL ++VEEKD GPAW  MMDR+     YQAW+R+P+ GPPQYRS T++EDA+
Sbjct  33    AVSTPDLMHLRRVVEEKDGGPAWTHMMDRTLPTFRYQAWKREPQNGPPQYRSSTIFEDAS  92

Query  1146  PEMVRDFFWDDEFRAK--WDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             P++VRDFFWDD+FR    WDDML+  ETLE+   TGTMVV+WVRKFPFFCSDREY+IGRR
Sbjct  93    PDVVRDFFWDDDFRISNTWDDMLLEHETLEECTKTGTMVVRWVRKFPFFCSDREYVIGRR  152



>ref|XP_006658340.1| PREDICTED: uncharacterized protein LOC102707324 [Oryza brachyantha]
Length=424

 Score =   177 bits (449),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/242 (36%), Positives = 143/242 (59%), Gaps = 30/242 (12%)
 Frame = +3

Query  642   IFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfvsssTGIN  821
             + +RP++ ++ +++++   PIW AV+IG+++GWA + R              +    G+ 
Sbjct  11    LLRRPAVAEMAVDVVLCAVPIWAAVMIGLVIGWACRLR-------------LLYVPPGLG  57

Query  822   LQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQE---------------ND  956
              ++++   +++ A  +  P+  S            ++ +   +                 
Sbjct  58    ARRLWLACTALSAFSVA-PRLLSTAFGSRGKHQRKDAPADDADASRDDAACVDGRTFFEG  116

Query  957   KSRVVDENDLYHLYQLVEEKDDG-PAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVY  1133
               +VV E DL HL QL++ K+ G   W  +M+R+ +NM+Y+AWRR+PE GP  Y SRTV+
Sbjct  117   GHQVVTEKDLEHLVQLLDNKESGDTTWQHLMERTTSNMTYKAWRREPEVGPITYCSRTVF  176

Query  1134  EDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIG  1313
             EDATPE+VRDFFWDDEFR +WD ML +++ L++ P  GTM++ W++KFPFFCSDREYI G
Sbjct  177   EDATPELVRDFFWDDEFRLRWDPMLAYSKILDEFPQNGTMIIHWIKKFPFFCSDREYIFG  236

Query  1314  RR  1319
             +R
Sbjct  237   QR  238



>ref|XP_009408481.1| PREDICTED: uncharacterized protein LOC103990913 [Musa acuminata 
subsp. malaccensis]
Length=440

 Score =   177 bits (449),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 145/250 (58%), Gaps = 21/250 (8%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--Asrdsfdsfvss  806
              +E+  +P++ + ++++++   PIWVAV+IG+++GW+W+PRW  L     R  F    ++
Sbjct  8     FMELMSKPAVVETLIDVLLCAVPIWVAVMIGLVIGWSWRPRWTGLLFLGLRSRFRFIWTA  67

Query  807   sTGINLQQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRVVDEN-D  983
               G+  ++++  F+++ A  +      S+  +    S+   + S       S +V+   D
Sbjct  68    PPGLGARRLWLAFTALSAFSVCRRLWSSFKGKREGPSIAGETGSRAAALTSSTLVEGGGD  127

Query  984   LYHLYQLVEEKD------------------DGPAWIQMMDRSATNMSYQAWRRDPETGPP  1109
             +     +V E D                     AW   M+R+  NM Y AWR +PE GP 
Sbjct  128   ILSNGVVVAEHDIISEKDLEHLLHLLDDKVGDAAWQNQMERTTPNMIYHAWRHEPEVGPI  187

Query  1110  QYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFC  1289
              YRSRTV+EDATPE+VRDFFWDD+FR KWD ML + E LE+ P +GTM+  W++KFPFFC
Sbjct  188   IYRSRTVFEDATPELVRDFFWDDDFRLKWDSMLAYYEILEEIPESGTMINHWIKKFPFFC  247

Query  1290  SDREYIIGRR  1319
             SDREYIIGRR
Sbjct  248   SDREYIIGRR  257



>dbj|BAJ97056.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score =   177 bits (449),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/239 (38%), Positives = 141/239 (59%), Gaps = 18/239 (8%)
 Frame = +3

Query  654   PSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC-AsrdsfdsfvsssTGINLQQ  830
             P++ ++ +++++   PIW AV+IG+ VGWAW+PRW  L      S    +    G+  ++
Sbjct  16    PALAEMAVDVLLCAVPIWAAVMIGLFVGWAWRPRWTGLIFLGFRSRLRLLCVPPGLGARR  75

Query  831   VFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQE---------------NDKSR  965
             ++   +++ A  +  P+  S            + S+   +                 K  
Sbjct  76    LWLACTALSAFSVA-PQLLSSAFRRHGKYQRKDPSNDDADACGDAGSCADGRSIFEGKHD  134

Query  966   VVDENDLYHLYQLVEEKDDG-PAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDA  1142
             +V E DL HL QL++ K+ G   W  +M+R+ +NM+Y+AWR +PE GP  + S+T++EDA
Sbjct  135   IVTEKDLDHLVQLLDNKESGRTTWQHLMERTTSNMTYKAWRHEPEVGPIMHCSQTIFEDA  194

Query  1143  TPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             TPE+VRDFFWDD+FR KWD ML+  +TL++    GT ++ W++KFPFFCSDREYI GRR
Sbjct  195   TPELVRDFFWDDDFRLKWDPMLVCFKTLDEFSQNGTTIIHWIKKFPFFCSDREYIFGRR  253



>ref|NP_001142221.1| hypothetical protein [Zea mays]
 gb|ACF87918.1| unknown [Zea mays]
 gb|AFW66619.1| hypothetical protein ZEAMMB73_358635 [Zea mays]
Length=419

 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 98/120 (82%), Gaps = 2/120 (2%)
 Frame = +3

Query  966   VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDAT  1145
              V + DL +L++LVE +D GPAWI+MMDRS   M+YQAWRRD +TGPPQY+S +++EDAT
Sbjct  116   AVGKRDLANLWRLVEGRDGGPAWIKMMDRSLPTMTYQAWRRDAQTGPPQYQSSSIFEDAT  175

Query  1146  PEMVRDFFWDDEFRA--KWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             PE VRDFF DDEFR   KWDDML++ +TLE+  +TGTM V WVRKFPFFCSDREYII RR
Sbjct  176   PEEVRDFFGDDEFRVSNKWDDMLVYHKTLEECQTTGTMKVHWVRKFPFFCSDREYIIARR  235



>gb|AFW66620.1| hypothetical protein ZEAMMB73_358635 [Zea mays]
Length=421

 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 98/120 (82%), Gaps = 2/120 (2%)
 Frame = +3

Query  966   VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDAT  1145
              V + DL +L++LVE +D GPAWI+MMDRS   M+YQAWRRD +TGPPQY+S +++EDAT
Sbjct  118   AVGKRDLANLWRLVEGRDGGPAWIKMMDRSLPTMTYQAWRRDAQTGPPQYQSSSIFEDAT  177

Query  1146  PEMVRDFFWDDEFRA--KWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             PE VRDFF DDEFR   KWDDML++ +TLE+  +TGTM V WVRKFPFFCSDREYII RR
Sbjct  178   PEEVRDFFGDDEFRVSNKWDDMLVYHKTLEECQTTGTMKVHWVRKFPFFCSDREYIIARR  237



>ref|XP_006648262.1| PREDICTED: uncharacterized protein LOC102714348 [Oryza brachyantha]
Length=347

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 100/120 (83%), Gaps = 2/120 (2%)
 Frame = +3

Query  966   VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDAT  1145
              V ++DL +L++LVE +D GPAWI+MM+++  NM+YQAWRRDP+TGPPQY+S T++E+A 
Sbjct  44    AVGKDDLVNLWRLVEGRDGGPAWIKMMEKALPNMTYQAWRRDPQTGPPQYQSSTIFENAN  103

Query  1146  PEMVRDFFWDDEFRA--KWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             PE VRDFF DD+FR   KWDDMLI+ +TLE+  +TGTM V WVRKFPFFCSDREYII RR
Sbjct  104   PEEVRDFFGDDQFRMSNKWDDMLIYHKTLEECQTTGTMKVHWVRKFPFFCSDREYIIARR  163



>gb|AGV54490.1| StAR-related lipid transfer protein [Phaseolus vulgaris]
Length=425

 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +3

Query  966   VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDAT  1145
              V   DL HL+ LVEEKD    WIQMMDRS   M Y+AW R+P+ GPPQYRS  ++EDAT
Sbjct  123   AVTIRDLLHLWLLVEEKDGSLPWIQMMDRSTPTMCYKAWHREPKDGPPQYRSSAIFEDAT  182

Query  1146  PEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             PEMVRD FWDDEFR +WDDML  +  +E+ P+TGTM VQW+RKFPFFC DREYIIGRR
Sbjct  183   PEMVRDLFWDDEFRPRWDDMLASSSIIEECPTTGTMKVQWIRKFPFFCKDREYIIGRR  240



>ref|XP_009145238.1| PREDICTED: uncharacterized protein LOC103868940 [Brassica rapa]
Length=412

 Score =   175 bits (444),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 96/226 (42%), Positives = 142/226 (63%), Gaps = 8/226 (4%)
 Frame = +3

Query  657   SIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLC--AsrdsfdsfvsssTGINLQQ  830
             S+ + ++++++ + P    +++G+L+GW+W+PRW  L     R       +   G   ++
Sbjct  8     SVTETLVDILLCSVP---PIMVGLLIGWSWRPRWTGLVYLGLRSKLRFLCTVPPGFGARR  64

Query  831   VFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSR---VVDENDLYHLYQ  1001
             V+  F+++   +    +  S   +   S  T   S    + D+ +   +V E DL HL  
Sbjct  65    VWLAFTALSLCRTLWSRLGSSDKKPEDSGETQAISRVSDKEDREKEQEIVREKDLEHLLH  124

Query  1002  LVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATPEMVRDFFWDDE  1181
             L+E ++    W  MMD+S  NM+YQAWR +P+TGP  YRSRTV+EDATP++VRDFFWDDE
Sbjct  125   LLEAENANMEWQSMMDKSTPNMNYQAWRHEPKTGPVVYRSRTVFEDATPDIVRDFFWDDE  184

Query  1182  FRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             FR KWD ML + +TLE+ P TGT +V W++KFPFFCSDREYIIGRR
Sbjct  185   FRPKWDPMLAYFKTLEEDPQTGTTIVHWIKKFPFFCSDREYIIGRR  230



>gb|EMS50172.1| hypothetical protein TRIUR3_23911 [Triticum urartu]
Length=315

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = +3

Query  966   VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDAT  1145
              V + DL +L++LVE  D GPAWI+MM+++  NM+YQAWRRDP+ GPPQY+S T++E+AT
Sbjct  12    AVGKADLVNLWRLVEGNDGGPAWIKMMEKALPNMTYQAWRRDPQNGPPQYQSSTIFENAT  71

Query  1146  PEMVRDFFWDDEFRA--KWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             P+ VRDFF DDEFR   KWDDMLI  +TLE+  +TG M V WVRKFPFFCSDREYIIGRR
Sbjct  72    PDEVRDFFGDDEFRMSNKWDDMLISHQTLEECQTTGMMKVHWVRKFPFFCSDREYIIGRR  131



>ref|XP_002453232.1| hypothetical protein SORBIDRAFT_04g002070 [Sorghum bicolor]
 gb|EES06208.1| hypothetical protein SORBIDRAFT_04g002070 [Sorghum bicolor]
Length=425

 Score =   175 bits (444),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 102/239 (43%), Positives = 153/239 (64%), Gaps = 7/239 (3%)
 Frame = +3

Query  621   LVSALLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANLCAsrdsfdsfv  800
             ++SA+  + ++P+      E+ +   P+W A ++G+L+GWAW+PRWA       +     
Sbjct  4     VLSAVARVLEQPTAWGAAWEMALLAGPLWAAALLGLLLGWAWRPRWAAGLVVATADGGSA  63

Query  801   sssTGINLQQVFSGF----SSIPALKLQIPKCFSWIseetsssltpnsssplQENDKSRV  968
             +++     Q  F+      + +PA +L+ P  ++  + +             +  ++   
Sbjct  64    AAAAQALAQPPFATLDFWKAQLPA-RLRAPLGYAGAAVQQREEDEDAVQGSSEGANEELA  122

Query  969   VDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDATP  1148
             V ++DL +L++LVE +D GPAWI+MM++S   M+YQAWRRD +TGPPQY+S +++E+ATP
Sbjct  123   VGKDDLVNLWRLVEGRDGGPAWIKMMEKSLPTMTYQAWRRDTQTGPPQYQSSSIFENATP  182

Query  1149  EMVRDFFWDDEFRA--KWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             E VRDFF DDEFR   KWDDMLI+ +TLE+  +TGTM V WVRKFPFFCSDREYII RR
Sbjct  183   EEVRDFFGDDEFRMSNKWDDMLIYHKTLEECQTTGTMKVHWVRKFPFFCSDREYIIARR  241



>ref|XP_002461562.1| hypothetical protein SORBIDRAFT_02g004760 [Sorghum bicolor]
 gb|EER98083.1| hypothetical protein SORBIDRAFT_02g004760 [Sorghum bicolor]
Length=446

 Score =   175 bits (444),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 142/243 (58%), Gaps = 22/243 (9%)
 Frame = +3

Query  654   PSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWAN---LCAsrdsfdsfvsssTGINL  824
             P++ ++ +++++   PIW AV+IG+ VGW+W+PRW     L         ++    G+  
Sbjct  20    PAVAEMAVDVLLCAVPIWAAVMIGLAVGWSWRPRWTGLLFLGLRSRLRVLWLWVPPGLGA  79

Query  825   QQVFSGFSSIPALKLQIPKCFSWIseetsssltpnsssplQE-----------------N  953
             ++++   +++ A  +  P+  S            + +SP                     
Sbjct  80    RRLWLACTALSACSVA-PRLLSSAFRRHRRGKHQDKASPEDHAAAAPDDGGCAVGRTIFE  138

Query  954   DKSRVVDENDLYHLYQLVEEKDDG-PAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTV  1130
              +   V E DL HL QL++ K+ G  AW  +M+R+ +NM+Y+AWRR+PE GP  Y SRT+
Sbjct  139   GEQDTVTERDLEHLLQLLDNKESGDTAWQNLMERTTSNMTYKAWRREPEEGPIMYCSRTI  198

Query  1131  YEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYII  1310
             +EDATPE+VRDFFWD +FR KWD ML +++TL++ P +G  +V W++KFPFFCSDREYI 
Sbjct  199   FEDATPELVRDFFWDGDFRLKWDPMLGYSKTLDEFPQSGATIVHWIKKFPFFCSDREYIF  258

Query  1311  GRR  1319
             G R
Sbjct  259   GGR  261



>ref|XP_008676876.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=502

 Score =   176 bits (445),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 98/120 (82%), Gaps = 2/120 (2%)
 Frame = +3

Query  966   VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDAT  1145
              V + DL +L++LVE +D GPAWI+MMDRS   M+YQAWRRD +TGPPQY+S +++EDAT
Sbjct  190   AVGKRDLANLWRLVEGRDGGPAWIKMMDRSLPTMTYQAWRRDAQTGPPQYQSSSIFEDAT  249

Query  1146  PEMVRDFFWDDEFRA--KWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             PE VRDFF DDEFR   KWDDML++ +TLE+  +TGTM V WVRKFPFFCSDREYII RR
Sbjct  250   PEEVRDFFGDDEFRVSNKWDDMLVYHKTLEECQTTGTMKVHWVRKFPFFCSDREYIIARR  309



>ref|XP_004952046.1| PREDICTED: uncharacterized protein LOC101765043 isoform X1 [Setaria 
italica]
Length=540

 Score =   176 bits (446),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 99/120 (83%), Gaps = 2/120 (2%)
 Frame = +3

Query  966   VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPPQYRSRTVYEDAT  1145
              V + DL +L++LVE +D GPAWI+MM++S   M+YQAWRRD +TGPPQY+S T++E+AT
Sbjct  237   AVGKEDLVNLWRLVEGRDGGPAWIKMMEKSLPTMTYQAWRRDAQTGPPQYQSSTIFENAT  296

Query  1146  PEMVRDFFWDDEFRA--KWDDMLIHAETLEDHPSTGTMVVQWVRKFPFFCSDREYIIGRR  1319
             PE VRDFF DDEFR   KWDDMLI+ +TLE+  +TGTM V WVRKFPFFCSDREYIIGRR
Sbjct  297   PEEVRDFFGDDEFRMSNKWDDMLIYHKTLEECQTTGTMKVHWVRKFPFFCSDREYIIGRR  356



>emb|CAB10229.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78492.1| hypothetical protein [Arabidopsis thaliana]
Length=420

 Score =   174 bits (440),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/235 (41%), Positives = 142/235 (60%), Gaps = 25/235 (11%)
 Frame = +3

Query  633   LLEIFQRPSIGDVILELMVFTTPIWVAVVIGVLVGWAWKPRWANL--CAsrdsfdsfvss  806
             LL  F+ PS  +  +++++   PIW+AV+IG+L+GW+W+PRW  L     R       ++
Sbjct  8     LLNFFKNPSFTETFVDILLCAVPIWLAVMIGLLIGWSWRPRWTGLIYLGFRSKLRFLWTA  67

Query  807   sTGINLQQVFSGFSSIPALKLQIPKCFS-WIseetsssltpnsssplQ----ENDKSR--  965
               G   ++++  F+++ A  +    C + W   +T ++ +   S+  Q    +ND+S   
Sbjct  68    PPGFGARRLWLAFTALSAFSV----CRTIWSRNDTRANKSATGSASSQTPVEDNDESGLA  123

Query  966   ------------VVDENDLYHLYQLVEEKDDGPAWIQMMDRSATNMSYQAWRRDPETGPP  1109
                         +V ENDL HL QL+E  +    W  MMD++  NMSYQAWR +PETGP 
Sbjct  124   SRGSDNGTVTEDIVTENDLEHLLQLLEVGNAALEWQSMMDKTTPNMSYQAWRHEPETGPV  183

Query  1110  QYRSRTVYEDATPEMVRDFFWDDEFRAKWDDMLIHAETLEDHPSTGTMVVQWVRK  1274
              YRSRTV+EDATP++VRDFFWDDEFR KWD ML + +TLE+   TGTM+VQW +K
Sbjct  184   IYRSRTVFEDATPDIVRDFFWDDEFRPKWDFMLANFKTLEEDTQTGTMIVQWRKK  238



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3833840346908