BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8020

Length=1367
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009621605.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    450   6e-148   Nicotiana tomentosiformis
ref|XP_009783429.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    449   8e-148   Nicotiana sylvestris
emb|CDP15892.1|  unnamed protein product                                434   5e-142   Coffea canephora [robusta coffee]
ref|XP_006364108.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    434   7e-142   Solanum tuberosum [potatoes]
ref|XP_009621612.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    434   7e-142   Nicotiana tomentosiformis
ref|XP_006364109.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    433   2e-141   Solanum tuberosum [potatoes]
ref|XP_009621600.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    433   2e-141   Nicotiana tomentosiformis
ref|XP_009783428.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    433   3e-141   Nicotiana sylvestris
ref|XP_004248184.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    431   9e-141   Solanum lycopersicum
ref|XP_011100229.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    431   9e-141   Sesamum indicum [beniseed]
ref|XP_004248185.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    429   6e-140   Solanum lycopersicum
ref|XP_009783430.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    429   9e-140   Nicotiana sylvestris
gb|AFQ93695.1|  acyl-CoA oxidase 3                                      412   3e-133   Prunus persica
ref|XP_008244854.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    410   8e-133   Prunus mume [ume]
gb|KDO45758.1|  hypothetical protein CISIN_1g011790mg                   404   8e-133   Citrus sinensis [apfelsine]
ref|XP_010093490.1|  Acyl-coenzyme A oxidase 3                          409   3e-132   
ref|XP_007043725.1|  Acyl-CoA oxidase 3 isoform 1                       409   8e-132   
ref|XP_006446734.1|  hypothetical protein CICLE_v10014502mg             408   9e-132   Citrus clementina [clementine]
ref|XP_011466939.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    405   1e-131   Fragaria vesca subsp. vesca
ref|XP_007043727.1|  Acyl-CoA oxidase 3 isoform 3                       407   1e-131   
ref|XP_007043726.1|  Acyl-CoA oxidase 3 isoform 2                       407   2e-131   
ref|XP_006469060.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    406   3e-131   Citrus sinensis [apfelsine]
ref|XP_010279215.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    407   4e-131   Nelumbo nucifera [Indian lotus]
ref|XP_004303096.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    405   1e-130   Fragaria vesca subsp. vesca
ref|XP_002278663.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    405   2e-130   Vitis vinifera
gb|KJB12480.1|  hypothetical protein B456_002G020600                    399   7e-130   Gossypium raimondii
gb|EYU29818.1|  hypothetical protein MIMGU_mgv1a002427mg                402   2e-129   Erythranthe guttata [common monkey flower]
ref|NP_001280826.1|  acyl-coenzyme A oxidase 3, peroxisomal-like        401   4e-129   Malus domestica [apple tree]
gb|AAF80226.1|AC025290_15  Contains similarity to an acyl-coenzym...    386   2e-128   Arabidopsis thaliana [mouse-ear cress]
gb|KJB12478.1|  hypothetical protein B456_002G020600                    399   5e-128   Gossypium raimondii
ref|XP_010035824.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    395   6e-127   Eucalyptus grandis [rose gum]
gb|KJB50144.1|  hypothetical protein B456_008G155500                    394   3e-126   Gossypium raimondii
ref|XP_010522108.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    391   3e-125   Tarenaya hassleriana [spider flower]
ref|XP_009354288.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    391   3e-125   Pyrus x bretschneideri [bai li]
gb|AAF73843.1|AF207994_1  acyl-CoA oxidase ACX3                         391   3e-125   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172119.1|  acyl-coenzyme A oxidase 3                             390   4e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417937.1|  hypothetical protein EUTSA_v10006988mg             390   6e-125   Eutrema salsugineum [saltwater cress]
gb|KHG26832.1|  Acyl-coenzyme A oxidase 3, peroxisomal -like protein    390   8e-125   Gossypium arboreum [tree cotton]
gb|KCW47289.1|  hypothetical protein EUGRSUZ_K01080                     390   8e-125   Eucalyptus grandis [rose gum]
ref|XP_004505527.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    389   2e-124   Cicer arietinum [garbanzo]
gb|KJB12486.1|  hypothetical protein B456_002G020700                    387   6e-124   Gossypium raimondii
ref|XP_006306351.1|  hypothetical protein CARUB_v10012245mg             387   1e-123   Capsella rubella
ref|XP_002889597.1|  acyl-CoA oxidase ACX3                              387   1e-123   
gb|KFK42952.1|  hypothetical protein AALP_AA1G060500                    387   1e-123   Arabis alpina [alpine rockcress]
ref|XP_008455941.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    386   2e-123   Cucumis melo [Oriental melon]
ref|XP_009119069.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    384   1e-122   Brassica rapa
ref|XP_006376402.1|  acyl-CoA oxidase family protein                    383   3e-122   
ref|XP_012079023.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    383   3e-122   Jatropha curcas
ref|XP_003527400.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    383   5e-122   Glycine max [soybeans]
ref|XP_004151905.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    382   7e-122   Cucumis sativus [cucumbers]
ref|XP_010457756.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    382   8e-122   Camelina sativa [gold-of-pleasure]
emb|CDY10192.1|  BnaC05g04350D                                          382   1e-121   Brassica napus [oilseed rape]
ref|XP_003607535.1|  Acyl-coenzyme A oxidase 3, peroxisomal             382   1e-121   Medicago truncatula
ref|XP_011013714.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    380   2e-121   Populus euphratica
ref|XP_011013710.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-coenzym...    381   3e-121   Populus euphratica
ref|XP_010475360.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    379   9e-121   Camelina sativa [gold-of-pleasure]
ref|XP_006852548.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    377   5e-120   Amborella trichopoda
ref|XP_002325591.1|  acyl-CoA oxidase family protein                    374   9e-119   
ref|XP_007132685.1|  hypothetical protein PHAVU_011G116000g             374   2e-118   Phaseolus vulgaris [French bean]
gb|KHG11955.1|  Acyl-coenzyme A oxidase 3, peroxisomal -like protein    373   3e-118   Gossypium arboreum [tree cotton]
ref|XP_011002667.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    373   4e-118   Populus euphratica
gb|KHG13766.1|  Acyl-coenzyme A oxidase 3, peroxisomal -like protein    372   4e-118   Gossypium arboreum [tree cotton]
dbj|BAK06462.1|  predicted protein                                      361   4e-117   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_172120.2|  putative acyl-CoA oxidase                             369   8e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003539950.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    369   2e-116   Glycine max [soybeans]
gb|KJB31620.1|  hypothetical protein B456_005G198300                    367   4e-116   Gossypium raimondii
ref|XP_010689758.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    364   1e-114   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009119067.1|  PREDICTED: putative acyl-coenzyme A oxidase ...    360   3e-113   Brassica rapa
ref|XP_002889598.1|  acyl-CoA oxidase 6                                 358   2e-112   Arabidopsis lyrata subsp. lyrata
ref|XP_010916040.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    360   2e-112   Elaeis guineensis
ref|XP_010689760.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    356   1e-111   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010485961.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    353   2e-111   Camelina sativa [gold-of-pleasure]
ref|XP_002525155.1|  acyl-CoA oxidase, putative                         353   2e-111   
emb|CDY10194.1|  BnaC05g04370D                                          355   2e-111   Brassica napus [oilseed rape]
ref|XP_003573815.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    352   4e-110   Brachypodium distachyon [annual false brome]
ref|XP_008784451.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    352   4e-110   Phoenix dactylifera
ref|NP_001057591.1|  Os06g0354500                                       352   5e-110   
ref|XP_009405080.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    351   8e-110   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY57822.1|  BnaA10g28090D                                          351   1e-109   Brassica napus [oilseed rape]
ref|XP_004965421.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    350   2e-109   Setaria italica
ref|XP_006417936.1|  hypothetical protein EUTSA_v10009440mg             349   3e-109   
ref|XP_006656066.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    348   3e-109   
gb|KHN07770.1|  Acyl-coenzyme A oxidase 3, peroxisomal                  345   4e-108   Glycine soja [wild soybean]
ref|XP_009388733.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    345   2e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010689759.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    340   8e-106   Beta vulgaris subsp. vulgaris [field beet]
gb|ACN41105.1|  unknown                                                 334   4e-103   Picea sitchensis
gb|AGT17248.1|  acyl-coenzyme A oxidase                                 332   2e-102   Saccharum hybrid cultivar R570
ref|NP_001152024.1|  acyl-coenzyme A oxidase 2                          330   1e-101   Zea mays [maize]
tpg|DAA56859.1|  TPA: putative acyl-CoA oxidase family protein          330   1e-101   
gb|EAZ00875.1|  hypothetical protein OsI_22900                          330   1e-101   Oryza sativa Indica Group [Indian rice]
ref|XP_002456627.1|  hypothetical protein SORBIDRAFT_03g039670          328   7e-101   Sorghum bicolor [broomcorn]
ref|XP_006592447.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    325   8e-101   
gb|EAZ36947.1|  hypothetical protein OsJ_21282                          326   4e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002985513.1|  hypothetical protein SELMODRAFT_122536             313   3e-95    
ref|XP_002994091.1|  hypothetical protein SELMODRAFT_187751             313   3e-95    
ref|XP_001759376.1|  predicted protein                                  311   1e-94    
ref|XP_001772379.1|  predicted protein                                  306   1e-92    
gb|KJB60308.1|  hypothetical protein B456_009G299600                    287   7e-91    Gossypium raimondii
gb|EPS62711.1|  hypothetical protein M569_12075                         274   3e-86    Genlisea aurea
emb|CBI21935.3|  unnamed protein product                                242   2e-69    Vitis vinifera
ref|XP_007213790.1|  hypothetical protein PRUPE_ppa002439m1g            209   1e-61    
gb|KHG14872.1|  Acyl-coenzyme A oxidase 3, peroxisomal -like protein    196   2e-56    Gossypium arboreum [tree cotton]
ref|XP_007213791.1|  hypothetical protein PRUPE_ppa002439m2g            201   2e-54    
gb|KJB50145.1|  hypothetical protein B456_008G155500                    199   1e-53    Gossypium raimondii
gb|EMT28672.1|  Acyl-coenzyme A oxidase 3, peroxisomal                  191   3e-50    
ref|XP_005707013.1|  acyl-CoA oxidase isoform 1                         185   6e-48    Galdieria sulphuraria
ref|XP_011037432.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    178   5e-46    Populus euphratica
gb|EEE65671.1|  hypothetical protein OsJ_21283                          169   7e-46    Oryza sativa Japonica Group [Japonica rice]
gb|EEC80572.1|  hypothetical protein OsI_22901                          166   1e-44    Oryza sativa Indica Group [Indian rice]
ref|XP_005716306.1|  acyl-CoA oxidase                                   171   3e-43    Chondrus crispus [carageen]
ref|XP_010457758.1|  PREDICTED: putative acyl-coenzyme A oxidase ...    160   1e-42    
ref|XP_004365565.1|  acyl-coenzyme A oxidase 3                          168   4e-42    Capsaspora owczarzaki ATCC 30864
ref|XP_005712968.1|  acyl-CoA oxidase                                   168   5e-42    Chondrus crispus [carageen]
gb|EMS62186.1|  hypothetical protein TRIUR3_06747                       160   7e-42    Triticum urartu
ref|XP_005703885.1|  acyl-CoA oxidase                                   167   7e-42    Galdieria sulphuraria
ref|XP_005536533.1|  acyl-CoA oxidase ACX3                              167   1e-41    Cyanidioschyzon merolae strain 10D
ref|XP_005712270.1|  acyl-CoA oxidase                                   166   2e-41    Chondrus crispus [carageen]
ref|XP_004363191.1|  putative acyl-CoA oxidase                          165   4e-41    Cavenderia fasciculata
gb|EMT28673.1|  hypothetical protein F775_14360                         153   6e-41    
ref|XP_005712269.1|  unnamed protein product                            163   2e-40    Chondrus crispus [carageen]
ref|XP_636605.1|  hypothetical protein DDB_G0288735                     156   5e-38    Dictyostelium discoideum AX4
gb|EFA75614.1|  putative acyl-CoA oxidase                               155   6e-38    Heterostelium album PN500
dbj|GAM28721.1|  hypothetical protein SAMD00019534_118970               153   4e-37    Acytostelium subglobosum LB1
ref|XP_003293845.1|  hypothetical protein DICPUDRAFT_158763             153   5e-37    Dictyostelium purpureum
gb|KIY97857.1|  acyl-CoA oxidase                                        143   6e-36    Monoraphidium neglectum
ref|XP_002159574.1|  PREDICTED: putative acyl-coenzyme A oxidase ...    149   1e-35    Hydra vulgaris
ref|XP_005649112.1|  acyl-CoA oxidase                                   147   4e-35    Coccomyxa subellipsoidea C-169
ref|XP_642669.1|  acyl-CoA oxidase                                      147   4e-35    Dictyostelium discoideum AX4
ref|XP_002677851.1|  acyl-coenzyme A oxidase                            148   7e-35    Naegleria gruberi strain NEG-M
gb|EFA78930.1|  acyl-CoA oxidase                                        145   3e-34    Heterostelium album PN500
ref|XP_009061608.1|  hypothetical protein LOTGIDRAFT_127454             144   3e-34    Lottia gigantea
gb|EFA80269.1|  hypothetical protein PPL_07095                          148   3e-34    Heterostelium album PN500
ref|WP_013062161.1|  acyl-CoA oxidase                                   144   2e-33    Salinibacter ruber
ref|WP_011404446.1|  acyl-CoA oxidase                                   144   2e-33    Salinibacter ruber
ref|XP_003288089.1|  hypothetical protein DICPUDRAFT_152296             142   3e-33    Dictyostelium purpureum
ref|WP_039855121.1|  acyl-CoA oxidase                                   142   3e-33    Gordonia sputi
dbj|GAB38637.1|  putative acyl-CoA oxidase                              142   4e-33    Gordonia sputi NBRC 100414
ref|WP_030226700.1|  acyl-CoA oxidase                                   141   5e-33    Streptomyces lavendulae
gb|ELT92145.1|  hypothetical protein CAPTEDRAFT_182867                  141   6e-33    Capitella teleta
gb|KEP51916.1|  acyl-coenzyme A oxidase 3, peroxisomal protein          141   7e-33    Rhizoctonia solani 123E
emb|CCO32276.1|  hypothetical protein BN14_06332                        139   9e-33    Rhizoctonia solani AG-1 IB
ref|WP_030389344.1|  acyl-CoA oxidase                                   140   1e-32    Streptomyces sp. NRRL S-241
ref|XP_002166799.2|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    140   2e-32    Hydra vulgaris
ref|WP_043324301.1|  acyl-CoA oxidase                                   141   2e-32    
gb|AFE09438.1|  putative acyl-CoA dehydrogenase                         141   2e-32    Corallococcus coralloides DSM 2259
ref|XP_002950277.1|  hypothetical protein VOLCADRAFT_104659             139   2e-32    Volvox carteri f. nagariensis
emb|CEL63350.1|  hypothetical protein RSOLAG1IB_05394                   139   2e-32    Rhizoctonia solani AG-1 IB
ref|WP_007237397.1|  acyl-CoA oxidase                                   139   4e-32    
ref|XP_004339964.1|  acylCoA dehydrogenase, middle domain contain...    139   5e-32    Acanthamoeba castellanii str. Neff
gb|EMS62187.1|  Acyl-coenzyme A oxidase 3, peroxisomal                  132   5e-32    Triticum urartu
ref|XP_003294150.1|  hypothetical protein DICPUDRAFT_58874              138   6e-32    Dictyostelium purpureum
ref|WP_044187894.1|  acyl-CoA oxidase                                   139   7e-32    Hyalangium minutum
ref|XP_002672633.1|  peroxisomal acyl-CoA oxidase                       137   7e-32    Naegleria gruberi strain NEG-M
gb|EUC54225.1|  acyl-coenzyme A oxidase 3, peroxisomal protein          137   1e-31    Rhizoctonia solani AG-3 Rhs1AP
ref|XP_007537568.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    135   1e-31    Erinaceus europaeus [common hedgehog]
ref|WP_005169429.1|  putative acyl-CoA oxidase                          137   1e-31    Gordonia aichiensis
ref|WP_043394213.1|  acyl-CoA oxidase                                   138   2e-31    Archangium violaceum
ref|WP_002637005.1|  acyl-CoA dehydrogenase                             137   5e-31    Myxococcus hansupus
ref|XP_003288045.1|  hypothetical protein DICPUDRAFT_78883              135   5e-31    Dictyostelium purpureum
ref|WP_015352554.1|  acyl-CoA dehydrogenase                             137   5e-31    Myxococcus stipitatus
ref|XP_643323.1|  acyl-CoA oxidase                                      135   6e-31    Dictyostelium discoideum AX4
ref|XP_005843308.1|  hypothetical protein CHLNCDRAFT_59273              135   8e-31    Chlorella variabilis
ref|WP_015360696.1|  acyl-CoA oxidase domain-containing protein         135   1e-30    Nonlabens dokdonensis
ref|WP_030760334.1|  MULTISPECIES: acyl-CoA oxidase                     134   1e-30    Streptomyces
ref|XP_005846795.1|  hypothetical protein CHLNCDRAFT_135324             132   2e-30    Chlorella variabilis
ref|WP_020172265.1|  acyl-CoA oxidase                                   134   2e-30    Gordonia polyisoprenivorans
gb|ELU16781.1|  hypothetical protein CAPTEDRAFT_177414                  133   2e-30    Capitella teleta
dbj|GAM18567.1|  hypothetical protein SAMD00019534_017420               134   2e-30    Acytostelium subglobosum LB1
ref|WP_030697375.1|  acyl-CoA oxidase                                   134   2e-30    Streptomyces
ref|WP_016696079.1|  hypothetical protein                               129   3e-30    
ref|WP_006437568.1|  putative acyl-CoA oxidase                          133   3e-30    Gordonia amicalis
ref|WP_013993723.1|  acyl-CoA oxidase                                   134   3e-30    Zobellia galactanivorans
ref|XP_002123442.2|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    133   4e-30    Ciona intestinalis [sea vase]
ref|WP_028638761.1|  acyl-CoA oxidase                                   133   4e-30    Nocardioides sp. URHA0032
gb|EME62368.1|  acyl-CoA oxidase                                        133   4e-30    Rhodococcus ruber BKS 20-38
ref|WP_040783005.1|  acyl-CoA oxidase                                   133   4e-30    Rhodococcus ruber
ref|WP_028643473.1|  acyl-CoA oxidase                                   133   4e-30    Nocardioides sp. URHA0020
gb|KFH61896.1|  hypothetical protein MVEG_12230                         133   4e-30    Mortierella verticillata NRRL 6337
ref|XP_002128280.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    132   5e-30    Ciona intestinalis [sea vase]
ref|WP_033400952.1|  acyl-CoA oxidase                                   132   5e-30    
ref|WP_014359023.1|  acyl-CoA oxidase                                   133   5e-30    Gordonia polyisoprenivorans
ref|XP_004360487.1|  acyl-CoA oxidase                                   134   6e-30    Cavenderia fasciculata
ref|WP_013937938.1|  acyl-CoA dehydrogenase                             133   6e-30    Myxococcus macrosporus
gb|AAH22268.1|  ACOXL protein                                           129   6e-30    Homo sapiens [man]
gb|ELU36718.1|  putative acyl-coenzyme a oxidase 3.2, peroxisomal       130   6e-30    Rhizoctonia solani AG-1 IA
ref|WP_023420722.1|  MULTISPECIES: Acyl-coenzyme A oxidase 1, per...    132   6e-30    Streptomyces
ref|WP_033948443.1|  acyl-CoA oxidase                                   132   7e-30    Streptomyces
gb|ABF87186.1|  putative acyl-CoA dehydrogenase                         132   9e-30    Myxococcus xanthus DK 1622
ref|WP_014773637.1|  acyl-CoA oxidase                                   132   1e-29    Belliella baltica
ref|WP_020478009.1|  acyl-CoA dehydrogenase                             132   1e-29    Myxococcus xanthus
ref|WP_019291205.1|  MULTISPECIES: acyl-CoA oxidase                     132   1e-29    Rhodococcus
ref|WP_006552333.1|  acyl-CoA oxidase                                   132   1e-29    Rhodococcus pyridinivorans
ref|WP_024101715.1|  acyl-CoA oxidase                                   132   1e-29    Rhodococcus pyridinivorans
gb|AAR00586.1|U77053_1  acyl-CoA oxidase                                132   1e-29    Phalaenopsis hybrid cultivar
ref|WP_039751994.1|  acyl-CoA oxidase                                   132   1e-29    
gb|AAB67883.1|  acyl-CoA oxidase homolog                                132   1e-29    Phalaenopsis hybrid cultivar
ref|WP_045823938.1|  acyl-CoA oxidase                                   132   1e-29    Williamsia herbipolensis
ref|WP_033235472.1|  acyl-CoA oxidase                                   131   1e-29    Rhodococcus
ref|WP_006935934.1|  MULTISPECIES: Acyl-coenzyme A oxidase 3, per...    131   1e-29    Rhodococcus
ref|XP_503244.1|  YALI0D24750p                                          132   1e-29    Yarrowia lipolytica CLIB122
ref|WP_031177408.1|  acyl-CoA oxidase                                   131   1e-29    Streptomyces
ref|WP_018894104.1|  acyl-CoA oxidase                                   131   1e-29    Streptomyces sp. CNY228
ref|WP_008735487.1|  acyl-CoA oxidase                                   131   1e-29    Streptomyces sp. Mg1
ref|WP_017680041.1|  acyl-CoA oxidase                                   131   1e-29    Rhodococcus
ref|WP_003946657.1|  MULTISPECIES: acyl-CoA oxidase                     131   1e-29    Streptomyces
ref|WP_045063823.1|  acyl-CoA oxidase                                   131   1e-29    Rhodococcus
ref|WP_033238735.1|  acyl-CoA oxidase                                   131   2e-29    Streptomyces griseus
gb|KDD73136.1|  hypothetical protein H632_c2497p0                       128   2e-29    Helicosporidium sp. ATCC 50920
ref|WP_016932641.1|  acyl-CoA oxidase                                   131   2e-29    Rhodococcus
gb|EFA78532.1|  putative acyl-CoA oxidase                               131   2e-29    Heterostelium album PN500
ref|WP_010592066.1|  acyl-CoA oxidase                                   131   2e-29    Rhodococcus
ref|XP_009441363.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    128   2e-29    
ref|XP_001639738.1|  predicted protein                                  130   2e-29    Nematostella vectensis
ref|WP_010639493.1|  acyl-CoA oxidase                                   131   2e-29    
ref|XP_001732973.1|  acyl-CoA oxidase                                   130   2e-29    Dictyostelium discoideum AX4
ref|WP_027020615.1|  acyl-CoA oxidase                                   130   3e-29    Corynebacterium sputi
ref|WP_018471012.1|  acyl-CoA oxidase                                   130   3e-29    Streptomyces
ref|WP_017614281.1|  acyl-CoA oxidase                                   130   4e-29    Nocardiopsis salina
ref|XP_002953234.1|  hypothetical protein VOLCADRAFT_93964              130   4e-29    Volvox carteri f. nagariensis
ref|XP_004350494.1|  hypothetical protein DFA_11547                     132   4e-29    Cavenderia fasciculata
ref|WP_035694733.1|  acyl-CoA oxidase                                   130   4e-29    Flavobacterium soli
ref|WP_030112305.1|  acyl-CoA oxidase                                   126   5e-29    
ref|WP_011753930.1|  acyl-CoA oxidase                                   130   5e-29    Nocardioides
ref|WP_040338148.1|  acyl-CoA oxidase                                   130   5e-29    
ref|WP_042377454.1|  acyl-CoA oxidase                                   130   5e-29    Gordonia alkanivorans
ref|XP_005718655.1|  acyl-CoA oxidase                                   130   5e-29    Chondrus crispus [carageen]
ref|WP_035104505.1|  acyl-CoA oxidase                                   130   5e-29    Corynebacterium camporealensis
ref|WP_026810093.1|  acyl-CoA oxidase                                   130   5e-29    Arenibacter latericius
ref|WP_043644508.1|  hypothetical protein                               130   6e-29    
ref|XP_003926782.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    129   6e-29    Saimiri boliviensis boliviensis
ref|WP_006797234.1|  acyl-CoA oxidase                                   130   6e-29    Flavobacteria bacterium BBFL7
ref|WP_042532221.1|  acyl-CoA oxidase                                   129   7e-29    Corynebacterium singulare
ref|WP_018102778.1|  MULTISPECIES: acyl-CoA oxidase                     129   8e-29    Streptomyces
ref|XP_006500336.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    129   8e-29    Mus musculus [mouse]
ref|WP_037233366.1|  acyl-CoA oxidase                                   129   8e-29    Rhodococcus wratislaviensis
ref|XP_505264.1|  YALI0F10857p                                          129   8e-29    Yarrowia lipolytica CLIB122
gb|AII09135.1|  acyl-CoA oxidase                                        129   8e-29    Rhodococcus opacus
ref|WP_010188978.1|  acyl-CoA oxidase                                   129   9e-29    Corynebacterium aurimucosum
ref|WP_009474726.1|  MULTISPECIES: acyl-CoA oxidase                     129   9e-29    Rhodococcus
ref|XP_010269210.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    129   9e-29    Nelumbo nucifera [Indian lotus]
ref|WP_005251993.1|  acyl-CoA oxidase                                   129   9e-29    Rhodococcus
ref|WP_034942646.1|  acyl-CoA oxidase                                   129   9e-29    Geodermatophilaceae bacterium URHB0062
ref|WP_028418867.1|  acyl-CoA oxidase                                   129   9e-29    Streptomyces sp. SolWspMP-sol2th
ref|XP_003287521.1|  hypothetical protein DICPUDRAFT_97730              129   9e-29    Dictyostelium purpureum
ref|WP_026453893.1|  acyl-CoA oxidase                                   129   9e-29    [Actinopolyspora] iraqiensis
ref|WP_018550940.1|  acyl-CoA oxidase                                   129   1e-28    Streptomyces sp. ATexAB-D23
ref|WP_030332097.1|  acyl-CoA oxidase                                   129   1e-28    Streptomyces sp. NRRL B-1381
ref|XP_003799352.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    129   1e-28    
gb|EAW50357.1|  acyl-Coenzyme A oxidase-like, isoform CRA_a             124   1e-28    Homo sapiens [man]
ref|WP_014374170.1|  acyl-CoA oxidase                                   129   1e-28    
ref|XP_005630480.1|  PREDICTED: acyl-CoA oxidase-like isoform X5        127   2e-28    
ref|WP_039676522.1|  acyl-CoA oxidase                                   128   2e-28    Corynebacterium
dbj|GAM20274.1|  hypothetical protein SAMD00019534_034490               128   2e-28    Acytostelium subglobosum LB1
ref|WP_005258360.1|  acyl-CoA oxidase                                   128   2e-28    Rhodococcus opacus
ref|XP_012029283.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    127   2e-28    
ref|WP_019809905.1|  acyl-CoA oxidase                                   128   2e-28    Saccharomonospora halophila
ref|XP_012029284.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    127   2e-28    
ref|XP_012029282.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    127   2e-28    
ref|WP_005566484.1|  MULTISPECIES: acyl-CoA oxidase                     128   2e-28    Rhodococcus
ref|XP_004361564.1|  putative acyl-CoA oxidase                          128   2e-28    Cavenderia fasciculata
ref|XP_011509737.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    123   2e-28    
ref|WP_036151893.1|  acyl-CoA oxidase                                   128   2e-28    Maribacter forsetii
gb|AJD87363.1|  hypothetical protein 3                                  128   2e-28    Blastobotrys adeninivorans
ref|XP_004399937.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-coenzym...    127   2e-28    
ref|WP_007023318.1|  acyl-CoA oxidase                                   127   2e-28    Saccharomonospora paurometabolica
ref|XP_639137.1|  acyl-CoA oxidase                                      128   3e-28    Dictyostelium discoideum AX4
ref|XP_012029285.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    127   3e-28    
ref|XP_007892130.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    127   3e-28    Callorhinchus milii [Australian ghost shark]
ref|XP_005630478.1|  PREDICTED: acyl-CoA oxidase-like isoform X3        127   3e-28    
ref|XP_012029281.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    127   3e-28    
ref|XP_005630477.1|  PREDICTED: acyl-CoA oxidase-like isoform X2        127   3e-28    
ref|WP_037831419.1|  acyl-CoA oxidase                                   127   3e-28    Streptomyces sp. NRRL S-325
ref|XP_005630479.1|  PREDICTED: acyl-CoA oxidase-like isoform X4        127   3e-28    Canis lupus familiaris [dogs]
ref|WP_006865285.1|  acyl-CoA oxidase                                   127   3e-28    Gordonia namibiensis
ref|XP_012029278.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    127   3e-28    
ref|WP_026238320.1|  acyl-CoA oxidase                                   127   3e-28    Streptomyces sp. CcalMP-8W
ref|WP_027862959.1|  acyl-CoA oxidase                                   127   3e-28    
gb|ERE69860.1|  acyl-coenzyme A oxidase-like protein                    120   4e-28    Cricetulus griseus [Chinese hamsters]
ref|WP_030768335.1|  acyl-CoA oxidase                                   127   4e-28    Streptomyces griseus
ref|WP_015576152.1|  acyl-coenzyme A oxidase 1                          127   4e-28    
ref|WP_027391884.1|  acyl-CoA oxidase                                   128   4e-28    
ref|WP_012832911.1|  acyl-CoA oxidase                                   127   4e-28    
ref|XP_005630476.1|  PREDICTED: acyl-CoA oxidase-like isoform X1        127   4e-28    
ref|WP_012924042.1|  acyl-CoA oxidase                                   127   4e-28    
ref|WP_030125188.1|  MULTISPECIES: acyl-CoA oxidase                     127   4e-28    
ref|WP_036382477.1|  acyl-CoA oxidase                                   127   4e-28    
gb|KJB44225.1|  hypothetical protein B456_007G240800                    127   4e-28    
ref|WP_018163641.1|  hypothetical protein                               127   4e-28    
ref|XP_012029279.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    127   4e-28    
gb|KJB44226.1|  hypothetical protein B456_007G240800                    127   4e-28    
gb|EXX57885.1|  acyl-CoA oxidase                                        122   4e-28    
ref|XP_012029276.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    127   4e-28    
ref|XP_008234652.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    127   5e-28    
ref|XP_010983071.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    126   5e-28    
ref|XP_009183206.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    124   5e-28    
gb|AGT91460.1|  acyl-CoA oxidase                                        127   5e-28    
ref|WP_032755520.1|  acyl-CoA oxidase                                   127   5e-28    
ref|WP_037129939.1|  acyl-CoA oxidase                                   127   5e-28    
ref|WP_024487810.1|  MULTISPECIES: acyl-CoA oxidase                     127   5e-28    
ref|WP_020534466.1|  hypothetical protein                               127   5e-28    
ref|WP_041815718.1|  acyl-CoA oxidase                                   127   5e-28    
gb|EME15692.1|  acyl-CoA oxidase                                        127   5e-28    
gb|KJB44224.1|  hypothetical protein B456_007G240800                    127   5e-28    
dbj|BAH32371.1|  putative acyl-CoA oxidase                              127   5e-28    
gb|EAR25828.1|  acyl-CoA oxidase                                        127   5e-28    
gb|EEN88202.1|  acyl-CoA dehydrogenase, middle domain protein           127   5e-28    
ref|WP_017581593.1|  acyl-CoA oxidase                                   127   5e-28    
ref|XP_006183680.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    126   5e-28    
ref|XP_002886952.1|  hypothetical protein ARALYDRAFT_894142             117   5e-28    
ref|XP_011232878.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    123   6e-28    
ref|WP_015607106.1|  Acyl-CoA oxidase domain-containing protein         127   6e-28    
ref|XP_008053271.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    127   6e-28    
ref|WP_017576371.1|  acyl-CoA oxidase                                   127   6e-28    
ref|WP_030292936.1|  MULTISPECIES: acyl-CoA oxidase                     127   6e-28    
ref|WP_043247513.1|  acyl-CoA oxidase                                   126   6e-28    
ref|WP_030736574.1|  acyl-CoA oxidase                                   126   6e-28    
ref|WP_026245499.1|  acyl-CoA oxidase                                   126   6e-28    
ref|WP_041825462.1|  acyl-CoA oxidase                                   126   6e-28    
ref|WP_031053630.1|  acyl-CoA oxidase                                   126   6e-28    
ref|WP_026242212.1|  acyl-CoA oxidase                                   126   6e-28    
ref|XP_007208434.1|  hypothetical protein PRUPE_ppa002282mg             127   6e-28    
gb|AFQ93694.1|  acyl-CoA oxidase 2                                      127   7e-28    
ref|WP_030580799.1|  acyl-CoA oxidase                                   126   7e-28    
ref|WP_035751757.1|  acyl-CoA oxidase                                   127   7e-28    
ref|WP_030194549.1|  MULTISPECIES: acyl-CoA oxidase                     126   7e-28    
ref|XP_008803753.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    127   7e-28    
ref|WP_030276558.1|  MULTISPECIES: acyl-CoA oxidase                     126   7e-28    
ref|XP_010916902.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    126   7e-28    
ref|XP_006156694.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    126   8e-28    
ref|WP_006122746.1|  MULTISPECIES: acyl-CoA oxidase                     126   8e-28    
ref|WP_002612916.1|  acyl-CoA dehydrogenase                             127   8e-28    
ref|WP_042270257.1|  acyl-CoA oxidase                                   127   8e-28    
ref|WP_013125356.1|  acyl-CoA oxidase                                   126   8e-28    
ref|WP_042246211.1|  acyl-CoA oxidase                                   127   8e-28    
ref|WP_036581400.1|  acyl-CoA oxidase                                   127   9e-28    
ref|WP_030762017.1|  acyl-CoA oxidase                                   126   9e-28    
ref|WP_010204053.1|  acyl-CoA dehydrogenase                             126   9e-28    
gb|ADW07059.1|  acyl-CoA dehydrogenase domain-containing protein        126   9e-28    
ref|WP_030220322.1|  acyl-CoA oxidase                                   126   9e-28    
ref|XP_004813510.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    125   1e-27    
ref|XP_010957303.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    125   1e-27    
ref|XP_001691953.1|  hypothetical protein CHLREDRAFT_170822             123   1e-27    
ref|WP_037494263.1|  acyl-CoA oxidase                                   125   1e-27    
ref|XP_011509735.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    123   1e-27    
ref|XP_006193629.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    126   1e-27    
ref|WP_040800504.1|  acyl-CoA dehydrogenase                             126   1e-27    
ref|WP_044101585.1|  acyl-CoA oxidase                                   126   1e-27    
ref|WP_029430245.1|  acyl-CoA oxidase                                   126   1e-27    
ref|WP_036194533.1|  acyl-CoA oxidase                                   125   1e-27    
ref|XP_006047075.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    126   1e-27    
ref|XP_001487268.1|  hypothetical protein PGUG_00645                    126   1e-27    
gb|EDK36547.2|  hypothetical protein PGUG_00645                         126   1e-27    
ref|WP_030081577.1|  acyl-CoA oxidase                                   125   1e-27    
ref|WP_031937608.1|  acyl-CoA oxidase                                   125   1e-27    
ref|WP_027078216.1|  acyl-CoA oxidase                                   126   1e-27    
ref|XP_008961118.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    125   1e-27    
ref|WP_031121894.1|  acyl-CoA oxidase                                   125   1e-27    
ref|WP_030317285.1|  acyl-CoA oxidase                                   125   1e-27    
ref|XP_008698361.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    125   1e-27    
ref|XP_011509733.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    124   1e-27    
ref|XP_011509732.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    124   1e-27    
ref|WP_029182498.1|  acyl-CoA oxidase                                   125   1e-27    
ref|WP_042295862.1|  acyl-CoA oxidase                                   126   1e-27    
ref|XP_011509731.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    124   1e-27    
ref|WP_030629375.1|  acyl-CoA oxidase                                   125   1e-27    
ref|WP_029121178.1|  acyl-CoA oxidase                                   125   1e-27    
ref|WP_035896540.1|  acyl-CoA dehydrogenase                             120   1e-27    
ref|XP_011509730.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    124   1e-27    
ref|WP_007619749.1|  putative acyl-CoA oxidase                          125   1e-27    
ref|WP_040719084.1|  acyl-CoA oxidase                                   125   2e-27    
ref|XP_004771031.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    125   2e-27    
ref|XP_004771032.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    125   2e-27    
ref|XP_005647184.1|  acyl-CoA oxidase                                   125   2e-27    
ref|XP_004771033.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    125   2e-27    
ref|WP_008354960.1|  acyl-CoA oxidase                                   125   2e-27    
ref|XP_011509716.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    124   2e-27    
ref|WP_035305307.1|  acyl-CoA oxidase                                   125   2e-27    
ref|WP_036336177.1|  acyl-CoA oxidase                                   125   2e-27    
ref|WP_007317217.1|  acyl-CoA oxidase                                   125   2e-27    
ref|WP_026812503.1|  acyl-CoA oxidase                                   125   2e-27    
gb|ERJ18395.1|  acyl-CoA oxidase protein                                125   2e-27    
ref|XP_011509721.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    124   2e-27    
ref|WP_040608171.1|  hypothetical protein                               125   2e-27    
ref|WP_034952575.1|  acyl-CoA oxidase                                   125   2e-27    
gb|ESW97032.1|  Acyl-coenzyme A oxidase                                 125   2e-27    
ref|WP_038237921.1|  acyl-CoA oxidase                                   125   2e-27    
ref|XP_011509728.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    123   2e-27    
ref|WP_005531336.1|  acyl-CoA oxidase                                   125   2e-27    
ref|XP_011509727.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    123   2e-27    
ref|WP_041801916.1|  acyl-CoA oxidase                                   125   2e-27    
gb|AEM70899.1|  Acyl-CoA oxidase                                        125   2e-27    
ref|WP_036565630.1|  acyl-CoA oxidase                                   125   3e-27    
ref|XP_011509729.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    123   3e-27    
ref|XP_009390291.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    125   3e-27    
ref|NP_001136279.1|  acyl-coenzyme A oxidase-like protein               124   3e-27    
ref|XP_011509713.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    124   3e-27    
ref|WP_026126958.1|  acyl-CoA oxidase                                   124   3e-27    
ref|WP_024874955.1|  acyl-CoA oxidase                                   124   3e-27    
ref|XP_011509722.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    123   3e-27    
ref|XP_011509720.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    123   3e-27    
ref|XP_011509718.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    123   3e-27    
ref|WP_031456312.1|  acyl-CoA oxidase                                   125   3e-27    
ref|XP_004360048.1|  acyl-CoA oxidase                                   126   3e-27    
ref|WP_030570486.1|  acyl-CoA oxidase                                   124   3e-27    
ref|XP_011509719.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    123   3e-27    
ref|WP_017588837.1|  acyl-CoA oxidase                                   124   3e-27    
ref|WP_033300853.1|  acyl-CoA oxidase                                   124   3e-27    
ref|WP_012688927.1|  acyl-CoA oxidase                                   124   3e-27    
ref|WP_018524646.1|  MULTISPECIES: acyl-CoA oxidase                     124   3e-27    
ref|WP_009183890.1|  acyl-CoA oxidase                                   125   3e-27    
ref|XP_011509706.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    124   3e-27    
ref|WP_029104814.1|  acyl-CoA oxidase                                   124   3e-27    
ref|XP_011509717.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    123   4e-27    
ref|WP_022827387.1|  acyl-CoA oxidase                                   125   4e-27    
ref|XP_011509712.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    124   4e-27    
ref|XP_011509715.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    123   4e-27    
ref|WP_029254848.1|  acyl-CoA oxidase                                   124   4e-27    
ref|XP_011509714.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    123   4e-27    
ref|NP_001099978.1|  acyl-coenzyme A oxidase-like protein               124   4e-27    
ref|WP_028075354.1|  acyl-CoA oxidase                                   124   4e-27    
gb|EFA74856.1|  acyl-CoA oxidase                                        124   4e-27    
ref|XP_011509711.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    123   4e-27    
ref|WP_043391714.1|  MULTISPECIES: acyl-CoA oxidase                     124   4e-27    
ref|WP_019598670.1|  hypothetical protein                               124   4e-27    
ref|WP_032779937.1|  acyl-CoA oxidase                                   124   4e-27    
ref|WP_027064968.1|  acyl-CoA oxidase                                   124   4e-27    
ref|WP_005518129.1|  acyl-CoA oxidase                                   124   4e-27    
ref|WP_013416987.1|  acyl-CoA oxidase                                   124   4e-27    
ref|XP_008453798.1|  PREDICTED: acyl-coenzyme A oxidase, peroxisomal    124   4e-27    
ref|XP_003277757.2|  PREDICTED: acyl-coenzyme A oxidase-like protein    124   5e-27    
ref|WP_022597503.1|  acyl-CoA oxidase                                   124   5e-27    
ref|XP_002619537.1|  hypothetical protein CLUG_00696                    124   5e-27    
ref|WP_030591343.1|  acyl-CoA oxidase                                   124   5e-27    
gb|EPZ31508.1|  Acyl-CoA dehydrogenase/oxidase domain-containing ...    123   5e-27    
ref|WP_029720473.1|  acyl-CoA oxidase                                   124   5e-27    
ref|WP_025744009.1|  acyl-CoA oxidase                                   124   5e-27    
ref|XP_004031653.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    124   6e-27    
gb|EMP11646.1|  acyl-CoA dehydrogenase, middle domain protein           123   6e-27    
ref|WP_024795146.1|  acyl-CoA oxidase                                   124   6e-27    
gb|ELW51453.1|  Acyl-coenzyme A oxidase-like protein                    123   6e-27    
gb|EFA77956.1|  acyl-CoA oxidase                                        123   7e-27    
ref|WP_030531740.1|  acyl-CoA oxidase                                   123   7e-27    
ref|WP_032769032.1|  acyl-CoA oxidase                                   123   7e-27    
ref|XP_004590893.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-coenzym...    124   7e-27    
ref|WP_039500185.1|  acyl-CoA oxidase                                   123   7e-27    
ref|WP_036550021.1|  acyl-CoA oxidase                                   123   7e-27    
ref|WP_026716117.1|  acyl-CoA oxidase                                   124   7e-27    
ref|XP_002991925.1|  hypothetical protein SELMODRAFT_134372             124   7e-27    
ref|WP_036491874.1|  acyl-CoA oxidase                                   123   8e-27    
gb|ESA00876.1|  hypothetical protein GLOINDRAFT_265185                  123   8e-27    
ref|XP_010808073.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    123   8e-27    
ref|WP_014044514.1|  MULTISPECIES: acyl-CoA oxidase                     123   8e-27    
ref|WP_028655548.1|  acyl-CoA oxidase                                   123   8e-27    
ref|XP_005599890.1|  PREDICTED: acyl-CoA oxidase-like                   123   8e-27    
emb|CDP01433.1|  unnamed protein product                                123   9e-27    
ref|WP_029144974.1|  acyl-CoA dehydrogenase                             123   9e-27    
ref|XP_010808071.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    123   9e-27    
ref|XP_002691204.4|  PREDICTED: acyl-coenzyme A oxidase-like prot...    123   9e-27    
dbj|GAK89314.1|  acyl-coenzyme A oxidase 1                              120   9e-27    
gb|EON25586.1|  acyl-CoA oxidase domain-containing protein              123   9e-27    
ref|XP_010808070.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    123   1e-26    
ref|WP_026992283.1|  acyl-CoA oxidase                                   123   1e-26    
ref|WP_045384104.1|  acyl-CoA oxidase                                   123   1e-26    
ref|WP_012946546.1|  acyl-CoA oxidase                                   123   1e-26    
ref|XP_001786103.1|  predicted protein                                  123   1e-26    
ref|XP_004354454.1|  acyl-CoA oxidase                                   121   1e-26    
ref|WP_006358547.1|  acyl-CoA oxidase                                   123   1e-26    
ref|XP_002979998.1|  hypothetical protein SELMODRAFT_178082             123   1e-26    
ref|XP_006817063.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-coenzym...    123   1e-26    
ref|WP_026707256.1|  acyl-CoA oxidase                                   123   1e-26    
emb|CDY14540.1|  BnaC03g49190D                                          123   1e-26    
ref|XP_009150593.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    123   1e-26    
ref|XP_002269650.2|  PREDICTED: acyl-coenzyme A oxidase, peroxisomal    123   1e-26    
gb|EYU24007.1|  hypothetical protein MIMGU_mgv1a002222mg                123   1e-26    
ref|XP_502199.1|  YALI0C23859p                                          123   1e-26    
ref|WP_013154234.1|  acyl-CoA oxidase                                   122   1e-26    
ref|XP_010025485.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    123   1e-26    
ref|WP_037340849.1|  acyl-CoA oxidase                                   122   1e-26    
ref|WP_006372698.1|  acyl-CoA oxidase                                   123   1e-26    
emb|CDY08820.1|  BnaA06g24040D                                          123   1e-26    
ref|XP_011097594.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    123   1e-26    
ref|WP_022882124.1|  acyl-CoA dehydrogenase                             123   1e-26    
ref|XP_004146872.1|  PREDICTED: acyl-coenzyme A oxidase, peroxisomal    122   1e-26    
ref|WP_005194221.1|  acyl-CoA oxidase                                   122   1e-26    
ref|WP_038508394.1|  acyl-CoA oxidase                                   122   1e-26    
dbj|GAK93202.1|  acyl-coenzyme A oxidase 1                              120   1e-26    
ref|WP_026978660.1|  acyl-CoA oxidase                                   122   2e-26    
ref|WP_034248225.1|  acyl-CoA oxidase                                   122   2e-26    
ref|WP_008378043.1|  putative acyl-CoA oxidase                          122   2e-26    
ref|XP_001754596.1|  predicted protein                                  122   2e-26    
ref|XP_006394077.1|  hypothetical protein EUTSA_v10003747mg             122   2e-26    
ref|XP_002618997.1|  hypothetical protein CLUG_00156                    122   2e-26    
ref|WP_031088727.1|  acyl-CoA oxidase                                   122   2e-26    
ref|XP_504475.1|  YALI0E27654p                                          122   2e-26    
ref|WP_008611975.1|  acyl-CoA oxidase                                   122   2e-26    
ref|XP_002866650.1|  acyl-CoA oxidase                                   122   2e-26    
ref|WP_040459667.1|  acyl-CoA oxidase                                   122   2e-26    
ref|XP_002548077.1|  acyl-coenzyme A oxidase 2                          122   2e-26    
gb|EKF56589.1|  acyl-CoA oxidase                                        122   2e-26    
ref|WP_013453510.1|  acyl-CoA oxidase                                   122   2e-26    



>ref|XP_009621605.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X2 
[Nicotiana tomentosiformis]
Length=686

 Score =   450 bits (1157),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 211/261 (81%), Positives = 230/261 (88%), Gaps = 1/261 (0%)
 Frame = +1

Query  583   SLSSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKL  762
             S SSMEK NFRT +L+RHL QENP  +  IL QS PC+ Y PPE SEP++ FD  EMRKL
Sbjct  7     SSSSMEKVNFRTKILSRHLNQENPTSNYSIL-QSFPCLSYNPPEFSEPSSIFDTKEMRKL  65

Query  763   MDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGV  942
             MDGHNL+ERDWL+GLM+QS LFNP+ RGGKV+V PD+NQS EQQREITMRRI YL   GV
Sbjct  66    MDGHNLQERDWLFGLMLQSNLFNPKIRGGKVFVQPDYNQSKEQQREITMRRIGYLLQNGV  125

Query  943   FRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRD  1122
             F  WLT KGPE ELRKLALLDV  IFDHSL+IK+GVHFFLWGGAI+FFGT+RHHDKWLRD
Sbjct  126   FESWLTGKGPEDELRKLALLDVVGIFDHSLAIKIGVHFFLWGGAIKFFGTQRHHDKWLRD  185

Query  1123  SENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATH  1302
             +ENY+VKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKY IGGAANHATH
Sbjct  186   TENYVVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYWIGGAANHATH  245

Query  1303  TVVFSQLNIDGKNQGVHAFIA  1365
             TVVFSQL+IDGKNQGVHAFIA
Sbjct  246   TVVFSQLHIDGKNQGVHAFIA  266


 Score =   184 bits (466),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 112/159 (70%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            ME+ +FRT +L+RHL  +   +         S PC+SY P E SEP++ FD  EMRKLMD
Sbjct  11   MEKVNFRTKILSRHLNQENPTSNYSILQ---SFPCLSYNPPEFSEPSSIFDTKEMRKLMD  67

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHNLQERDWL+G+M+QS +FNP+  GG+V V  DYNQ+ EQQRE+TMRRI YL   GVF 
Sbjct  68   GHNLQERDWLFGLMLQSNLFNPKIRGGKVFVQPDYNQSKEQQREITMRRIGYLLQNGVFE  127

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
             WLT     E ELRK+AL +V+ IFD SLAIKIGV  FL
Sbjct  128  SWLT-GKGPEDELRKLALLDVVGIFDHSLAIKIGVHFFL  165



>ref|XP_009783429.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X2 
[Nicotiana sylvestris]
Length=686

 Score =   449 bits (1156),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 209/259 (81%), Positives = 230/259 (89%), Gaps = 1/259 (0%)
 Frame = +1

Query  589   SSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMD  768
             SSMEK NFRT +L+RHL QENP  ++ IL QS PC+ Y PPE SEP++ FD+ EMRKLMD
Sbjct  9     SSMEKVNFRTKILSRHLNQENPTSNNSIL-QSFPCLSYNPPEFSEPSSVFDIKEMRKLMD  67

Query  769   GHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFR  948
             GHNL+ERDWL+GLM+QS LFNP+ RGGKV+V PD+NQS EQQREITMRRI YL   GVF 
Sbjct  68    GHNLQERDWLFGLMLQSNLFNPKIRGGKVFVQPDYNQSKEQQREITMRRIGYLMQNGVFE  127

Query  949   GWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSE  1128
              WLT KGPE ELRKLALLDV  IFDHSL+IK+GVHFFLWGGAI+FFGT+RHHDKWLRD+E
Sbjct  128   RWLTGKGPEDELRKLALLDVVGIFDHSLAIKIGVHFFLWGGAIKFFGTQRHHDKWLRDTE  187

Query  1129  NYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTV  1308
             NY+VKGCFAMTELGHGSNVRGIETVTTYDSST EFVINTPCESAQKY IGGAANHATHTV
Sbjct  188   NYVVKGCFAMTELGHGSNVRGIETVTTYDSSTREFVINTPCESAQKYWIGGAANHATHTV  247

Query  1309  VFSQLNIDGKNQGVHAFIA  1365
             VFSQL+IDGKNQGVHAFIA
Sbjct  248   VFSQLHIDGKNQGVHAFIA  266


 Score =   184 bits (468),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 114/159 (72%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            ME+ +FRT +L+RHL  +   + +       S PC+SY P E SEP++ FD+ EMRKLMD
Sbjct  11   MEKVNFRTKILSRHLNQENPTSNNSILQ---SFPCLSYNPPEFSEPSSVFDIKEMRKLMD  67

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHNLQERDWL+G+M+QS +FNP+  GG+V V  DYNQ+ EQQRE+TMRRI YL   GVF 
Sbjct  68   GHNLQERDWLFGLMLQSNLFNPKIRGGKVFVQPDYNQSKEQQREITMRRIGYLMQNGVFE  127

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
             WLT     E ELRK+AL +V+ IFD SLAIKIGV  FL
Sbjct  128  RWLT-GKGPEDELRKLALLDVVGIFDHSLAIKIGVHFFL  165



>emb|CDP15892.1| unnamed protein product [Coffea canephora]
Length=675

 Score =   434 bits (1117),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 198/257 (77%), Positives = 228/257 (89%), Gaps = 2/257 (1%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             MEK NFRT VL+RHL   +P   D   LQSSPC+ YTPPELSEP + FDV  MRKLMDGH
Sbjct  1     MEKINFRTKVLSRHL-NHDP-TGDKPFLQSSPCLSYTPPELSEPNSFFDVKLMRKLMDGH  58

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             N+E+RDWLY L++QS+LFNP+ +GGK++V PD+NQSMEQQRE+TM+RI YL D GVF+GW
Sbjct  59    NIEDRDWLYNLIVQSKLFNPQEKGGKIFVLPDYNQSMEQQREMTMKRIEYLLDNGVFQGW  118

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LT KGPEAELRK A LDV  IFDHSL+IK+GVHFFLWGGAIQFFGTKRHHDKWL+D+E+Y
Sbjct  119   LTRKGPEAELRKFAFLDVVGIFDHSLAIKIGVHFFLWGGAIQFFGTKRHHDKWLKDTEDY  178

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
             +VKGCF+MTELGHGSNVRGIET+TTYDS+T EF+INTPCESAQKY IGGAANHATHT+VF
Sbjct  179   VVKGCFSMTELGHGSNVRGIETITTYDSNTREFIINTPCESAQKYWIGGAANHATHTIVF  238

Query  1315  SQLNIDGKNQGVHAFIA  1365
             SQLNI+G+NQGVHAFIA
Sbjct  239   SQLNINGRNQGVHAFIA  255


 Score =   192 bits (488),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 117/159 (74%), Gaps = 5/159 (3%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            ME+ +FRT VL+RHL +    +         SSPC+SYTP E SEP + FDV  MRKLMD
Sbjct  1    MEKINFRTKVLSRHLNHDPTGDKPFLQ----SSPCLSYTPPELSEPNSFFDVKLMRKLMD  56

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHN+++RDWLY +++QSK+FNP+  GG++ V  DYNQ+MEQQREMTM+RIEYL D GVF+
Sbjct  57   GHNIEDRDWLYNLIVQSKLFNPQEKGGKIFVLPDYNQSMEQQREMTMKRIEYLLDNGVFQ  116

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT     EAELRK A  +V+ IFD SLAIKIGV  FL
Sbjct  117  GWLTRKG-PEAELRKFAFLDVVGIFDHSLAIKIGVHFFL  154



>ref|XP_006364108.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X1 [Solanum tuberosum]
Length=685

 Score =   434 bits (1116),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 203/267 (76%), Positives = 232/267 (87%), Gaps = 4/267 (1%)
 Frame = +1

Query  571   LESSSL--SSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDV  744
             +E S+L  SSMEK NFRT VL+RHL QE P ++  ++LQS PC+ Y PPELSEPAA FD+
Sbjct  1     MEKSNLLCSSMEKVNFRTKVLSRHLKQETPTLN--VILQSFPCLSYNPPELSEPAAVFDI  58

Query  745   AEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAY  924
              EMRKLMDGHNLEERDW +GL++QS+LFNP  RGGKV++ PD++QS EQQREITMRRI Y
Sbjct  59    KEMRKLMDGHNLEERDWFFGLILQSKLFNPVKRGGKVFLSPDYSQSKEQQREITMRRIEY  118

Query  925   LSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHH  1104
             L + G  + WLT KGPE ELRKL+LLD   IFDHSLS+K+GVHF LWGGAIQFFGTKRHH
Sbjct  119   LVEHGFSKNWLTVKGPEDELRKLSLLDCLFIFDHSLSVKMGVHFLLWGGAIQFFGTKRHH  178

Query  1105  DKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGA  1284
             DKWL+D+E+Y+VKGCF+MTELGHGSNVR IETVTTYDSSTGEFVINTPCESAQKY IGGA
Sbjct  179   DKWLKDTEDYVVKGCFSMTELGHGSNVRSIETVTTYDSSTGEFVINTPCESAQKYWIGGA  238

Query  1285  ANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             ANHATHT+VFSQL IDG+NQGVHAFIA
Sbjct  239   ANHATHTIVFSQLIIDGENQGVHAFIA  265


 Score =   171 bits (432),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 110/159 (69%), Gaps = 5/159 (3%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            ME+ +FRT VL+RHL  +             S PC+SY P E SEPAA FD+ EMRKLMD
Sbjct  11   MEKVNFRTKVLSRHLKQETPTLNVILQ----SFPCLSYNPPELSEPAAVFDIKEMRKLMD  66

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHNL+ERDW +G+++QSK+FNP   GG+V +  DY+Q+ EQQRE+TMRRIEYL + G  +
Sbjct  67   GHNLEERDWFFGLILQSKLFNPVKRGGKVFLSPDYSQSKEQQREITMRRIEYLVEHGFSK  126

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
             WLT     E ELRK++L + + IFD SL++K+GV   L
Sbjct  127  NWLTVKG-PEDELRKLSLLDCLFIFDHSLSVKMGVHFLL  164



>ref|XP_009621612.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X3 
[Nicotiana tomentosiformis]
Length=676

 Score =   434 bits (1116),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 202/257 (79%), Positives = 222/257 (86%), Gaps = 1/257 (0%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             MEK NFRT VL++HLIQENP   +  L QS PC+ Y PPE SEP + FD+ EMRKL+DGH
Sbjct  1     MEKVNFRTKVLSKHLIQENPTPINSTL-QSFPCLSYNPPEFSEPYSVFDIKEMRKLLDGH  59

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             NL+E DWL+GLM+QS LFN   RGGKV+V PD+NQS EQQREITMRRI YL   GVF+GW
Sbjct  60    NLQEMDWLFGLMLQSNLFNTNVRGGKVFVLPDYNQSKEQQREITMRRIGYLLQNGVFKGW  119

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LT KGPE ELRK   +DV  IFDHSL IK+GVHFFLWGGAI+FFGT+RHHDKWLRD+ENY
Sbjct  120   LTGKGPEDELRKFDFVDVIGIFDHSLKIKIGVHFFLWGGAIKFFGTQRHHDKWLRDTENY  179

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
             +VKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKY IGGAANHATHTVVF
Sbjct  180   VVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYWIGGAANHATHTVVF  239

Query  1315  SQLNIDGKNQGVHAFIA  1365
             SQL+IDGKNQGVHAFIA
Sbjct  240   SQLHIDGKNQGVHAFIA  256


 Score =   172 bits (435),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 109/159 (69%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            ME+ +FRT VL++HL+ +    ++       S PC+SY P E SEP + FD+ EMRKL+D
Sbjct  1    MEKVNFRTKVLSKHLIQENPTPINSTLQ---SFPCLSYNPPEFSEPYSVFDIKEMRKLLD  57

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHNLQE DWL+G+M+QS +FN    GG+V V  DYNQ+ EQQRE+TMRRI YL   GVF+
Sbjct  58   GHNLQEMDWLFGLMLQSNLFNTNVRGGKVFVLPDYNQSKEQQREITMRRIGYLLQNGVFK  117

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT     E ELRK    +VI IFD SL IKIGV  FL
Sbjct  118  GWLT-GKGPEDELRKFDFVDVIGIFDHSLKIKIGVHFFL  155



>ref|XP_006364109.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X2 [Solanum tuberosum]
Length=683

 Score =   433 bits (1113),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 201/265 (76%), Positives = 227/265 (86%), Gaps = 2/265 (1%)
 Frame = +1

Query  571   LESSSLSSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAE  750
             ++ S  SSMEK NFRT ++ RHL QE P    ++LLQS PC+ Y PPELSEP+A FD  E
Sbjct  1     MQKSHFSSMEKVNFRTKIICRHLNQETP--SPNLLLQSIPCLSYNPPELSEPSAIFDTKE  58

Query  751   MRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLS  930
             MRKLMDGHN  E+DWL+GLM+QS LFNP  RGGKV+V PD+NQS EQQREITM+RI YL 
Sbjct  59    MRKLMDGHNFVEKDWLFGLMLQSNLFNPIERGGKVFVSPDYNQSKEQQREITMKRIGYLL  118

Query  931   DCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDK  1110
             + GVF+ WLT KGPE ELRKL LLD   I+DHSL+IK+GVHFFLWGGAIQFFGTKRHHDK
Sbjct  119   EHGVFKKWLTGKGPEDELRKLGLLDCLCIYDHSLAIKVGVHFFLWGGAIQFFGTKRHHDK  178

Query  1111  WLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAAN  1290
             WL+D+E+Y+VKGCF+MTELGHGSNVR IETVTTYDSSTGEFVINTPCESAQKY IGGAAN
Sbjct  179   WLKDTEDYVVKGCFSMTELGHGSNVRSIETVTTYDSSTGEFVINTPCESAQKYWIGGAAN  238

Query  1291  HATHTVVFSQLNIDGKNQGVHAFIA  1365
             HATHT+VFSQL IDG+NQGVHAFIA
Sbjct  239   HATHTIVFSQLIIDGENQGVHAFIA  263


 Score =   171 bits (433),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 107/159 (67%), Gaps = 5/159 (3%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            ME+ +FRT ++ RHL  +             S PC+SY P E SEP+A FD  EMRKLMD
Sbjct  9    MEKVNFRTKIICRHLNQETPSPNLLLQ----SIPCLSYNPPELSEPSAIFDTKEMRKLMD  64

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHN  E+DWL+G+M+QS +FNP   GG+V V  DYNQ+ EQQRE+TM+RI YL + GVF+
Sbjct  65   GHNFVEKDWLFGLMLQSNLFNPIERGGKVFVSPDYNQSKEQQREITMKRIGYLLEHGVFK  124

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
             WLT     E ELRK+ L + + I+D SLAIK+GV  FL
Sbjct  125  KWLT-GKGPEDELRKLGLLDCLCIYDHSLAIKVGVHFFL  162



>ref|XP_009621600.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X1 
[Nicotiana tomentosiformis]
Length=691

 Score =   433 bits (1113),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 201/257 (78%), Positives = 225/257 (88%), Gaps = 1/257 (0%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             MEK NFRT VL+RHL QENP   + IL QS PC+ Y PPE SEP++ FD+ EMRKL+D H
Sbjct  16    MEKVNFRTKVLSRHLNQENPTPINSIL-QSFPCLSYNPPEFSEPSSVFDIKEMRKLLDDH  74

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             NLE++DWL+GLM+QS LFN + RG KV+V PD+NQS EQQ EITMRRI YL + GVF+GW
Sbjct  75    NLEDKDWLFGLMLQSNLFNTKVRGDKVFVCPDYNQSKEQQSEITMRRIEYLLEHGVFKGW  134

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LT  GPE ELRKLA  DV +IFDHSLS+K+GVHFFLWGGAI+FFGT+RHHDKWLRD+ENY
Sbjct  135   LTGNGPEDELRKLAFTDVVSIFDHSLSVKIGVHFFLWGGAIKFFGTQRHHDKWLRDTENY  194

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
             +VKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKY IGGAANHATHTVVF
Sbjct  195   VVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYWIGGAANHATHTVVF  254

Query  1315  SQLNIDGKNQGVHAFIA  1365
             SQL+IDGKNQGVHAFIA
Sbjct  255   SQLHIDGKNQGVHAFIA  271


 Score =   174 bits (442),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 115/159 (72%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            ME+ +FRT VL+RHL  +    ++       S PC+SY P E SEP++ FD+ EMRKL+D
Sbjct  16   MEKVNFRTKVLSRHLNQENPTPINSILQ---SFPCLSYNPPEFSEPSSVFDIKEMRKLLD  72

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
             HNL+++DWL+G+M+QS +FN +  G +V V  DYNQ+ EQQ E+TMRRIEYL + GVF+
Sbjct  73   DHNLEDKDWLFGLMLQSNLFNTKVRGDKVFVCPDYNQSKEQQSEITMRRIEYLLEHGVFK  132

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT N   E ELRK+A  +V++IFD SL++KIGV  FL
Sbjct  133  GWLTGNG-PEDELRKLAFTDVVSIFDHSLSVKIGVHFFL  170



>ref|XP_009783428.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X1 
[Nicotiana sylvestris]
Length=691

 Score =   433 bits (1113),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 201/257 (78%), Positives = 226/257 (88%), Gaps = 1/257 (0%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             MEKANFRT VL+RHL QENP   + IL QS PC+ Y PPE S P++ FD  EMRKL+D H
Sbjct  16    MEKANFRTKVLSRHLNQENPTPINSIL-QSFPCLSYIPPEFSGPSSVFDTKEMRKLLDDH  74

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             NLE++DWL+GLM+++ LFNP+ RGGKV+V PD+NQS EQQREITMRRI YL + GVF+GW
Sbjct  75    NLEDKDWLFGLMLKNNLFNPKIRGGKVFVCPDYNQSKEQQREITMRRIEYLLEHGVFKGW  134

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LT  GPE ELRKLA  DV +IFDHSLS+K+GVHFFLWGGAI+FFGT+RHHDKWLRD+ENY
Sbjct  135   LTGNGPEDELRKLAFTDVVSIFDHSLSVKIGVHFFLWGGAIKFFGTQRHHDKWLRDTENY  194

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
             +VKGCFAMTELGHGSNVRGIETVTTYDSST EFVINTPCESAQKY IGGAANHATHTVVF
Sbjct  195   VVKGCFAMTELGHGSNVRGIETVTTYDSSTREFVINTPCESAQKYWIGGAANHATHTVVF  254

Query  1315  SQLNIDGKNQGVHAFIA  1365
             SQL+IDGKNQGVHAFIA
Sbjct  255   SQLHIDGKNQGVHAFIA  271


 Score =   178 bits (451),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 117/159 (74%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            ME+A+FRT VL+RHL  +    ++       S PC+SY P E S P++ FD  EMRKL+D
Sbjct  16   MEKANFRTKVLSRHLNQENPTPINSILQ---SFPCLSYIPPEFSGPSSVFDTKEMRKLLD  72

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
             HNL+++DWL+G+M+++ +FNP+  GG+V V  DYNQ+ EQQRE+TMRRIEYL + GVF+
Sbjct  73   DHNLEDKDWLFGLMLKNNLFNPKIRGGKVFVCPDYNQSKEQQREITMRRIEYLLEHGVFK  132

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT N   E ELRK+A  +V++IFD SL++KIGV  FL
Sbjct  133  GWLTGNG-PEDELRKLAFTDVVSIFDHSLSVKIGVHFFL  170



>ref|XP_004248184.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X1 [Solanum lycopersicum]
Length=686

 Score =   431 bits (1109),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 202/267 (76%), Positives = 232/267 (87%), Gaps = 4/267 (1%)
 Frame = +1

Query  571   LESSSL--SSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDV  744
             +E S+L  SSMEK NFRT VL+RHL QE P ++  ++LQS PC+ Y PPELSE AA FD+
Sbjct  2     MEKSNLLCSSMEKVNFRTKVLSRHLKQETPTLN--VILQSLPCLSYNPPELSETAAVFDI  59

Query  745   AEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAY  924
              EMRKLMDGHNLEERDW +GL++QS+LFNP  RGGKV++ PD++QS EQQRE+TMRRI Y
Sbjct  60    KEMRKLMDGHNLEERDWFFGLILQSKLFNPVRRGGKVFLSPDYSQSKEQQREMTMRRIEY  119

Query  925   LSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHH  1104
             L + G  + WLT KGPE ELRKLALLD   I+DHSLSIK+GVHF LWGGAIQFFGTKRHH
Sbjct  120   LVEHGFSKDWLTVKGPEDELRKLALLDCIFIYDHSLSIKMGVHFLLWGGAIQFFGTKRHH  179

Query  1105  DKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGA  1284
             DKWL+D+E+Y++KGCF+MTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKY IGGA
Sbjct  180   DKWLKDTEDYVIKGCFSMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYWIGGA  239

Query  1285  ANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             ANHATHT+VFSQL IDG+NQGVHAFIA
Sbjct  240   ANHATHTIVFSQLIIDGENQGVHAFIA  266


 Score =   169 bits (428),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 109/159 (69%), Gaps = 5/159 (3%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            ME+ +FRT VL+RHL  +             S PC+SY P E SE AA FD+ EMRKLMD
Sbjct  12   MEKVNFRTKVLSRHLKQETPTLNVILQ----SLPCLSYNPPELSETAAVFDIKEMRKLMD  67

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHNL+ERDW +G+++QSK+FNP   GG+V +  DY+Q+ EQQREMTMRRIEYL + G  +
Sbjct  68   GHNLEERDWFFGLILQSKLFNPVRRGGKVFLSPDYSQSKEQQREMTMRRIEYLVEHGFSK  127

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
             WLT     E ELRK+AL + I I+D SL+IK+GV   L
Sbjct  128  DWLTVKG-PEDELRKLALLDCIFIYDHSLSIKMGVHFLL  165



>ref|XP_011100229.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Sesamum 
indicum]
Length=678

 Score =   431 bits (1108),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 203/259 (78%), Positives = 225/259 (87%), Gaps = 4/259 (2%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDIL---LQSSPCIGYTPPELSEPAASFDVAEMRKLM  765
             MEK NFRT VLTRHL Q+N  V        + SSPC+ YTPPE+SE  +SFDV  MRKLM
Sbjct  1     MEKVNFRTQVLTRHL-QDNHRVAATATATAISSSPCLSYTPPEVSEQPSSFDVNSMRKLM  59

Query  766   DGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVF  945
             DGHNLE+RDWL+ LMIQSRLFNP+ RGGK++V PD+NQSMEQQREITM+RI YL D GVF
Sbjct  60    DGHNLEDRDWLFNLMIQSRLFNPKLRGGKIFVVPDYNQSMEQQREITMKRIQYLLDHGVF  119

Query  946   RGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDS  1125
              GWLT KG EAE+RKLALL+V  IFDHSL+IK+GVHFFLWGGA+QFFGTKRHHD+WL  +
Sbjct  120   EGWLTRKGFEAEMRKLALLEVIEIFDHSLAIKIGVHFFLWGGAVQFFGTKRHHDRWLSAT  179

Query  1126  ENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHT  1305
             ENYLVKGCF+MTELGHGSNVRGIET+TTYDS TGEFVINTPCESAQKY IGGAANHATHT
Sbjct  180   ENYLVKGCFSMTELGHGSNVRGIETITTYDSKTGEFVINTPCESAQKYWIGGAANHATHT  239

Query  1306  VVFSQLNIDGKNQGVHAFI  1362
             VVFSQLNIDGKN+GVHAFI
Sbjct  240   VVFSQLNIDGKNEGVHAFI  258


 Score =   196 bits (498),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 117/159 (74%), Gaps = 1/159 (1%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            ME+ +FRT VLTRHL +            + SSPC+SYTP E SE  + FDV  MRKLMD
Sbjct  1    MEKVNFRTQVLTRHLQDNHRVAATATATAISSSPCLSYTPPEVSEQPSSFDVNSMRKLMD  60

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHNL++RDWL+ +MIQS++FNP+  GG++ V  DYNQ+MEQQRE+TM+RI+YL D GVF 
Sbjct  61   GHNLEDRDWLFNLMIQSRLFNPKLRGGKIFVVPDYNQSMEQQREITMKRIQYLLDHGVFE  120

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT     EAE+RK+AL EVI IFD SLAIKIGV  FL
Sbjct  121  GWLTRKG-FEAEMRKLALLEVIEIFDHSLAIKIGVHFFL  158



>ref|XP_004248185.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X2 [Solanum lycopersicum]
Length=683

 Score =   429 bits (1104),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 199/265 (75%), Positives = 227/265 (86%), Gaps = 2/265 (1%)
 Frame = +1

Query  571   LESSSLSSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAE  750
             ++ S  SSMEK NFRT +++RHL QE P    ++LLQS PC+ Y PPEL EP+A FD  E
Sbjct  1     MQKSHFSSMEKVNFRTKIISRHLNQETP--SPNLLLQSIPCLSYNPPELLEPSAIFDTKE  58

Query  751   MRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLS  930
             MRKLMDGHN  E+DWL+GLM+QS LFNP  RGGKV+V PD+NQS EQQREITM+RI YL 
Sbjct  59    MRKLMDGHNFVEKDWLFGLMLQSNLFNPIERGGKVFVSPDYNQSKEQQREITMKRIGYLL  118

Query  931   DCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDK  1110
             + GVF+ WLT KG E ELRKL LLD   I+DHSL+IK+GVHFFLWGGAIQFFGTKRHHDK
Sbjct  119   EHGVFKKWLTGKGHEDELRKLGLLDCLGIYDHSLAIKVGVHFFLWGGAIQFFGTKRHHDK  178

Query  1111  WLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAAN  1290
             WL+D+E+Y++KGCF+MTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKY IGGAAN
Sbjct  179   WLKDTEDYVIKGCFSMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYWIGGAAN  238

Query  1291  HATHTVVFSQLNIDGKNQGVHAFIA  1365
             HATHT+VFSQL IDG+NQGVHAFIA
Sbjct  239   HATHTIVFSQLIIDGENQGVHAFIA  263


 Score =   170 bits (430),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 107/159 (67%), Gaps = 5/159 (3%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            ME+ +FRT +++RHL  +             S PC+SY P E  EP+A FD  EMRKLMD
Sbjct  9    MEKVNFRTKIISRHLNQETPSPNLLLQ----SIPCLSYNPPELLEPSAIFDTKEMRKLMD  64

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHN  E+DWL+G+M+QS +FNP   GG+V V  DYNQ+ EQQRE+TM+RI YL + GVF+
Sbjct  65   GHNFVEKDWLFGLMLQSNLFNPIERGGKVFVSPDYNQSKEQQREITMKRIGYLLEHGVFK  124

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
             WLT     E ELRK+ L + + I+D SLAIK+GV  FL
Sbjct  125  KWLTGKGH-EDELRKLGLLDCLGIYDHSLAIKVGVHFFL  162



>ref|XP_009783430.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X3 
[Nicotiana sylvestris]
Length=686

 Score =   429 bits (1103),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 201/261 (77%), Positives = 224/261 (86%), Gaps = 1/261 (0%)
 Frame = +1

Query  583   SLSSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKL  762
             S SSME+ NFRT V+++HL QENP  +   LLQS PC+ Y PPE SEP + FD+ EMRKL
Sbjct  7     SSSSMERVNFRTKVISKHLNQENPTFNYS-LLQSFPCLSYNPPEFSEPFSVFDIKEMRKL  65

Query  763   MDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGV  942
             +DG+NL+ERDWL+GLM+QS LFN + RGGKV+V PD++QS EQQREITMRRI YL   GV
Sbjct  66    LDGYNLQERDWLFGLMLQSNLFNTKVRGGKVFVCPDYDQSKEQQREITMRRIGYLMQNGV  125

Query  943   FRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRD  1122
             F  WLT KGPE ELRK   +DV  IFDHSL IKLGVHFFLWGGAI+FFGT+RHHDKWLRD
Sbjct  126   FERWLTGKGPEDELRKFDFVDVVGIFDHSLKIKLGVHFFLWGGAIKFFGTQRHHDKWLRD  185

Query  1123  SENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATH  1302
             +ENY+VKGCFAMTELGHGSNVRGIETVTTYDSST EFVINTPCESAQKY IGGAANHATH
Sbjct  186   TENYVVKGCFAMTELGHGSNVRGIETVTTYDSSTREFVINTPCESAQKYWIGGAANHATH  245

Query  1303  TVVFSQLNIDGKNQGVHAFIA  1365
             TVVFSQL+IDGKNQGVHAFIA
Sbjct  246   TVVFSQLHIDGKNQGVHAFIA  266


 Score =   166 bits (419),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 106/159 (67%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            MER +FRT V+++HL  +             S PC+SY P E SEP + FD+ EMRKL+D
Sbjct  11   MERVNFRTKVISKHLNQENPTFNYSLLQ---SFPCLSYNPPEFSEPFSVFDIKEMRKLLD  67

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            G+NLQERDWL+G+M+QS +FN +  GG+V V  DY+Q+ EQQRE+TMRRI YL   GVF 
Sbjct  68   GYNLQERDWLFGLMLQSNLFNTKVRGGKVFVCPDYDQSKEQQREITMRRIGYLMQNGVFE  127

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
             WLT     E ELRK    +V+ IFD SL IK+GV  FL
Sbjct  128  RWLT-GKGPEDELRKFDFVDVVGIFDHSLKIKLGVHFFL  165



>gb|AFQ93695.1| acyl-CoA oxidase 3 [Prunus persica]
Length=672

 Score =   412 bits (1058),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 194/257 (75%), Positives = 220/257 (86%), Gaps = 5/257 (2%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             M++  +RT VL+ HL Q  P +     L  +PC+G++PPELSEP   FD  EMRKL+D H
Sbjct  1     MDRVTWRTQVLSNHLNQ--PSMSSP--LSPNPCVGFSPPELSEPF-EFDTKEMRKLLDAH  55

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             NLE+RDWL+GLM QS+ FNPR  GG+V+V PD+NQSMEQQRE+TM+RIAYL D GVF GW
Sbjct  56    NLEDRDWLFGLMKQSKPFNPREAGGRVFVSPDYNQSMEQQREMTMKRIAYLLDRGVFEGW  115

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LTEKG EAELRKLAL +V  I+DHSLS+KLGVHFFLWGGAIQFFGTKRHHDKWLRD+ENY
Sbjct  116   LTEKGVEAELRKLALHEVIGIYDHSLSVKLGVHFFLWGGAIQFFGTKRHHDKWLRDTENY  175

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
              +KGCFAM+ELGHGSNVRGIETVTTYDS+TGEFVINTPCESAQKY IGGAANHATHT+VF
Sbjct  176   TIKGCFAMSELGHGSNVRGIETVTTYDSNTGEFVINTPCESAQKYWIGGAANHATHTIVF  235

Query  1315  SQLNIDGKNQGVHAFIA  1365
             SQLNI GKN GVHAFIA
Sbjct  236   SQLNISGKNHGVHAFIA  252


 Score =   179 bits (454),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 111/159 (70%), Gaps = 8/159 (5%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+R ++RT VL+ HL      +          +PC+ ++P E SEP   FD  EMRKL+D
Sbjct  1    MDRVTWRTQVLSNHLNQPSMSSPLS------PNPCVGFSPPELSEPF-EFDTKEMRKLLD  53

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
             HNL++RDWL+G+M QSK FNPR  GGRV V  DYNQ+MEQQREMTM+RI YL D GVF 
Sbjct  54   AHNLEDRDWLFGLMKQSKPFNPREAGGRVFVSPDYNQSMEQQREMTMKRIAYLLDRGVFE  113

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLTE    EAELRK+AL EVI I+D SL++K+GV  FL
Sbjct  114  GWLTEKG-VEAELRKLALHEVIGIYDHSLSVKLGVHFFL  151



>ref|XP_008244854.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Prunus 
mume]
Length=662

 Score =   410 bits (1054),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 192/257 (75%), Positives = 220/257 (86%), Gaps = 5/257 (2%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             M++  +RT VL+ HL Q  P +     L  +PC+G++PPELSEP   FD  EMRKL+D H
Sbjct  1     MDRVTWRTQVLSNHLNQ--PSMSSP--LSPNPCVGFSPPELSEPF-EFDTKEMRKLLDAH  55

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             NLE+RDWL+GLM QS+LFNPR  GG+V+V PD+NQSMEQQRE+TM+RIAYL D GVF GW
Sbjct  56    NLEDRDWLFGLMKQSKLFNPREAGGRVFVSPDYNQSMEQQREMTMKRIAYLLDRGVFEGW  115

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LTEKG EAELRKLAL +V  I+DHSL++KLGVH+FLWG AI FFGTKRHHDKWLRD+ENY
Sbjct  116   LTEKGVEAELRKLALHEVIGIYDHSLAVKLGVHYFLWGSAILFFGTKRHHDKWLRDTENY  175

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
              +KGCFAM+ELGHGSNVRGIETVTTYDS+TGEFVINTPCESAQKY IGGAANHATHT+VF
Sbjct  176   TIKGCFAMSELGHGSNVRGIETVTTYDSNTGEFVINTPCESAQKYWIGGAANHATHTIVF  235

Query  1315  SQLNIDGKNQGVHAFIA  1365
             SQLNI GKNQGVHAFIA
Sbjct  236   SQLNISGKNQGVHAFIA  252


 Score =   181 bits (460),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 112/159 (70%), Gaps = 8/159 (5%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+R ++RT VL+ HL      +          +PC+ ++P E SEP   FD  EMRKL+D
Sbjct  1    MDRVTWRTQVLSNHLNQPSMSSPLS------PNPCVGFSPPELSEPF-EFDTKEMRKLLD  53

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
             HNL++RDWL+G+M QSK+FNPR  GGRV V  DYNQ+MEQQREMTM+RI YL D GVF 
Sbjct  54   AHNLEDRDWLFGLMKQSKLFNPREAGGRVFVSPDYNQSMEQQREMTMKRIAYLLDRGVFE  113

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLTE    EAELRK+AL EVI I+D SLA+K+GV  FL
Sbjct  114  GWLTEKG-VEAELRKLALHEVIGIYDHSLAVKLGVHYFL  151



>gb|KDO45758.1| hypothetical protein CISIN_1g011790mg [Citrus sinensis]
 gb|KDO45759.1| hypothetical protein CISIN_1g011790mg [Citrus sinensis]
Length=477

 Score =   404 bits (1038),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 187/256 (73%), Positives = 222/256 (87%), Gaps = 5/256 (2%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             M++A  RT ++  HL+Q N     D +L ++ C+ Y+PPEL+E    FD+ EMRKL+DGH
Sbjct  1     MDRAIHRTIIIKNHLLQPN----SDQILTTNACLSYSPPELNE-VYDFDLKEMRKLLDGH  55

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             NL+ERDWL+ LM+QS+LFNPR RG KVYV PD+NQ+MEQQRE+TM+RI+YL +  VF GW
Sbjct  56    NLQERDWLFNLMVQSKLFNPRKRGEKVYVAPDYNQTMEQQREMTMKRISYLLERNVFEGW  115

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LT KG EAELRKLALL+VT IFDHSL+IK+GVHFFLWGGAIQFFGT+RHH+KWLRD+ENY
Sbjct  116   LTAKGAEAELRKLALLEVTGIFDHSLAIKIGVHFFLWGGAIQFFGTQRHHEKWLRDTENY  175

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
             +V GCFAMTELGHGSNVRGIETVTTYD++TGEF+INTPCESAQKY IGGAANHATHT+VF
Sbjct  176   VVLGCFAMTELGHGSNVRGIETVTTYDANTGEFIINTPCESAQKYWIGGAANHATHTIVF  235

Query  1315  SQLNIDGKNQGVHAFI  1362
             SQL I+GKNQGVHAFI
Sbjct  236   SQLEINGKNQGVHAFI  251


 Score =   169 bits (429),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 111/159 (70%), Gaps = 8/159 (5%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+RA  RT ++  HLL   +  +        ++ C+SY+P E +E    FD+ EMRKL+D
Sbjct  1    MDRAIHRTIIIKNHLLQPNSDQILT------TNACLSYSPPELNE-VYDFDLKEMRKLLD  53

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHNLQERDWL+ +M+QSK+FNPR  G +V+V  DYNQ MEQQREMTM+RI YL +  VF 
Sbjct  54   GHNLQERDWLFNLMVQSKLFNPRKRGEKVYVAPDYNQTMEQQREMTMKRISYLLERNVFE  113

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT    AEAELRK+AL EV  IFD SLAIKIGV  FL
Sbjct  114  GWLTAKG-AEAELRKLALLEVTGIFDHSLAIKIGVHFFL  151



>ref|XP_010093490.1| Acyl-coenzyme A oxidase 3 [Morus notabilis]
 gb|EXB54129.1| Acyl-coenzyme A oxidase 3 [Morus notabilis]
Length=667

 Score =   409 bits (1051),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/257 (73%), Positives = 219/257 (85%), Gaps = 5/257 (2%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             M++ + RT VLT HLI   P    + LL ++PC+ Y+PPELSEP+  FD   MR L+D H
Sbjct  1     MDRVSRRTRVLTNHLIGPPP----ETLLAANPCLNYSPPELSEPS-EFDPKAMRSLLDAH  55

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             NL++RDWL+GL+IQS LFNPR+  GKV+V PD+NQSM+QQRE+TM+RI YL D GVF GW
Sbjct  56    NLQQRDWLFGLLIQSPLFNPRTAAGKVFVSPDYNQSMQQQREMTMKRITYLLDRGVFHGW  115

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LTEKGPEAE+RK A  +V  I+DHSL++KLGVHFFLWGGAIQFFGTKRHHDKWLRD+ENY
Sbjct  116   LTEKGPEAEMRKFAFFEVIGIYDHSLAVKLGVHFFLWGGAIQFFGTKRHHDKWLRDTENY  175

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
              +KGCFAM+ELGHGSNVRGIETVTTYD +TGEFVI+TPCESAQKY IGGAANHATHT+VF
Sbjct  176   AIKGCFAMSELGHGSNVRGIETVTTYDKNTGEFVISTPCESAQKYWIGGAANHATHTIVF  235

Query  1315  SQLNIDGKNQGVHAFIA  1365
             SQLNI+G NQGVHAFIA
Sbjct  236   SQLNINGSNQGVHAFIA  252


 Score =   174 bits (440),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 111/159 (70%), Gaps = 8/159 (5%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+R S RT VLT HL+      L        ++PC++Y+P E SEP+  FD   MR L+D
Sbjct  1    MDRVSRRTRVLTNHLIGPPPETLLA------ANPCLNYSPPELSEPS-EFDPKAMRSLLD  53

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
             HNLQ+RDWL+G++IQS +FNPR+  G+V V  DYNQ+M+QQREMTM+RI YL D GVF 
Sbjct  54   AHNLQQRDWLFGLLIQSPLFNPRTAAGKVFVSPDYNQSMQQQREMTMKRITYLLDRGVFH  113

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLTE    EAE+RK A  EVI I+D SLA+K+GV  FL
Sbjct  114  GWLTEKG-PEAEMRKFAFFEVIGIYDHSLAVKLGVHFFL  151



>ref|XP_007043725.1| Acyl-CoA oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOX99556.1| Acyl-CoA oxidase 3 isoform 1 [Theobroma cacao]
Length=690

 Score =   409 bits (1050),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 189/259 (73%), Positives = 223/259 (86%), Gaps = 2/259 (1%)
 Frame = +1

Query  592   SMEKANFRTHVLTRHLIQENPCVDDDIL-LQSSPCIGYTPPELSEPAASFDVAEMRKLMD  768
             SM++A  RT +LT HL+Q +P     I  L S+ C+ Y+PPELSE  A FD+ EMR+L+D
Sbjct  14    SMDRAFQRTKILTNHLLQSSPSSPAQIPSLSSNACLDYSPPELSEGYA-FDIKEMRQLLD  72

Query  769   GHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFR  948
             GH++ +RDWL+G+M+QS+LFNPR RGGKV+V PD+NQSMEQQRE+T +RI YL + GVF+
Sbjct  73    GHHVADRDWLFGMMMQSKLFNPRVRGGKVFVSPDYNQSMEQQREMTWKRIVYLLERGVFK  132

Query  949   GWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSE  1128
             GWLTEKG EAE+RK A  +   +FDHS++IKLGVHFFLWGGAIQFFGTK HHDKWLRD+E
Sbjct  133   GWLTEKGEEAEMRKFAYFEAVGLFDHSIAIKLGVHFFLWGGAIQFFGTKHHHDKWLRDTE  192

Query  1129  NYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTV  1308
             NYL+KGCFAMTELGHGSNVRGIETVTTYDS+TGEFVINTPCESAQKY IGGAANHATHT+
Sbjct  193   NYLIKGCFAMTELGHGSNVRGIETVTTYDSNTGEFVINTPCESAQKYWIGGAANHATHTI  252

Query  1309  VFSQLNIDGKNQGVHAFIA  1365
             VFSQLNI+G NQGVHAFIA
Sbjct  253   VFSQLNINGTNQGVHAFIA  271


 Score =   165 bits (418),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 113/159 (71%), Gaps = 3/159 (2%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+RA  RT +LT HLL     +      L  S+ C+ Y+P E SE  A FD+ EMR+L+D
Sbjct  15   MDRAFQRTKILTNHLLQSSPSSPAQIPSLS-SNACLDYSPPELSEGYA-FDIKEMRQLLD  72

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GH++ +RDWL+G+M+QSK+FNPR  GG+V V  DYNQ+MEQQREMT +RI YL + GVF+
Sbjct  73   GHHVADRDWLFGMMMQSKLFNPRVRGGKVFVSPDYNQSMEQQREMTWKRIVYLLERGVFK  132

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLTE  + EAE+RK A  E + +FD S+AIK+GV  FL
Sbjct  133  GWLTEKGE-EAEMRKFAYFEAVGLFDHSIAIKLGVHFFL  170



>ref|XP_006446734.1| hypothetical protein CICLE_v10014502mg [Citrus clementina]
 gb|ESR59974.1| hypothetical protein CICLE_v10014502mg [Citrus clementina]
Length=671

 Score =   408 bits (1048),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 188/256 (73%), Positives = 223/256 (87%), Gaps = 5/256 (2%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             M++A  RT ++  HL+Q N     D +L ++ C+ Y+PPEL+E    FD+ EMRKL+DGH
Sbjct  1     MDRAIHRTIIIKNHLLQPN----SDQILTTNACLSYSPPELNE-VYDFDLKEMRKLLDGH  55

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             NL+ERDWL+ LM+QS+LFNPR RG KVYV PD+NQ+MEQQRE+TM+RI+YL + GVF GW
Sbjct  56    NLQERDWLFNLMVQSKLFNPRKRGEKVYVAPDYNQTMEQQREMTMKRISYLLERGVFEGW  115

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LT KG EAELRKLALL+VT IFDHSL+IK+GVHFFLWGGAIQFFGT+RHH+KWLRD+ENY
Sbjct  116   LTAKGAEAELRKLALLEVTGIFDHSLAIKIGVHFFLWGGAIQFFGTQRHHEKWLRDTENY  175

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
             +V GCFAMTELGHGSNVRGIETVTTYD++TGEF+INTPCESAQKY IGGAANHATHT+VF
Sbjct  176   VVLGCFAMTELGHGSNVRGIETVTTYDANTGEFIINTPCESAQKYWIGGAANHATHTIVF  235

Query  1315  SQLNIDGKNQGVHAFI  1362
             SQL I+GKNQGVHAFI
Sbjct  236   SQLEINGKNQGVHAFI  251


 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 112/159 (70%), Gaps = 8/159 (5%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+RA  RT ++  HLL   +  +        ++ C+SY+P E +E    FD+ EMRKL+D
Sbjct  1    MDRAIHRTIIIKNHLLQPNSDQILT------TNACLSYSPPELNE-VYDFDLKEMRKLLD  53

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHNLQERDWL+ +M+QSK+FNPR  G +V+V  DYNQ MEQQREMTM+RI YL + GVF 
Sbjct  54   GHNLQERDWLFNLMVQSKLFNPRKRGEKVYVAPDYNQTMEQQREMTMKRISYLLERGVFE  113

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT    AEAELRK+AL EV  IFD SLAIKIGV  FL
Sbjct  114  GWLTAKG-AEAELRKLALLEVTGIFDHSLAIKIGVHFFL  151



>ref|XP_011466939.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=596

 Score =   405 bits (1041),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/258 (74%), Positives = 219/258 (85%), Gaps = 6/258 (2%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             M++  +RT VL+ HL    P       L ++PC+GY+PPEL+EP   F+  EMRKL+D H
Sbjct  1     MDRVTWRTQVLSNHL--HRPAASS--ALTANPCLGYSPPELTEPF-EFNTKEMRKLLDHH  55

Query  775   NLEERDWLYGLMIQSRLFNPRSRG-GKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRG  951
             NLEERDWL+GLM QS+LFNP+  G G+V+V PD+NQSMEQQRE+TM+RI YL D GVF+G
Sbjct  56    NLEERDWLFGLMRQSKLFNPKEAGDGRVFVSPDYNQSMEQQREMTMKRIEYLLDRGVFKG  115

Query  952   WLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSEN  1131
             WLTEKG EAELRK ALL+V+ I+DHSLS+KLGVHFFLWGGAI FFGTKRHHDKWLRD+EN
Sbjct  116   WLTEKGVEAELRKFALLEVSGIYDHSLSVKLGVHFFLWGGAILFFGTKRHHDKWLRDTEN  175

Query  1132  YLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVV  1311
             Y +KGCFAMTELGHGSNVRGIETVTTYDS TGEFVINTPCESAQKY IGGAANHATHT+V
Sbjct  176   YAIKGCFAMTELGHGSNVRGIETVTTYDSKTGEFVINTPCESAQKYWIGGAANHATHTIV  235

Query  1312  FSQLNIDGKNQGVHAFIA  1365
             FSQLNI G NQGVHAFIA
Sbjct  236   FSQLNISGTNQGVHAFIA  253


 Score =   174 bits (442),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 113/160 (71%), Gaps = 9/160 (6%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+R ++RT VL+ HL      +         ++PC+ Y+P E +EP   F+  EMRKL+D
Sbjct  1    MDRVTWRTQVLSNHLHRPAASSALT------ANPCLGYSPPELTEPF-EFNTKEMRKLLD  53

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMG-GRVHVGADYNQAMEQQREMTMRRIEYLSDCGVF  358
             HNL+ERDWL+G+M QSK+FNP+  G GRV V  DYNQ+MEQQREMTM+RIEYL D GVF
Sbjct  54   HHNLEERDWLFGLMRQSKLFNPKEAGDGRVFVSPDYNQSMEQQREMTMKRIEYLLDRGVF  113

Query  359  RGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            +GWLTE    EAELRK AL EV  I+D SL++K+GV  FL
Sbjct  114  KGWLTEKG-VEAELRKFALLEVSGIYDHSLSVKLGVHFFL  152



>ref|XP_007043727.1| Acyl-CoA oxidase 3 isoform 3 [Theobroma cacao]
 gb|EOX99558.1| Acyl-CoA oxidase 3 isoform 3 [Theobroma cacao]
Length=642

 Score =   407 bits (1045),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 188/258 (73%), Positives = 222/258 (86%), Gaps = 2/258 (1%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDIL-LQSSPCIGYTPPELSEPAASFDVAEMRKLMDG  771
             M++A  RT +LT HL+Q +P     I  L S+ C+ Y+PPELSE  A FD+ EMR+L+DG
Sbjct  1     MDRAFQRTKILTNHLLQSSPSSPAQIPSLSSNACLDYSPPELSEGYA-FDIKEMRQLLDG  59

Query  772   HNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRG  951
             H++ +RDWL+G+M+QS+LFNPR RGGKV+V PD+NQSMEQQRE+T +RI YL + GVF+G
Sbjct  60    HHVADRDWLFGMMMQSKLFNPRVRGGKVFVSPDYNQSMEQQREMTWKRIVYLLERGVFKG  119

Query  952   WLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSEN  1131
             WLTEKG EAE+RK A  +   +FDHS++IKLGVHFFLWGGAIQFFGTK HHDKWLRD+EN
Sbjct  120   WLTEKGEEAEMRKFAYFEAVGLFDHSIAIKLGVHFFLWGGAIQFFGTKHHHDKWLRDTEN  179

Query  1132  YLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVV  1311
             YL+KGCFAMTELGHGSNVRGIETVTTYDS+TGEFVINTPCESAQKY IGGAANHATHT+V
Sbjct  180   YLIKGCFAMTELGHGSNVRGIETVTTYDSNTGEFVINTPCESAQKYWIGGAANHATHTIV  239

Query  1312  FSQLNIDGKNQGVHAFIA  1365
             FSQLNI+G NQGVHAFIA
Sbjct  240   FSQLNINGTNQGVHAFIA  257


 Score =   165 bits (417),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 113/159 (71%), Gaps = 3/159 (2%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+RA  RT +LT HLL     +      L  S+ C+ Y+P E SE  A FD+ EMR+L+D
Sbjct  1    MDRAFQRTKILTNHLLQSSPSSPAQIPSLS-SNACLDYSPPELSEGYA-FDIKEMRQLLD  58

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GH++ +RDWL+G+M+QSK+FNPR  GG+V V  DYNQ+MEQQREMT +RI YL + GVF+
Sbjct  59   GHHVADRDWLFGMMMQSKLFNPRVRGGKVFVSPDYNQSMEQQREMTWKRIVYLLERGVFK  118

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLTE  + EAE+RK A  E + +FD S+AIK+GV  FL
Sbjct  119  GWLTEKGE-EAEMRKFAYFEAVGLFDHSIAIKLGVHFFL  156



>ref|XP_007043726.1| Acyl-CoA oxidase 3 isoform 2 [Theobroma cacao]
 gb|EOX99557.1| Acyl-CoA oxidase 3 isoform 2 [Theobroma cacao]
Length=676

 Score =   407 bits (1046),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 188/258 (73%), Positives = 222/258 (86%), Gaps = 2/258 (1%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDIL-LQSSPCIGYTPPELSEPAASFDVAEMRKLMDG  771
             M++A  RT +LT HL+Q +P     I  L S+ C+ Y+PPELSE  A FD+ EMR+L+DG
Sbjct  1     MDRAFQRTKILTNHLLQSSPSSPAQIPSLSSNACLDYSPPELSEGYA-FDIKEMRQLLDG  59

Query  772   HNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRG  951
             H++ +RDWL+G+M+QS+LFNPR RGGKV+V PD+NQSMEQQRE+T +RI YL + GVF+G
Sbjct  60    HHVADRDWLFGMMMQSKLFNPRVRGGKVFVSPDYNQSMEQQREMTWKRIVYLLERGVFKG  119

Query  952   WLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSEN  1131
             WLTEKG EAE+RK A  +   +FDHS++IKLGVHFFLWGGAIQFFGTK HHDKWLRD+EN
Sbjct  120   WLTEKGEEAEMRKFAYFEAVGLFDHSIAIKLGVHFFLWGGAIQFFGTKHHHDKWLRDTEN  179

Query  1132  YLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVV  1311
             YL+KGCFAMTELGHGSNVRGIETVTTYDS+TGEFVINTPCESAQKY IGGAANHATHT+V
Sbjct  180   YLIKGCFAMTELGHGSNVRGIETVTTYDSNTGEFVINTPCESAQKYWIGGAANHATHTIV  239

Query  1312  FSQLNIDGKNQGVHAFIA  1365
             FSQLNI+G NQGVHAFIA
Sbjct  240   FSQLNINGTNQGVHAFIA  257


 Score =   165 bits (418),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 113/159 (71%), Gaps = 3/159 (2%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+RA  RT +LT HLL     +      L  S+ C+ Y+P E SE  A FD+ EMR+L+D
Sbjct  1    MDRAFQRTKILTNHLLQSSPSSPAQIPSLS-SNACLDYSPPELSEGYA-FDIKEMRQLLD  58

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GH++ +RDWL+G+M+QSK+FNPR  GG+V V  DYNQ+MEQQREMT +RI YL + GVF+
Sbjct  59   GHHVADRDWLFGMMMQSKLFNPRVRGGKVFVSPDYNQSMEQQREMTWKRIVYLLERGVFK  118

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLTE  + EAE+RK A  E + +FD S+AIK+GV  FL
Sbjct  119  GWLTEKGE-EAEMRKFAYFEAVGLFDHSIAIKLGVHFFL  156



>ref|XP_006469060.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Citrus 
sinensis]
Length=671

 Score =   406 bits (1044),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 187/256 (73%), Positives = 223/256 (87%), Gaps = 5/256 (2%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             M++A  RT ++  HL+Q N     D +L ++ C+ Y+PPEL+E    FD+ EMRKL+DGH
Sbjct  1     MDRAIHRTIIIKNHLLQPN----SDQILTTNACLSYSPPELNE-VYDFDLKEMRKLLDGH  55

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             NL+E+DWL+ LM+QS+LFNPR RG KVYV PD+NQ+MEQQRE+TM+RI+YL + GVF GW
Sbjct  56    NLQEQDWLFNLMVQSKLFNPRKRGEKVYVAPDYNQTMEQQREMTMKRISYLLERGVFEGW  115

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LT KG EAELRKLALL+VT IFDHSL+IK+GVHFFLWGGAIQFFGT+RHH+KWLRD+ENY
Sbjct  116   LTAKGAEAELRKLALLEVTGIFDHSLAIKIGVHFFLWGGAIQFFGTQRHHEKWLRDTENY  175

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
             +V GCFAMTELGHGSNVRGIETVTTYD++TGEF+INTPCESAQKY IGGAANHATHT+VF
Sbjct  176   VVLGCFAMTELGHGSNVRGIETVTTYDANTGEFIINTPCESAQKYWIGGAANHATHTIVF  235

Query  1315  SQLNIDGKNQGVHAFI  1362
             SQL I+GKNQGVHAFI
Sbjct  236   SQLEINGKNQGVHAFI  251


 Score =   171 bits (432),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 112/159 (70%), Gaps = 8/159 (5%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+RA  RT ++  HLL   +  +        ++ C+SY+P E +E    FD+ EMRKL+D
Sbjct  1    MDRAIHRTIIIKNHLLQPNSDQILT------TNACLSYSPPELNE-VYDFDLKEMRKLLD  53

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHNLQE+DWL+ +M+QSK+FNPR  G +V+V  DYNQ MEQQREMTM+RI YL + GVF 
Sbjct  54   GHNLQEQDWLFNLMVQSKLFNPRKRGEKVYVAPDYNQTMEQQREMTMKRISYLLERGVFE  113

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT    AEAELRK+AL EV  IFD SLAIKIGV  FL
Sbjct  114  GWLTAKG-AEAELRKLALLEVTGIFDHSLAIKIGVHFFL  151



>ref|XP_010279215.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Nelumbo 
nucifera]
Length=684

 Score =   407 bits (1045),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 189/257 (74%), Positives = 223/257 (87%), Gaps = 2/257 (1%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDI-LLQSSPCIGYTPPELSEPAASFDVAEMRKLMDG  771
             M++ ++R  VLTRHL Q +        +L+SS C+ Y PPELSE    FDV EMR+LMDG
Sbjct  8     MDRVSWRAQVLTRHLQQPSSSHSSVAPVLESSVCLQYAPPELSEKF-DFDVREMRQLMDG  66

Query  772   HNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRG  951
             HN+E+RDWL+GLMIQS+LF PR+ GGKV+V PD+NQSMEQQRE+TM+RIAYL D GVF G
Sbjct  67    HNIEDRDWLFGLMIQSKLFCPRNSGGKVFVSPDYNQSMEQQREMTMKRIAYLLDRGVFEG  126

Query  952   WLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSEN  1131
             WLTEKG EAELRK A  +V  IFDHSL++KLGVHFFLWGGAIQFFGTKRHHDKWL+D+E+
Sbjct  127   WLTEKGAEAELRKFAFFEVIGIFDHSLAVKLGVHFFLWGGAIQFFGTKRHHDKWLKDTES  186

Query  1132  YLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVV  1311
             Y++KGCFAMTELGHGSNVRGIET+TTYD+STGEFVINTPCESAQKY IGGAANHAT+T+V
Sbjct  187   YVIKGCFAMTELGHGSNVRGIETITTYDTSTGEFVINTPCESAQKYWIGGAANHATYTIV  246

Query  1312  FSQLNIDGKNQGVHAFI  1362
             FSQL+I+GK++GVHAFI
Sbjct  247   FSQLHINGKSEGVHAFI  263


 Score =   181 bits (460),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 115/159 (72%), Gaps = 3/159 (2%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+R S+R  VLTRHL    + +     VL  SS C+ Y P E SE    FDV EMR+LMD
Sbjct  8    MDRVSWRAQVLTRHLQQPSSSHSSVAPVLE-SSVCLQYAPPELSE-KFDFDVREMRQLMD  65

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHN+++RDWL+G+MIQSK+F PR+ GG+V V  DYNQ+MEQQREMTM+RI YL D GVF 
Sbjct  66   GHNIEDRDWLFGLMIQSKLFCPRNSGGKVFVSPDYNQSMEQQREMTMKRIAYLLDRGVFE  125

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLTE   AEAELRK A  EVI IFD SLA+K+GV  FL
Sbjct  126  GWLTEKG-AEAELRKFAFFEVIGIFDHSLAVKLGVHFFL  163



>ref|XP_004303096.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=674

 Score =   405 bits (1041),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 192/258 (74%), Positives = 219/258 (85%), Gaps = 6/258 (2%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             M++  +RT VL+ HL    P       L ++PC+GY+PPEL+EP   F+  EMRKL+D H
Sbjct  1     MDRVTWRTQVLSNHL--HRPAASS--ALTANPCLGYSPPELTEPF-EFNTKEMRKLLDHH  55

Query  775   NLEERDWLYGLMIQSRLFNPRSRG-GKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRG  951
             NLEERDWL+GLM QS+LFNP+  G G+V+V PD+NQSMEQQRE+TM+RI YL D GVF+G
Sbjct  56    NLEERDWLFGLMRQSKLFNPKEAGDGRVFVSPDYNQSMEQQREMTMKRIEYLLDRGVFKG  115

Query  952   WLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSEN  1131
             WLTEKG EAELRK ALL+V+ I+DHSLS+KLGVHFFLWGGAI FFGTKRHHDKWLRD+EN
Sbjct  116   WLTEKGVEAELRKFALLEVSGIYDHSLSVKLGVHFFLWGGAILFFGTKRHHDKWLRDTEN  175

Query  1132  YLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVV  1311
             Y +KGCFAMTELGHGSNVRGIETVTTYDS TGEFVINTPCESAQKY IGGAANHATHT+V
Sbjct  176   YAIKGCFAMTELGHGSNVRGIETVTTYDSKTGEFVINTPCESAQKYWIGGAANHATHTIV  235

Query  1312  FSQLNIDGKNQGVHAFIA  1365
             FSQLNI G NQGVHAFIA
Sbjct  236   FSQLNISGTNQGVHAFIA  253


 Score =   174 bits (442),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 113/160 (71%), Gaps = 9/160 (6%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+R ++RT VL+ HL      +         ++PC+ Y+P E +EP   F+  EMRKL+D
Sbjct  1    MDRVTWRTQVLSNHLHRPAASSALT------ANPCLGYSPPELTEPF-EFNTKEMRKLLD  53

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMG-GRVHVGADYNQAMEQQREMTMRRIEYLSDCGVF  358
             HNL+ERDWL+G+M QSK+FNP+  G GRV V  DYNQ+MEQQREMTM+RIEYL D GVF
Sbjct  54   HHNLEERDWLFGLMRQSKLFNPKEAGDGRVFVSPDYNQSMEQQREMTMKRIEYLLDRGVF  113

Query  359  RGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            +GWLTE    EAELRK AL EV  I+D SL++K+GV  FL
Sbjct  114  KGWLTEKG-VEAELRKFALLEVSGIYDHSLSVKLGVHFFL  152



>ref|XP_002278663.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Vitis vinifera]
Length=691

 Score =   405 bits (1040),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/261 (70%), Positives = 222/261 (85%), Gaps = 2/261 (1%)
 Frame = +1

Query  583   SLSSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKL  762
             S S  ++ + R   L  HL   +  ++    L  SPC+ Y+PPEL+ P + F++++MRKL
Sbjct  3     SPSPADQVSRRAQALAGHLRGLHTSMEPS--LSPSPCLQYSPPELASPPSDFNLSDMRKL  60

Query  763   MDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGV  942
             MDGHNL++RDWL+GLMIQS+LFNPR  GG+V+V PD+NQSMEQQRE+TM+RI YL DCGV
Sbjct  61    MDGHNLQDRDWLFGLMIQSKLFNPRVAGGRVFVSPDYNQSMEQQREMTMKRIHYLLDCGV  120

Query  943   FRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRD  1122
             F+ WLT +GPE E+RK AL +V  ++DHSL++KLGVH+FLWGGAIQFFGTKRHHDKWLRD
Sbjct  121   FQEWLTGRGPEVEMRKFALHEVIGMYDHSLAVKLGVHYFLWGGAIQFFGTKRHHDKWLRD  180

Query  1123  SENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATH  1302
             SENY++KGCFAMTELGHGSNVRGIETVTTYDS TGEFVIN+PCESAQKY IGGAANHATH
Sbjct  181   SENYVIKGCFAMTELGHGSNVRGIETVTTYDSKTGEFVINSPCESAQKYWIGGAANHATH  240

Query  1303  TVVFSQLNIDGKNQGVHAFIA  1365
             T+VFSQLNI+GK++GVHAFIA
Sbjct  241   TIVFSQLNINGKSEGVHAFIA  261


 Score =   180 bits (456),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = +2

Query  98   SPCISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVG  277
            SPC+ Y+P E + P + F++ +MRKLMDGHNLQ+RDWL+G+MIQSK+FNPR  GGRV V 
Sbjct  35   SPCLQYSPPELASPPSDFNLSDMRKLMDGHNLQDRDWLFGLMIQSKLFNPRVAGGRVFVS  94

Query  278  ADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIK  457
             DYNQ+MEQQREMTM+RI YL DCGVF+ WLT     E E+RK AL EVI ++D SLA+K
Sbjct  95   PDYNQSMEQQREMTMKRIHYLLDCGVFQEWLTGRG-PEVEMRKFALHEVIGMYDHSLAVK  153

Query  458  IGVQVFL  478
            +GV  FL
Sbjct  154  LGVHYFL  160



>gb|KJB12480.1| hypothetical protein B456_002G020600 [Gossypium raimondii]
Length=548

 Score =   399 bits (1025),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 187/259 (72%), Positives = 217/259 (84%), Gaps = 4/259 (2%)
 Frame = +1

Query  589   SSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMD  768
             S ME+A  RT +LT HL+Q  P       L S+ C+ Y+PPELSE  A FD+ +MRKL+D
Sbjct  23    SKMEQAFKRTQILTNHLLQSAPSSQT---LSSNACLSYSPPELSENYA-FDIKDMRKLID  78

Query  769   GHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFR  948
              HNLEERDWL+GLM QS+LFNP+ RGGKV+V PD+NQSMEQQRE+T++RI YL + G F+
Sbjct  79    RHNLEERDWLFGLMKQSKLFNPKVRGGKVFVSPDYNQSMEQQREMTLKRIEYLLEKGAFK  138

Query  949   GWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSE  1128
             GWLTEKG + E+RK A  +V +I+DHSL  KLGVHFFLWGGAIQFFGTK HHDKWLRD+E
Sbjct  139   GWLTEKGEDIEMRKFAGFEVCSIYDHSLFTKLGVHFFLWGGAIQFFGTKHHHDKWLRDTE  198

Query  1129  NYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTV  1308
             NY +KGCFAMTELGHGSNVRG+ETVTTYDS+TGEFVINTPCESAQKY IGGAANHATHTV
Sbjct  199   NYSIKGCFAMTELGHGSNVRGLETVTTYDSNTGEFVINTPCESAQKYWIGGAANHATHTV  258

Query  1309  VFSQLNIDGKNQGVHAFIA  1365
             VFSQL+I+G NQGVHAFI 
Sbjct  259   VFSQLHINGTNQGVHAFIV  277


 Score =   162 bits (411),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 111/159 (70%), Gaps = 7/159 (4%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            ME+A  RT +LT HLL     +         S+ C+SY+P E SE  A FD+ +MRKL+D
Sbjct  25   MEQAFKRTQILTNHLLQSAPSSQTLS-----SNACLSYSPPELSENYA-FDIKDMRKLID  78

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
             HNL+ERDWL+G+M QSK+FNP+  GG+V V  DYNQ+MEQQREMT++RIEYL + G F+
Sbjct  79   RHNLEERDWLFGLMKQSKLFNPKVRGGKVFVSPDYNQSMEQQREMTLKRIEYLLEKGAFK  138

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLTE  + + E+RK A  EV +I+D SL  K+GV  FL
Sbjct  139  GWLTEKGE-DIEMRKFAGFEVCSIYDHSLFTKLGVHFFL  176



>gb|EYU29818.1| hypothetical protein MIMGU_mgv1a002427mg [Erythranthe guttata]
Length=676

 Score =   402 bits (1032),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/256 (76%), Positives = 219/256 (86%), Gaps = 1/256 (0%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             MEK NFRT VL RHL Q+         +  SPC+ Y PPE SEP + FDV+ MRKLMDGH
Sbjct  1     MEKFNFRTQVLIRHL-QQTTATATAAAISRSPCLSYAPPETSEPPSPFDVSSMRKLMDGH  59

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             NL +RDW++ LMIQS+LFNP+ RGGKV+V PD+NQSMEQQREITM+RI YL D GVF GW
Sbjct  60    NLVDRDWVFNLMIQSKLFNPKMRGGKVFVVPDYNQSMEQQREITMKRIQYLLDHGVFDGW  119

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LT +G E+E+RKLALL+V  IFDHSL+IK+GVHFFLWGGAIQFFGTKRHHDKWL  +ENY
Sbjct  120   LTGRGFESEMRKLALLEVIEIFDHSLAIKIGVHFFLWGGAIQFFGTKRHHDKWLSATENY  179

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
             L+KGCF+MTELGHGSNVRGIETVTTYDS +GEFVINTPCESAQKY IGGAANHATHTVVF
Sbjct  180   LIKGCFSMTELGHGSNVRGIETVTTYDSKSGEFVINTPCESAQKYWIGGAANHATHTVVF  239

Query  1315  SQLNIDGKNQGVHAFI  1362
             SQLN+DGKN+GVHAFI
Sbjct  240   SQLNVDGKNEGVHAFI  255


 Score =   171 bits (432),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 112/159 (70%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            ME+ +FRT VL RHL                 SPC+SY P E SEP + FDV  MRKLMD
Sbjct  1    MEKFNFRTQVLIRHLQQTTATATAAAISR---SPCLSYAPPETSEPPSPFDVSSMRKLMD  57

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHNL +RDW++ +MIQSK+FNP+  GG+V V  DYNQ+MEQQRE+TM+RI+YL D GVF 
Sbjct  58   GHNLVDRDWVFNLMIQSKLFNPKMRGGKVFVVPDYNQSMEQQREITMKRIQYLLDHGVFD  117

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT     E+E+RK+AL EVI IFD SLAIKIGV  FL
Sbjct  118  GWLTGRG-FESEMRKLALLEVIEIFDHSLAIKIGVHFFL  155



>ref|NP_001280826.1| acyl-coenzyme A oxidase 3, peroxisomal-like [Malus domestica]
 gb|ABB83366.1| putative medium chain acyl-CoA oxidase [Malus domestica]
Length=674

 Score =   401 bits (1030),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 187/261 (72%), Positives = 217/261 (83%), Gaps = 12/261 (5%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQ----ENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKL  762
             M++  +RT VL+ HL Q     NP       L  +PC+G++PPELSEP   FD  EMRKL
Sbjct  1     MDRVTWRTRVLSNHLNQPSWSSNP-------LSPNPCLGFSPPELSEPF-EFDTKEMRKL  52

Query  763   MDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGV  942
             +D HNLE+RDWL+GLM QS+L NPR  GG+V++ PD+NQSMEQQR++TM+RIAYL D GV
Sbjct  53    LDAHNLEDRDWLFGLMKQSKLLNPREAGGRVFIAPDYNQSMEQQRQMTMKRIAYLLDRGV  112

Query  943   FRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRD  1122
             F+GWLT+KG +AELRK A  +V  IFDHSL++KLGVHFFLWGGAIQFFGTKRHHDKWL D
Sbjct  113   FKGWLTDKGVDAELRKFAFFEVIGIFDHSLAVKLGVHFFLWGGAIQFFGTKRHHDKWLSD  172

Query  1123  SENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATH  1302
             +ENY +KGCFAM+ELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKY IGGAANHATH
Sbjct  173   TENYTIKGCFAMSELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYWIGGAANHATH  232

Query  1303  TVVFSQLNIDGKNQGVHAFIA  1365
             T+VFSQL+I G NQGVHA IA
Sbjct  233   TIVFSQLSISGNNQGVHALIA  253


 Score =   174 bits (440),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 110/159 (69%), Gaps = 7/159 (4%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+R ++RT VL+ HL      +          +PC+ ++P E SEP   FD  EMRKL+D
Sbjct  1    MDRVTWRTRVLSNHLNQPSWSSNPLS-----PNPCLGFSPPELSEPF-EFDTKEMRKLLD  54

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
             HNL++RDWL+G+M QSK+ NPR  GGRV +  DYNQ+MEQQR+MTM+RI YL D GVF+
Sbjct  55   AHNLEDRDWLFGLMKQSKLLNPREAGGRVFIAPDYNQSMEQQRQMTMKRIAYLLDRGVFK  114

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT+    +AELRK A  EVI IFD SLA+K+GV  FL
Sbjct  115  GWLTDKG-VDAELRKFAFFEVIGIFDHSLAVKLGVHFFL  152



>gb|AAF80226.1|AC025290_15 Contains similarity to an acyl-coenzyme A oxidase I precursor 
from Candida tropicalis gb|M12161 [Arabidopsis thaliana]
Length=305

 Score =   386 bits (992),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/258 (71%), Positives = 218/258 (84%), Gaps = 2/258 (1%)
 Frame = +1

Query  592   SMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDG  771
             S  +A  R HVL  H++Q NP    +  L    C+ Y+PPEL+E +  FDV EMRKL+DG
Sbjct  2     SDNRALRRAHVLANHILQSNP-PSSNPSLSRELCLQYSPPELNE-SYGFDVKEMRKLLDG  59

Query  772   HNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRG  951
             HN+ +RDW+YGLM+QS LFN + RGGK++V PD+NQ+MEQQREITM+RI YL + GVF+G
Sbjct  60    HNVVDRDWIYGLMMQSNLFNRKERGGKIFVSPDYNQTMEQQREITMKRIWYLLENGVFKG  119

Query  952   WLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSEN  1131
             WLTE GPEAELRKLALL+V  I+DHS+SIK+GVHFFLWG A++FFGTKRHH+KWL+++E+
Sbjct  120   WLTETGPEAELRKLALLEVCGIYDHSVSIKVGVHFFLWGNAVKFFGTKRHHEKWLKNTED  179

Query  1132  YLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVV  1311
             Y+VKGCFAMTELGHGSNVRGIETVTTYD  T EFVINTPCESAQKY IGGAANHATHT+V
Sbjct  180   YVVKGCFAMTELGHGSNVRGIETVTTYDPKTEEFVINTPCESAQKYWIGGAANHATHTIV  239

Query  1312  FSQLNIDGKNQGVHAFIA  1365
             FSQL+I+G NQGVHAFIA
Sbjct  240   FSQLHINGTNQGVHAFIA  257


 Score =   156 bits (394),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 95/125 (76%), Gaps = 2/125 (2%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGAD  283
            C+ Y+P E +E    FDV EMRKL+DGHN+ +RDW+YG+M+QS +FN +  GG++ V  D
Sbjct  34   CLQYSPPELNESYG-FDVKEMRKLLDGHNVVDRDWIYGLMMQSNLFNRKERGGKIFVSPD  92

Query  284  YNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIG  463
            YNQ MEQQRE+TM+RI YL + GVF+GWLTE    EAELRK+AL EV  I+D S++IK+G
Sbjct  93   YNQTMEQQREITMKRIWYLLENGVFKGWLTETG-PEAELRKLALLEVCGIYDHSVSIKVG  151

Query  464  VQVFL  478
            V  FL
Sbjct  152  VHFFL  156



>gb|KJB12478.1| hypothetical protein B456_002G020600 [Gossypium raimondii]
 gb|KJB12479.1| hypothetical protein B456_002G020600 [Gossypium raimondii]
Length=694

 Score =   399 bits (1025),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 187/258 (72%), Positives = 217/258 (84%), Gaps = 4/258 (2%)
 Frame = +1

Query  589   SSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMD  768
             S ME+A  RT +LT HL+Q  P       L S+ C+ Y+PPELSE  A FD+ +MRKL+D
Sbjct  23    SKMEQAFKRTQILTNHLLQSAPSSQT---LSSNACLSYSPPELSENYA-FDIKDMRKLID  78

Query  769   GHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFR  948
              HNLEERDWL+GLM QS+LFNP+ RGGKV+V PD+NQSMEQQRE+T++RI YL + G F+
Sbjct  79    RHNLEERDWLFGLMKQSKLFNPKVRGGKVFVSPDYNQSMEQQREMTLKRIEYLLEKGAFK  138

Query  949   GWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSE  1128
             GWLTEKG + E+RK A  +V +I+DHSL  KLGVHFFLWGGAIQFFGTK HHDKWLRD+E
Sbjct  139   GWLTEKGEDIEMRKFAGFEVCSIYDHSLFTKLGVHFFLWGGAIQFFGTKHHHDKWLRDTE  198

Query  1129  NYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTV  1308
             NY +KGCFAMTELGHGSNVRG+ETVTTYDS+TGEFVINTPCESAQKY IGGAANHATHTV
Sbjct  199   NYSIKGCFAMTELGHGSNVRGLETVTTYDSNTGEFVINTPCESAQKYWIGGAANHATHTV  258

Query  1309  VFSQLNIDGKNQGVHAFI  1362
             VFSQL+I+G NQGVHAFI
Sbjct  259   VFSQLHINGTNQGVHAFI  276


 Score =   162 bits (410),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 111/159 (70%), Gaps = 7/159 (4%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            ME+A  RT +LT HLL     +         S+ C+SY+P E SE  A FD+ +MRKL+D
Sbjct  25   MEQAFKRTQILTNHLLQSAPSSQTLS-----SNACLSYSPPELSENYA-FDIKDMRKLID  78

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
             HNL+ERDWL+G+M QSK+FNP+  GG+V V  DYNQ+MEQQREMT++RIEYL + G F+
Sbjct  79   RHNLEERDWLFGLMKQSKLFNPKVRGGKVFVSPDYNQSMEQQREMTLKRIEYLLEKGAFK  138

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLTE  + + E+RK A  EV +I+D SL  K+GV  FL
Sbjct  139  GWLTEKGE-DIEMRKFAGFEVCSIYDHSLFTKLGVHFFL  176



>ref|XP_010035824.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Eucalyptus 
grandis]
 gb|KCW47288.1| hypothetical protein EUGRSUZ_K01080 [Eucalyptus grandis]
Length=675

 Score =   395 bits (1016),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 184/256 (72%), Positives = 212/256 (83%), Gaps = 2/256 (1%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             M++A +R  V+  HL Q+ PC     L   +PC+ Y+PPEL+EPAA+FDVA MR L+DGH
Sbjct  1     MDRAFWRARVIKNHLTQD-PCTQTRSL-SGAPCLDYSPPELAEPAAAFDVAAMRALLDGH  58

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             N+ ERDWL+GLM QS+LFNPR  GG+V+V PD+NQSMEQQRE+TMRRI +L + GVF GW
Sbjct  59    NVAERDWLFGLMTQSKLFNPRRVGGRVFVAPDYNQSMEQQREMTMRRIEFLLERGVFEGW  118

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LT    E ELRKLAL +V  I+DHSL+IK GVHFFLWGGAIQFFGT+RHH KWLRD+ENY
Sbjct  119   LTAGTAEGELRKLALQEVANIYDHSLAIKFGVHFFLWGGAIQFFGTERHHVKWLRDTENY  178

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
             +VKGCFAMTELGHGSNVRGIETVTTYD    EF+INTPCESAQKY IGGAANHATHTV F
Sbjct  179   VVKGCFAMTELGHGSNVRGIETVTTYDPRAREFIINTPCESAQKYWIGGAANHATHTVAF  238

Query  1315  SQLNIDGKNQGVHAFI  1362
             SQLNI+G NQGVHAFI
Sbjct  239   SQLNINGINQGVHAFI  254


 Score =   180 bits (456),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 109/159 (69%), Gaps = 5/159 (3%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+RA +R  V+  HL                 +PC+ Y+P E +EPAA FDV  MR L+D
Sbjct  1    MDRAFWRARVIKNHLTQDPCTQTRSLS----GAPCLDYSPPELAEPAAAFDVAAMRALLD  56

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHN+ ERDWL+G+M QSK+FNPR +GGRV V  DYNQ+MEQQREMTMRRIE+L + GVF 
Sbjct  57   GHNVAERDWLFGLMTQSKLFNPRRVGGRVFVAPDYNQSMEQQREMTMRRIEFLLERGVFE  116

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT    AE ELRK+AL EV  I+D SLAIK GV  FL
Sbjct  117  GWLTAG-TAEGELRKLALQEVANIYDHSLAIKFGVHFFL  154



>gb|KJB50144.1| hypothetical protein B456_008G155500 [Gossypium raimondii]
Length=676

 Score =   394 bits (1011),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 185/258 (72%), Positives = 218/258 (84%), Gaps = 2/258 (1%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVD-DDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDG  771
             M++A  RT VLT HL+Q  P        L S+ C+ Y+PPELSE  A FD+++MRKLMDG
Sbjct  1     MDRAFQRTKVLTGHLLQSPPTSSFQTPSLSSNACLNYSPPELSEKYA-FDISDMRKLMDG  59

Query  772   HNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRG  951
             H+LEERD L+G++ QS++FNPR RGGKV+V PD+NQSMEQQRE+T +RI YL + GVF+G
Sbjct  60    HDLEERDRLFGMITQSKVFNPRVRGGKVFVSPDYNQSMEQQREMTWKRIEYLFERGVFQG  119

Query  952   WLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSEN  1131
             WLT +G E E+R+ A  +V  +FDHS+SIKLGVHFFLWGGAIQFFGTK HHDKWLRD+EN
Sbjct  120   WLTGEGEEVEMRRFACFEVLGLFDHSISIKLGVHFFLWGGAIQFFGTKHHHDKWLRDTEN  179

Query  1132  YLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVV  1311
             YL+KGCFAMTELGHGSNVRGIET+TTYDS+TGEFVINTPCESAQKY IGGAANHATHT+V
Sbjct  180   YLIKGCFAMTELGHGSNVRGIETITTYDSNTGEFVINTPCESAQKYWIGGAANHATHTIV  239

Query  1312  FSQLNIDGKNQGVHAFIA  1365
             FSQLNI+G NQGVHA IA
Sbjct  240   FSQLNINGTNQGVHALIA  257


 Score =   161 bits (407),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 113/159 (71%), Gaps = 3/159 (2%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+RA  RT VLT HLL     +      L  S+ C++Y+P E SE  A FD+ +MRKLMD
Sbjct  1    MDRAFQRTKVLTGHLLQSPPTSSFQTPSLS-SNACLNYSPPELSEKYA-FDISDMRKLMD  58

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GH+L+ERD L+G++ QSKVFNPR  GG+V V  DYNQ+MEQQREMT +RIEYL + GVF+
Sbjct  59   GHDLEERDRLFGMITQSKVFNPRVRGGKVFVSPDYNQSMEQQREMTWKRIEYLFERGVFQ  118

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT  +  E E+R+ A  EV+ +FD S++IK+GV  FL
Sbjct  119  GWLT-GEGEEVEMRRFACFEVLGLFDHSISIKLGVHFFL  156



>ref|XP_010522108.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Tarenaya hassleriana]
Length=680

 Score =   391 bits (1005),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 180/260 (69%), Positives = 220/260 (85%), Gaps = 2/260 (1%)
 Frame = +1

Query  586   LSSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLM  765
             +S   +A  RT +LT H+++ +P    +  L    C+ Y+PP+L+E +  FD+ EMRKL+
Sbjct  1     MSDQSRALRRTQILTNHILR-SPSPASNSSLSPEVCLQYSPPQLNE-SYGFDIKEMRKLL  58

Query  766   DGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVF  945
             DGHN+E+RDWLYGLMIQS LFN R RGGK++V PD+NQ+MEQQREITMRRI YL + GVF
Sbjct  59    DGHNVEDRDWLYGLMIQSNLFNRRERGGKIFVSPDYNQTMEQQREITMRRIWYLLEKGVF  118

Query  946   RGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDS  1125
             +GWLT+ G EAEL+K +LL++  IFDHSL+IK+GVHFFLW GAIQFFGT+RHH+KWL+D+
Sbjct  119   QGWLTKTGAEAELKKFSLLEICGIFDHSLAIKIGVHFFLWAGAIQFFGTRRHHEKWLKDT  178

Query  1126  ENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHT  1305
             E+Y+VKGCFAMTELGHGSNVRGIETVTTYD  TGEF+INTPCESAQKY IGGAANHATHT
Sbjct  179   EDYVVKGCFAMTELGHGSNVRGIETVTTYDPRTGEFIINTPCESAQKYWIGGAANHATHT  238

Query  1306  VVFSQLNIDGKNQGVHAFIA  1365
             +VFSQL+I+G NQGVHAFIA
Sbjct  239   IVFSQLDINGTNQGVHAFIA  258


 Score =   163 bits (412),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 111/159 (70%), Gaps = 9/159 (6%)
 Frame = +2

Query  8    RASFRTNVLTRHllnqqnpnlddddvllqSSP--CISYTPAEASEPAARFDVFEMRKLMD  181
            RA  RT +LT H+L   +P  +        SP  C+ Y+P + +E    FD+ EMRKL+D
Sbjct  6    RALRRTQILTNHILRSPSPASNSSL-----SPEVCLQYSPPQLNESYG-FDIKEMRKLLD  59

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHN+++RDWLYG+MIQS +FN R  GG++ V  DYNQ MEQQRE+TMRRI YL + GVF+
Sbjct  60   GHNVEDRDWLYGLMIQSNLFNRRERGGKIFVSPDYNQTMEQQREITMRRIWYLLEKGVFQ  119

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT+   AEAEL+K +L E+  IFD SLAIKIGV  FL
Sbjct  120  GWLTKTG-AEAELKKFSLLEICGIFDHSLAIKIGVHFFL  157



>ref|XP_009354288.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Pyrus 
x bretschneideri]
Length=674

 Score =   391 bits (1005),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 184/257 (72%), Positives = 214/257 (83%), Gaps = 4/257 (2%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             M++  +RT VL  HL   N        L  +PC+G++PPELSEP   FD  EMRKL+D H
Sbjct  1     MDRVTWRTRVLLNHL---NQLSSSSNPLSPNPCLGFSPPELSEPF-EFDTKEMRKLLDAH  56

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             NLE+RDWL+GLM QS+LFNPR  GG+V++ PD+NQSMEQQR++TM+RIAYL D GVF+GW
Sbjct  57    NLEDRDWLFGLMKQSKLFNPREAGGRVFIAPDYNQSMEQQRQMTMKRIAYLLDRGVFKGW  116

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LT++G +AELRK A  +V  IFDHSL++KLGVHFFLWGGAIQFFGTKRHHDKWL D+ENY
Sbjct  117   LTDRGVDAELRKFAFFEVIGIFDHSLAVKLGVHFFLWGGAIQFFGTKRHHDKWLSDTENY  176

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
              +KGCFAM+ELGHGSNVRGIETVTTYDSST EFVINTPCESAQKY IGGAANHATHT+VF
Sbjct  177   AIKGCFAMSELGHGSNVRGIETVTTYDSSTEEFVINTPCESAQKYWIGGAANHATHTIVF  236

Query  1315  SQLNIDGKNQGVHAFIA  1365
             SQL+I G NQGVHA IA
Sbjct  237   SQLSISGNNQGVHALIA  253


 Score =   170 bits (430),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 111/159 (70%), Gaps = 7/159 (4%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+R ++RT VL  HL    + +          +PC+ ++P E SEP   FD  EMRKL+D
Sbjct  1    MDRVTWRTRVLLNHLNQLSSSSNPLS-----PNPCLGFSPPELSEPF-EFDTKEMRKLLD  54

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
             HNL++RDWL+G+M QSK+FNPR  GGRV +  DYNQ+MEQQR+MTM+RI YL D GVF+
Sbjct  55   AHNLEDRDWLFGLMKQSKLFNPREAGGRVFIAPDYNQSMEQQRQMTMKRIAYLLDRGVFK  114

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT+    +AELRK A  EVI IFD SLA+K+GV  FL
Sbjct  115  GWLTDRG-VDAELRKFAFFEVIGIFDHSLAVKLGVHFFL  152



>gb|AAF73843.1|AF207994_1 acyl-CoA oxidase ACX3 [Arabidopsis thaliana]
Length=675

 Score =   391 bits (1004),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 182/258 (71%), Positives = 219/258 (85%), Gaps = 2/258 (1%)
 Frame = +1

Query  592   SMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDG  771
             S  +A  R HVL  H++Q NP   +  L +   C+ Y+PPEL+E +  FDV EMRKL+DG
Sbjct  2     SDNRALRRAHVLANHILQSNPPSSNPSLSREV-CLQYSPPELNE-SYGFDVKEMRKLLDG  59

Query  772   HNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRG  951
             HN+ +RDW+YGLM+QS LFN + RGGK++V PD+NQ+MEQQREITM+RI YL + GVF+G
Sbjct  60    HNVVDRDWIYGLMMQSNLFNRKERGGKIFVSPDYNQTMEQQREITMKRIWYLLENGVFKG  119

Query  952   WLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSEN  1131
             WLTE GPEAELRKLALL+V  I+DHS+SIK+GVHFFLWG A++FFGTKRHH+KWL+++E+
Sbjct  120   WLTETGPEAELRKLALLEVCGIYDHSVSIKVGVHFFLWGNAVKFFGTKRHHEKWLKNTED  179

Query  1132  YLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVV  1311
             Y+VKGCFAMTELGHGSNVRGIETVTTYD  T EFVINTPCESAQKY IGGAANHATHT+V
Sbjct  180   YVVKGCFAMTELGHGSNVRGIETVTTYDPKTEEFVINTPCESAQKYWIGGAANHATHTIV  239

Query  1312  FSQLNIDGKNQGVHAFIA  1365
             FSQL+I+G NQGVHAFIA
Sbjct  240   FSQLHINGTNQGVHAFIA  257


 Score =   157 bits (396),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 95/125 (76%), Gaps = 2/125 (2%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGAD  283
            C+ Y+P E +E    FDV EMRKL+DGHN+ +RDW+YG+M+QS +FN +  GG++ V  D
Sbjct  34   CLQYSPPELNESYG-FDVKEMRKLLDGHNVVDRDWIYGLMMQSNLFNRKERGGKIFVSPD  92

Query  284  YNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIG  463
            YNQ MEQQRE+TM+RI YL + GVF+GWLTE    EAELRK+AL EV  I+D S++IK+G
Sbjct  93   YNQTMEQQREITMKRIWYLLENGVFKGWLTETG-PEAELRKLALLEVCGIYDHSVSIKVG  151

Query  464  VQVFL  478
            V  FL
Sbjct  152  VHFFL  156



>ref|NP_172119.1| acyl-coenzyme A oxidase 3 [Arabidopsis thaliana]
 sp|P0CZ23.1|ACOX3_ARATH RecName: Full=Acyl-coenzyme A oxidase 3, peroxisomal; Short=AOX 
3; Short=Acyl-CoA oxidase 3; AltName: Full=Medium-chain acyl-CoA 
oxidase; Short=AtCX3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF76137.1|AF253474_1 acyl-CoA oxidase [Arabidopsis thaliana]
 gb|AAM20431.1| acyl-CoA oxidase ACX3 [Arabidopsis thaliana]
 gb|AAP37772.1| At1g06290 [Arabidopsis thaliana]
 dbj|BAD44020.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE27972.1| acyl-coenzyme A oxidase 3 [Arabidopsis thaliana]
Length=675

 Score =   390 bits (1003),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 182/258 (71%), Positives = 218/258 (84%), Gaps = 2/258 (1%)
 Frame = +1

Query  592   SMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDG  771
             S  +A  R HVL  H++Q NP   +  L     C+ Y+PPEL+E +  FDV EMRKL+DG
Sbjct  2     SDNRALRRAHVLANHILQSNPPSSNPSL-SRELCLQYSPPELNE-SYGFDVKEMRKLLDG  59

Query  772   HNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRG  951
             HN+ +RDW+YGLM+QS LFN + RGGK++V PD+NQ+MEQQREITM+RI YL + GVF+G
Sbjct  60    HNVVDRDWIYGLMMQSNLFNRKERGGKIFVSPDYNQTMEQQREITMKRIWYLLENGVFKG  119

Query  952   WLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSEN  1131
             WLTE GPEAELRKLALL+V  I+DHS+SIK+GVHFFLWG A++FFGTKRHH+KWL+++E+
Sbjct  120   WLTETGPEAELRKLALLEVCGIYDHSVSIKVGVHFFLWGNAVKFFGTKRHHEKWLKNTED  179

Query  1132  YLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVV  1311
             Y+VKGCFAMTELGHGSNVRGIETVTTYD  T EFVINTPCESAQKY IGGAANHATHT+V
Sbjct  180   YVVKGCFAMTELGHGSNVRGIETVTTYDPKTEEFVINTPCESAQKYWIGGAANHATHTIV  239

Query  1312  FSQLNIDGKNQGVHAFIA  1365
             FSQL+I+G NQGVHAFIA
Sbjct  240   FSQLHINGTNQGVHAFIA  257


 Score =   157 bits (396),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 95/125 (76%), Gaps = 2/125 (2%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGAD  283
            C+ Y+P E +E    FDV EMRKL+DGHN+ +RDW+YG+M+QS +FN +  GG++ V  D
Sbjct  34   CLQYSPPELNESYG-FDVKEMRKLLDGHNVVDRDWIYGLMMQSNLFNRKERGGKIFVSPD  92

Query  284  YNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIG  463
            YNQ MEQQRE+TM+RI YL + GVF+GWLTE    EAELRK+AL EV  I+D S++IK+G
Sbjct  93   YNQTMEQQREITMKRIWYLLENGVFKGWLTETG-PEAELRKLALLEVCGIYDHSVSIKVG  151

Query  464  VQVFL  478
            V  FL
Sbjct  152  VHFFL  156



>ref|XP_006417937.1| hypothetical protein EUTSA_v10006988mg [Eutrema salsugineum]
 gb|ESQ36290.1| hypothetical protein EUTSA_v10006988mg [Eutrema salsugineum]
Length=675

 Score =   390 bits (1002),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 179/258 (69%), Positives = 221/258 (86%), Gaps = 2/258 (1%)
 Frame = +1

Query  592   SMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDG  771
             S  +A  R HVL  H+++ +P +  ++ L    C+ Y+PPEL+E +  F+V EMRKL+DG
Sbjct  2     SDNRALRRAHVLANHILR-SPTLPSNLSLTREVCLQYSPPELNE-SYGFEVKEMRKLLDG  59

Query  772   HNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRG  951
             HN+E+RDWLYGLM+QS LFN + RGGK++V PD+NQ+MEQQRE+TM+RI YL + GVF+G
Sbjct  60    HNMEDRDWLYGLMMQSNLFNRKERGGKIFVSPDYNQTMEQQREVTMKRIWYLLERGVFKG  119

Query  952   WLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSEN  1131
             WLTE GP+AEL+KLALL+V  I+DHSLSIKLGVHFFLWG A++FFGT+RHH+KWL+++E+
Sbjct  120   WLTETGPDAELKKLALLEVCGIYDHSLSIKLGVHFFLWGNAVKFFGTRRHHEKWLKNTED  179

Query  1132  YLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVV  1311
             Y+VKGCFAMTELGHGSNVRGIETVTTYD  TGEFVINTPCESAQKY IGGAA HATHT+V
Sbjct  180   YVVKGCFAMTELGHGSNVRGIETVTTYDPRTGEFVINTPCESAQKYWIGGAAKHATHTIV  239

Query  1312  FSQLNIDGKNQGVHAFIA  1365
             FSQL+I+G NQGVHAFIA
Sbjct  240   FSQLDINGTNQGVHAFIA  257


 Score =   155 bits (391),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 96/125 (77%), Gaps = 2/125 (2%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGAD  283
            C+ Y+P E +E    F+V EMRKL+DGHN+++RDWLYG+M+QS +FN +  GG++ V  D
Sbjct  34   CLQYSPPELNESYG-FEVKEMRKLLDGHNMEDRDWLYGLMMQSNLFNRKERGGKIFVSPD  92

Query  284  YNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIG  463
            YNQ MEQQRE+TM+RI YL + GVF+GWLTE    +AEL+K+AL EV  I+D SL+IK+G
Sbjct  93   YNQTMEQQREVTMKRIWYLLERGVFKGWLTETG-PDAELKKLALLEVCGIYDHSLSIKLG  151

Query  464  VQVFL  478
            V  FL
Sbjct  152  VHFFL  156



>gb|KHG26832.1| Acyl-coenzyme A oxidase 3, peroxisomal -like protein [Gossypium 
arboreum]
Length=670

 Score =   390 bits (1001),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 186/256 (73%), Positives = 215/256 (84%), Gaps = 4/256 (2%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             ME+A  RT +LT HL+Q          L S+ C+ Y+PPELSE  A FD+ +MRKL+D H
Sbjct  1     MEQAFKRTQILTNHLLQS---SPSSQTLSSNACLSYSPPELSENYA-FDIKDMRKLIDRH  56

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             NLEERDWL+GLM QS+LFNP+ RGGKV+V PD+NQSMEQQRE+T++RI YL + G F+GW
Sbjct  57    NLEERDWLFGLMKQSKLFNPKVRGGKVFVSPDYNQSMEQQREMTLKRIEYLLEKGAFKGW  116

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LTEKG + E+RK A  +V +I+DHSL  KLGVHFFLWGGAIQFFGTK HHDKWLRD+ENY
Sbjct  117   LTEKGEDIEMRKFAGFEVCSIYDHSLFTKLGVHFFLWGGAIQFFGTKHHHDKWLRDTENY  176

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
              +KGCFAMTELGHGSNVRGIETVTTYDS+TGEFVINTPCESAQKY IGGAANHATHTVVF
Sbjct  177   WIKGCFAMTELGHGSNVRGIETVTTYDSNTGEFVINTPCESAQKYWIGGAANHATHTVVF  236

Query  1315  SQLNIDGKNQGVHAFI  1362
             SQL+I+G NQGVHAFI
Sbjct  237   SQLHINGTNQGVHAFI  252


 Score =   159 bits (401),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 111/159 (70%), Gaps = 7/159 (4%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            ME+A  RT +LT HLL     +         S+ C+SY+P E SE  A FD+ +MRKL+D
Sbjct  1    MEQAFKRTQILTNHLLQSSPSSQTLS-----SNACLSYSPPELSENYA-FDIKDMRKLID  54

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
             HNL+ERDWL+G+M QSK+FNP+  GG+V V  DYNQ+MEQQREMT++RIEYL + G F+
Sbjct  55   RHNLEERDWLFGLMKQSKLFNPKVRGGKVFVSPDYNQSMEQQREMTLKRIEYLLEKGAFK  114

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLTE  + + E+RK A  EV +I+D SL  K+GV  FL
Sbjct  115  GWLTEKGE-DIEMRKFAGFEVCSIYDHSLFTKLGVHFFL  152



>gb|KCW47289.1| hypothetical protein EUGRSUZ_K01080 [Eucalyptus grandis]
Length=678

 Score =   390 bits (1002),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 184/259 (71%), Positives = 212/259 (82%), Gaps = 5/259 (2%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             M++A +R  V+  HL Q+ PC     L   +PC+ Y+PPEL+EPAA+FDVA MR L+DGH
Sbjct  1     MDRAFWRARVIKNHLTQD-PCTQTRSL-SGAPCLDYSPPELAEPAAAFDVAAMRALLDGH  58

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             N+ ERDWL+GLM QS+LFNPR  GG+V+V PD+NQSMEQQRE+TMRRI +L + GVF GW
Sbjct  59    NVAERDWLFGLMTQSKLFNPRRVGGRVFVAPDYNQSMEQQREMTMRRIEFLLERGVFEGW  118

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LT    E ELRKLAL +V  I+DHSL+IK GVHFFLWGGAIQFFGT+RHH KWLRD+ENY
Sbjct  119   LTAGTAEGELRKLALQEVANIYDHSLAIKFGVHFFLWGGAIQFFGTERHHVKWLRDTENY  178

Query  1135  LVKGCFAMTELGHGS---NVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHT  1305
             +VKGCFAMTELGHGS   NVRGIETVTTYD    EF+INTPCESAQKY IGGAANHATHT
Sbjct  179   VVKGCFAMTELGHGSNVCNVRGIETVTTYDPRAREFIINTPCESAQKYWIGGAANHATHT  238

Query  1306  VVFSQLNIDGKNQGVHAFI  1362
             V FSQLNI+G NQGVHAFI
Sbjct  239   VAFSQLNINGINQGVHAFI  257


 Score =   180 bits (456),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 109/159 (69%), Gaps = 5/159 (3%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+RA +R  V+  HL                 +PC+ Y+P E +EPAA FDV  MR L+D
Sbjct  1    MDRAFWRARVIKNHLTQDPCTQTRSLS----GAPCLDYSPPELAEPAAAFDVAAMRALLD  56

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHN+ ERDWL+G+M QSK+FNPR +GGRV V  DYNQ+MEQQREMTMRRIE+L + GVF 
Sbjct  57   GHNVAERDWLFGLMTQSKLFNPRRVGGRVFVAPDYNQSMEQQREMTMRRIEFLLERGVFE  116

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT    AE ELRK+AL EV  I+D SLAIK GV  FL
Sbjct  117  GWLTAG-TAEGELRKLALQEVANIYDHSLAIKFGVHFFL  154



>ref|XP_004505527.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Cicer 
arietinum]
Length=678

 Score =   389 bits (1000),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/257 (70%), Positives = 217/257 (84%), Gaps = 3/257 (1%)
 Frame = +1

Query  598   EKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEP-AASFDVAEMRKLMDGH  774
             ++ + RT +L+ HL  + P      +LQ + C+ Y+PPELSE    +FDV EMR+L+DGH
Sbjct  4     DRISRRTEILSNHLRLDPPTATS--ILQQNGCLSYSPPELSESNPVTFDVTEMRRLLDGH  61

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             N+EERDWL+GLMIQSRLFN R   G+V+V PD+NQSMEQQRE+TM+RIAYL D GVFRGW
Sbjct  62    NIEERDWLFGLMIQSRLFNQREVDGRVFVSPDYNQSMEQQREMTMKRIAYLLDRGVFRGW  121

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LT +GP+ ELRKLAL +V  ++DHSL++K+GVH FLWGGA++F GTKRHHDKWLR +EN 
Sbjct  122   LTGEGPQDELRKLALHEVIGMYDHSLAVKIGVHIFLWGGAVKFLGTKRHHDKWLRATENN  181

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
              +KGCFAM+ELGHGSNVRGIETVTTYDS+TGEFVINTPCESAQKY IGGAANH+THT+VF
Sbjct  182   EMKGCFAMSELGHGSNVRGIETVTTYDSNTGEFVINTPCESAQKYWIGGAANHSTHTIVF  241

Query  1315  SQLNIDGKNQGVHAFIA  1365
             SQLNI+G NQGVHAFIA
Sbjct  242   SQLNINGSNQGVHAFIA  258


 Score =   170 bits (430),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 111/159 (70%), Gaps = 6/159 (4%)
 Frame = +2

Query  5    ERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEP-AARFDVFEMRKLMD  181
            +R S RT +L+ HL                 + C+SY+P E SE     FDV EMR+L+D
Sbjct  4    DRISRRTEILSNHLRLDPPTATSILQ----QNGCLSYSPPELSESNPVTFDVTEMRRLLD  59

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHN++ERDWL+G+MIQS++FN R + GRV V  DYNQ+MEQQREMTM+RI YL D GVFR
Sbjct  60   GHNIEERDWLFGLMIQSRLFNQREVDGRVFVSPDYNQSMEQQREMTMKRIAYLLDRGVFR  119

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT  +  + ELRK+AL EVI ++D SLA+KIGV +FL
Sbjct  120  GWLT-GEGPQDELRKLALHEVIGMYDHSLAVKIGVHIFL  157



>gb|KJB12486.1| hypothetical protein B456_002G020700 [Gossypium raimondii]
Length=672

 Score =   387 bits (995),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 184/256 (72%), Positives = 214/256 (84%), Gaps = 2/256 (1%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             ME+A  RT VLT HL+Q +  +    L  S+ C+ Y+PPELSE  A FDV EMRKL+DGH
Sbjct  1     MERAFQRTQVLTNHLLQSSSPLPSQTL-SSNACLSYSPPELSENCA-FDVKEMRKLIDGH  58

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             NLEERDWL+GLM QS LFNP+ RGGKV+V PD+NQSMEQQRE+T++RI YL + GVF+GW
Sbjct  59    NLEERDWLFGLMKQSELFNPKVRGGKVFVSPDYNQSMEQQREMTLKRIKYLQERGVFKGW  118

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LTEKG E E+RK A  +V +I+DHSL  KLGVHF +WGGAIQF GTK HHDKWLRD+ENY
Sbjct  119   LTEKGEEIEMRKFAGFEVFSIYDHSLFTKLGVHFPMWGGAIQFCGTKHHHDKWLRDTENY  178

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
              +KGCFAMTELGHGSN+R +ETVTTYDS+TGEFVINTPCESAQK+ IGGAA HATHTVVF
Sbjct  179   SIKGCFAMTELGHGSNIRSLETVTTYDSNTGEFVINTPCESAQKFWIGGAAKHATHTVVF  238

Query  1315  SQLNIDGKNQGVHAFI  1362
             SQL+I+G NQGVHAFI
Sbjct  239   SQLHINGINQGVHAFI  254


 Score =   166 bits (420),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 112/156 (72%), Gaps = 5/156 (3%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            MERA  RT VLT HLL   +P          S+ C+SY+P E SE  A FDV EMRKL+D
Sbjct  1    MERAFQRTQVLTNHLLQSSSPLPSQTLS---SNACLSYSPPELSENCA-FDVKEMRKLID  56

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHNL+ERDWL+G+M QS++FNP+  GG+V V  DYNQ+MEQQREMT++RI+YL + GVF+
Sbjct  57   GHNLEERDWLFGLMKQSELFNPKVRGGKVFVSPDYNQSMEQQREMTLKRIKYLQERGVFK  116

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQ  469
            GWLTE  + E E+RK A  EV +I+D SL  K+GV 
Sbjct  117  GWLTEKGE-EIEMRKFAGFEVFSIYDHSLFTKLGVH  151



>ref|XP_006306351.1| hypothetical protein CARUB_v10012245mg [Capsella rubella]
 gb|EOA39249.1| hypothetical protein CARUB_v10012245mg [Capsella rubella]
Length=675

 Score =   387 bits (994),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 177/251 (71%), Positives = 214/251 (85%), Gaps = 2/251 (1%)
 Frame = +1

Query  613   RTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERD  792
             R HVL  H++Q  P    ++ L    C+ Y+PPEL+E    FDV EMRKL+DGHN+ +RD
Sbjct  9     RVHVLANHILQSTP-PSSNLSLTREICLQYSPPELNE-ICGFDVKEMRKLLDGHNVVDRD  66

Query  793   WLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGP  972
             W+YGLM+QS LFN + RGGK++V PD+NQ+MEQQREITM+RI YL + GVF+GWLTE GP
Sbjct  67    WIYGLMMQSNLFNRKERGGKIFVSPDYNQTMEQQREITMKRIWYLLENGVFKGWLTETGP  126

Query  973   EAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCF  1152
             EAELRKLALL+V  ++DHS+SIK+GVHFFLWG A++FFGTKRHH+KWL+++E+Y+VKGCF
Sbjct  127   EAELRKLALLEVCGLYDHSVSIKVGVHFFLWGNAVKFFGTKRHHEKWLKNTEDYVVKGCF  186

Query  1153  AMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNID  1332
             AMTELGHGSNVRGIETVTTYD  + EFVINTPCESAQKY IGGAANHATHT+VFSQL+I+
Sbjct  187   AMTELGHGSNVRGIETVTTYDPRSEEFVINTPCESAQKYWIGGAANHATHTIVFSQLHIN  246

Query  1333  GKNQGVHAFIA  1365
             G NQGVHAFIA
Sbjct  247   GTNQGVHAFIA  257


 Score =   155 bits (393),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 95/125 (76%), Gaps = 2/125 (2%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGAD  283
            C+ Y+P E +E    FDV EMRKL+DGHN+ +RDW+YG+M+QS +FN +  GG++ V  D
Sbjct  34   CLQYSPPELNEICG-FDVKEMRKLLDGHNVVDRDWIYGLMMQSNLFNRKERGGKIFVSPD  92

Query  284  YNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIG  463
            YNQ MEQQRE+TM+RI YL + GVF+GWLTE    EAELRK+AL EV  ++D S++IK+G
Sbjct  93   YNQTMEQQREITMKRIWYLLENGVFKGWLTETG-PEAELRKLALLEVCGLYDHSVSIKVG  151

Query  464  VQVFL  478
            V  FL
Sbjct  152  VHFFL  156



>ref|XP_002889597.1| acyl-CoA oxidase ACX3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65856.1| acyl-CoA oxidase ACX3 [Arabidopsis lyrata subsp. lyrata]
Length=675

 Score =   387 bits (993),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/258 (69%), Positives = 219/258 (85%), Gaps = 2/258 (1%)
 Frame = +1

Query  592   SMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDG  771
             S  +A  R+HVL  H++Q  P +  ++ L    C+ Y+PPEL+E    FDV EMRKL+DG
Sbjct  2     SDNRALRRSHVLANHILQSTP-LASNLSLTREVCLQYSPPELNENYG-FDVKEMRKLLDG  59

Query  772   HNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRG  951
             HN+ +RDW+YGLM+QS LFN + RGGK++V PD+NQ+MEQQREITM+RI YL + GVF+G
Sbjct  60    HNVVDRDWIYGLMMQSNLFNRKERGGKIFVSPDYNQTMEQQREITMKRIWYLLENGVFKG  119

Query  952   WLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSEN  1131
             WLTE GPEAELRKLALL+V  I+DHS+SIK+GVHFFLWG A++FFGTKRHH+KWL+++E+
Sbjct  120   WLTETGPEAELRKLALLEVCGIYDHSVSIKVGVHFFLWGNAVKFFGTKRHHEKWLKNTED  179

Query  1132  YLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVV  1311
             Y+VKGCFAMTELGHGSNVRGIET+TTYD +T EFVI TPCESAQKY IGGAANHATHT+V
Sbjct  180   YVVKGCFAMTELGHGSNVRGIETLTTYDPTTEEFVITTPCESAQKYWIGGAANHATHTIV  239

Query  1312  FSQLNIDGKNQGVHAFIA  1365
             FSQL+I+G NQGVHAFIA
Sbjct  240   FSQLHINGTNQGVHAFIA  257


 Score =   156 bits (395),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 95/125 (76%), Gaps = 2/125 (2%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGAD  283
            C+ Y+P E +E    FDV EMRKL+DGHN+ +RDW+YG+M+QS +FN +  GG++ V  D
Sbjct  34   CLQYSPPELNENYG-FDVKEMRKLLDGHNVVDRDWIYGLMMQSNLFNRKERGGKIFVSPD  92

Query  284  YNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIG  463
            YNQ MEQQRE+TM+RI YL + GVF+GWLTE    EAELRK+AL EV  I+D S++IK+G
Sbjct  93   YNQTMEQQREITMKRIWYLLENGVFKGWLTETG-PEAELRKLALLEVCGIYDHSVSIKVG  151

Query  464  VQVFL  478
            V  FL
Sbjct  152  VHFFL  156



>gb|KFK42952.1| hypothetical protein AALP_AA1G060500 [Arabis alpina]
Length=675

 Score =   387 bits (993),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/258 (69%), Positives = 218/258 (84%), Gaps = 2/258 (1%)
 Frame = +1

Query  592   SMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDG  771
             S  +A  R H+L  HL+Q  P    + + +   C+ Y+PPEL+E +  F++ EMRKL+DG
Sbjct  2     SENRALQRAHILANHLLQSPPLPSPNSITRDV-CLQYSPPELNE-SYGFELNEMRKLLDG  59

Query  772   HNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRG  951
             HN+E+RDWLYGLM+QS LFN + RGGK++V PD+NQ+MEQQREITM+RI YL D GVF+G
Sbjct  60    HNVEDRDWLYGLMMQSNLFNRKERGGKIFVSPDYNQTMEQQREITMKRIWYLLDNGVFKG  119

Query  952   WLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSEN  1131
             WLTE GPE+EL+KLALL+V  I+DHS+SIKLGVHFFLWG A++FFGT+RHH+KWL+++E+
Sbjct  120   WLTESGPESELKKLALLEVCGIYDHSVSIKLGVHFFLWGNAVKFFGTRRHHEKWLKNTED  179

Query  1132  YLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVV  1311
             Y+VKGCFAMTELGHGSNVRGIETVTTYDS T EFVINTPCESAQKY IGGAA HATHT+V
Sbjct  180   YVVKGCFAMTELGHGSNVRGIETVTTYDSRTEEFVINTPCESAQKYWIGGAAKHATHTIV  239

Query  1312  FSQLNIDGKNQGVHAFIA  1365
             FSQLNI+  NQGVHAFIA
Sbjct  240   FSQLNINRTNQGVHAFIA  257


 Score =   155 bits (393),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 97/125 (78%), Gaps = 2/125 (2%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGAD  283
            C+ Y+P E +E    F++ EMRKL+DGHN+++RDWLYG+M+QS +FN +  GG++ V  D
Sbjct  34   CLQYSPPELNESYG-FELNEMRKLLDGHNVEDRDWLYGLMMQSNLFNRKERGGKIFVSPD  92

Query  284  YNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIG  463
            YNQ MEQQRE+TM+RI YL D GVF+GWLTE+   E+EL+K+AL EV  I+D S++IK+G
Sbjct  93   YNQTMEQQREITMKRIWYLLDNGVFKGWLTESG-PESELKKLALLEVCGIYDHSVSIKLG  151

Query  464  VQVFL  478
            V  FL
Sbjct  152  VHFFL  156



>ref|XP_008455941.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Cucumis 
melo]
Length=677

 Score =   386 bits (992),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/258 (69%), Positives = 217/258 (84%), Gaps = 7/258 (3%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLI-QENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDG  771
             ME+ ++RT VL+ HL+ Q++P      LL  +PC+ ++PPELSE   SFD+ EMR L+DG
Sbjct  1     MERVSWRTQVLSNHLLPQQSPS-----LLSPNPCLQFSPPELSE-RFSFDIVEMRNLLDG  54

Query  772   HNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRG  951
             HNL +RDW++GLM+QS+LFNP   GG+V+V PD+NQSM+QQRE+TM+RI YL D GVF+G
Sbjct  55    HNLPDRDWIFGLMVQSKLFNPFQSGGRVFVSPDYNQSMQQQREMTMKRIEYLLDNGVFKG  114

Query  952   WLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSEN  1131
             WLT+ G EA  RK AL +   I+DHSL+IKLGVHF LWGGAIQFFGTKRHHD WL+++EN
Sbjct  115   WLTDNGIEAVWRKFALFEAIGIYDHSLAIKLGVHFHLWGGAIQFFGTKRHHDAWLKNTEN  174

Query  1132  YLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVV  1311
             Y ++GCFAM+ELGHGSNVRGIETVT YDSSTGEFVINTPCESAQKY IGGAANHATH +V
Sbjct  175   YAIRGCFAMSELGHGSNVRGIETVTKYDSSTGEFVINTPCESAQKYWIGGAANHATHAIV  234

Query  1312  FSQLNIDGKNQGVHAFIA  1365
             FSQL+I+GKN+GVHAFIA
Sbjct  235   FSQLDINGKNEGVHAFIA  252


 Score =   172 bits (435),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 116/159 (73%), Gaps = 8/159 (5%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            MER S+RT VL+ HLL QQ+P+L         +PC+ ++P E SE  + FD+ EMR L+D
Sbjct  1    MERVSWRTQVLSNHLLPQQSPSLLS------PNPCLQFSPPELSERFS-FDIVEMRNLLD  53

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHNL +RDW++G+M+QSK+FNP   GGRV V  DYNQ+M+QQREMTM+RIEYL D GVF+
Sbjct  54   GHNLPDRDWIFGLMVQSKLFNPFQSGGRVFVSPDYNQSMQQQREMTMKRIEYLLDNGVFK  113

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT+N   EA  RK AL E I I+D SLAIK+GV   L
Sbjct  114  GWLTDNG-IEAVWRKFALFEAIGIYDHSLAIKLGVHFHL  151



>ref|XP_009119069.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Brassica rapa]
 emb|CDY57818.1| BnaA10g28060D [Brassica napus]
Length=675

 Score =   384 bits (986),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 181/258 (70%), Positives = 217/258 (84%), Gaps = 2/258 (1%)
 Frame = +1

Query  592   SMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDG  771
             S  +A  R H+L  H+++  P      L +   C+ Y+PPEL+E +  FDV EMR+L+DG
Sbjct  2     SENRALQRAHILANHILRSPPLPSSLSLAREV-CLQYSPPELNE-SYGFDVKEMRRLLDG  59

Query  772   HNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRG  951
             HN E+RDWLYGLM+QS LFN + RGGK++V PD+NQ+MEQQREITM+RI YL + GV+RG
Sbjct  60    HNTEDRDWLYGLMMQSNLFNRKERGGKIFVSPDYNQTMEQQREITMKRIWYLLEKGVYRG  119

Query  952   WLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSEN  1131
             WLT+ GPEAEL+KLALL+V  I+DHSLSIKLGVHFFLWG A++FFGTKRHH+KWL+++E+
Sbjct  120   WLTDSGPEAELKKLALLEVCGIYDHSLSIKLGVHFFLWGNAVKFFGTKRHHEKWLKNTED  179

Query  1132  YLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVV  1311
             Y+VKGCFAMTELGHGSNVRGIETVTTYD  TGEFVINTPCESAQKY IGGAA HATHT+V
Sbjct  180   YVVKGCFAMTELGHGSNVRGIETVTTYDPRTGEFVINTPCESAQKYWIGGAAKHATHTIV  239

Query  1312  FSQLNIDGKNQGVHAFIA  1365
             FSQLNI+G NQGVHAFIA
Sbjct  240   FSQLNINGTNQGVHAFIA  257


 Score =   155 bits (393),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 96/125 (77%), Gaps = 2/125 (2%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGAD  283
            C+ Y+P E +E    FDV EMR+L+DGHN ++RDWLYG+M+QS +FN +  GG++ V  D
Sbjct  34   CLQYSPPELNESYG-FDVKEMRRLLDGHNTEDRDWLYGLMMQSNLFNRKERGGKIFVSPD  92

Query  284  YNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIG  463
            YNQ MEQQRE+TM+RI YL + GV+RGWLT++   EAEL+K+AL EV  I+D SL+IK+G
Sbjct  93   YNQTMEQQREITMKRIWYLLEKGVYRGWLTDSG-PEAELKKLALLEVCGIYDHSLSIKLG  151

Query  464  VQVFL  478
            V  FL
Sbjct  152  VHFFL  156



>ref|XP_006376402.1| acyl-CoA oxidase family protein [Populus trichocarpa]
 gb|ERP54199.1| acyl-CoA oxidase family protein [Populus trichocarpa]
Length=673

 Score =   383 bits (984),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 178/259 (69%), Positives = 217/259 (84%), Gaps = 3/259 (1%)
 Frame = +1

Query  589   SSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMD  768
             SS+  A+ RT +L  HL+Q +P      L QS+ C+ Y+PPEL+E +  FD+ EMRK++D
Sbjct  5     SSINTASRRTRILNNHLVQ-SPSKPTSCL-QSNSCLSYSPPELTE-SFDFDIKEMRKILD  61

Query  769   GHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFR  948
              HNLE+RDWL+G++ Q R+FN + RGG+++V PD+NQ+MEQQRE+TM+RI YL + G F 
Sbjct  62    FHNLEDRDWLFGVIKQGRVFNGKERGGRLFVSPDYNQTMEQQREMTMKRIEYLLERGAFD  121

Query  949   GWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSE  1128
             GWLT+KG EAEL+KLALL+   IFDHSL+IK+GVHFFLWGGAIQF GTKRHHDKWLRD+E
Sbjct  122   GWLTKKGVEAELKKLALLEAIQIFDHSLAIKIGVHFFLWGGAIQFMGTKRHHDKWLRDTE  181

Query  1129  NYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTV  1308
              + +KGCF+MTELGHGSNVRGIETVTTYDS TGEFVINTPCESAQKY IGGAANHATHT+
Sbjct  182   TFAIKGCFSMTELGHGSNVRGIETVTTYDSKTGEFVINTPCESAQKYWIGGAANHATHTI  241

Query  1309  VFSQLNIDGKNQGVHAFIA  1365
             VFSQLNI+G N+GVHA IA
Sbjct  242   VFSQLNINGVNEGVHALIA  260


 Score =   159 bits (403),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 108/159 (68%), Gaps = 6/159 (4%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            +  AS RT +L  HL+   +           S+ C+SY+P E +E +  FD+ EMRK++D
Sbjct  7    INTASRRTRILNNHLVQSPSKPTSCLQ----SNSCLSYSPPELTE-SFDFDIKEMRKILD  61

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
             HNL++RDWL+GV+ Q +VFN +  GGR+ V  DYNQ MEQQREMTM+RIEYL + G F 
Sbjct  62   FHNLEDRDWLFGVIKQGRVFNGKERGGRLFVSPDYNQTMEQQREMTMKRIEYLLERGAFD  121

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT+    EAEL+K+AL E I IFD SLAIKIGV  FL
Sbjct  122  GWLTKKG-VEAELKKLALLEAIQIFDHSLAIKIGVHFFL  159



>ref|XP_012079023.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Jatropha 
curcas]
 gb|KDP31760.1| hypothetical protein JCGZ_12221 [Jatropha curcas]
Length=680

 Score =   383 bits (984),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 183/262 (70%), Positives = 220/262 (84%), Gaps = 3/262 (1%)
 Frame = +1

Query  580   SSLSSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRK  759
             +S SS ++A  RT +LT HL+  +        L+S+ C+ Y+PPEL E    FD  EMRK
Sbjct  2     ASQSSTDRALIRTRILTNHLLSSS--SQSISSLESNACVSYSPPELHE-RCDFDPNEMRK  58

Query  760   LMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCG  939
             L+D HN+++RDWL+GLM QS++FNPR +GG+VYV PD+NQSMEQQREITMRR+AYL + G
Sbjct  59    LLDMHNIDDRDWLFGLMRQSKVFNPREKGGRVYVAPDYNQSMEQQREITMRRVAYLLERG  118

Query  940   VFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLR  1119
             VF GWLT KG E+E++K+AL +V  +FDHSL+IKLGVHFFLWGGAIQFFGT+RHHDKWLR
Sbjct  119   VFDGWLTGKGLESEMKKMALFEVIGMFDHSLAIKLGVHFFLWGGAIQFFGTERHHDKWLR  178

Query  1120  DSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHAT  1299
             D+E Y +KGCFAMTELGHGSNVRGIETVT YDS+TGEFVINTPCESAQKY IGGAANHAT
Sbjct  179   DTETYAIKGCFAMTELGHGSNVRGIETVTIYDSNTGEFVINTPCESAQKYWIGGAANHAT  238

Query  1300  HTVVFSQLNIDGKNQGVHAFIA  1365
             HT+VFSQLNI+G ++GVHAFIA
Sbjct  239   HTIVFSQLNINGMSEGVHAFIA  260


 Score =   162 bits (409),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 113/158 (72%), Gaps = 6/158 (4%)
 Frame = +2

Query  5    ERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMDG  184
            +RA  RT +LT HLL+  + ++   +    S+ C+SY+P E  E    FD  EMRKL+D 
Sbjct  8    DRALIRTRILTNHLLSSSSQSISSLE----SNACVSYSPPELHE-RCDFDPNEMRKLLDM  62

Query  185  HNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFRG  364
            HN+ +RDWL+G+M QSKVFNPR  GGRV+V  DYNQ+MEQQRE+TMRR+ YL + GVF G
Sbjct  63   HNIDDRDWLFGLMRQSKVFNPREKGGRVYVAPDYNQSMEQQREITMRRVAYLLERGVFDG  122

Query  365  WLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            WLT     E+E++K+AL EVI +FD SLAIK+GV  FL
Sbjct  123  WLT-GKGLESEMKKMALFEVIGMFDHSLAIKLGVHFFL  159



>ref|XP_003527400.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Glycine 
max]
Length=675

 Score =   383 bits (983),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 178/256 (70%), Positives = 207/256 (81%), Gaps = 3/256 (1%)
 Frame = +1

Query  598   EKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHN  777
             ++ + RT VLT HL++  P      LL   PC+ Y+PPELS    SFD  EMRKLMD HN
Sbjct  4     DRVSRRTEVLTNHLLRRTP--PPSALLHPHPCLSYSPPELSN-TISFDTREMRKLMDCHN  60

Query  778   LEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWL  957
             LEERDW++ L++QS LFNPR R G+V+V PD+NQ ME QR+ TM+RI YL   GVFRGWL
Sbjct  61    LEERDWIFSLILQSPLFNPRHRAGRVFVSPDYNQPMEHQRQATMKRIGYLLQKGVFRGWL  120

Query  958   TEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYL  1137
             T  GPE ELRKLAL +V  ++DHSL++KLGVHFFLWGGA++F GTKRHHDKWL  +ENY 
Sbjct  121   TGNGPEQELRKLALHEVIGMYDHSLAVKLGVHFFLWGGAVKFLGTKRHHDKWLNSTENYD  180

Query  1138  VKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFS  1317
             +KGCFAM+ELGHGSNVRGIETVTTYDS+TGEFVINTPCES QKY IGGAANHATHT+VFS
Sbjct  181   IKGCFAMSELGHGSNVRGIETVTTYDSNTGEFVINTPCESGQKYWIGGAANHATHTIVFS  240

Query  1318  QLNIDGKNQGVHAFIA  1365
             QL I+G NQGVHAFIA
Sbjct  241   QLYINGSNQGVHAFIA  256


 Score =   159 bits (403),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 105/158 (66%), Gaps = 6/158 (4%)
 Frame = +2

Query  5    ERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMDG  184
            +R S RT VLT HLL +  P            PC+SY+P E S   + FD  EMRKLMD 
Sbjct  4    DRVSRRTEVLTNHLLRRTPPPSALLH----PHPCLSYSPPELSNTIS-FDTREMRKLMDC  58

Query  185  HNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFRG  364
            HNL+ERDW++ +++QS +FNPR   GRV V  DYNQ ME QR+ TM+RI YL   GVFRG
Sbjct  59   HNLEERDWIFSLILQSPLFNPRHRAGRVFVSPDYNQPMEHQRQATMKRIGYLLQKGVFRG  118

Query  365  WLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            WLT N   E ELRK+AL EVI ++D SLA+K+GV  FL
Sbjct  119  WLTGNG-PEQELRKLALHEVIGMYDHSLAVKLGVHFFL  155



>ref|XP_004151905.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Cucumis 
sativus]
 gb|KGN63212.1| hypothetical protein Csa_2G415540 [Cucumis sativus]
Length=681

 Score =   382 bits (982),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 175/257 (68%), Positives = 212/257 (82%), Gaps = 5/257 (2%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             ME+ ++RT VL+ HL+          LL  +PC+ ++PPELSE   SFD+ EMR L+D H
Sbjct  1     MERVSWRTQVLSNHLLPHQSAS----LLTPNPCLQFSPPELSE-RFSFDIVEMRNLLDAH  55

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             NL +RDW++GLM+QS+LFNP   GG+V+V PD+NQSM+QQRE+TM+RI YL D GVF+GW
Sbjct  56    NLPDRDWIFGLMVQSKLFNPLQSGGRVFVSPDYNQSMQQQREMTMKRIEYLLDNGVFKGW  115

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LT+ G EA  RK AL +   I+DHSL+IKLGVHF LWGGAIQFFGTKRHHD WL+++ENY
Sbjct  116   LTDNGIEAAWRKFALFEAIGIYDHSLAIKLGVHFHLWGGAIQFFGTKRHHDAWLKNTENY  175

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
              ++GCFAM+ELGHGSNVRGIETVT YDSSTGEFVINTPCESAQKY IGGAANHATH +VF
Sbjct  176   AIRGCFAMSELGHGSNVRGIETVTKYDSSTGEFVINTPCESAQKYWIGGAANHATHAIVF  235

Query  1315  SQLNIDGKNQGVHAFIA  1365
             SQL+I+GKN+GVHAFIA
Sbjct  236   SQLDINGKNEGVHAFIA  252


 Score =   171 bits (432),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 113/159 (71%), Gaps = 8/159 (5%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            MER S+RT VL+ HLL  Q+ +L         +PC+ ++P E SE  + FD+ EMR L+D
Sbjct  1    MERVSWRTQVLSNHLLPHQSASLLT------PNPCLQFSPPELSERFS-FDIVEMRNLLD  53

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
             HNL +RDW++G+M+QSK+FNP   GGRV V  DYNQ+M+QQREMTM+RIEYL D GVF+
Sbjct  54   AHNLPDRDWIFGLMVQSKLFNPLQSGGRVFVSPDYNQSMQQQREMTMKRIEYLLDNGVFK  113

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT+N   EA  RK AL E I I+D SLAIK+GV   L
Sbjct  114  GWLTDNG-IEAAWRKFALFEAIGIYDHSLAIKLGVHFHL  151



>ref|XP_010457756.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Camelina 
sativa]
Length=675

 Score =   382 bits (981),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 175/251 (70%), Positives = 214/251 (85%), Gaps = 2/251 (1%)
 Frame = +1

Query  613   RTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERD  792
             R +VL  H++Q  P    ++ L    C+ Y+PPEL+E +  FDV EMRKL+DGHN+ +RD
Sbjct  9     RVNVLVNHILQSTP-PSSNLSLTREICLQYSPPELNE-SCVFDVKEMRKLLDGHNVVDRD  66

Query  793   WLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGP  972
             W+YGLM QS LFN + RGGK++V PD+NQ+MEQQREITM+RI YL + GVF+GWLTE GP
Sbjct  67    WIYGLMTQSNLFNRKERGGKIFVSPDYNQTMEQQREITMKRIWYLLENGVFKGWLTESGP  126

Query  973   EAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCF  1152
             +AELRKLALL+V  I+DHS+SIK+GVHFFLWG A++FFGTKRHH+KWL+++E+Y+VKGCF
Sbjct  127   DAELRKLALLEVCGIYDHSVSIKVGVHFFLWGNAVKFFGTKRHHEKWLKNTEDYVVKGCF  186

Query  1153  AMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNID  1332
             AMTELGHGSNVRGIETVTTYD ++ EFVI TPCESAQKY IGGAANHATHT+VFSQL+I+
Sbjct  187   AMTELGHGSNVRGIETVTTYDPTSEEFVITTPCESAQKYWIGGAANHATHTIVFSQLHIN  246

Query  1333  GKNQGVHAFIA  1365
             G NQGVHAFIA
Sbjct  247   GTNQGVHAFIA  257


 Score =   156 bits (394),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 107/157 (68%), Gaps = 5/157 (3%)
 Frame = +2

Query  8    RASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMDGH  187
            RA  R NVL  H+L    P+ +          C+ Y+P E +E    FDV EMRKL+DGH
Sbjct  5    RALQRVNVLVNHILQSTPPSSNLSLTREI---CLQYSPPELNESCV-FDVKEMRKLLDGH  60

Query  188  NLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFRGW  367
            N+ +RDW+YG+M QS +FN +  GG++ V  DYNQ MEQQRE+TM+RI YL + GVF+GW
Sbjct  61   NVVDRDWIYGLMTQSNLFNRKERGGKIFVSPDYNQTMEQQREITMKRIWYLLENGVFKGW  120

Query  368  LTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            LTE+   +AELRK+AL EV  I+D S++IK+GV  FL
Sbjct  121  LTESG-PDAELRKLALLEVCGIYDHSVSIKVGVHFFL  156



>emb|CDY10192.1| BnaC05g04350D [Brassica napus]
Length=677

 Score =   382 bits (981),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 203/225 (90%), Gaps = 1/225 (0%)
 Frame = +1

Query  691   CIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPD  870
             C+ Y+PPEL+E +  FDV EMR+L+DGHN E+RDWLYGLM+QS LFN + RGGK++V PD
Sbjct  36    CLQYSPPELNE-SYGFDVKEMRRLLDGHNTEDRDWLYGLMMQSNLFNRKERGGKIFVSPD  94

Query  871   FNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGV  1050
             +NQ+MEQQREITM+RI YL + GV+RGWLT+ GPEAEL+KLALL+V  I+DHSLSIKLGV
Sbjct  95    YNQTMEQQREITMKRIWYLLEKGVYRGWLTDSGPEAELKKLALLEVCGIYDHSLSIKLGV  154

Query  1051  HFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGE  1230
             HFFLWG A++FFGTKRHH+KWL+++E+Y+VKGCFAMTELGHGSNVRGIETVTTYD  TGE
Sbjct  155   HFFLWGNAVKFFGTKRHHEKWLKNTEDYVVKGCFAMTELGHGSNVRGIETVTTYDPRTGE  214

Query  1231  FVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             FVINTPCESAQKY IGGAA HATHT+VFSQLNI+G NQGVHAFIA
Sbjct  215   FVINTPCESAQKYWIGGAAKHATHTIVFSQLNINGTNQGVHAFIA  259


 Score =   155 bits (393),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 96/125 (77%), Gaps = 2/125 (2%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGAD  283
            C+ Y+P E +E    FDV EMR+L+DGHN ++RDWLYG+M+QS +FN +  GG++ V  D
Sbjct  36   CLQYSPPELNESYG-FDVKEMRRLLDGHNTEDRDWLYGLMMQSNLFNRKERGGKIFVSPD  94

Query  284  YNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIG  463
            YNQ MEQQRE+TM+RI YL + GV+RGWLT++   EAEL+K+AL EV  I+D SL+IK+G
Sbjct  95   YNQTMEQQREITMKRIWYLLEKGVYRGWLTDSG-PEAELKKLALLEVCGIYDHSLSIKLG  153

Query  464  VQVFL  478
            V  FL
Sbjct  154  VHFFL  158



>ref|XP_003607535.1| Acyl-coenzyme A oxidase 3, peroxisomal [Medicago truncatula]
 gb|AES89732.1| peroxisomal acyl-CoA oxidase [Medicago truncatula]
Length=678

 Score =   382 bits (980),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/252 (71%), Positives = 209/252 (83%), Gaps = 3/252 (1%)
 Frame = +1

Query  613   RTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEP-AASFDVAEMRKLMDGHNLEER  789
             RT +LT HL  + P      +L +  C+ ++PPELSE    +FD  EMRKL+DGHNLE+R
Sbjct  9     RTTILTNHLRHDPPTAP--TILHNHACLSHSPPELSESNPTTFDTFEMRKLLDGHNLEDR  66

Query  790   DWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKG  969
             DWL+GLMIQS LFN R   G+V+V PD+NQSMEQQRE+TM+RIAYL D GVFRGWLT  G
Sbjct  67    DWLFGLMIQSGLFNRREVDGRVFVNPDYNQSMEQQREMTMKRIAYLLDRGVFRGWLTGDG  126

Query  970   PEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGC  1149
             P+ ELRKLAL +V  ++DHSL++KLGVH FLWGGA++F GTKRHHDKWLR +ENY +KGC
Sbjct  127   PQEELRKLALHEVIGMYDHSLAVKLGVHIFLWGGAVKFLGTKRHHDKWLRATENYDIKGC  186

Query  1150  FAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNI  1329
             FAM+ELGHGSNVRGIETVTTYD  +GEFVINTPCESAQKY IGGAANHATHT+VFSQLNI
Sbjct  187   FAMSELGHGSNVRGIETVTTYDPISGEFVINTPCESAQKYWIGGAANHATHTIVFSQLNI  246

Query  1330  DGKNQGVHAFIA  1365
             +G NQGVHAFIA
Sbjct  247   NGSNQGVHAFIA  258


 Score =   171 bits (432),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 110/159 (69%), Gaps = 6/159 (4%)
 Frame = +2

Query  5    ERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEP-AARFDVFEMRKLMD  181
             R + RT +LT HL +              +  C+S++P E SE     FD FEMRKL+D
Sbjct  4    HRITRRTTILTNHLRHDPPTAPTILH----NHACLSHSPPELSESNPTTFDTFEMRKLLD  59

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GHNL++RDWL+G+MIQS +FN R + GRV V  DYNQ+MEQQREMTM+RI YL D GVFR
Sbjct  60   GHNLEDRDWLFGLMIQSGLFNRREVDGRVFVNPDYNQSMEQQREMTMKRIAYLLDRGVFR  119

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT  D  + ELRK+AL EVI ++D SLA+K+GV +FL
Sbjct  120  GWLT-GDGPQEELRKLALHEVIGMYDHSLAVKLGVHIFL  157



>ref|XP_011013714.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Populus 
euphratica]
Length=643

 Score =   380 bits (977),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/259 (68%), Positives = 215/259 (83%), Gaps = 3/259 (1%)
 Frame = +1

Query  589   SSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMD  768
             SS+  A+ RT +L  HL+Q +        LQS+ C+ Y+PPEL+E +  FDV EMRK++D
Sbjct  5     SSINTASRRTRILHNHLVQSHS--KPTSCLQSNSCLSYSPPELAE-SFDFDVKEMRKILD  61

Query  769   GHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFR  948
              HNLE+RDWL+G++ Q  +FN + RGG+++V PD+NQ+MEQQRE+TM+RI YL + G F 
Sbjct  62    FHNLEDRDWLFGVIKQGSVFNGKERGGRLFVSPDYNQTMEQQREMTMKRIEYLLERGAFD  121

Query  949   GWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSE  1128
             GWLT+KG +AEL+KLA L+V  IFDHSLS+K+GVHFFLWGGAIQF GTKRHHDKWLRD+E
Sbjct  122   GWLTKKGVQAELKKLAFLEVIQIFDHSLSVKIGVHFFLWGGAIQFMGTKRHHDKWLRDTE  181

Query  1129  NYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTV  1308
              + +KGCF+MTELGHGSNVRGIETVTTYDS TGEFVINTPCESAQKY IGGAANHATHT+
Sbjct  182   TFAIKGCFSMTELGHGSNVRGIETVTTYDSKTGEFVINTPCESAQKYWIGGAANHATHTI  241

Query  1309  VFSQLNIDGKNQGVHAFIA  1365
             VFSQLNI+G N+GVHA IA
Sbjct  242   VFSQLNINGVNEGVHALIA  260


 Score =   155 bits (393),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 107/159 (67%), Gaps = 6/159 (4%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            +  AS RT +L  HL+   +           S+ C+SY+P E +E +  FDV EMRK++D
Sbjct  7    INTASRRTRILHNHLVQSHSKPTSCLQ----SNSCLSYSPPELAE-SFDFDVKEMRKILD  61

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
             HNL++RDWL+GV+ Q  VFN +  GGR+ V  DYNQ MEQQREMTM+RIEYL + G F 
Sbjct  62   FHNLEDRDWLFGVIKQGSVFNGKERGGRLFVSPDYNQTMEQQREMTMKRIEYLLERGAFD  121

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT+    +AEL+K+A  EVI IFD SL++KIGV  FL
Sbjct  122  GWLTKKG-VQAELKKLAFLEVIQIFDHSLSVKIGVHFFL  159



>ref|XP_011013710.1| PREDICTED: LOW QUALITY PROTEIN: acyl-coenzyme A oxidase 3, peroxisomal-like 
[Populus euphratica]
Length=680

 Score =   381 bits (978),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 177/259 (68%), Positives = 215/259 (83%), Gaps = 3/259 (1%)
 Frame = +1

Query  589   SSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMD  768
             SS+  A+ RT +L  HL+Q +        LQS+ C+ Y+PPEL+E +  FD+ EMRK++D
Sbjct  5     SSINTASRRTRILHNHLVQSHS--KPTSCLQSNSCLSYSPPELTE-SFDFDIKEMRKILD  61

Query  769   GHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFR  948
              HNLE+RDWL+G++ Q  +FN + RGG+++V PD+NQ+MEQQRE+TM+RI YL + G F 
Sbjct  62    FHNLEDRDWLFGVIKQGSVFNGKERGGRLFVSPDYNQTMEQQREMTMKRIEYLLERGAFD  121

Query  949   GWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSE  1128
             GWLT+KG EAEL+KLALL+V  IFDHSL+IK GVHFFLWGGAIQF GTKRHHDKWLRD+E
Sbjct  122   GWLTKKGVEAELKKLALLEVIEIFDHSLAIKTGVHFFLWGGAIQFMGTKRHHDKWLRDTE  181

Query  1129  NYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTV  1308
              + +KGCF+MTELGHGSNVRGIETVTTYDS TGEFVINTPCESAQKY IGGAANHATHT+
Sbjct  182   TFAIKGCFSMTELGHGSNVRGIETVTTYDSKTGEFVINTPCESAQKYWIGGAANHATHTI  241

Query  1309  VFSQLNIDGKNQGVHAFIA  1365
             VFSQLNI+G N+GVHA IA
Sbjct  242   VFSQLNINGVNEGVHALIA  260


 Score =   158 bits (399),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 107/159 (67%), Gaps = 6/159 (4%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            +  AS RT +L  HL+   +           S+ C+SY+P E +E +  FD+ EMRK++D
Sbjct  7    INTASRRTRILHNHLVQSHSKPTSCLQ----SNSCLSYSPPELTE-SFDFDIKEMRKILD  61

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
             HNL++RDWL+GV+ Q  VFN +  GGR+ V  DYNQ MEQQREMTM+RIEYL + G F 
Sbjct  62   FHNLEDRDWLFGVIKQGSVFNGKERGGRLFVSPDYNQTMEQQREMTMKRIEYLLERGAFD  121

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT+    EAEL+K+AL EVI IFD SLAIK GV  FL
Sbjct  122  GWLTKKG-VEAELKKLALLEVIEIFDHSLAIKTGVHFFL  159



>ref|XP_010475360.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Camelina 
sativa]
Length=676

 Score =   379 bits (974),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 175/251 (70%), Positives = 215/251 (86%), Gaps = 1/251 (0%)
 Frame = +1

Query  613   RTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERD  792
             R ++L  H++Q +P    ++ L    C+ Y+PPEL+E +  FDV EMRKL+DGH++ +RD
Sbjct  9     RVNILVNHILQSSPTSSSNLSLTREICLQYSPPELNE-SCVFDVKEMRKLLDGHDVVDRD  67

Query  793   WLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGP  972
             W+YGLM QS LFN + RGGK++V PD+NQ+MEQQREITM+RI YL + GVF+GWLTE GP
Sbjct  68    WIYGLMTQSNLFNRKERGGKIFVSPDYNQTMEQQREITMKRIWYLLENGVFQGWLTESGP  127

Query  973   EAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCF  1152
             EAELRKLALL+V  I+DHS+SIK+GVHFFLWG A++FFGTKRHH+KWL+ +E+Y+VKGCF
Sbjct  128   EAELRKLALLEVCGIYDHSVSIKVGVHFFLWGNAVKFFGTKRHHEKWLKSTEDYVVKGCF  187

Query  1153  AMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNID  1332
             AMTELGHGSNVRGIETVTTYD +T EFVI+TPCESAQKY IGGAANHATHT+VFSQL+I+
Sbjct  188   AMTELGHGSNVRGIETVTTYDPTTEEFVISTPCESAQKYWIGGAANHATHTIVFSQLHIN  247

Query  1333  GKNQGVHAFIA  1365
             G NQGVHAFIA
Sbjct  248   GTNQGVHAFIA  258


 Score =   154 bits (389),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 95/125 (76%), Gaps = 2/125 (2%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGAD  283
            C+ Y+P E +E    FDV EMRKL+DGH++ +RDW+YG+M QS +FN +  GG++ V  D
Sbjct  35   CLQYSPPELNESCV-FDVKEMRKLLDGHDVVDRDWIYGLMTQSNLFNRKERGGKIFVSPD  93

Query  284  YNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIG  463
            YNQ MEQQRE+TM+RI YL + GVF+GWLTE+   EAELRK+AL EV  I+D S++IK+G
Sbjct  94   YNQTMEQQREITMKRIWYLLENGVFQGWLTESG-PEAELRKLALLEVCGIYDHSVSIKVG  152

Query  464  VQVFL  478
            V  FL
Sbjct  153  VHFFL  157



>ref|XP_006852548.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Amborella 
trichopoda]
 gb|ERN14015.1| hypothetical protein AMTR_s00021p00193270 [Amborella trichopoda]
Length=678

 Score =   377 bits (969),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 179/251 (71%), Positives = 208/251 (83%), Gaps = 3/251 (1%)
 Frame = +1

Query  613   RTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERD  792
             RT ++T HL+ E         L++SPC+ +TPPE+SE + SFD  E+R+L+DGH++EERD
Sbjct  11    RTALITGHLLHERSHSSS---LEASPCLQFTPPEVSEGSFSFDNLELRRLLDGHHVEERD  67

Query  793   WLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGP  972
             WL  LM     F PR  GGKV+V  D+NQSM+QQRE+TM+RI++L   GVF GWLT KG 
Sbjct  68    WLLNLMAGCNYFCPREIGGKVFVGADYNQSMKQQREVTMKRISFLLSNGVFEGWLTRKGV  127

Query  973   EAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCF  1152
             EAEL+KLA L+   IFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRD+E Y VKGCF
Sbjct  128   EAELKKLAFLECLGIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDTECYAVKGCF  187

Query  1153  AMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNID  1332
             AM+ELGHGSNVRGIETVTTYDS+TGEFVINTPCESAQKY IGGAANHATHT+VFSQL+I+
Sbjct  188   AMSELGHGSNVRGIETVTTYDSNTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLHIN  247

Query  1333  GKNQGVHAFIA  1365
             G NQGVHAFIA
Sbjct  248   GTNQGVHAFIA  258


 Score =   154 bits (390),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 93/128 (73%), Gaps = 1/128 (1%)
 Frame = +2

Query  95   SSPCISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHV  274
            +SPC+ +TP E SE +  FD  E+R+L+DGH+++ERDWL  +M     F PR +GG+V V
Sbjct  31   ASPCLQFTPPEVSEGSFSFDNLELRRLLDGHHVEERDWLLNLMAGCNYFCPREIGGKVFV  90

Query  275  GADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAI  454
            GADYNQ+M+QQRE+TM+RI +L   GVF GWLT     EAEL+K+A  E + IFD SL+I
Sbjct  91   GADYNQSMKQQREVTMKRISFLLSNGVFEGWLTRKG-VEAELKKLAFLECLGIFDHSLSI  149

Query  455  KIGVQVFL  478
            K+GV  FL
Sbjct  150  KLGVHFFL  157



>ref|XP_002325591.1| acyl-CoA oxidase family protein [Populus trichocarpa]
 gb|EEE99972.1| acyl-CoA oxidase family protein [Populus trichocarpa]
Length=680

 Score =   374 bits (961),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 176/259 (68%), Positives = 214/259 (83%), Gaps = 3/259 (1%)
 Frame = +1

Query  589   SSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMD  768
             SS+ +A+ RT +L  HL+Q +P  D    L+S+ C+ YTPPE +E +  FD  EMRK++D
Sbjct  5     SSINRASRRTRILNNHLVQ-SPS-DPTSCLRSNSCLSYTPPEETE-SLDFDTKEMRKILD  61

Query  769   GHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFR  948
              HNLE+RDWL+G++ Q ++FN + RGG+++V P++NQ+MEQQRE+TM+RI YL + GVF 
Sbjct  62    LHNLEDRDWLFGVIKQGKVFNGKERGGRLFVLPEYNQTMEQQREMTMKRIEYLFERGVFD  121

Query  949   GWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSE  1128
             GWL +KG EAEL+KLA LDV   FD SL++ LGVHFFLWGGAIQF GTKRHHDKWLRD+E
Sbjct  122   GWLMKKGVEAELKKLAFLDVIQNFDQSLAVMLGVHFFLWGGAIQFMGTKRHHDKWLRDTE  181

Query  1129  NYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTV  1308
              + +KGCF+MTELGHGSNVRGIETVTTYD  TGEFVINTPCESAQKY IGGAANHATHT+
Sbjct  182   TFGLKGCFSMTELGHGSNVRGIETVTTYDLKTGEFVINTPCESAQKYWIGGAANHATHTI  241

Query  1309  VFSQLNIDGKNQGVHAFIA  1365
             VFSQLNIDG NQGVHAFIA
Sbjct  242   VFSQLNIDGVNQGVHAFIA  260


 Score =   150 bits (378),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 106/159 (67%), Gaps = 6/159 (4%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            + RAS RT +L  HL+   +           S+ C+SYTP E +E +  FD  EMRK++D
Sbjct  7    INRASRRTRILNNHLVQSPSDPTSCLR----SNSCLSYTPPEETE-SLDFDTKEMRKILD  61

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
             HNL++RDWL+GV+ Q KVFN +  GGR+ V  +YNQ MEQQREMTM+RIEYL + GVF 
Sbjct  62   LHNLEDRDWLFGVIKQGKVFNGKERGGRLFVLPEYNQTMEQQREMTMKRIEYLFERGVFD  121

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWL +    EAEL+K+A  +VI  FD SLA+ +GV  FL
Sbjct  122  GWLMKKG-VEAELKKLAFLDVIQNFDQSLAVMLGVHFFL  159



>ref|XP_007132685.1| hypothetical protein PHAVU_011G116000g [Phaseolus vulgaris]
 gb|ESW04679.1| hypothetical protein PHAVU_011G116000g [Phaseolus vulgaris]
Length=674

 Score =   374 bits (959),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/251 (69%), Positives = 206/251 (82%), Gaps = 3/251 (1%)
 Frame = +1

Query  613   RTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERD  792
             RT +LT HL++  P      +L    C+ Y+PPELS   A FD  EMR+LMDGHNLE+RD
Sbjct  8     RTEILTNHLLRRAPPPSS--VLHPHRCLSYSPPELSNDFA-FDAREMRRLMDGHNLEDRD  64

Query  793   WLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGP  972
             WL+ +++QS LFN R R G+++V PD+NQSMEQQRE T++RI YL   GVFRGWLT + P
Sbjct  65    WLFSVIVQSALFNRRERAGRIFVCPDYNQSMEQQREATLKRIEYLVKRGVFRGWLTGEAP  124

Query  973   EAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCF  1152
             E ELRKLAL +V  ++DHSL++KLGVH+FLWGGA++F GTKRHHDKWL  +ENY +KGCF
Sbjct  125   EEELRKLALHEVLGMYDHSLAVKLGVHYFLWGGAVKFLGTKRHHDKWLSATENYDMKGCF  184

Query  1153  AMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNID  1332
             AM+ELGHGSNVRGIET+TTYDS+TGEFVINTPCES QKY IGGAANHATHT+VFSQLNI+
Sbjct  185   AMSELGHGSNVRGIETITTYDSNTGEFVINTPCESGQKYWIGGAANHATHTIVFSQLNIN  244

Query  1333  GKNQGVHAFIA  1365
             G NQGVHAFIA
Sbjct  245   GSNQGVHAFIA  255


 Score =   155 bits (392),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 106/158 (67%), Gaps = 6/158 (4%)
 Frame = +2

Query  5    ERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMDG  184
             R S RT +LT HLL +  P             C+SY+P E S   A FD  EMR+LMDG
Sbjct  3    HRVSRRTEILTNHLLRRAPPPSSVLHPHR----CLSYSPPELSNDFA-FDAREMRRLMDG  57

Query  185  HNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFRG  364
            HNL++RDWL+ V++QS +FN R   GR+ V  DYNQ+MEQQRE T++RIEYL   GVFRG
Sbjct  58   HNLEDRDWLFSVIVQSALFNRRERAGRIFVCPDYNQSMEQQREATLKRIEYLVKRGVFRG  117

Query  365  WLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            WLT  +  E ELRK+AL EV+ ++D SLA+K+GV  FL
Sbjct  118  WLT-GEAPEEELRKLALHEVLGMYDHSLAVKLGVHYFL  154



>gb|KHG11955.1| Acyl-coenzyme A oxidase 3, peroxisomal -like protein [Gossypium 
arboreum]
Length=671

 Score =   373 bits (957),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 179/256 (70%), Positives = 212/256 (83%), Gaps = 3/256 (1%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             ME+A  RT VLT HL+Q +  +    L  S+ C+ Y+PPELSE  A FDV EMRKL+D H
Sbjct  1     MERAFQRTQVLTNHLLQSSTPLPSQTL-SSNACLSYSPPELSENYA-FDVKEMRKLIDSH  58

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             NLEERDWL+GLM QS LFNP+ +GGKV+V PD+NQSMEQQRE+T++RI YL + GVF+GW
Sbjct  59    NLEERDWLFGLMKQSELFNPKVKGGKVFVSPDYNQSMEQQREMTLKRIKYLQERGVFKGW  118

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LTEKG E E+RK +  ++ +I+DHSL  KLGVHF + GGAIQF GTK HHDKWLRD+ENY
Sbjct  119   LTEKGEEIEMRKFSGFEIFSIYDHSLFTKLGVHFPM-GGAIQFCGTKHHHDKWLRDTENY  177

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
              +KGCFAMTELGHGSN+R +ETVTTYDS+TGEFVINTPCESAQK+ IGGAA HATHTVVF
Sbjct  178   SIKGCFAMTELGHGSNIRSLETVTTYDSNTGEFVINTPCESAQKFWIGGAAKHATHTVVF  237

Query  1315  SQLNIDGKNQGVHAFI  1362
             SQL+I+G NQGVHAFI
Sbjct  238   SQLHINGINQGVHAFI  253


 Score =   162 bits (409),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 110/156 (71%), Gaps = 5/156 (3%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            MERA  RT VLT HLL    P          S+ C+SY+P E SE  A FDV EMRKL+D
Sbjct  1    MERAFQRTQVLTNHLLQSSTPLPSQTLS---SNACLSYSPPELSENYA-FDVKEMRKLID  56

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
             HNL+ERDWL+G+M QS++FNP+  GG+V V  DYNQ+MEQQREMT++RI+YL + GVF+
Sbjct  57   SHNLEERDWLFGLMKQSELFNPKVKGGKVFVSPDYNQSMEQQREMTLKRIKYLQERGVFK  116

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQ  469
            GWLTE  + E E+RK +  E+ +I+D SL  K+GV 
Sbjct  117  GWLTEKGE-EIEMRKFSGFEIFSIYDHSLFTKLGVH  151



>ref|XP_011002667.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Populus 
euphratica]
Length=680

 Score =   373 bits (957),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/259 (68%), Positives = 213/259 (82%), Gaps = 3/259 (1%)
 Frame = +1

Query  589   SSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMD  768
             SS+ +A+ RT +L  HL+Q +P  D    L+ + C+ YTPPE++E +  FD  EMRK++D
Sbjct  5     SSINRASRRTRILNNHLVQ-SPS-DPTSCLRPNSCLSYTPPEVTE-SLDFDTKEMRKILD  61

Query  769   GHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFR  948
              HNLE+RDWL+G++ Q  +FN + RGG+++V PD+NQ+MEQQRE+TM+RI YL + GVF 
Sbjct  62    FHNLEDRDWLFGVIKQGSVFNGKERGGRLFVLPDYNQTMEQQREMTMKRIKYLFERGVFD  121

Query  949   GWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSE  1128
             GWL +KG EAEL+KLA L+V   FD SL++ LGVHFFLWGGAIQF GTKRHHDKWLRD+E
Sbjct  122   GWLMKKGVEAELKKLAFLEVIQNFDQSLAVMLGVHFFLWGGAIQFMGTKRHHDKWLRDTE  181

Query  1129  NYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTV  1308
              + +KGCF+MTELGHGSNVRGIETVTTYD  TGEFVINTPCESAQKY IGGAANHATHT+
Sbjct  182   TFGLKGCFSMTELGHGSNVRGIETVTTYDLKTGEFVINTPCESAQKYWIGGAANHATHTI  241

Query  1309  VFSQLNIDGKNQGVHAFIA  1365
             VFSQLNIDG NQGVHAFIA
Sbjct  242   VFSQLNIDGVNQGVHAFIA  260


 Score =   148 bits (373),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 104/159 (65%), Gaps = 6/159 (4%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            + RAS RT +L  HL+   +            + C+SYTP E +E +  FD  EMRK++D
Sbjct  7    INRASRRTRILNNHLVQSPSDPTSCLR----PNSCLSYTPPEVTE-SLDFDTKEMRKILD  61

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
             HNL++RDWL+GV+ Q  VFN +  GGR+ V  DYNQ MEQQREMTM+RI+YL + GVF 
Sbjct  62   FHNLEDRDWLFGVIKQGSVFNGKERGGRLFVLPDYNQTMEQQREMTMKRIKYLFERGVFD  121

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWL +    EAEL+K+A  EVI  FD SLA+ +GV  FL
Sbjct  122  GWLMKKG-VEAELKKLAFLEVIQNFDQSLAVMLGVHFFL  159



>gb|KHG13766.1| Acyl-coenzyme A oxidase 3, peroxisomal -like protein [Gossypium 
arboreum]
Length=675

 Score =   372 bits (956),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/257 (68%), Positives = 206/257 (80%), Gaps = 1/257 (0%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             M++A  RT +LT HL+Q +P       L S+ C  YTPPELSE  A FD  EMR+L+DGH
Sbjct  1     MDRAFERTKILTDHLLQSSPPSPVQTSLSSNACFNYTPPELSEKYA-FDTKEMRRLIDGH  59

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             +LE RD L+G+M QS+LFNPR RGGKV+V PD+NQ MEQQREIT++RI YL D G F+GW
Sbjct  60    HLEVRDRLFGMMSQSKLFNPRVRGGKVFVSPDYNQPMEQQREITLKRIDYLFDRGAFKGW  119

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LT++G E ELRK A  +V  IFDHS+   L VHFFLWGGA+Q FGTK HH+KWLRD+E  
Sbjct  120   LTDQGEEIELRKFASFEVFGIFDHSMGTMLAVHFFLWGGAVQVFGTKHHHNKWLRDTETR  179

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
             +VKGCFAM+ELGHGSNVRG+ETVTTYDS+T EFVI TPCESAQK+ IGGAANHATH +VF
Sbjct  180   VVKGCFAMSELGHGSNVRGVETVTTYDSNTQEFVITTPCESAQKFWIGGAANHATHAIVF  239

Query  1315  SQLNIDGKNQGVHAFIA  1365
             SQLNI+G NQGVHAFIA
Sbjct  240   SQLNINGSNQGVHAFIA  256


 Score =   150 bits (379),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 106/159 (67%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+RA  RT +LT HLL    P+     +   S+ C +YTP E SE  A FD  EMR+L+D
Sbjct  1    MDRAFERTKILTDHLLQSSPPSPVQTSLS--SNACFNYTPPELSEKYA-FDTKEMRRLID  57

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GH+L+ RD L+G+M QSK+FNPR  GG+V V  DYNQ MEQQRE+T++RI+YL D G F+
Sbjct  58   GHHLEVRDRLFGMMSQSKLFNPRVRGGKVFVSPDYNQPMEQQREITLKRIDYLFDRGAFK  117

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT+  + E ELRK A  EV  IFD S+   + V  FL
Sbjct  118  GWLTDQGE-EIELRKFASFEVFGIFDHSMGTMLAVHFFL  155



>dbj|BAK06462.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=411

 Score =   361 bits (927),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/230 (72%), Positives = 192/230 (83%), Gaps = 0/230 (0%)
 Frame = +1

Query  676   LQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKV  855
             L  SPC+ Y PPE SE   +F   E+R L+DGH+L ERDW YG M +S LF PR  G KV
Sbjct  33    LHFSPCLSYAPPESSEAPPAFAPMELRALLDGHHLRERDWAYGAMEESPLFCPRRAGDKV  92

Query  856   YVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLS  1035
             +V PD+N+  E QRE TMRRI YL+  GVFRGWLTE GP+AELRKLALL+   ++DHSL+
Sbjct  93    FVSPDYNEGKEGQREATMRRIGYLARRGVFRGWLTEPGPDAELRKLALLECLGVYDHSLA  152

Query  1036  IKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYD  1215
             IK+GVHFFLWGGA++F GTKRHHDKWL D+ENY++KGCFAMTELGHGSNVRGIETV TYD
Sbjct  153   IKVGVHFFLWGGAVKFLGTKRHHDKWLLDTENYIIKGCFAMTELGHGSNVRGIETVATYD  212

Query  1216  SSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             S TGEFVINTPCESAQKY IGGAANHATHT+VF+QL+I+G+N+GVHAFIA
Sbjct  213   SKTGEFVINTPCESAQKYWIGGAANHATHTIVFAQLHINGRNEGVHAFIA  262


 Score =   150 bits (379),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 89/127 (70%), Gaps = 1/127 (1%)
 Frame = +2

Query  98   SPCISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVG  277
            SPC+SY P E+SE    F   E+R L+DGH+L+ERDW YG M +S +F PR  G +V V 
Sbjct  36   SPCLSYAPPESSEAPPAFAPMELRALLDGHHLRERDWAYGAMEESPLFCPRRAGDKVFVS  95

Query  278  ADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIK  457
             DYN+  E QRE TMRRI YL+  GVFRGWLTE    +AELRK+AL E + ++D SLAIK
Sbjct  96   PDYNEGKEGQREATMRRIGYLARRGVFRGWLTE-PGPDAELRKLALLECLGVYDHSLAIK  154

Query  458  IGVQVFL  478
            +GV  FL
Sbjct  155  VGVHFFL  161



>ref|NP_172120.2| putative acyl-CoA oxidase [Arabidopsis thaliana]
 sp|Q9LMI7.1|ACO32_ARATH RecName: Full=Putative acyl-coenzyme A oxidase 3.2, peroxisomal; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF82160.1|AC068143_2 Contains similarity to an acyl-CoA oxidase (ASX2) mRNA from Arabidopsis 
thaliana gb|AF057043 and contains an acyl-CoA oxidase 
PF|01756 domain [Arabidopsis thaliana]
 gb|AEE27973.1| acyl-CoA oxidase [Arabidopsis thaliana]
Length=675

 Score =   369 bits (948),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 167/251 (67%), Positives = 208/251 (83%), Gaps = 2/251 (1%)
 Frame = +1

Query  613   RTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERD  792
             R H+L  H+++ +P    +  L    C  Y+PPEL+E +  F+V EMRKL+DGHNLEERD
Sbjct  9     RAHILANHILR-SPRPSSNPSLTPEVCFQYSPPELNE-SYGFEVKEMRKLLDGHNLEERD  66

Query  793   WLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGP  972
             WLYGLM+QS LFNP+ RGG+++V PD+NQ+MEQQR+I+M+RI YL + GVF+GWLTE GP
Sbjct  67    WLYGLMMQSNLFNPKQRGGQIFVSPDYNQTMEQQRQISMKRIFYLLEKGVFQGWLTETGP  126

Query  973   EAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCF  1152
             EAEL+K AL +V  I+D+SLS KLGVHF LWG A++FFGTKRHH+KWL+D+E+Y+VKGCF
Sbjct  127   EAELKKFALYEVCGIYDYSLSAKLGVHFLLWGNAVKFFGTKRHHEKWLKDTEDYVVKGCF  186

Query  1153  AMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNID  1332
             AMTELGHG+NVRGIETVTTYD +T EFVINTPCESAQKY IG AANHA H +V SQL+++
Sbjct  187   AMTELGHGTNVRGIETVTTYDPTTEEFVINTPCESAQKYWIGEAANHANHAIVISQLSMN  246

Query  1333  GKNQGVHAFIA  1365
             G NQG+H FIA
Sbjct  247   GTNQGIHVFIA  257


 Score =   155 bits (391),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 94/125 (75%), Gaps = 2/125 (2%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGAD  283
            C  Y+P E +E    F+V EMRKL+DGHNL+ERDWLYG+M+QS +FNP+  GG++ V  D
Sbjct  34   CFQYSPPELNESYG-FEVKEMRKLLDGHNLEERDWLYGLMMQSNLFNPKQRGGQIFVSPD  92

Query  284  YNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIG  463
            YNQ MEQQR+++M+RI YL + GVF+GWLTE    EAEL+K AL EV  I+D+SL+ K+G
Sbjct  93   YNQTMEQQRQISMKRIFYLLEKGVFQGWLTETG-PEAELKKFALYEVCGIYDYSLSAKLG  151

Query  464  VQVFL  478
            V   L
Sbjct  152  VHFLL  156



>ref|XP_003539950.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X1 [Glycine max]
Length=675

 Score =   369 bits (946),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 178/260 (68%), Positives = 210/260 (81%), Gaps = 4/260 (2%)
 Frame = +1

Query  586   LSSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLM  765
             ++  ++ + RT VLT HL++         LL+  PC+ Y+PPELS    SFD  EMRKLM
Sbjct  1     MTDNDRVSRRTEVLTNHLLRR---TPPPSLLRPLPCLSYSPPELSN-TISFDTREMRKLM  56

Query  766   DGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVF  945
             D HNLE+RDWL+ L++QS LFNPR R G+ +V PD+NQ ME QR+ TM+RIAYL D GVF
Sbjct  57    DCHNLEDRDWLFSLILQSPLFNPRHRAGRFFVCPDYNQPMEHQRQATMKRIAYLLDKGVF  116

Query  946   RGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDS  1125
             RGWLT  GPE ELRKLAL +V  ++DHSL++KLGVHFFLWGGA++F GTKRHHDKWL  +
Sbjct  117   RGWLTGNGPEQELRKLALHEVIGMYDHSLAVKLGVHFFLWGGAVKFLGTKRHHDKWLNST  176

Query  1126  ENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHT  1305
             ENY +KGCFAM+ELGHGSNVRGIETVTTYDS+TGEFVINTPCES QKY IGGAANHATHT
Sbjct  177   ENYDIKGCFAMSELGHGSNVRGIETVTTYDSNTGEFVINTPCESGQKYWIGGAANHATHT  236

Query  1306  VVFSQLNIDGKNQGVHAFIA  1365
             +VFSQL I+G NQGVHAFIA
Sbjct  237   IVFSQLYINGSNQGVHAFIA  256


 Score =   150 bits (379),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 103/158 (65%), Gaps = 7/158 (4%)
 Frame = +2

Query  5    ERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMDG  184
            +R S RT VLT HLL +  P      +   S     Y+P E S   + FD  EMRKLMD 
Sbjct  5    DRVSRRTEVLTNHLLRRTPPPSLLRPLPCLS-----YSPPELSNTIS-FDTREMRKLMDC  58

Query  185  HNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFRG  364
            HNL++RDWL+ +++QS +FNPR   GR  V  DYNQ ME QR+ TM+RI YL D GVFRG
Sbjct  59   HNLEDRDWLFSLILQSPLFNPRHRAGRFFVCPDYNQPMEHQRQATMKRIAYLLDKGVFRG  118

Query  365  WLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            WLT N   E ELRK+AL EVI ++D SLA+K+GV  FL
Sbjct  119  WLTGNG-PEQELRKLALHEVIGMYDHSLAVKLGVHFFL  155



>gb|KJB31620.1| hypothetical protein B456_005G198300 [Gossypium raimondii]
Length=674

 Score =   367 bits (943),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 175/257 (68%), Positives = 206/257 (80%), Gaps = 2/257 (1%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             M++A  RT +LT HL+Q +P       L S+ C  YT PELSE  A FD  EMR+L+DGH
Sbjct  1     MDRAFERTKILTDHLLQSSPS-PVQTSLSSNACFNYTLPELSEKYA-FDTKEMRRLIDGH  58

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             +LE RD L+G+M QS+LFNPR RGGKV+V PD+NQ MEQQREIT++RI YL + G F+GW
Sbjct  59    HLEVRDRLFGMMSQSKLFNPRVRGGKVFVSPDYNQPMEQQREITLKRIDYLFERGAFKGW  118

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LTE+G E ELRK A  +V   FDHS+   L VHFFLWGGA+Q FGTK HHDKWLRD+E +
Sbjct  119   LTEQGEEIELRKFASFEVFGTFDHSMGTMLAVHFFLWGGAVQVFGTKHHHDKWLRDTEAH  178

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
             +VKGCFAM+ELGHGSNVRG+ETVTTYDS+T EFVINTPCESAQK+ IGGAANHATH +VF
Sbjct  179   VVKGCFAMSELGHGSNVRGVETVTTYDSNTQEFVINTPCESAQKFWIGGAANHATHAIVF  238

Query  1315  SQLNIDGKNQGVHAFIA  1365
             SQLNI+G NQGVHAFIA
Sbjct  239   SQLNINGSNQGVHAFIA  255


 Score =   143 bits (361),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 102/159 (64%), Gaps = 5/159 (3%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+RA  RT +LT HLL      +        S+ C +YT  E SE  A FD  EMR+L+D
Sbjct  1    MDRAFERTKILTDHLLQSSPSPVQTSLS---SNACFNYTLPELSEKYA-FDTKEMRRLID  56

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GH+L+ RD L+G+M QSK+FNPR  GG+V V  DYNQ MEQQRE+T++RI+YL + G F+
Sbjct  57   GHHLEVRDRLFGMMSQSKLFNPRVRGGKVFVSPDYNQPMEQQREITLKRIDYLFERGAFK  116

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLTE  + E ELRK A  EV   FD S+   + V  FL
Sbjct  117  GWLTEQGE-EIELRKFASFEVFGTFDHSMGTMLAVHFFL  154



>ref|XP_010689758.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=686

 Score =   364 bits (934),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/257 (67%), Positives = 203/257 (79%), Gaps = 4/257 (2%)
 Frame = +1

Query  598   EKANFRTHVLTRHLIQENPCVDDDILLQSSP-CIGYTPPELSEPAASFDVAEMRKLMDGH  774
             ++ NFRT +L  HL   NP +       SS  C+ Y+PPELSEP A FD  +MR L+D H
Sbjct  13    DQINFRTQILLHHL---NPILSPSPTSLSSSPCLSYSPPELSEPCAVFDTNQMRSLLDSH  69

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             N+E R+WL+ +++QS LFNP  RG + +V PD+N SMEQQREIT +RI YL DCGVF+GW
Sbjct  70    NIEHRNWLFNIILQSNLFNPIIRGHRKFVIPDYNHSMEQQREITFKRILYLRDCGVFKGW  129

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENY  1134
             LT    E ELR +A  +V  +FDHSL+IKLGVHFFLWGGAIQFFGTKRHHDKWL+ +E Y
Sbjct  130   LTGHSQEDELRNMAFNEVLALFDHSLAIKLGVHFFLWGGAIQFFGTKRHHDKWLKITEEY  189

Query  1135  LVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVF  1314
              +KGCFAMTELGHGSNVRGIET+TTYDS+T EF+INTPCESAQKY IGGAA HATHTVVF
Sbjct  190   GIKGCFAMTELGHGSNVRGIETITTYDSNTEEFIINTPCESAQKYWIGGAAKHATHTVVF  249

Query  1315  SQLNIDGKNQGVHAFIA  1365
             SQL I+GK++GVHAFI 
Sbjct  250   SQLKINGKDEGVHAFIV  266


 Score =   155 bits (393),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 108/158 (68%), Gaps = 5/158 (3%)
 Frame = +2

Query  5    ERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMDG  184
            ++ +FRT +L  HL    +P+         SSPC+SY+P E SEP A FD  +MR L+D 
Sbjct  13   DQINFRTQILLHHLNPILSPSPTSLS----SSPCLSYSPPELSEPCAVFDTNQMRSLLDS  68

Query  185  HNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFRG  364
            HN++ R+WL+ +++QS +FNP   G R  V  DYN +MEQQRE+T +RI YL DCGVF+G
Sbjct  69   HNIEHRNWLFNIILQSNLFNPIIRGHRKFVIPDYNHSMEQQREITFKRILYLRDCGVFKG  128

Query  365  WLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            WLT + Q E ELR +A  EV+A+FD SLAIK+GV  FL
Sbjct  129  WLTGHSQ-EDELRNMAFNEVLALFDHSLAIKLGVHFFL  165



>ref|XP_009119067.1| PREDICTED: putative acyl-coenzyme A oxidase 3.2, peroxisomal 
[Brassica rapa]
Length=676

 Score =   360 bits (924),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/259 (66%), Positives = 207/259 (80%), Gaps = 3/259 (1%)
 Frame = +1

Query  592   SMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDG  771
             S   A +R HVL  H++Q +P    +I L    C+ YTPPE++E +  FDV EMRKL+D 
Sbjct  2     SENHALWRAHVLANHILQ-SPPPPLNIFLTREVCLQYTPPEVNE-SYGFDVKEMRKLLDR  59

Query  772   HNLEERDWLYGLMIQSRLFNPRSRGG-KVYVWPDFNQSMEQQREITMRRIAYLSDCGVFR  948
             HNLE+RDWLYG++IQS LFN + RGG KV+V PD+N++MEQQREI+M+RI YL + GVF+
Sbjct  60    HNLEDRDWLYGIIIQSNLFNRKIRGGGKVFVSPDYNETMEQQREISMKRIMYLLEKGVFQ  119

Query  949   GWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSE  1128
             GWLTE  PEAEL+K AL +V  ++D+SLS KLGV F LWG A++ FGTKRHHDKWL+D+E
Sbjct  120   GWLTETSPEAELKKFALYEVCGMYDYSLSAKLGVQFLLWGNAVKLFGTKRHHDKWLKDTE  179

Query  1129  NYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTV  1308
             +YLVKGCFAMTELGHGSNVRGIETVTTYD  T EFVINTPCESAQKY IG AANHATH +
Sbjct  180   DYLVKGCFAMTELGHGSNVRGIETVTTYDPMTEEFVINTPCESAQKYWIGEAANHATHAI  239

Query  1309  VFSQLNIDGKNQGVHAFIA  1365
             V SQL I+G NQG+H FIA
Sbjct  240   VISQLEINGTNQGIHVFIA  258


 Score =   147 bits (371),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPR-SMGGRVHVGA  280
            C+ YTP E +E    FDV EMRKL+D HNL++RDWLYG++IQS +FN +   GG+V V  
Sbjct  34   CLQYTPPEVNESYG-FDVKEMRKLLDRHNLEDRDWLYGIIIQSNLFNRKIRGGGKVFVSP  92

Query  281  DYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKI  460
            DYN+ MEQQRE++M+RI YL + GVF+GWLTE    EAEL+K AL EV  ++D+SL+ K+
Sbjct  93   DYNETMEQQREISMKRIMYLLEKGVFQGWLTET-SPEAELKKFALYEVCGMYDYSLSAKL  151

Query  461  GVQVFL  478
            GVQ  L
Sbjct  152  GVQFLL  157



>ref|XP_002889598.1| acyl-CoA oxidase 6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65857.1| acyl-CoA oxidase 6 [Arabidopsis lyrata subsp. lyrata]
Length=675

 Score =   358 bits (918),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/251 (67%), Positives = 202/251 (80%), Gaps = 2/251 (1%)
 Frame = +1

Query  613   RTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERD  792
             R H+L  H+++       ++ L    C+ Y+PPEL+E    FDV EMRKL+DGHNLE+RD
Sbjct  9     RAHILANHILRSP-SPSSNLSLTPEVCLQYSPPELNE-RYGFDVKEMRKLLDGHNLEDRD  66

Query  793   WLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGP  972
             W YGLM+QS LFN + RGGK +V PD+NQ+MEQQR I+M+RI YL + GVF+GWLTE GP
Sbjct  67    WFYGLMMQSNLFNRKERGGKGFVSPDYNQTMEQQRHISMKRILYLLENGVFQGWLTETGP  126

Query  973   EAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCF  1152
             EAEL K AL +V  I+D+SLS KLGVHF LWG A++FFGTKRHH+KWL+D+E+YLVKGCF
Sbjct  127   EAELNKFALYEVCGIYDYSLSAKLGVHFLLWGNAVKFFGTKRHHEKWLKDTEDYLVKGCF  186

Query  1153  AMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNID  1332
             AMTELGHG+NVRGIETVTTYD+ T EFVINTPCESAQKY IG AANHA H +V SQL+I+
Sbjct  187   AMTELGHGTNVRGIETVTTYDARTEEFVINTPCESAQKYWIGEAANHANHAIVISQLSIN  246

Query  1333  GKNQGVHAFIA  1365
             G NQGVH FIA
Sbjct  247   GTNQGVHVFIA  257


 Score =   146 bits (369),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 90/125 (72%), Gaps = 2/125 (2%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGAD  283
            C+ Y+P E +E    FDV EMRKL+DGHNL++RDW YG+M+QS +FN +  GG+  V  D
Sbjct  34   CLQYSPPELNERYG-FDVKEMRKLLDGHNLEDRDWFYGLMMQSNLFNRKERGGKGFVSPD  92

Query  284  YNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIG  463
            YNQ MEQQR ++M+RI YL + GVF+GWLTE    EAEL K AL EV  I+D+SL+ K+G
Sbjct  93   YNQTMEQQRHISMKRILYLLENGVFQGWLTETG-PEAELNKFALYEVCGIYDYSLSAKLG  151

Query  464  VQVFL  478
            V   L
Sbjct  152  VHFLL  156



>ref|XP_010916040.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Elaeis 
guineensis]
Length=747

 Score =   360 bits (923),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 176/255 (69%), Positives = 203/255 (80%), Gaps = 7/255 (3%)
 Frame = +1

Query  613   RTHVLTRHLIQENPC---VDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLE  783
             R  V+ RHL   +P         LL  + C+ Y+PPE SE  ASFD  EMR+LMDGH+LE
Sbjct  75    RAAVIARHL--RDPAGGTPSASSLLVPAACLHYSPPEASE-KASFDSCEMRRLMDGHDLE  131

Query  784   ERDWLYGLMIQSRLFNPRSRGG-KVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLT  960
              RDWL+ +M +S LF PR RGG KV+V PD+NQ+ EQQRE+TMRRI YL   GVF GWLT
Sbjct  132   ARDWLFRVMEESLLFCPRRRGGEKVFVVPDYNQTKEQQREVTMRRIEYLLGRGVFDGWLT  191

Query  961   EKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLV  1140
              +GPEAE+RK A  +   I+DHSL+IKLGVHFFLWGGAIQFFGTKRHHDKWL+D+ENY V
Sbjct  192   GRGPEAEMRKFAFFECLGIYDHSLAIKLGVHFFLWGGAIQFFGTKRHHDKWLKDTENYDV  251

Query  1141  KGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQ  1320
             KGCFAMTELGHGSNVRGIET+ TYDS+T EFVINTP ESAQKY IGGAA HATHT++FSQ
Sbjct  252   KGCFAMTELGHGSNVRGIETIATYDSNTEEFVINTPYESAQKYWIGGAAKHATHTIIFSQ  311

Query  1321  LNIDGKNQGVHAFIA  1365
             L+I+G NQGVHAFIA
Sbjct  312   LHINGANQGVHAFIA  326


 Score =   142 bits (357),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 90/126 (71%), Gaps = 3/126 (2%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGG-RVHVGA  280
            C+ Y+P EASE A+ FD  EMR+LMDGH+L+ RDWL+ VM +S +F PR  GG +V V  
Sbjct  102  CLHYSPPEASEKAS-FDSCEMRRLMDGHDLEARDWLFRVMEESLLFCPRRRGGEKVFVVP  160

Query  281  DYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKI  460
            DYNQ  EQQRE+TMRRIEYL   GVF GWLT     EAE+RK A  E + I+D SLAIK+
Sbjct  161  DYNQTKEQQREVTMRRIEYLLGRGVFDGWLT-GRGPEAEMRKFAFFECLGIYDHSLAIKL  219

Query  461  GVQVFL  478
            GV  FL
Sbjct  220  GVHFFL  225



>ref|XP_010689760.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=688

 Score =   356 bits (914),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/259 (65%), Positives = 204/259 (79%), Gaps = 6/259 (2%)
 Frame = +1

Query  598   EKANFRTHVLTRHLIQENPCVDDDILLQSSP-CIGYTPPELSEPAA--SFDVAEMRKLMD  768
             ++ NFRT +L  HL   NP +       SS  C+ Y+PPELSEP A  SFD  EMR L+D
Sbjct  13    DQINFRTQILLHHL---NPILSPSPTSLSSSPCLSYSPPELSEPCATISFDTKEMRNLLD  69

Query  769   GHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFR  948
              HN+E+RD LY L+I+S +FNPR  G +V+V PD+NQ MEQQRE+TM R+ YL D GV  
Sbjct  70    MHNIEDRDGLYNLIIESSVFNPRKVGSRVFVSPDYNQPMEQQREVTMERLQYLVDHGVLG  129

Query  949   GWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSE  1128
             GW+TE+G   ELR++AL +V  I+DHSL++ LG H+FLWGGAIQFFGTKRHHDKWL+ +E
Sbjct  130   GWITERGAAIELRRMALNEVVQIYDHSLAVMLGAHYFLWGGAIQFFGTKRHHDKWLKITE  189

Query  1129  NYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTV  1308
              Y +KGCFAMTELGHGSNVRGIET+TTYDS+T EF+INTPCESAQKY IGGAA HATHTV
Sbjct  190   EYGIKGCFAMTELGHGSNVRGIETITTYDSNTEEFIINTPCESAQKYWIGGAAKHATHTV  249

Query  1309  VFSQLNIDGKNQGVHAFIA  1365
             VFSQL I+GK++GVHAFI 
Sbjct  250   VFSQLKINGKDEGVHAFIV  268


 Score =   147 bits (371),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 104/160 (65%), Gaps = 7/160 (4%)
 Frame = +2

Query  5    ERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAA--RFDVFEMRKLM  178
            ++ +FRT +L  HL    +P+            C+SY+P E SEP A   FD  EMR L+
Sbjct  13   DQINFRTQILLHHLNPILSPSPTSLSSSP----CLSYSPPELSEPCATISFDTKEMRNLL  68

Query  179  DGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVF  358
            D HN+++RD LY ++I+S VFNPR +G RV V  DYNQ MEQQRE+TM R++YL D GV 
Sbjct  69   DMHNIEDRDGLYNLIIESSVFNPRKVGSRVFVSPDYNQPMEQQREVTMERLQYLVDHGVL  128

Query  359  RGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
             GW+TE   A  ELR++AL EV+ I+D SLA+ +G   FL
Sbjct  129  GGWITERG-AAIELRRMALNEVVQIYDHSLAVMLGAHYFL  167



>ref|XP_010485961.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Camelina sativa]
Length=623

 Score =   353 bits (907),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = +1

Query  751   MRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLS  930
             MRKL+DGHNL +RDW+YGLM QS LFN + RGGK++V PD+NQ+MEQQREITM+RI YL 
Sbjct  1     MRKLLDGHNLVDRDWIYGLMTQSNLFNRKERGGKIFVSPDYNQTMEQQREITMKRIWYLL  60

Query  931   DCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDK  1110
             + GVF+GWLTE GPEAELRKLALL+V  I+DHS+SIK+GVHFFLWG A++FFGTKRHH+K
Sbjct  61    ENGVFKGWLTESGPEAELRKLALLEVCGIYDHSVSIKVGVHFFLWGNAVKFFGTKRHHEK  120

Query  1111  WLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAAN  1290
             WL+++E+Y+VKGCFAMTELGHGSNVRGIETVTTYD ++ EFVI+TPCESAQKY IGGAAN
Sbjct  121   WLKNTEDYVVKGCFAMTELGHGSNVRGIETVTTYDPTSEEFVISTPCESAQKYWIGGAAN  180

Query  1291  HATHTVVFSQLNIDGKNQGVHAFIA  1365
             HATHT+VFSQL+I+G NQGVHAFIA
Sbjct  181   HATHTIVFSQLHINGTNQGVHAFIA  205


 Score =   142 bits (357),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 83/105 (79%), Gaps = 1/105 (1%)
 Frame = +2

Query  164  MRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLS  343
            MRKL+DGHNL +RDW+YG+M QS +FN +  GG++ V  DYNQ MEQQRE+TM+RI YL 
Sbjct  1    MRKLLDGHNLVDRDWIYGLMTQSNLFNRKERGGKIFVSPDYNQTMEQQREITMKRIWYLL  60

Query  344  DCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            + GVF+GWLTE+   EAELRK+AL EV  I+D S++IK+GV  FL
Sbjct  61   ENGVFKGWLTESG-PEAELRKLALLEVCGIYDHSVSIKVGVHFFL  104



>ref|XP_002525155.1| acyl-CoA oxidase, putative [Ricinus communis]
 gb|EEF37282.1| acyl-CoA oxidase, putative [Ricinus communis]
Length=625

 Score =   353 bits (907),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = +1

Query  751   MRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLS  930
             MRKL+D HN+E+RDWL+GLM QS++FNP  +GG+VY  PD+NQS EQQRE+TM+RI Y+ 
Sbjct  1     MRKLLDMHNIEDRDWLFGLMRQSKVFNPVEKGGRVYAVPDYNQSTEQQREMTMKRIGYML  60

Query  931   DCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDK  1110
             + GVF GWLT KG E+E++K A L+VT IFDHSLS+KLGVHFFLWGGAIQFFGTKRHHDK
Sbjct  61    ERGVFNGWLTGKGLESEMKKFAFLEVTGIFDHSLSVKLGVHFFLWGGAIQFFGTKRHHDK  120

Query  1111  WLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAAN  1290
             WLR++E Y +KGCFAM+ELGHGSNVRGIETV TYDS+TGEFVINTPCESAQKY IGGAAN
Sbjct  121   WLRNTETYALKGCFAMSELGHGSNVRGIETVATYDSNTGEFVINTPCESAQKYWIGGAAN  180

Query  1291  HATHTVVFSQLNIDGKNQGVHAFIA  1365
             HATHT+VFSQLNI+G NQGVHAFIA
Sbjct  181   HATHTIVFSQLNINGTNQGVHAFIA  205


 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 79/105 (75%), Gaps = 1/105 (1%)
 Frame = +2

Query  164  MRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLS  343
            MRKL+D HN+++RDWL+G+M QSKVFNP   GGRV+   DYNQ+ EQQREMTM+RI Y+ 
Sbjct  1    MRKLLDMHNIEDRDWLFGLMRQSKVFNPVEKGGRVYAVPDYNQSTEQQREMTMKRIGYML  60

Query  344  DCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            + GVF GWLT     E+E++K A  EV  IFD SL++K+GV  FL
Sbjct  61   ERGVFNGWLT-GKGLESEMKKFAFLEVTGIFDHSLSVKLGVHFFL  104



>emb|CDY10194.1| BnaC05g04370D [Brassica napus]
Length=674

 Score =   355 bits (911),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 166/251 (66%), Positives = 203/251 (81%), Gaps = 2/251 (1%)
 Frame = +1

Query  613   RTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERD  792
             R +VL  H++Q +P    +I L    C+ YTPPE++E +  F V EMRKL+DGHNLE+RD
Sbjct  9     RANVLANHILQ-SPPQPSNISLAREACLQYTPPEVNE-SYGFQVKEMRKLLDGHNLEDRD  66

Query  793   WLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGP  972
             WLYG++IQS LFN + RGGKV+V PD+N++MEQQREI+M+RI +L + GVF+GWLTE GP
Sbjct  67    WLYGIIIQSNLFNRKIRGGKVFVSPDYNETMEQQREISMKRILHLLEKGVFKGWLTETGP  126

Query  973   EAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCF  1152
             EAEL+K AL +V  ++D+SLS KLGVHF LWG AI+FFGTKRHH+KWL+ +E+YLVKGCF
Sbjct  127   EAELKKFALYEVCGMYDYSLSAKLGVHFLLWGNAIKFFGTKRHHEKWLKHTEDYLVKGCF  186

Query  1153  AMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNID  1332
             AMTELGHGSNV+GIETVTTYD  T EFVINTPCESAQKY IG AA HA H +V SQL I+
Sbjct  187   AMTELGHGSNVKGIETVTTYDPRTEEFVINTPCESAQKYWIGEAAIHANHAIVISQLEIN  246

Query  1333  GKNQGVHAFIA  1365
               NQG+H FIA
Sbjct  247   ETNQGIHVFIA  257


 Score =   149 bits (375),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 93/125 (74%), Gaps = 2/125 (2%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGAD  283
            C+ YTP E +E    F V EMRKL+DGHNL++RDWLYG++IQS +FN +  GG+V V  D
Sbjct  34   CLQYTPPEVNESYG-FQVKEMRKLLDGHNLEDRDWLYGIIIQSNLFNRKIRGGKVFVSPD  92

Query  284  YNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIG  463
            YN+ MEQQRE++M+RI +L + GVF+GWLTE    EAEL+K AL EV  ++D+SL+ K+G
Sbjct  93   YNETMEQQREISMKRILHLLEKGVFKGWLTETG-PEAELKKFALYEVCGMYDYSLSAKLG  151

Query  464  VQVFL  478
            V   L
Sbjct  152  VHFLL  156



>ref|XP_003573815.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Brachypodium 
distachyon]
Length=686

 Score =   352 bits (903),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/235 (69%), Positives = 195/235 (83%), Gaps = 5/235 (2%)
 Frame = +1

Query  676   LQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPR-----S  840
             LQSSPC+ Y PPE +E   +F   E+R L+DGH+L ERDWL+G M +S LF PR      
Sbjct  32    LQSSPCLSYAPPESTENPPAFSPIELRALLDGHHLRERDWLFGAMEESPLFCPRRVGGGG  91

Query  841   RGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIF  1020
              GGKV+V PD+N+  E QRE TMRRIAYL+  GVFRGWLTE GP+AELRKLA+LD   ++
Sbjct  92    GGGKVFVSPDYNEGKEGQREATMRRIAYLTGRGVFRGWLTEPGPDAELRKLAMLDCLGVY  151

Query  1021  DHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIET  1200
             DHSL+IK+GVHFFLWG AI+F GTKRHHDKWL ++ENY++KGCFAMTELGHGSNVRGIET
Sbjct  152   DHSLAIKVGVHFFLWGSAIKFLGTKRHHDKWLVETENYVIKGCFAMTELGHGSNVRGIET  211

Query  1201  VTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             + TYDS + EFVINTPCESAQKY IGGAANHATHT+VF+QL+I+G+N+GVHAF+A
Sbjct  212   IATYDSKSREFVINTPCESAQKYWIGGAANHATHTIVFAQLHINGRNEGVHAFVA  266


 Score =   142 bits (359),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 93/133 (70%), Gaps = 6/133 (5%)
 Frame = +2

Query  95   SSPCISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSM-----G  259
            SSPC+SY P E++E    F   E+R L+DGH+L+ERDWL+G M +S +F PR +     G
Sbjct  34   SSPCLSYAPPESTENPPAFSPIELRALLDGHHLRERDWLFGAMEESPLFCPRRVGGGGGG  93

Query  260  GRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFD  439
            G+V V  DYN+  E QRE TMRRI YL+  GVFRGWLTE    +AELRK+A+ + + ++D
Sbjct  94   GKVFVSPDYNEGKEGQREATMRRIAYLTGRGVFRGWLTE-PGPDAELRKLAMLDCLGVYD  152

Query  440  FSLAIKIGVQVFL  478
             SLAIK+GV  FL
Sbjct  153  HSLAIKVGVHFFL  165



>ref|XP_008784451.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Phoenix 
dactylifera]
Length=689

 Score =   352 bits (904),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 171/267 (64%), Positives = 207/267 (78%), Gaps = 7/267 (3%)
 Frame = +1

Query  577   SSSLSSMEKANFRTHVLTRHLIQE---NPCVDDDILLQSSPCIGYTPPELSEPAASFDVA  747
             + S S+ ++   R  V+ RHL +     P       L  + C+ Y+PPE+SE AA FD  
Sbjct  5     APSSSAADQVVRRAAVIARHLREHAGGTPSASP--FLVPAACLRYSPPEVSEKAA-FDSR  61

Query  748   EMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGG-KVYVWPDFNQSMEQQREITMRRIAY  924
             EMR+LMD H+LE RDWL+ +M ++RLF PR RGG K +V PD+NQ+ EQQRE TMRRI Y
Sbjct  62    EMRRLMDDHDLEARDWLFRVMEENRLFCPRRRGGEKAFVAPDYNQTKEQQREATMRRIEY  121

Query  925   LSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHH  1104
             L   GVF GWLT +G EAE+RK AL +   I+DHS++IKLGV FFLWGGAIQF GTKRHH
Sbjct  122   LLGRGVFEGWLTGRGLEAEMRKFALFECVGIYDHSIAIKLGVQFFLWGGAIQFLGTKRHH  181

Query  1105  DKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGA  1284
             DKWL+D+ENY+VKGCFAMTELGHGSNVRGIET+ TYDS+T EFVI+TPCESAQKY IGGA
Sbjct  182   DKWLKDTENYVVKGCFAMTELGHGSNVRGIETIATYDSNTEEFVISTPCESAQKYWIGGA  241

Query  1285  ANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             A HATHT++FSQL+I+G +QGVHAFIA
Sbjct  242   AKHATHTIIFSQLHINGTSQGVHAFIA  268


 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 89/126 (71%), Gaps = 3/126 (2%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGG-RVHVGA  280
            C+ Y+P E SE AA FD  EMR+LMD H+L+ RDWL+ VM ++++F PR  GG +  V  
Sbjct  44   CLRYSPPEVSEKAA-FDSREMRRLMDDHDLEARDWLFRVMEENRLFCPRRRGGEKAFVAP  102

Query  281  DYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKI  460
            DYNQ  EQQRE TMRRIEYL   GVF GWLT     EAE+RK AL E + I+D S+AIK+
Sbjct  103  DYNQTKEQQREATMRRIEYLLGRGVFEGWLT-GRGLEAEMRKFALFECVGIYDHSIAIKL  161

Query  461  GVQVFL  478
            GVQ FL
Sbjct  162  GVQFFL  167



>ref|NP_001057591.1| Os06g0354500 [Oryza sativa Japonica Group]
 dbj|BAD35410.1| putative acyl-CoA oxidase ACX3 [Oryza sativa Japonica Group]
 dbj|BAF19505.1| Os06g0354500 [Oryza sativa Japonica Group]
 dbj|BAG90186.1| unnamed protein product [Oryza sativa Japonica Group]
Length=685

 Score =   352 bits (903),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 190/230 (83%), Gaps = 0/230 (0%)
 Frame = +1

Query  676   LQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKV  855
             L+ S C+ Y PPE SEPA +F   E+R L+DGH+L ERDW +  M +S LF  R  GGKV
Sbjct  36    LEPSACLSYAPPESSEPAPAFSPLELRSLLDGHHLRERDWAFRAMEESPLFCQRRSGGKV  95

Query  856   YVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLS  1035
             +V PD+N+  E QRE TMRR+ YL+  GVFRGWLTE GP+AELRKLALL+   ++DHSL+
Sbjct  96    FVSPDYNEGKEGQREATMRRVGYLARRGVFRGWLTEPGPDAELRKLALLECLGMYDHSLA  155

Query  1036  IKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYD  1215
             IK+GVHFFLWG AI+F GTKRHHDKWL D+ENY++KGCF+MTELGHGSNVRGIETV TYD
Sbjct  156   IKIGVHFFLWGSAIKFLGTKRHHDKWLSDTENYVIKGCFSMTELGHGSNVRGIETVATYD  215

Query  1216  SSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
               T EFVINTPCESAQKY IGGAANHATHT+VF+QL+I+G+N+GVHAF+A
Sbjct  216   IKTREFVINTPCESAQKYWIGGAANHATHTIVFAQLHINGRNEGVHAFVA  265


 Score =   147 bits (370),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 89/127 (70%), Gaps = 1/127 (1%)
 Frame = +2

Query  98   SPCISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVG  277
            S C+SY P E+SEPA  F   E+R L+DGH+L+ERDW +  M +S +F  R  GG+V V 
Sbjct  39   SACLSYAPPESSEPAPAFSPLELRSLLDGHHLRERDWAFRAMEESPLFCQRRSGGKVFVS  98

Query  278  ADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIK  457
             DYN+  E QRE TMRR+ YL+  GVFRGWLTE    +AELRK+AL E + ++D SLAIK
Sbjct  99   PDYNEGKEGQREATMRRVGYLARRGVFRGWLTE-PGPDAELRKLALLECLGMYDHSLAIK  157

Query  458  IGVQVFL  478
            IGV  FL
Sbjct  158  IGVHFFL  164



>ref|XP_009405080.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=683

 Score =   351 bits (901),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 162/253 (64%), Positives = 195/253 (77%), Gaps = 2/253 (1%)
 Frame = +1

Query  613   RTHVLTRHLIQENPCVD--DDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEE  786
             RT VL  HL++ +   D     L++ + C+ Y+PPELSE   SFD A +R+++DGH+ E 
Sbjct  10    RTAVLAGHLLRGSAPADGLSSALIEPAACLHYSPPELSEQPPSFDTASLRRVLDGHDTEG  69

Query  787   RDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEK  966
             RDWL+ LM +S LF PR RG + +V PD+NQ+MEQQR +TMRRI YL   GVF GWLT  
Sbjct  70    RDWLFRLMEESSLFCPRRRGNRTFVAPDYNQTMEQQRAVTMRRIEYLLANGVFEGWLTGS  129

Query  967   GPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKG  1146
             GPEA +RK A  +   IFDHSL+IKLGVHFFLWGGA+Q FGTK HHDKWL+ +ENY V+G
Sbjct  130   GPEALMRKFAFFECIGIFDHSLAIKLGVHFFLWGGAVQIFGTKHHHDKWLKAAENYQVQG  189

Query  1147  CFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLN  1326
             CF MTELGHGSNVRG+ET+ TYD++ GEFVINTPCESAQKY IGGAAN ATH V+FSQL 
Sbjct  190   CFVMTELGHGSNVRGLETIATYDANAGEFVINTPCESAQKYWIGGAANDATHAVIFSQLL  249

Query  1327  IDGKNQGVHAFIA  1365
             I+G NQGVH FIA
Sbjct  250   INGTNQGVHVFIA  262


 Score =   141 bits (355),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 96/156 (62%), Gaps = 1/156 (1%)
 Frame = +2

Query  11   ASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMDGHN  190
            A+ RT VL  HLL    P       L++ + C+ Y+P E SE    FD   +R+++DGH+
Sbjct  7    AARRTAVLAGHLLRGSAPADGLSSALIEPAACLHYSPPELSEQPPSFDTASLRRVLDGHD  66

Query  191  LQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFRGWL  370
             + RDWL+ +M +S +F PR  G R  V  DYNQ MEQQR +TMRRIEYL   GVF GWL
Sbjct  67   TEGRDWLFRLMEESSLFCPRRRGNRTFVAPDYNQTMEQQRAVTMRRIEYLLANGVFEGWL  126

Query  371  TENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            T     EA +RK A  E I IFD SLAIK+GV  FL
Sbjct  127  T-GSGPEALMRKFAFFECIGIFDHSLAIKLGVHFFL  161



>emb|CDY57822.1| BnaA10g28090D [Brassica napus]
Length=675

 Score =   351 bits (900),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 202/252 (80%), Gaps = 3/252 (1%)
 Frame = +1

Query  613   RTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERD  792
             R +VL  H++Q +P     I L    C+ YTPPE++E +  F V EMRKL+DGHNLE+RD
Sbjct  9     RANVLANHILQ-SPHHPSTISLAREACLQYTPPEVNE-SYGFQVKEMRKLLDGHNLEDRD  66

Query  793   WLYGLMIQSRLFNPRSRGG-KVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKG  969
             WLYG++IQS LFN + RGG KV+V PD+N++MEQQREI+M+RI Y  + GVF+GWLTE G
Sbjct  67    WLYGIIIQSNLFNRKERGGGKVFVSPDYNETMEQQREISMKRIMYFLENGVFKGWLTETG  126

Query  970   PEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGC  1149
             PE+EL+K AL +V  ++D+SLS KLGVHF LWG AI+FFGTKRHH+KWL+D+E+YLVKGC
Sbjct  127   PESELKKFALYEVCGMYDYSLSAKLGVHFLLWGNAIKFFGTKRHHEKWLKDTEDYLVKGC  186

Query  1150  FAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNI  1329
             FAMTELGHGSNV+GIETVT+YD  T EFVINTPCESAQKY IG AA HA H +V SQL I
Sbjct  187   FAMTELGHGSNVKGIETVTSYDPRTEEFVINTPCESAQKYWIGEAAIHANHAIVISQLEI  246

Query  1330  DGKNQGVHAFIA  1365
             +  NQG+H FIA
Sbjct  247   NETNQGIHVFIA  258


 Score =   144 bits (364),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 92/126 (73%), Gaps = 3/126 (2%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSM-GGRVHVGA  280
            C+ YTP E +E    F V EMRKL+DGHNL++RDWLYG++IQS +FN +   GG+V V  
Sbjct  34   CLQYTPPEVNESYG-FQVKEMRKLLDGHNLEDRDWLYGIIIQSNLFNRKERGGGKVFVSP  92

Query  281  DYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKI  460
            DYN+ MEQQRE++M+RI Y  + GVF+GWLTE    E+EL+K AL EV  ++D+SL+ K+
Sbjct  93   DYNETMEQQREISMKRIMYFLENGVFKGWLTETG-PESELKKFALYEVCGMYDYSLSAKL  151

Query  461  GVQVFL  478
            GV   L
Sbjct  152  GVHFLL  157



>ref|XP_004965421.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Setaria 
italica]
Length=687

 Score =   350 bits (899),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/264 (63%), Positives = 201/264 (76%), Gaps = 6/264 (2%)
 Frame = +1

Query  592   SMEKANFRTHVLTRHLI----QENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRK  759
             ++  A  R   + RHL        P      LL  SPC+ Y  PE +EPA +F  AE+R 
Sbjct  4     ALSPAGRRAATIARHLAGALPSPPPLAATVALLGPSPCLSYALPESTEPAPAFPPAELRA  63

Query  760   LMDGHNLEERDWLYGLMIQSRLFNPRSR--GGKVYVWPDFNQSMEQQREITMRRIAYLSD  933
             L+DGH+L ERDW++ +M +S+LF PR R  G +V+V PD+N   E QRE TMRR+A+L+ 
Sbjct  64    LLDGHHLWERDWVFRVMEESQLFCPRQRCSGSRVFVAPDYNDGKEAQREATMRRVAHLAR  123

Query  934   CGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKW  1113
              GVFRGWLTE G EAELRKLALL+   ++DHSL+IK+GVHFFLWG AI+F GTKRHHDKW
Sbjct  124   RGVFRGWLTEPGAEAELRKLALLESLGVYDHSLAIKIGVHFFLWGSAIKFLGTKRHHDKW  183

Query  1114  LRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANH  1293
             L  +ENY +KGCFAMTELGHGSNVRGIET+ TYDS   EF+INTPCESAQKY IGGAANH
Sbjct  184   LFATENYDIKGCFAMTELGHGSNVRGIETIATYDSKAREFIINTPCESAQKYWIGGAANH  243

Query  1294  ATHTVVFSQLNIDGKNQGVHAFIA  1365
             ATHT+VFSQL+I+GKN+GVHAF+A
Sbjct  244   ATHTIVFSQLHINGKNEGVHAFVA  267


 Score =   145 bits (365),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 91/129 (71%), Gaps = 3/129 (2%)
 Frame = +2

Query  98   SPCISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRS--MGGRVH  271
            SPC+SY   E++EPA  F   E+R L+DGH+L ERDW++ VM +S++F PR    G RV 
Sbjct  39   SPCLSYALPESTEPAPAFPPAELRALLDGHHLWERDWVFRVMEESQLFCPRQRCSGSRVF  98

Query  272  VGADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLA  451
            V  DYN   E QRE TMRR+ +L+  GVFRGWLTE   AEAELRK+AL E + ++D SLA
Sbjct  99   VAPDYNDGKEAQREATMRRVAHLARRGVFRGWLTE-PGAEAELRKLALLESLGVYDHSLA  157

Query  452  IKIGVQVFL  478
            IKIGV  FL
Sbjct  158  IKIGVHFFL  166



>ref|XP_006417936.1| hypothetical protein EUTSA_v10009440mg, partial [Eutrema salsugineum]
 gb|ESQ36289.1| hypothetical protein EUTSA_v10009440mg, partial [Eutrema salsugineum]
Length=648

 Score =   349 bits (895),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/233 (67%), Positives = 191/233 (82%), Gaps = 0/233 (0%)
 Frame = +1

Query  667   DILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRG  846
             ++ L    C+ Y+PPE    +  F++ EMRKL+DGHN+EERDWLYGLM+QS LFN + RG
Sbjct  15    NLSLTRDVCLQYSPPEELNGSYGFEIKEMRKLLDGHNVEERDWLYGLMMQSNLFNRKERG  74

Query  847   GKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDH  1026
             GK++V PD+NQ+MEQQRE+TM+RI YL   GVF+GWLTE GP+AE +K AL +V  I+D+
Sbjct  75    GKIFVSPDYNQTMEQQREVTMKRIWYLLQKGVFKGWLTETGPDAEQKKFALYEVCGIYDY  134

Query  1027  SLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVT  1206
             S+  KLGVHF LWG A++FFGTKRH DKWL+D+E+Y+VKGC  MTELGHGSNV+GIETVT
Sbjct  135   SIIAKLGVHFLLWGNAVKFFGTKRHDDKWLKDTEDYVVKGCLVMTELGHGSNVKGIETVT  194

Query  1207  TYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             TYD  TGEFVINTPCESAQKY IG AAN+ATH +V SQLNI+G NQG+H FIA
Sbjct  195   TYDPRTGEFVINTPCESAQKYWIGEAANYATHAIVISQLNINGTNQGIHVFIA  247


 Score =   147 bits (371),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 90/125 (72%), Gaps = 1/125 (1%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGAD  283
            C+ Y+P E    +  F++ EMRKL+DGHN++ERDWLYG+M+QS +FN +  GG++ V  D
Sbjct  23   CLQYSPPEELNGSYGFEIKEMRKLLDGHNVEERDWLYGLMMQSNLFNRKERGGKIFVSPD  82

Query  284  YNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIG  463
            YNQ MEQQRE+TM+RI YL   GVF+GWLTE    +AE +K AL EV  I+D+S+  K+G
Sbjct  83   YNQTMEQQREVTMKRIWYLLQKGVFKGWLTETG-PDAEQKKFALYEVCGIYDYSIIAKLG  141

Query  464  VQVFL  478
            V   L
Sbjct  142  VHFLL  146



>ref|XP_006656066.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like, partial 
[Oryza brachyantha]
Length=647

 Score =   348 bits (894),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 189/227 (83%), Gaps = 0/227 (0%)
 Frame = +1

Query  685   SPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVW  864
             S C+ Y  PE SEPA +F   E+R L+DGH++ ERDW +  M +S LF PR  GG+V+V 
Sbjct  1     SACLSYGSPESSEPAPAFSPLELRLLLDGHHVRERDWAFRAMEESPLFCPRRCGGRVFVS  60

Query  865   PDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKL  1044
             PD+N+  E QRE TMRR+ YL+  GVFRGWLTE GPEAELRKLALL+   ++DHSL+IK+
Sbjct  61    PDYNEGKEGQREATMRRVGYLARRGVFRGWLTEPGPEAELRKLALLECLGVYDHSLAIKI  120

Query  1045  GVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSST  1224
             GVHFFLWG AI+F GTKRHHDKWL D+ENY++KGCF+MTELGHGSNVRGIETV TYDS T
Sbjct  121   GVHFFLWGSAIKFLGTKRHHDKWLSDTENYVIKGCFSMTELGHGSNVRGIETVATYDSKT  180

Query  1225  GEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
              EF+INTPCESAQKY IGGAANHATHT+VF+QL+I+G+N+GVHAF+A
Sbjct  181   REFMINTPCESAQKYWIGGAANHATHTIVFAQLHINGRNEGVHAFVA  227


 Score =   147 bits (372),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 89/127 (70%), Gaps = 1/127 (1%)
 Frame = +2

Query  98   SPCISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVG  277
            S C+SY   E+SEPA  F   E+R L+DGH+++ERDW +  M +S +F PR  GGRV V 
Sbjct  1    SACLSYGSPESSEPAPAFSPLELRLLLDGHHVRERDWAFRAMEESPLFCPRRCGGRVFVS  60

Query  278  ADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIK  457
             DYN+  E QRE TMRR+ YL+  GVFRGWLTE    EAELRK+AL E + ++D SLAIK
Sbjct  61   PDYNEGKEGQREATMRRVGYLARRGVFRGWLTE-PGPEAELRKLALLECLGVYDHSLAIK  119

Query  458  IGVQVFL  478
            IGV  FL
Sbjct  120  IGVHFFL  126



>gb|KHN07770.1| Acyl-coenzyme A oxidase 3, peroxisomal [Glycine soja]
Length=624

 Score =   345 bits (885),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = +1

Query  751   MRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLS  930
             MRKLMD HNLEERDW++ L++QS LFNPR R G+V+V PD+NQ ME QR+ TM+RI YL 
Sbjct  1     MRKLMDCHNLEERDWIFSLILQSPLFNPRHRAGRVFVSPDYNQPMEHQRQATMKRIGYLL  60

Query  931   DCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDK  1110
               GVFRGWLT  GPE ELRKLAL +V  ++DHSL++KLGVHFFLWGGA++F GTKRHHDK
Sbjct  61    QKGVFRGWLTGNGPEQELRKLALHEVIGMYDHSLAVKLGVHFFLWGGAVKFLGTKRHHDK  120

Query  1111  WLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAAN  1290
             WL  +ENY +KGCFAM+ELGHGSNVRGIETVTTYDS+TGEFVINTPCES QKY IGGAAN
Sbjct  121   WLNSTENYDIKGCFAMSELGHGSNVRGIETVTTYDSNTGEFVINTPCESGQKYWIGGAAN  180

Query  1291  HATHTVVFSQLNIDGKNQGVHAFIA  1365
             HATHT+VFSQL I+G NQGVHAFIA
Sbjct  181   HATHTIVFSQLYINGSNQGVHAFIA  205


 Score =   137 bits (346),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 79/105 (75%), Gaps = 1/105 (1%)
 Frame = +2

Query  164  MRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLS  343
            MRKLMD HNL+ERDW++ +++QS +FNPR   GRV V  DYNQ ME QR+ TM+RI YL 
Sbjct  1    MRKLMDCHNLEERDWIFSLILQSPLFNPRHRAGRVFVSPDYNQPMEHQRQATMKRIGYLL  60

Query  344  DCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
              GVFRGWLT N   E ELRK+AL EVI ++D SLA+K+GV  FL
Sbjct  61   QKGVFRGWLTGNG-PEQELRKLALHEVIGMYDHSLAVKLGVHFFL  104



>ref|XP_009388733.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=679

 Score =   345 bits (884),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = +1

Query  691   CIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPD  870
             C+ Y PPELSE   +FD+A +R+++DGH+L  RDWL+ LM +S LF PR RG + +V PD
Sbjct  34    CLHYDPPELSEKPPAFDLAALRRVLDGHDLAARDWLFRLMEESPLFCPRRRGDRTFVAPD  93

Query  871   FNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGV  1050
             +NQ+ EQQR +TMRRI YL   GVF GW+T  GPEAELRKLA  +   I+DHSLS+KLGV
Sbjct  94    YNQTKEQQRAVTMRRIEYLLRRGVFEGWITGSGPEAELRKLAFFECIAIYDHSLSVKLGV  153

Query  1051  HFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGE  1230
              FFLWGGAI+FFGTKRHHDKWL+ +E+Y VKGCFAMTELGHGSNVRGIET+  YD++T E
Sbjct  154   TFFLWGGAIRFFGTKRHHDKWLKATEDYQVKGCFAMTELGHGSNVRGIETIAIYDTNTRE  213

Query  1231  FVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             FVINTPCESAQKY IGGAANHATHT++FSQL I+G +QG+HAF+A
Sbjct  214   FVINTPCESAQKYWIGGAANHATHTIIFSQLLINGTSQGIHAFVA  258


 Score =   136 bits (343),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGAD  283
            C+ Y P E SE    FD+  +R+++DGH+L  RDWL+ +M +S +F PR  G R  V  D
Sbjct  34   CLHYDPPELSEKPPAFDLAALRRVLDGHDLAARDWLFRLMEESPLFCPRRRGDRTFVAPD  93

Query  284  YNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIG  463
            YNQ  EQQR +TMRRIEYL   GVF GW+T     EAELRK+A  E IAI+D SL++K+G
Sbjct  94   YNQTKEQQRAVTMRRIEYLLRRGVFEGWIT-GSGPEAELRKLAFFECIAIYDHSLSVKLG  152

Query  464  VQVFL  478
            V  FL
Sbjct  153  VTFFL  157



>ref|XP_010689759.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=664

 Score =   340 bits (872),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 185/225 (82%), Gaps = 1/225 (0%)
 Frame = +1

Query  688   PCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWP  867
             PC  Y+ P LSE   SFD  EMR L+D HN+E+RD LY L+I+S +FNPR  G +V+V P
Sbjct  20    PCSTYSDPHLSE-TISFDTKEMRNLLDMHNIEDRDGLYNLIIESSVFNPRKVGSRVFVSP  78

Query  868   DFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLG  1047
             D+NQ MEQQRE+TM R+ YL D GV  GW+TE+G   ELR++AL +V  I+DHSL++ LG
Sbjct  79    DYNQPMEQQREVTMERLQYLVDHGVLGGWITERGAAIELRRMALNEVVQIYDHSLAVMLG  138

Query  1048  VHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTG  1227
              H+FLWGGAIQFFGTKRHHDKWL+ +E Y +KGCFAMTELGHGSNVRGIET+TTYDS+T 
Sbjct  139   AHYFLWGGAIQFFGTKRHHDKWLKITEEYGIKGCFAMTELGHGSNVRGIETITTYDSNTE  198

Query  1228  EFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             EF+INTPCESAQKY IGGAA HATHTVVFSQL I+GK++GVHAFI
Sbjct  199   EFIINTPCESAQKYWIGGAAKHATHTVVFSQLKINGKDEGVHAFI  243


 Score =   137 bits (346),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 88/126 (70%), Gaps = 2/126 (2%)
 Frame = +2

Query  101  PCISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGA  280
            PC +Y+    SE  + FD  EMR L+D HN+++RD LY ++I+S VFNPR +G RV V  
Sbjct  20   PCSTYSDPHLSETIS-FDTKEMRNLLDMHNIEDRDGLYNLIIESSVFNPRKVGSRVFVSP  78

Query  281  DYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKI  460
            DYNQ MEQQRE+TM R++YL D GV  GW+TE   A  ELR++AL EV+ I+D SLA+ +
Sbjct  79   DYNQPMEQQREVTMERLQYLVDHGVLGGWITERGAA-IELRRMALNEVVQIYDHSLAVML  137

Query  461  GVQVFL  478
            G   FL
Sbjct  138  GAHYFL  143



>gb|ACN41105.1| unknown [Picea sitchensis]
Length=680

 Score =   334 bits (856),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 196/252 (78%), Gaps = 3/252 (1%)
 Frame = +1

Query  613   RTHVLTRHLIQENPCVDDDIL-LQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEER  789
             R  V+ RHLI  NP    +I  LQ+S C+ Y+PPE      +FD+  MR+L+DGHN+E+R
Sbjct  11    RASVIARHLI--NPDTYHEISSLQTSSCLQYSPPENFSGKPTFDIGAMRELIDGHNIEDR  68

Query  790   DWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKG  969
             DW++ LM  S LF P+ RGG++YV PD+N+ ME QRE+TM+RI YL D GVF+GWLT+  
Sbjct  69    DWIFNLMANSDLFCPKRRGGQIYVLPDYNKPMEHQREMTMKRILYLLDKGVFKGWLTKPS  128

Query  970   PEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGC  1149
              E E R   L +   ++DHSL +KLGVH+ LWGGAI+F GTK H +KWL+D+E+++++G 
Sbjct  129   LEMEARSSTLHECLGLYDHSLGVKLGVHYNLWGGAIKFLGTKGHREKWLQDTEDFVIRGS  188

Query  1150  FAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNI  1329
             FAMTELGHGSNVRGIET+TTYD ST EFVI TPCESAQKY IGGAANHATHTVVFSQL I
Sbjct  189   FAMTELGHGSNVRGIETITTYDPSTQEFVITTPCESAQKYWIGGAANHATHTVVFSQLII  248

Query  1330  DGKNQGVHAFIA  1365
             +GKN+GVHAF+A
Sbjct  249   NGKNEGVHAFVA  260


 Score =   131 bits (329),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 85/128 (66%), Gaps = 1/128 (1%)
 Frame = +2

Query  95   SSPCISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHV  274
            +S C+ Y+P E       FD+  MR+L+DGHN+++RDW++ +M  S +F P+  GG+++V
Sbjct  33   TSSCLQYSPPENFSGKPTFDIGAMRELIDGHNIEDRDWIFNLMANSDLFCPKRRGGQIYV  92

Query  275  GADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAI  454
              DYN+ ME QREMTM+RI YL D GVF+GWLT+    E E R   L E + ++D SL +
Sbjct  93   LPDYNKPMEHQREMTMKRILYLLDKGVFKGWLTK-PSLEMEARSSTLHECLGLYDHSLGV  151

Query  455  KIGVQVFL  478
            K+GV   L
Sbjct  152  KLGVHYNL  159



>gb|AGT17248.1| acyl-coenzyme A oxidase [Saccharum hybrid cultivar R570]
Length=682

 Score =   332 bits (851),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/232 (67%), Positives = 186/232 (80%), Gaps = 2/232 (1%)
 Frame = +1

Query  676   LQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLF-NPRSR-GG  849
             L+ S C+ Y PPE +E  A+F   ++R L+DGH+L  RDWL+ +M +S LF +P +R G 
Sbjct  33    LEPSCCLSYVPPESTERPAAFAPGDLRVLLDGHDLPARDWLFRVMEESPLFRSPCARTGS  92

Query  850   KVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHS  1029
             +V+V PD N   E QRE TMRRIAYL   GVFRGWLTE G +AELRKLALLD   I+DHS
Sbjct  93    RVFVGPDLNDGKEGQREATMRRIAYLKQRGVFRGWLTEDGADAELRKLALLDCIAIYDHS  152

Query  1030  LSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTT  1209
             L+IK+GVHFFLWG AI+F GTKRHHDKWL  +ENY + GCFAMTELGHGSNVRGIET+ T
Sbjct  153   LAIKIGVHFFLWGSAIKFLGTKRHHDKWLVATENYDIMGCFAMTELGHGSNVRGIETIAT  212

Query  1210  YDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             YDS T EF+INTPCES+QKY IGGAANHATHT+VF QL+I+G+N+GVHAF+A
Sbjct  213   YDSETREFIINTPCESSQKYWIGGAANHATHTIVFCQLHINGRNEGVHAFVA  264


 Score =   138 bits (347),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 90/129 (70%), Gaps = 3/129 (2%)
 Frame = +2

Query  98   SPCISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVF-NPRS-MGGRVH  271
            S C+SY P E++E  A F   ++R L+DGH+L  RDWL+ VM +S +F +P +  G RV 
Sbjct  36   SCCLSYVPPESTERPAAFAPGDLRVLLDGHDLPARDWLFRVMEESPLFRSPCARTGSRVF  95

Query  272  VGADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLA  451
            VG D N   E QRE TMRRI YL   GVFRGWLTE D A+AELRK+AL + IAI+D SLA
Sbjct  96   VGPDLNDGKEGQREATMRRIAYLKQRGVFRGWLTE-DGADAELRKLALLDCIAIYDHSLA  154

Query  452  IKIGVQVFL  478
            IKIGV  FL
Sbjct  155  IKIGVHFFL  163



>ref|NP_001152024.1| acyl-coenzyme A oxidase 2 [Zea mays]
 gb|ACG45431.1| acyl-coenzyme A oxidase 2 [Zea mays]
Length=684

 Score =   330 bits (846),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/232 (68%), Positives = 184/232 (79%), Gaps = 2/232 (1%)
 Frame = +1

Query  676   LQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGK-  852
             L+ S C+ Y PPE +E  A+F  A++R L+DGH+L  RDWL+  M +S LF  RS     
Sbjct  33    LEPSCCLSYVPPESTERPAAFAPADLRLLLDGHDLPTRDWLFRAMEESPLFRSRSSRTGS  92

Query  853   -VYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHS  1029
              V+V PDFN   E QRE TMRRIAYL+  GVFRGWLTE G  AELRKLALLD   I+DHS
Sbjct  93    RVFVAPDFNDGKEGQREATMRRIAYLNRRGVFRGWLTEDGAAAELRKLALLDCIAIYDHS  152

Query  1030  LSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTT  1209
             L+IK+GVHFFLWG AI+F GTKRHHDKWL  +ENY +KGCFAMTELGHGSNVRGIET+ T
Sbjct  153   LAIKIGVHFFLWGSAIKFLGTKRHHDKWLVATENYDIKGCFAMTELGHGSNVRGIETIAT  212

Query  1210  YDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             YDS T EF+INTPCESAQKY IGGAANHATHT+VF QL+I+G+N+GVHAF+A
Sbjct  213   YDSETREFIINTPCESAQKYWIGGAANHATHTIVFCQLHINGRNEGVHAFVA  264


 Score =   128 bits (321),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 86/129 (67%), Gaps = 3/129 (2%)
 Frame = +2

Query  98   SPCISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGR--VH  271
            S C+SY P E++E  A F   ++R L+DGH+L  RDWL+  M +S +F  RS      V 
Sbjct  36   SCCLSYVPPESTERPAAFAPADLRLLLDGHDLPTRDWLFRAMEESPLFRSRSSRTGSRVF  95

Query  272  VGADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLA  451
            V  D+N   E QRE TMRRI YL+  GVFRGWLTE D A AELRK+AL + IAI+D SLA
Sbjct  96   VAPDFNDGKEGQREATMRRIAYLNRRGVFRGWLTE-DGAAAELRKLALLDCIAIYDHSLA  154

Query  452  IKIGVQVFL  478
            IKIGV  FL
Sbjct  155  IKIGVHFFL  163



>tpg|DAA56859.1| TPA: putative acyl-CoA oxidase family protein [Zea mays]
Length=684

 Score =   330 bits (846),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/232 (68%), Positives = 184/232 (79%), Gaps = 2/232 (1%)
 Frame = +1

Query  676   LQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGK-  852
             L+ S C+ Y PPE +E  A+F  A++R L+DGH+L  RDWL+  M +S LF  RS     
Sbjct  33    LEPSCCLSYVPPESTERPAAFAPADLRLLLDGHDLPTRDWLFRAMEESPLFRSRSSRTGS  92

Query  853   -VYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHS  1029
              V+V PDFN   E QRE TMRRIAYL+  GVFRGWLTE G  AELRKLALLD   I+DHS
Sbjct  93    RVFVAPDFNDGKEGQREATMRRIAYLNRRGVFRGWLTEDGAAAELRKLALLDCIAIYDHS  152

Query  1030  LSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTT  1209
             L+IK+GVHFFLWG AI+F GTKRHHDKWL  +ENY +KGCFAMTELGHGSNVRGIET+ T
Sbjct  153   LAIKIGVHFFLWGSAIKFLGTKRHHDKWLVATENYDIKGCFAMTELGHGSNVRGIETIAT  212

Query  1210  YDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             YDS T EF+INTPCESAQKY IGGAANHATHT+VF QL+I+G+N+GVHAF+A
Sbjct  213   YDSETREFIINTPCESAQKYWIGGAANHATHTIVFCQLHINGRNEGVHAFVA  264


 Score =   128 bits (321),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 86/129 (67%), Gaps = 3/129 (2%)
 Frame = +2

Query  98   SPCISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGR--VH  271
            S C+SY P E++E  A F   ++R L+DGH+L  RDWL+  M +S +F  RS      V 
Sbjct  36   SCCLSYVPPESTERPAAFAPADLRLLLDGHDLPTRDWLFRAMEESPLFRSRSSRTGSRVF  95

Query  272  VGADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLA  451
            V  D+N   E QRE TMRRI YL+  GVFRGWLTE D A AELRK+AL + IAI+D SLA
Sbjct  96   VAPDFNDGKEGQREATMRRIAYLNRRGVFRGWLTE-DGAAAELRKLALLDCIAIYDHSLA  154

Query  452  IKIGVQVFL  478
            IKIGV  FL
Sbjct  155  IKIGVHFFL  163



>gb|EAZ00875.1| hypothetical protein OsI_22900 [Oryza sativa Indica Group]
Length=688

 Score =   330 bits (846),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 190/245 (78%), Gaps = 6/245 (2%)
 Frame = +1

Query  649   NPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLF  828
             NP      LL+   C+GY PPE +E   +F + ++R+L+DGH+L  RDW++ +M QS LF
Sbjct  24    NPAAKFASLLEPFSCLGYVPPESNEQPPAFALGDLRRLLDGHDLGVRDWMFRVMEQSTLF  83

Query  829   NPRSRG----GKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLT--EKGPEAELRK  990
               R  G    G+V+  PDFN+  E  RE TMRRI YL+  GVFRGWLT  E   EAELR+
Sbjct  84    CSRHGGPGPAGRVFASPDFNKDKEGLREATMRRIGYLARRGVFRGWLTDTEGDAEAELRR  143

Query  991   LALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELG  1170
             +ALLD   ++DHSL+IK+GVHFFLWG AI+F GTKRHHDKWL D+ENY++KGCF+MTELG
Sbjct  144   IALLDCIGVYDHSLAIKIGVHFFLWGSAIKFLGTKRHHDKWLSDTENYVIKGCFSMTELG  203

Query  1171  HGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGV  1350
             HGSNVRGIETV TYD  T EFVINTPCESAQKY IGGAANHATHT+VF+QL+I+G+N+GV
Sbjct  204   HGSNVRGIETVATYDIKTREFVINTPCESAQKYWIGGAANHATHTIVFAQLHINGRNEGV  263

Query  1351  HAFIA  1365
             HAF+A
Sbjct  264   HAFVA  268


 Score =   129 bits (324),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 87/130 (67%), Gaps = 5/130 (4%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMG----GRVH  271
            C+ Y P E++E    F + ++R+L+DGH+L  RDW++ VM QS +F  R  G    GRV 
Sbjct  38   CLGYVPPESNEQPPAFALGDLRRLLDGHDLGVRDWMFRVMEQSTLFCSRHGGPGPAGRVF  97

Query  272  VGADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTEND-QAEAELRKVALCEVIAIFDFSL  448
               D+N+  E  RE TMRRI YL+  GVFRGWLT+ +  AEAELR++AL + I ++D SL
Sbjct  98   ASPDFNKDKEGLREATMRRIGYLARRGVFRGWLTDTEGDAEAELRRIALLDCIGVYDHSL  157

Query  449  AIKIGVQVFL  478
            AIKIGV  FL
Sbjct  158  AIKIGVHFFL  167



>ref|XP_002456627.1| hypothetical protein SORBIDRAFT_03g039670 [Sorghum bicolor]
 gb|EES01747.1| hypothetical protein SORBIDRAFT_03g039670 [Sorghum bicolor]
Length=684

 Score =   328 bits (840),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 184/232 (79%), Gaps = 2/232 (1%)
 Frame = +1

Query  676   LQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLF-NPRSR-GG  849
             L+ S C+ Y PPE +E  A+F   ++R L+DGH+L  RDWL+  M +S LF +P +R G 
Sbjct  33    LEPSCCLSYVPPESTERPAAFAPGDLRLLLDGHDLPARDWLFRAMEESPLFRSPSARTGS  92

Query  850   KVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHS  1029
             +V+V  D N   E QRE TMRRIAYL   GVFRGWLT+ G +AELRKLALLD   I+DHS
Sbjct  93    RVFVGADLNDGKEGQREATMRRIAYLKQRGVFRGWLTKDGADAELRKLALLDCIAIYDHS  152

Query  1030  LSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTT  1209
             L+IK+GVHFFLWG AI+F GTKRHHDKWL  +ENY + GCFAMTELGHGSNVRGIET+ T
Sbjct  153   LAIKIGVHFFLWGSAIKFLGTKRHHDKWLVATENYDIMGCFAMTELGHGSNVRGIETIAT  212

Query  1210  YDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             YDS T EF+INTPCESAQKY IGGAANHATHT+VF QL+I+G+N+GVHAF+A
Sbjct  213   YDSETREFIINTPCESAQKYWIGGAANHATHTIVFCQLHINGRNEGVHAFVA  264


 Score =   138 bits (348),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 88/129 (68%), Gaps = 3/129 (2%)
 Frame = +2

Query  98   SPCISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRS--MGGRVH  271
            S C+SY P E++E  A F   ++R L+DGH+L  RDWL+  M +S +F   S   G RV 
Sbjct  36   SCCLSYVPPESTERPAAFAPGDLRLLLDGHDLPARDWLFRAMEESPLFRSPSARTGSRVF  95

Query  272  VGADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLA  451
            VGAD N   E QRE TMRRI YL   GVFRGWLT+ D A+AELRK+AL + IAI+D SLA
Sbjct  96   VGADLNDGKEGQREATMRRIAYLKQRGVFRGWLTK-DGADAELRKLALLDCIAIYDHSLA  154

Query  452  IKIGVQVFL  478
            IKIGV  FL
Sbjct  155  IKIGVHFFL  163



>ref|XP_006592447.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X2 [Glycine max]
Length=584

 Score =   325 bits (833),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 157/235 (67%), Positives = 187/235 (80%), Gaps = 4/235 (2%)
 Frame = +1

Query  586   LSSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLM  765
             ++  ++ + RT VLT HL++         LL+  PC+ Y+PPELS    SFD  EMRKLM
Sbjct  1     MTDNDRVSRRTEVLTNHLLRR---TPPPSLLRPLPCLSYSPPELSN-TISFDTREMRKLM  56

Query  766   DGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVF  945
             D HNLE+RDWL+ L++QS LFNPR R G+ +V PD+NQ ME QR+ TM+RIAYL D GVF
Sbjct  57    DCHNLEDRDWLFSLILQSPLFNPRHRAGRFFVCPDYNQPMEHQRQATMKRIAYLLDKGVF  116

Query  946   RGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDS  1125
             RGWLT  GPE ELRKLAL +V  ++DHSL++KLGVHFFLWGGA++F GTKRHHDKWL  +
Sbjct  117   RGWLTGNGPEQELRKLALHEVIGMYDHSLAVKLGVHFFLWGGAVKFLGTKRHHDKWLNST  176

Query  1126  ENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAAN  1290
             ENY +KGCFAM+ELGHGSNVRGIETVTTYDS+TGEFVINTPCES QKY IGGAAN
Sbjct  177   ENYDIKGCFAMSELGHGSNVRGIETVTTYDSNTGEFVINTPCESGQKYWIGGAAN  231


 Score =   150 bits (380),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 103/158 (65%), Gaps = 7/158 (4%)
 Frame = +2

Query  5    ERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMDG  184
            +R S RT VLT HLL +  P      +   S     Y+P E S   + FD  EMRKLMD 
Sbjct  5    DRVSRRTEVLTNHLLRRTPPPSLLRPLPCLS-----YSPPELSNTIS-FDTREMRKLMDC  58

Query  185  HNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFRG  364
            HNL++RDWL+ +++QS +FNPR   GR  V  DYNQ ME QR+ TM+RI YL D GVFRG
Sbjct  59   HNLEDRDWLFSLILQSPLFNPRHRAGRFFVCPDYNQPMEHQRQATMKRIAYLLDKGVFRG  118

Query  365  WLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            WLT N   E ELRK+AL EVI ++D SLA+K+GV  FL
Sbjct  119  WLTGNG-PEQELRKLALHEVIGMYDHSLAVKLGVHFFL  155



>gb|EAZ36947.1| hypothetical protein OsJ_21282 [Oryza sativa Japonica Group]
Length=685

 Score =   326 bits (836),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 187/237 (79%), Gaps = 6/237 (3%)
 Frame = +1

Query  673   LLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRG--  846
             LL+   C+GY PPE +E   +F + ++R+L+DGH+L  RDW++ +M QS LF  R  G  
Sbjct  29    LLEPFSCLGYVPPESNEQPPAFALGDLRRLLDGHDLGVRDWMFRVMEQSTLFCSRHGGPG  88

Query  847   --GKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLT--EKGPEAELRKLALLDVTT  1014
               G+V+  PDFN+  E  RE  MRRI YL+  GVFRGWLT  E   EAELR++ALLD   
Sbjct  89    PAGRVFASPDFNKDKEGLREAKMRRIGYLARRGVFRGWLTDTEGDAEAELRRIALLDCIG  148

Query  1015  IFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGI  1194
             ++DHSL+IK+GVHFFLWG AI+F GTKRHHDKWL D+ENY++KGCF+MTELGHGSNVRGI
Sbjct  149   VYDHSLAIKIGVHFFLWGSAIKFLGTKRHHDKWLSDTENYVIKGCFSMTELGHGSNVRGI  208

Query  1195  ETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             ETV TYD  T EFVINTPCESAQKY IGGAANHATHT+VF+QL+I+G+N+GVHAF+A
Sbjct  209   ETVATYDIKTREFVINTPCESAQKYWIGGAANHATHTIVFAQLHINGRNEGVHAFVA  265


 Score =   127 bits (318),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 86/130 (66%), Gaps = 5/130 (4%)
 Frame = +2

Query  104  CISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMG----GRVH  271
            C+ Y P E++E    F + ++R+L+DGH+L  RDW++ VM QS +F  R  G    GRV 
Sbjct  35   CLGYVPPESNEQPPAFALGDLRRLLDGHDLGVRDWMFRVMEQSTLFCSRHGGPGPAGRVF  94

Query  272  VGADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTEND-QAEAELRKVALCEVIAIFDFSL  448
               D+N+  E  RE  MRRI YL+  GVFRGWLT+ +  AEAELR++AL + I ++D SL
Sbjct  95   ASPDFNKDKEGLREAKMRRIGYLARRGVFRGWLTDTEGDAEAELRRIALLDCIGVYDHSL  154

Query  449  AIKIGVQVFL  478
            AIKIGV  FL
Sbjct  155  AIKIGVHFFL  164



>ref|XP_002985513.1| hypothetical protein SELMODRAFT_122536 [Selaginella moellendorffii]
 gb|EFJ13387.1| hypothetical protein SELMODRAFT_122536 [Selaginella moellendorffii]
Length=678

 Score =   313 bits (802),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/266 (58%), Positives = 197/266 (74%), Gaps = 8/266 (3%)
 Frame = +1

Query  571   LESSSLSSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPEL-SEPAASFDVA  747
             +E+  +SS   A  R  VLT HL + +       L+   PC+ Y+PPEL SEPA  FD+ 
Sbjct  1     MEAGQVSS--AATRRALVLTGHLKEID---KGSSLVVRQPCLEYSPPELNSEPA--FDIE  53

Query  748   EMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYL  927
              M+ L+DGH+ + R +++ LM +S LF  R  G +V++  D+NQ ME QRE+TM+RI Y 
Sbjct  54    LMQGLLDGHDAQTRTFIFNLMSESDLFVSRRVGRRVFLGADYNQPMEVQRELTMKRIQYF  113

Query  928   SDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHD  1107
              D GVFRGWLT+  P++ LR  A+ +   +FDHSL+IKLGVHF LWGG++++ G+KRHHD
Sbjct  114   LDRGVFRGWLTDDRPQSALRMAAMFEYIGLFDHSLAIKLGVHFHLWGGSVKYLGSKRHHD  173

Query  1108  KWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAA  1287
             KWL  +E + V GCFAMTELGHGSNVRGIET+T YD ST EFVINTPCESAQKY IGGAA
Sbjct  174   KWLLPTEEFSVIGCFAMTELGHGSNVRGIETITVYDPSTKEFVINTPCESAQKYWIGGAA  233

Query  1288  NHATHTVVFSQLNIDGKNQGVHAFIA  1365
              HATHTVVFSQL+++GKN+GVHAFIA
Sbjct  234   MHATHTVVFSQLHMNGKNEGVHAFIA  259


 Score =   131 bits (330),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 90/127 (71%), Gaps = 4/127 (3%)
 Frame = +2

Query  101  PCISYTPAEA-SEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVG  277
            PC+ Y+P E  SEPA  FD+  M+ L+DGH+ Q R +++ +M +S +F  R +G RV +G
Sbjct  35   PCLEYSPPELNSEPA--FDIELMQGLLDGHDAQTRTFIFNLMSESDLFVSRRVGRRVFLG  92

Query  278  ADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIK  457
            ADYNQ ME QRE+TM+RI+Y  D GVFRGWLT+ D+ ++ LR  A+ E I +FD SLAIK
Sbjct  93   ADYNQPMEVQRELTMKRIQYFLDRGVFRGWLTD-DRPQSALRMAAMFEYIGLFDHSLAIK  151

Query  458  IGVQVFL  478
            +GV   L
Sbjct  152  LGVHFHL  158



>ref|XP_002994091.1| hypothetical protein SELMODRAFT_187751 [Selaginella moellendorffii]
 gb|EFJ04838.1| hypothetical protein SELMODRAFT_187751 [Selaginella moellendorffii]
Length=678

 Score =   313 bits (802),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/266 (58%), Positives = 197/266 (74%), Gaps = 8/266 (3%)
 Frame = +1

Query  571   LESSSLSSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPEL-SEPAASFDVA  747
             +E+  +SS   A  R  VLT HL + +       L+   PC+ Y+PPEL SEPA  FD+ 
Sbjct  1     MEAGQVSS--AATRRALVLTGHLKEID---KGSSLVVRQPCLEYSPPELNSEPA--FDIE  53

Query  748   EMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYL  927
              M+ L+DGH+ + R +++ LM +S LF  R  G +V++  D+NQ ME QRE+TM+RI Y 
Sbjct  54    LMQGLLDGHDAQTRTFIFNLMSESDLFVSRRVGRRVFLGADYNQPMEVQRELTMKRIQYF  113

Query  928   SDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHD  1107
              D GVFRGWLT+  P++ LR  A+ +   +FDHSL+IKLGVHF LWGG++++ G+KRHHD
Sbjct  114   LDRGVFRGWLTDDRPQSALRMAAMFEYIGLFDHSLAIKLGVHFHLWGGSVKYLGSKRHHD  173

Query  1108  KWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAA  1287
             KWL  +E + V GCFAMTELGHGSNVRGIET+T YD ST EFVINTPCESAQKY IGGAA
Sbjct  174   KWLMPTEEFSVIGCFAMTELGHGSNVRGIETITVYDPSTQEFVINTPCESAQKYWIGGAA  233

Query  1288  NHATHTVVFSQLNIDGKNQGVHAFIA  1365
              HATHTVVFSQL+++GKN+GVHAFIA
Sbjct  234   MHATHTVVFSQLHMNGKNEGVHAFIA  259


 Score =   131 bits (330),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 90/127 (71%), Gaps = 4/127 (3%)
 Frame = +2

Query  101  PCISYTPAEA-SEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVG  277
            PC+ Y+P E  SEPA  FD+  M+ L+DGH+ Q R +++ +M +S +F  R +G RV +G
Sbjct  35   PCLEYSPPELNSEPA--FDIELMQGLLDGHDAQTRTFIFNLMSESDLFVSRRVGRRVFLG  92

Query  278  ADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIK  457
            ADYNQ ME QRE+TM+RI+Y  D GVFRGWLT+ D+ ++ LR  A+ E I +FD SLAIK
Sbjct  93   ADYNQPMEVQRELTMKRIQYFLDRGVFRGWLTD-DRPQSALRMAAMFEYIGLFDHSLAIK  151

Query  458  IGVQVFL  478
            +GV   L
Sbjct  152  LGVHFHL  158



>ref|XP_001759376.1| predicted protein [Physcomitrella patens]
 gb|EDQ75678.1| predicted protein [Physcomitrella patens]
Length=680

 Score =   311 bits (797),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/250 (60%), Positives = 182/250 (73%), Gaps = 3/250 (1%)
 Frame = +1

Query  613   RTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERD  792
             RT VL RHL QE   V      Q SPC+ Y PPEL    +SFD + MR+L+DGH++  RD
Sbjct  15    RTGVLARHLAQELSPVS---FFQPSPCLAYQPPELHCDKSSFDKSVMRELLDGHHVALRD  71

Query  793   WLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGP  972
                 LMI S LF  +  G   +  P+FN +ME+ R+ T+ RI +    GVF+GWLT+   
Sbjct  72    SFANLMISSDLFVNKRVGNLTFATPNFNTTMEEHRDKTLDRILFFRSKGVFKGWLTDSSV  131

Query  973   EAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCF  1152
             +  L++ AL +    FDHSL+IKLGVH  LWGGAIQ+ GTKRHHDKWL+ +E+Y V+GCF
Sbjct  132   DHALKRAALFETLGTFDHSLAIKLGVHIHLWGGAIQYLGTKRHHDKWLKITEDYQVRGCF  191

Query  1153  AMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNID  1332
             AM+ELGHGSNVRGIETVTTYD ST EF+I+TPCESAQKY IGGAA HATHT+VFSQL ID
Sbjct  192   AMSELGHGSNVRGIETVTTYDPSTEEFIIDTPCESAQKYWIGGAAQHATHTIVFSQLLID  251

Query  1333  GKNQGVHAFI  1362
             GKN+GVHAF+
Sbjct  252   GKNEGVHAFV  261


 Score =   103 bits (256),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 85/153 (56%), Gaps = 6/153 (4%)
 Frame = +2

Query  20   RTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMDGHNLQE  199
            RT VL RHL  + +P           SPC++Y P E     + FD   MR+L+DGH++  
Sbjct  15   RTGVLARHLAQELSPVSFFQ-----PSPCLAYQPPELHCDKSSFDKSVMRELLDGHHVAL  69

Query  200  RDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTEN  379
            RD    +MI S +F  + +G       ++N  ME+ R+ T+ RI +    GVF+GWLT++
Sbjct  70   RDSFANLMISSDLFVNKRVGNLTFATPNFNTTMEEHRDKTLDRILFFRSKGVFKGWLTDS  129

Query  380  DQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
                A L++ AL E +  FD SLAIK+GV + L
Sbjct  130  SVDHA-LKRAALFETLGTFDHSLAIKLGVHIHL  161



>ref|XP_001772379.1| predicted protein [Physcomitrella patens]
 gb|EDQ62850.1| predicted protein [Physcomitrella patens]
Length=678

 Score =   306 bits (784),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/253 (57%), Positives = 185/253 (73%), Gaps = 3/253 (1%)
 Frame = +1

Query  604   ANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLE  783
             A  R  VL RHL  E   +     L+ SPC+ Y PPE     +SFD + MR+L+DGH+++
Sbjct  9     AARRAGVLARHLAHEMSPLS---FLRPSPCLAYQPPEFHCDNSSFDKSIMRELLDGHHVD  65

Query  784   ERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTE  963
              RD    L++ S LF  +  G +V+  P+FN +M +QR+ T+ RI +L   GVF+GWL++
Sbjct  66    LRDSFTDLLMSSDLFTSKRVGDRVFASPNFNLTMAEQRDKTLERILFLRSEGVFKGWLSD  125

Query  964   KGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVK  1143
                +  L++ AL +   IFDHSL IKLGVH  LWGG+IQ+ GTKRHHDKWL  +E+Y V+
Sbjct  126   SSVDDALKRAALFETMGIFDHSLVIKLGVHIHLWGGSIQYLGTKRHHDKWLDRTEDYQVR  185

Query  1144  GCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQL  1323
             GCFAM+ELGHGSNVRGIETVTTYD+ST EF+I+TPCESAQKY IGGAA HATHT+VFSQL
Sbjct  186   GCFAMSELGHGSNVRGIETVTTYDTSTEEFIIDTPCESAQKYWIGGAAQHATHTIVFSQL  245

Query  1324  NIDGKNQGVHAFI  1362
              IDGKN+GVHAF+
Sbjct  246   LIDGKNEGVHAFV  258


 Score =   104 bits (259),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 79/127 (62%), Gaps = 1/127 (1%)
 Frame = +2

Query  98   SPCISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVG  277
            SPC++Y P E     + FD   MR+L+DGH++  RD    +++ S +F  + +G RV   
Sbjct  33   SPCLAYQPPEFHCDNSSFDKSIMRELLDGHHVDLRDSFTDLLMSSDLFTSKRVGDRVFAS  92

Query  278  ADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIK  457
             ++N  M +QR+ T+ RI +L   GVF+GWL+++   +A L++ AL E + IFD SL IK
Sbjct  93   PNFNLTMAEQRDKTLERILFLRSEGVFKGWLSDSSVDDA-LKRAALFETMGIFDHSLVIK  151

Query  458  IGVQVFL  478
            +GV + L
Sbjct  152  LGVHIHL  158



>gb|KJB60308.1| hypothetical protein B456_009G299600 [Gossypium raimondii]
 gb|KJB60309.1| hypothetical protein B456_009G299600 [Gossypium raimondii]
 gb|KJB60310.1| hypothetical protein B456_009G299600 [Gossypium raimondii]
 gb|KJB60311.1| hypothetical protein B456_009G299600 [Gossypium raimondii]
 gb|KJB60312.1| hypothetical protein B456_009G299600 [Gossypium raimondii]
Length=231

 Score =   287 bits (735),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = +1

Query  805   LMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAEL  984
             +M QS+LFNP  RGGKV+V P++NQ MEQQREI ++RI YL D G F+GWLTE+G E EL
Sbjct  1     MMSQSKLFNPGVRGGKVFVLPNYNQPMEQQREIMLKRIDYLFDIGEFKGWLTEQGEEIEL  60

Query  985   RKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTE  1164
             +K A  +V   FDHS+   L VHFFLWGGA+Q FGTK HHDKWLRD+E ++VKGCFAM+E
Sbjct  61    KKFASFEVFGTFDHSMGTMLAVHFFLWGGAVQVFGTKHHHDKWLRDTETHVVKGCFAMSE  120

Query  1165  LGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQ  1344
             LGHGSNVRG+E VTTYDS+T EFVINTPCESAQK+ IG AANHATH +VFS LNI+G NQ
Sbjct  121   LGHGSNVRGVEIVTTYDSNTQEFVINTPCESAQKFWIGEAANHATHAIVFSPLNINGSNQ  180

Query  1345  GVHAFIA  1365
             GVHAFIA
Sbjct  181   GVHAFIA  187


 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = +2

Query  218  VMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAE  397
            +M QSK+FNP   GG+V V  +YNQ MEQQRE+ ++RI+YL D G F+GWLTE  + E E
Sbjct  1    MMSQSKLFNPGVRGGKVFVLPNYNQPMEQQREIMLKRIDYLFDIGEFKGWLTEQGE-EIE  59

Query  398  LRKVALCEVIAIFDFSLAIKIGVQVFL  478
            L+K A  EV   FD S+   + V  FL
Sbjct  60   LKKFASFEVFGTFDHSMGTMLAVHFFL  86



>gb|EPS62711.1| hypothetical protein M569_12075, partial [Genlisea aurea]
Length=197

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 157/199 (79%), Gaps = 4/199 (2%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQEN-PCVDDDILLQSSPCIGYTPPELSEP-AASFDVAEMRKLMD  768
             MEK   R  VL+RHL     P V D I  + SPC+ + P E+SE    SFDV  MRKLMD
Sbjct  1     MEKLISRARVLSRHLQDHAIPGVSDGI--RPSPCLSFVPAEVSEKQPPSFDVESMRKLMD  58

Query  769   GHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFR  948
             GHN+++R WL+ L++QS LFN + RGGKV+V PD+NQ+MEQQREITM RI YL D GVF+
Sbjct  59    GHNVDDRVWLFNLLVQSDLFNGKLRGGKVFVVPDYNQTMEQQREITMERIRYLLDHGVFK  118

Query  949   GWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSE  1128
             GWLTEKG E+ELRKLALL+V  IFDHSL+IKLGVHFFLWGGAIQFFGTK HHDKWL  +E
Sbjct  119   GWLTEKGAESELRKLALLEVLGIFDHSLAIKLGVHFFLWGGAIQFFGTKIHHDKWLSPTE  178

Query  1129  NYLVKGCFAMTELGHGSNV  1185
             NY VKGCF+MTELGHGSNV
Sbjct  179   NYEVKGCFSMTELGHGSNV  197


 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 110/160 (69%), Gaps = 5/160 (3%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEP-AARFDVFEMRKLM  178
            ME+   R  VL+RHL +   P + D       SPC+S+ PAE SE     FDV  MRKLM
Sbjct  1    MEKLISRARVLSRHLQDHAIPGVSDGIR---PSPCLSFVPAEVSEKQPPSFDVESMRKLM  57

Query  179  DGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVF  358
            DGHN+ +R WL+ +++QS +FN +  GG+V V  DYNQ MEQQRE+TM RI YL D GVF
Sbjct  58   DGHNVDDRVWLFNLLVQSDLFNGKLRGGKVFVVPDYNQTMEQQREITMERIRYLLDHGVF  117

Query  359  RGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            +GWLTE   AE+ELRK+AL EV+ IFD SLAIK+GV  FL
Sbjct  118  KGWLTEKG-AESELRKLALLEVLGIFDHSLAIKLGVHFFL  156



>emb|CBI21935.3| unnamed protein product [Vitis vinifera]
Length=558

 Score =   242 bits (618),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +1

Query  982   LRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMT  1161
             +RK AL +V  ++DHSL++KLGVH+FLWGGAIQFFGTKRHHDKWLRDSENY++KGCFAMT
Sbjct  1     MRKFALHEVIGMYDHSLAVKLGVHYFLWGGAIQFFGTKRHHDKWLRDSENYVIKGCFAMT  60

Query  1162  ELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKN  1341
             ELGHGSNVRGIETVTTYDS TGEFVIN+PCESAQKY IGGAANHATHT+VFSQLNI+GK+
Sbjct  61    ELGHGSNVRGIETVTTYDSKTGEFVINSPCESAQKYWIGGAANHATHTIVFSQLNINGKS  120

Query  1342  QGVHAFIA  1365
             +GVHAFIA
Sbjct  121   EGVHAFIA  128



>ref|XP_007213790.1| hypothetical protein PRUPE_ppa002439m1g, partial [Prunus persica]
 gb|EMJ14989.1| hypothetical protein PRUPE_ppa002439m1g, partial [Prunus persica]
Length=151

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 123/156 (79%), Gaps = 5/156 (3%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             M++  +RT VL+ HL Q  P +     L  +PC+G++PPELSEP   FD  EMRKL+D H
Sbjct  1     MDRVTWRTQVLSNHLNQ--PSMSSP--LSPNPCVGFSPPELSEPF-EFDTKEMRKLLDAH  55

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
             NLE+RDWL+GLM QS+ FNPR  GG+V+V PD+NQSMEQQRE+TM+RIAYL D GVF GW
Sbjct  56    NLEDRDWLFGLMKQSKPFNPREAGGRVFVSPDYNQSMEQQREMTMKRIAYLLDRGVFEGW  115

Query  955   LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFL  1062
             LTEKG EAELRKLAL +V  I+DHSLS+KLGVHFFL
Sbjct  116   LTEKGVEAELRKLALHEVIGIYDHSLSVKLGVHFFL  151


 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 111/159 (70%), Gaps = 8/159 (5%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+R ++RT VL+ HL      +          +PC+ ++P E SEP   FD  EMRKL+D
Sbjct  1    MDRVTWRTQVLSNHLNQPSMSSPLS------PNPCVGFSPPELSEPF-EFDTKEMRKLLD  53

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
             HNL++RDWL+G+M QSK FNPR  GGRV V  DYNQ+MEQQREMTM+RI YL D GVF 
Sbjct  54   AHNLEDRDWLFGLMKQSKPFNPREAGGRVFVSPDYNQSMEQQREMTMKRIAYLLDRGVFE  113

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLTE    EAELRK+AL EVI I+D SL++K+GV  FL
Sbjct  114  GWLTEKG-VEAELRKLALHEVIGIYDHSLSVKLGVHFFL  151



>gb|KHG14872.1| Acyl-coenzyme A oxidase 3, peroxisomal -like protein [Gossypium 
arboreum]
Length=168

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 121/158 (77%), Gaps = 2/158 (1%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVD-DDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDG  771
             M++A  RT VLT HL+Q  P        L S+ C+ Y+PPELSE  A FD+ +MRKLMDG
Sbjct  1     MDRAFQRTKVLTDHLLQSPPSSSFQTPSLSSNACLNYSPPELSEKYA-FDINDMRKLMDG  59

Query  772   HNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRG  951
             H+LEERD L+G++ QS++FNPR RGGKV+V PD+NQSMEQQRE+T +RI YL + GVF+G
Sbjct  60    HDLEERDRLFGMITQSKVFNPRVRGGKVFVSPDYNQSMEQQREMTWKRIEYLFERGVFQG  119

Query  952   WLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLW  1065
             WLT +G E E+R+ A  +V  +FDHS+SIKLGVHFFLW
Sbjct  120   WLTGEGEEVEMRRFACFEVLGLFDHSISIKLGVHFFLW  157


 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 115/162 (71%), Gaps = 4/162 (2%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+RA  RT VLT HLL     +      L  S+ C++Y+P E SE  A FD+ +MRKLMD
Sbjct  1    MDRAFQRTKVLTDHLLQSPPSSSFQTPSLS-SNACLNYSPPELSEKYA-FDINDMRKLMD  58

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GH+L+ERD L+G++ QSKVFNPR  GG+V V  DYNQ+MEQQREMT +RIEYL + GVF+
Sbjct  59   GHDLEERDRLFGMITQSKVFNPRVRGGKVFVSPDYNQSMEQQREMTWKRIEYLFERGVFQ  118

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL-CI  484
            GWLT  +  E E+R+ A  EV+ +FD S++IK+GV  FL C+
Sbjct  119  GWLT-GEGEEVEMRRFACFEVLGLFDHSISIKLGVHFFLWCV  159



>ref|XP_007213791.1| hypothetical protein PRUPE_ppa002439m2g, partial [Prunus persica]
 gb|EMJ14990.1| hypothetical protein PRUPE_ppa002439m2g, partial [Prunus persica]
Length=520

 Score =   201 bits (511),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/100 (91%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +1

Query  1066  GGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINT  1245
             GGAIQFFGTKRHHDKWLRD+ENY +KGCFAM+ELGHGSNVRGIETVTTYDS+TGEFVINT
Sbjct  1     GGAIQFFGTKRHHDKWLRDTENYTIKGCFAMSELGHGSNVRGIETVTTYDSNTGEFVINT  60

Query  1246  PCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             PCESAQKY IGGAANHATHT+VFSQLNI GKN GVHAFIA
Sbjct  61    PCESAQKYWIGGAANHATHTIVFSQLNISGKNHGVHAFIA  100



>gb|KJB50145.1| hypothetical protein B456_008G155500 [Gossypium raimondii]
Length=543

 Score =   199 bits (506),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 122/158 (77%), Gaps = 2/158 (1%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVD-DDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDG  771
             M++A  RT VLT HL+Q  P        L S+ C+ Y+PPELSE  A FD+++MRKLMDG
Sbjct  1     MDRAFQRTKVLTGHLLQSPPTSSFQTPSLSSNACLNYSPPELSEKYA-FDISDMRKLMDG  59

Query  772   HNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRG  951
             H+LEERD L+G++ QS++FNPR RGGKV+V PD+NQSMEQQRE+T +RI YL + GVF+G
Sbjct  60    HDLEERDRLFGMITQSKVFNPRVRGGKVFVSPDYNQSMEQQREMTWKRIEYLFERGVFQG  119

Query  952   WLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLW  1065
             WLT +G E E+R+ A  +V  +FDHS+SIKLGVHFFLW
Sbjct  120   WLTGEGEEVEMRRFACFEVLGLFDHSISIKLGVHFFLW  157


 Score =   161 bits (408),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 113/159 (71%), Gaps = 3/159 (2%)
 Frame = +2

Query  2    MERASFRTNVLTRHllnqqnpnlddddvllqSSPCISYTPAEASEPAARFDVFEMRKLMD  181
            M+RA  RT VLT HLL     +      L  S+ C++Y+P E SE  A FD+ +MRKLMD
Sbjct  1    MDRAFQRTKVLTGHLLQSPPTSSFQTPSLS-SNACLNYSPPELSEKYA-FDISDMRKLMD  58

Query  182  GHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYLSDCGVFR  361
            GH+L+ERD L+G++ QSKVFNPR  GG+V V  DYNQ+MEQQREMT +RIEYL + GVF+
Sbjct  59   GHDLEERDRLFGMITQSKVFNPRVRGGKVFVSPDYNQSMEQQREMTWKRIEYLFERGVFQ  118

Query  362  GWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            GWLT  +  E E+R+ A  EV+ +FD S++IK+GV  FL
Sbjct  119  GWLT-GEGEEVEMRRFACFEVLGLFDHSISIKLGVHFFL  156



>gb|EMT28672.1| Acyl-coenzyme A oxidase 3, peroxisomal [Aegilops tauschii]
Length=594

 Score =   191 bits (485),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  1057  FLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFV  1236
             F  GGA++F GTKRHHDKWL D+ENY++KGCFAMTELGHGSNVRGIETV TYDS TGEFV
Sbjct  72    FSKGGAVKFLGTKRHHDKWLLDTENYVIKGCFAMTELGHGSNVRGIETVATYDSKTGEFV  131

Query  1237  INTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             INTPCESAQKY IGGAANHATHT+VF+QL+I+G+N+GVHAFIA
Sbjct  132   INTPCESAQKYWIGGAANHATHTIVFAQLHINGRNEGVHAFIA  174



>ref|XP_005707013.1| acyl-CoA oxidase isoform 1 [Galdieria sulphuraria]
 ref|XP_005707014.1| acyl-CoA oxidase isoform 2 [Galdieria sulphuraria]
 gb|EME30493.1| acyl-CoA oxidase isoform 1 [Galdieria sulphuraria]
 gb|EME30494.1| acyl-CoA oxidase isoform 2 [Galdieria sulphuraria]
Length=640

 Score =   185 bits (469),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 137/226 (61%), Gaps = 12/226 (5%)
 Frame = +1

Query  688   PCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWP  867
             PC+ Y PPE + P+ +F+  ++  L   H+ + R+ L+ +  +  LF  R          
Sbjct  12    PCMEYIPPERASPSPTFEPKKLYPLFVDHDWDLRERLFEV-FKEPLFQFR----------  60

Query  868   DFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLG  1047
              +  +ME++R +  RR + L++ G+ +G LT   P+   R  A  +   ++DHSLS+ + 
Sbjct  61    -YGITMEEERNLLRRRWSRLNELGLLKGTLTSGQPKDRARFDAFFECVEMYDHSLSVAMT  119

Query  1048  VHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTG  1227
             VH+ L+G  I F GT     KWL   E+  + GCFA+TELGHGSNVRGIET  TYD ST 
Sbjct  120   VHYGLFGSTIAFLGTDEQKQKWLPKVEDCSMHGCFALTELGHGSNVRGIETQATYDKSTQ  179

Query  1228  EFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             EF+I+TPCE+AQKY IGGA+ +A    VF+QL+++G   G+H F+ 
Sbjct  180   EFIIHTPCETAQKYWIGGASTNARWATVFAQLSLNGTYYGIHPFVV  225



>ref|XP_011037432.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Populus 
euphratica]
Length=514

 Score =   178 bits (451),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +1

Query  1084  FGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQ  1263
              GTKRHHDKWLRD+E + +KGCF+MTELGHGSNVRGIETVTTYDS TGEFVINTPCESAQ
Sbjct  1     MGTKRHHDKWLRDTETFAIKGCFSMTELGHGSNVRGIETVTTYDSKTGEFVINTPCESAQ  60

Query  1264  KYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             KY IGGAANHATHT+VFSQLNI+G N+GVHA IA
Sbjct  61    KYWIGGAANHATHTIVFSQLNINGVNEGVHALIA  94



>gb|EEE65671.1| hypothetical protein OsJ_21283 [Oryza sativa Japonica Group]
Length=195

 Score =   169 bits (428),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = +1

Query  676   LQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKV  855
             L+ S C+ Y PPE SEPA +F   E+R L+DGH+L ERDW +  M +S LF  R  GGKV
Sbjct  36    LEPSACLSYAPPESSEPAPAFSPLELRSLLDGHHLRERDWAFRAMEESPLFCQRRSGGKV  95

Query  856   YVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLS  1035
             +V PD+N+  E QRE TMRR+ YL+  GVFRGWLTE GP+AELRKLALL+   ++DHSL+
Sbjct  96    FVSPDYNEGKEGQREATMRRVGYLARRGVFRGWLTEPGPDAELRKLALLECLGMYDHSLA  155

Query  1036  IKLGVHFFL  1062
             IK+GVHFFL
Sbjct  156   IKIGVHFFL  164


 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 91/130 (70%), Gaps = 1/130 (1%)
 Frame = +2

Query  98   SPCISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVG  277
            S C+SY P E+SEPA  F   E+R L+DGH+L+ERDW +  M +S +F  R  GG+V V 
Sbjct  39   SACLSYAPPESSEPAPAFSPLELRSLLDGHHLRERDWAFRAMEESPLFCQRRSGGKVFVS  98

Query  278  ADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIK  457
             DYN+  E QRE TMRR+ YL+  GVFRGWLTE    +AELRK+AL E + ++D SLAIK
Sbjct  99   PDYNEGKEGQREATMRRVGYLARRGVFRGWLTEPG-PDAELRKLALLECLGMYDHSLAIK  157

Query  458  IGVQVFLCIE  487
            IGV  FLC E
Sbjct  158  IGVHFFLCFE  167



>gb|EEC80572.1| hypothetical protein OsI_22901 [Oryza sativa Indica Group]
Length=195

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = +1

Query  676   LQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKV  855
             L+ S C+ Y PPE SEPA +F   E+R L+D H+L ERDW +  M +S LF  R  GGKV
Sbjct  36    LEPSACLSYAPPESSEPAPAFSPLELRSLLDRHHLRERDWAFRAMEESPLFCQRRSGGKV  95

Query  856   YVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLS  1035
             +V PD+N+  E QRE TMRR+ YL+  GVFRGWLTE GP+AELRKLALL+   ++DHSL+
Sbjct  96    FVSPDYNEGKEGQREATMRRVGYLARRGVFRGWLTEPGPDAELRKLALLECLGMYDHSLA  155

Query  1036  IKLGVHFFL  1062
             IK+GVHFFL
Sbjct  156   IKIGVHFFL  164


 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 90/130 (69%), Gaps = 1/130 (1%)
 Frame = +2

Query  98   SPCISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVG  277
            S C+SY P E+SEPA  F   E+R L+D H+L+ERDW +  M +S +F  R  GG+V V 
Sbjct  39   SACLSYAPPESSEPAPAFSPLELRSLLDRHHLRERDWAFRAMEESPLFCQRRSGGKVFVS  98

Query  278  ADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIK  457
             DYN+  E QRE TMRR+ YL+  GVFRGWLTE    +AELRK+AL E + ++D SLAIK
Sbjct  99   PDYNEGKEGQREATMRRVGYLARRGVFRGWLTEPG-PDAELRKLALLECLGMYDHSLAIK  157

Query  458  IGVQVFLCIE  487
            IGV  FLC E
Sbjct  158  IGVHFFLCFE  167



>ref|XP_005716306.1| acyl-CoA oxidase [Chondrus crispus]
 emb|CDF36487.1| acyl-CoA oxidase [Chondrus crispus]
Length=656

 Score =   171 bits (434),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 130/220 (59%), Gaps = 12/220 (5%)
 Frame = +1

Query  706   PPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSM  885
             P  +     +F+  +MR+L+D ++ E RD LY L  +  +F PR           +N S+
Sbjct  48    PSGVVAARPAFNQKKMRELLDMNSFEVRDRLYEL-FKDPVFAPR-----------YNDSL  95

Query  886   EQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLW  1065
             ++QR  T++R + ++  G+FR  L +  PE   R  A+L+  +  DHSL IK+ VH+ L+
Sbjct  96    DEQRARTIQRWSLIAKTGLFRNALRKFTPEGRRRYEAILESVSALDHSLEIKMSVHYGLF  155

Query  1066  GGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINT  1245
             GG +   G     DKW+   E+  + GCF+MTELGHGSNV+GI+T   YD  +  F++NT
Sbjct  156   GGTVSLMGDDEQGDKWMPKIESCEMLGCFSMTELGHGSNVKGIQTTAIYDIPSQTFIVNT  215

Query  1246  PCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             PCE AQKY IGGA   A  T +F+QL + G   GVH F+A
Sbjct  216   PCEEAQKYWIGGAFQSARWTALFAQLYVKGVCHGVHPFLA  255



>ref|XP_010457758.1| PREDICTED: putative acyl-coenzyme A oxidase 3.2, peroxisomal 
[Camelina sativa]
Length=194

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 86/97 (89%), Gaps = 1/97 (1%)
 Frame = +1

Query  1078  QFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTT-YDSSTGEFVINTPCE  1254
             +FFGTKRHH+KWL D+E+Y+VKGCFAMTELGHG+NVRGIETVTT YD ++ EFVINTPCE
Sbjct  4     KFFGTKRHHEKWLNDTEDYVVKGCFAMTELGHGTNVRGIETVTTYYDPASEEFVINTPCE  63

Query  1255  SAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             S+QKY IG AANHATH +V SQLNI+  NQG+H FIA
Sbjct  64    SSQKYWIGEAANHATHAIVISQLNINETNQGIHVFIA  100



>ref|XP_004365565.1| acyl-coenzyme A oxidase 3 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE89168.1| acyl-coenzyme A oxidase 3 [Capsaspora owczarzaki ATCC 30864]
Length=705

 Score =   168 bits (426),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/222 (40%), Positives = 136/222 (61%), Gaps = 14/222 (6%)
 Frame = +1

Query  700   YTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQ  879
             ++ P  +  +++  +  + K +D HN   R  ++ L+ +  LF             D+N 
Sbjct  32    HSAPSATSNSSTVSIDLLNKFVDKHNFATRKAMWELL-KEPLFEL-----------DYNM  79

Query  880   SMEQQREITMRRIAYLSDCGVFRGWLTEKG-PEAELRKLALLDVTTIFDHSLSIKLGVHF  1056
             S++Q R++T+RR+  LSD G     L     PE+++   A  D   ++D +L++++G H 
Sbjct  80    SIKQLRDLTLRRLQRLSDLGYPYQMLDPNSTPESQMEVYARTDCMYMYDCNLTVRVGAHV  139

Query  1057  FLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFV  1236
              LWGG+++  GT+ HH+K+L+D     + GCFAMTELGHGSNV+G+ET  T+D +T EF+
Sbjct  140   NLWGGSVRNLGTEYHHEKYLKDIAYNRLPGCFAMTELGHGSNVKGLETTATFDKATQEFI  199

Query  1237  INTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             INTP ESAQK+ IG A   A    VF+QL+I G N+G+HAFI
Sbjct  200   INTPTESAQKFWIGNALT-AHAATVFAQLHIGGVNRGIHAFI  240



>ref|XP_005712968.1| acyl-CoA oxidase [Chondrus crispus]
 ref|XP_005712969.1| Acyl-COA oxydase [Chondrus crispus]
 emb|CDF33165.1| acyl-CoA oxidase [Chondrus crispus]
 emb|CDF33166.1| Acyl-COA oxydase [Chondrus crispus]
Length=672

 Score =   168 bits (425),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/232 (39%), Positives = 122/232 (53%), Gaps = 12/232 (5%)
 Frame = +1

Query  667   DILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRG  846
             D   Q    +   PP +  P   FD+ +MR+L+D +N   RD  Y L      F      
Sbjct  35    DAEAQQRAGVNPFPPGVVAPRPVFDIKKMRELLDMNNFALRDSFYELFKNPVFF------  88

Query  847   GKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDH  1026
                   P +N+S+ +QR  T++R   ++  GVF   L     E   R  A L+     +H
Sbjct  89    ------PRYNESLAEQRARTIQRWRLIAKTGVFHNTLQTFTAEGRQRYEATLESVGAMEH  142

Query  1027  SLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVT  1206
             S+ IK+GVH+ L+GG +   G      KW    EN  + GCFAMTELGHGSNV+GI+T  
Sbjct  143   SMEIKMGVHYGLFGGTVSLMGDDEQCAKWTPKIENCQMLGCFAMTELGHGSNVKGIQTKA  202

Query  1207  TYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              YD  +  F++NTPCE AQKY IGGA   A  T +F+QL + G   GVH F+
Sbjct  203   VYDIPSQTFIVNTPCEEAQKYWIGGAFQSARWTALFAQLYVKGVCHGVHPFL  254


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 58/120 (48%), Gaps = 13/120 (11%)
 Frame = +2

Query  119  PAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAM  298
            P     P   FD+ +MR+L+D +N   RD  Y  + ++ VF PR           YN+++
Sbjct  48   PPGVVAPRPVFDIKKMRELLDMNNFALRDSFY-ELFKNPVFFPR-----------YNESL  95

Query  299  EQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
             +QR  T++R   ++  GVF   L +   AE   R  A  E +   + S+ IK+GV   L
Sbjct  96   AEQRARTIQRWRLIAKTGVFHNTL-QTFTAEGRQRYEATLESVGAMEHSMEIKMGVHYGL  154



>gb|EMS62186.1| hypothetical protein TRIUR3_06747 [Triticum urartu]
Length=245

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = +1

Query  676   LQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKV  855
             LQ SPC+ Y PPE S    +F   E+R L+DGH+L ERDW YG M +S LF PR  GGKV
Sbjct  33    LQFSPCLSYAPPESSGAPPAFAPMELRALLDGHHLRERDWAYGAMEESPLFCPRRAGGKV  92

Query  856   YVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLS  1035
             +V PD+N+  E QRE TMRRI YL+  GVFRGWLTE GP+AEL KLALL+   ++DHSL+
Sbjct  93    FVSPDYNEGKEGQREATMRRIGYLTRRGVFRGWLTEPGPDAELHKLALLECLGVYDHSLA  152

Query  1036  IKLGV  1050
             IK+ +
Sbjct  153   IKIEI  157


 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 85/123 (69%), Gaps = 1/123 (1%)
 Frame = +2

Query  98   SPCISYTPAEASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVG  277
            SPC+SY P E+S     F   E+R L+DGH+L+ERDW YG M +S +F PR  GG+V V 
Sbjct  36   SPCLSYAPPESSGAPPAFAPMELRALLDGHHLRERDWAYGAMEESPLFCPRRAGGKVFVS  95

Query  278  ADYNQAMEQQREMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIK  457
             DYN+  E QRE TMRRI YL+  GVFRGWLTE    +AEL K+AL E + ++D SLAIK
Sbjct  96   PDYNEGKEGQREATMRRIGYLTRRGVFRGWLTEPG-PDAELHKLALLECLGVYDHSLAIK  154

Query  458  IGV  466
            I +
Sbjct  155  IEI  157



>ref|XP_005703885.1| acyl-CoA oxidase [Galdieria sulphuraria]
 gb|EME27365.1| acyl-CoA oxidase [Galdieria sulphuraria]
Length=636

 Score =   167 bits (423),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 88/226 (39%), Positives = 132/226 (58%), Gaps = 12/226 (5%)
 Frame = +1

Query  688   PCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWP  867
             PC  Y P E +   + F++ ++R     H++E R  ++   ++  +F+ R          
Sbjct  6     PCGEYLPAETASTISPFNLFKLRNYFLEHDIEFRYSVFE-ALKEPIFHFR----------  54

Query  868   DFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLG  1047
              +  S+E++R    +R A L + G  +G LT   P+   +  A  +   ++DHSLS+ +G
Sbjct  55    -YGLSLEEERLWLKKRWARLHELGFLKGTLTSVDPKVRSKYDAFFECIEMYDHSLSVAMG  113

Query  1048  VHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTG  1227
             VH+ L+G  I F GT+    +WL   E+  + GCFA+TELGHGSNVRGIET  TYD  + 
Sbjct  114   VHYGLFGSTIAFLGTEDQVREWLPKVEDCSMLGCFALTELGHGSNVRGIETQATYDPVSQ  173

Query  1228  EFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             EF+I TPCE+AQKY IGGAA  A  + VF+QL ++G N G+H F+ 
Sbjct  174   EFIIFTPCETAQKYWIGGAAETARWSTVFAQLTVNGVNYGIHPFLV  219



>ref|XP_005536533.1| acyl-CoA oxidase ACX3 [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80497.1| acyl-CoA oxidase ACX3 [Cyanidioschyzon merolae strain 10D]
Length=773

 Score =   167 bits (424),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/212 (42%), Positives = 131/212 (62%), Gaps = 14/212 (7%)
 Frame = +1

Query  733   SFDVAEMRKLMDGHNLEERDWLYGLMIQ-SRLFNPRSRGGKVYVWPDFNQSMEQQREITM  909
             +F    MR L+D H++  RD +Y +  Q + LF PR           +  ++ ++RE+ M
Sbjct  82    TFCRQRMRALLDAHDIAFRDRIYAMFEQHADLFTPR-----------YGLTVPEERELVM  130

Query  910   RRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFG  1089
              R A + +  + +G L    PEA  R  A+++     DHSL +K+GVH+ L+G ++   G
Sbjct  131   ARWAVIREAQLLKGTLN-YSPEARGRYDAVMESCGYVDHSLEVKMGVHYGLFGSSVALLG  189

Query  1090  TKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKY  1269
              ++   +WL+D E+  + GCFA+TELGHGSNVRGIET+ TYD   GEF+I+TP E+AQKY
Sbjct  190   DEQQCRRWLQDIEDARMLGCFALTELGHGSNVRGIETLATYDPGRGEFIIHTPTETAQKY  249

Query  1270  SIGGAANHATHTVVFSQ-LNIDGKNQGVHAFI  1362
              IGGAA  A   VVF++ L  DG ++G+H F+
Sbjct  250   WIGGAAETARWAVVFAKLLTPDGVHRGIHPFL  281



>ref|XP_005712270.1| acyl-CoA oxidase [Chondrus crispus]
 emb|CDF77396.1| acyl-CoA oxidase [Chondrus crispus]
Length=672

 Score =   166 bits (420),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 119/219 (54%), Gaps = 12/219 (5%)
 Frame = +1

Query  706   PPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSM  885
             PP +      FD+ +MR+L+D +N E RD  Y L      F            P +N+S+
Sbjct  48    PPGVVASRPVFDIKKMRELLDMNNFELRDSFYELFKNPVFF------------PRYNESL  95

Query  886   EQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLW  1065
              +QR  T++R   ++  GVF   L     E   R  A L+     +HS+ IK+GVH+ L+
Sbjct  96    AEQRARTIQRWRLIAKTGVFHKTLQNFTAEGRQRYEATLESVGAMEHSMEIKMGVHYGLF  155

Query  1066  GGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINT  1245
             GG +   G      KW    EN  + GCFAMTELGHGSNV+GI+T   YD  +  F++NT
Sbjct  156   GGTVSMMGDDEQSAKWAPMIENCQMLGCFAMTELGHGSNVKGIQTKAVYDIPSQTFIVNT  215

Query  1246  PCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             PCE AQKY IGGA   A  T +F+QL + G   GVH F+
Sbjct  216   PCEEAQKYWIGGAFQSARWTALFAQLYVQGVCHGVHPFL  254


 Score = 56.2 bits (134),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 61/117 (52%), Gaps = 15/117 (13%)
 Frame = +2

Query  128  ASEPAARFDVFEMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQ  307
            AS P   FD+ +MR+L+D +N + RD  Y  + ++ VF PR           YN+++ +Q
Sbjct  53   ASRPV--FDIKKMRELLDMNNFELRDSFY-ELFKNPVFFPR-----------YNESLAEQ  98

Query  308  REMTMRRIEYLSDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            R  T++R   ++  GVF   L +N  AE   R  A  E +   + S+ IK+GV   L
Sbjct  99   RARTIQRWRLIAKTGVFHKTL-QNFTAEGRQRYEATLESVGAMEHSMEIKMGVHYGL  154



>ref|XP_004363191.1| putative acyl-CoA oxidase [Dictyostelium fasciculatum]
 gb|EGG25340.1| putative acyl-CoA oxidase [Dictyostelium fasciculatum]
Length=657

 Score =   165 bits (418),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 101/265 (38%), Positives = 147/265 (55%), Gaps = 32/265 (12%)
 Frame = +1

Query  613   RTHVLTRHLIQENPCVDDDILLQS-------------SPCIGYTPPELSEPAASFDVAEM  753
             R H +  H++   P VDD I L+S             S  +  TP + S+P + +D  E+
Sbjct  6     RIHTIVSHIL---PSVDD-IWLESNDVSASTAATSNGSEPLNITPDKPSKPISKWDKEEL  61

Query  754   RKLMDGHNLEERDWLYGL-MIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLS  930
             R+ ++ +   ++     L  ++  LF PR           +N + E+ RE+T++R   L 
Sbjct  62    REFLESNPAYKQHKQAILEALRDPLFAPR-----------YNMNKEEWRELTVKRAVKLI  110

Query  931   DCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDK  1110
               G+       + P    + L  L++ ++ D+SLS+K+GVHF L+G A+   GT++HH K
Sbjct  111   QQGLISITDLNRDPN---KYLMTLELASLADNSLSVKMGVHFSLFGNAVLNLGTEKHHLK  167

Query  1111  WLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAAN  1290
             +L+D + + + GCF MTELGHGSNV+GIET  TYD  T EFVINTP ESAQK  IG AA 
Sbjct  168   YLKDIDTWKLPGCFGMTELGHGSNVQGIETTATYDKDTEEFVINTPSESAQKSWIGNAAV  227

Query  1291  HATHTVVFSQLNIDGKNQGVHAFIA  1365
             H     VF+QL   G N GVH F+ 
Sbjct  228   HGQACSVFAQLITGGVNHGVHVFVV  252



>gb|EMT28673.1| hypothetical protein F775_14360 [Aegilops tauschii]
Length=133

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +1

Query  748   EMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYL  927
             E+R L+DGH+L ERDW YG M +S LF PR  GGKV+V PD+N+  E QRE TMRRI YL
Sbjct  2     ELRALLDGHHLRERDWAYGAMEESPLFCPRRAGGKVFVSPDYNEGKEGQREATMRRIGYL  61

Query  928   SDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLW  1065
             +  GVFRGWLTE GP+AELRKLALL+   ++DHSL+IK+GVHFFLW
Sbjct  62    TRRGVFRGWLTEPGPDAELRKLALLECLGVYDHSLAIKVGVHFFLW  107


 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = +2

Query  161  EMRKLMDGHNLQERDWLYGVMIQSKVFNPRSMGGRVHVGADYNQAMEQQREMTMRRIEYL  340
            E+R L+DGH+L+ERDW YG M +S +F PR  GG+V V  DYN+  E QRE TMRRI YL
Sbjct  2    ELRALLDGHHLRERDWAYGAMEESPLFCPRRAGGKVFVSPDYNEGKEGQREATMRRIGYL  61

Query  341  SDCGVFRGWLTENDQAEAELRKVALCEVIAIFDFSLAIKIGVQVFL  478
            +  GVFRGWLTE    +AELRK+AL E + ++D SLAIK+GV  FL
Sbjct  62   TRRGVFRGWLTEPG-PDAELRKLALLECLGVYDHSLAIKVGVHFFL  106



>ref|XP_005712269.1| unnamed protein product [Chondrus crispus]
 emb|CDF77395.1| unnamed protein product [Chondrus crispus]
Length=672

 Score =   163 bits (412),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/219 (41%), Positives = 126/219 (58%), Gaps = 12/219 (5%)
 Frame = +1

Query  706   PPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSM  885
             PP +     +FD  +MR+L+D +N E RD LY L       NP      V+V P +N+++
Sbjct  48    PPGVVAARPAFDTKKMRELLDMNNFELRDSLYELFK-----NP------VFV-PRYNETL  95

Query  886   EQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLW  1065
             +++R  T++R   ++  GVF   L     +   R  A L+     DHSL IK+GVH+ L+
Sbjct  96    DEERARTIQRWRLIAKTGVFHEALRIFTVKGRQRYEATLESVGAIDHSLDIKMGVHYGLF  155

Query  1066  GGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINT  1245
             GG +   G      +W+   E+  + GCF+MTELGHGSNV+GI+T   YD  +  FV+NT
Sbjct  156   GGTVSLMGDDDQGARWMPKIESCEMLGCFSMTELGHGSNVKGIQTTAVYDIPSRTFVVNT  215

Query  1246  PCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             PCE AQKY IGGA   A  T +F+QL + G   GVH F+
Sbjct  216   PCEEAQKYWIGGAFQSARWTALFAQLYVKGVCHGVHPFL  254



>ref|XP_636605.1| hypothetical protein DDB_G0288735 [Dictyostelium discoideum AX4]
 gb|EAL63099.1| hypothetical protein DDB_G0288735 [Dictyostelium discoideum AX4]
Length=652

 Score =   156 bits (394),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 110/167 (66%), Gaps = 3/167 (2%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKL  1044
             P +N +++Q RE+T++R   +   G        + P   ++ L  +++  + D SLS+KL
Sbjct  83    PKYNMNVQQWRELTLQRAMIIIKAGAISLAEFNRDP---MKYLVSMEMLNLVDPSLSVKL  139

Query  1045  GVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSST  1224
             GVHF L+G A+   GT++HH K+++D +++ + GCF MTELGHGSNV+G+ET  TYD +T
Sbjct  140   GVHFSLFGNAVLNLGTEKHHIKYIKDIDSWKLPGCFGMTELGHGSNVQGVETTATYDKTT  199

Query  1225  GEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
              EF+INTP +SAQK+ IG AA H     VF+QL ID  + GVH F+ 
Sbjct  200   QEFIINTPSDSAQKFWIGNAACHGQACSVFAQLYIDNVHYGVHVFVV  246



>gb|EFA75614.1| putative acyl-CoA oxidase [Polysphondylium pallidum PN500]
Length=646

 Score =   155 bits (393),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 109/167 (65%), Gaps = 3/167 (2%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKL  1044
             P +N + EQ RE+T++R   + + G+       + P   L  + LL+++   D SLS+KL
Sbjct  78    PKYNMNCEQWREVTLQRSIKVINSGLISLAEFNRDPMKYLLSMELLNLS---DPSLSVKL  134

Query  1045  GVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSST  1224
             GVHF L+G A+   GT++HH K+++D + + + GCF MTELGHGSNV+G+ET  TYD  T
Sbjct  135   GVHFSLFGNAVLNLGTEKHHLKYIKDIDTWKLPGCFGMTELGHGSNVQGVETTATYDKDT  194

Query  1225  GEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
              EF+INTP +SAQK+ IG AA H     VF+QL I G + GVH F+ 
Sbjct  195   QEFIINTPSDSAQKFWIGNAALHGQACAVFAQLYIGGVHYGVHVFVV  241



>dbj|GAM28721.1| hypothetical protein SAMD00019534_118970 [Acytostelium subglobosum 
LB1]
Length=658

 Score =   153 bits (387),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 108/167 (65%), Gaps = 3/167 (2%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKL  1044
             P +N ++EQ RE+T++R   +   G+       + P   ++ L  ++   + D SLS+KL
Sbjct  90    PVYNMTVEQWRELTLQRAVKVIRSGLISISEFNRDP---MKYLISMETINMSDSSLSVKL  146

Query  1045  GVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSST  1224
             GVHF L+G A+   GT++HH K+L+D + + + GCF MTELGHGSNV+G+ET  TYD  T
Sbjct  147   GVHFSLFGNAVLNLGTEKHHLKYLKDIDTWKLPGCFGMTELGHGSNVQGVETTATYDKDT  206

Query  1225  GEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
              EF+INTP +SAQK+ IG AA H     VF+QL I G + GVH F+ 
Sbjct  207   QEFIINTPSDSAQKFWIGNAALHGQACSVFAQLYIGGVHYGVHVFVV  253



>ref|XP_003293845.1| hypothetical protein DICPUDRAFT_158763 [Dictyostelium purpureum]
 gb|EGC29627.1| hypothetical protein DICPUDRAFT_158763 [Dictyostelium purpureum]
Length=648

 Score =   153 bits (386),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 110/167 (66%), Gaps = 3/167 (2%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKL  1044
             P +N ++++ RE+T++R   +   G        + P   ++ L  L++  + D SLS+KL
Sbjct  80    PKYNMNVQEWRELTLQRAIKVIKAGAISLAEFNRDP---MKYLVSLEMLNLCDPSLSVKL  136

Query  1045  GVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSST  1224
             GVHF L+G A+   GT++HH K+++D +++ + GCF MTELGHGSNV+G+ET  TYD +T
Sbjct  137   GVHFSLFGNAVLNLGTEKHHLKYIKDIDSWKLPGCFGMTELGHGSNVQGVETTATYDKNT  196

Query  1225  GEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
              EF+INTP +SAQK+ IG AA H     VF+QL ID  + GVH F+ 
Sbjct  197   EEFIINTPSDSAQKFWIGNAALHGQACSVFAQLYIDNVHYGVHVFVV  243



>gb|KIY97857.1| acyl-CoA oxidase [Monoraphidium neglectum]
Length=223

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 101/168 (60%), Gaps = 9/168 (5%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCGVF--RGWLTEKGPEAELRKL-ALLDVTTIFDHSLS  1035
             PD+ QSM + RE T+ R+        F  R +LT+       RK  A L+  +  D+SL+
Sbjct  19    PDYYQSMMEFREQTLVRLQRFLQQRFFSIRDYLTDP------RKFQAALECLSFCDYSLA  72

Query  1036  IKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYD  1215
             IK GVH  L GG I   GTK+HHD +L   ++  + GCF MTELGHGSNV GIET   YD
Sbjct  73    IKCGVHMTLCGGTICKLGTKKHHDAFLPGIDSLALPGCFGMTELGHGSNVMGIETTAHYD  132

Query  1216  SSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAF  1359
              STGEFVINTP   A K+ IGG+  H    VVF+QL + GK +G H F
Sbjct  133   PSTGEFVINTPNNEASKFWIGGSGQHGKLCVVFAQLTVAGKWEGPHVF  180



>ref|XP_002159574.1| PREDICTED: putative acyl-coenzyme A oxidase 3.2, peroxisomal-like 
[Hydra vulgaris]
Length=665

 Score =   149 bits (377),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/221 (38%), Positives = 126/221 (57%), Gaps = 17/221 (8%)
 Frame = +1

Query  706   PPELSEP--AASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQ  879
             P EL       SF+V +M++L+D  N E RD +   +    +F P+           +N 
Sbjct  42    PKELRAKWNKPSFNVDKMKELIDHDNHEMRDEMRKFL-SDPIFKPK-----------YNI  89

Query  880   SMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFF  1059
             S+ ++REI ++R+  + + G       +  P   L+  A  ++ +I D ++S K+ V F 
Sbjct  90    SLSEEREIALQRLKKICEKGFISVLDFKNNP---LKIFAAHEIASIVDPAMSTKMTVQFN  146

Query  1060  LWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVI  1239
             L+GG +   GTKRHHD++L+  ++    GCFA+TELG+G+N   +ET   YD  + EF+I
Sbjct  147   LFGGTVLKLGTKRHHDRYLKGIDSLEDIGCFALTELGYGNNAVEMETTAVYDIESQEFII  206

Query  1240  NTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             NTP   AQKY I   A HA H VVF+QLNI+GK+ GVH  +
Sbjct  207   NTPSPLAQKYWITNGAIHAKHCVVFAQLNIEGKSHGVHGIL  247



>ref|XP_005649112.1| acyl-CoA oxidase [Coccomyxa subellipsoidea C-169]
 gb|EIE24568.1| acyl-CoA oxidase [Coccomyxa subellipsoidea C-169]
Length=635

 Score =   147 bits (371),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 101/166 (61%), Gaps = 3/166 (2%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKL  1044
             P++  S+ + R++T+RR+    D   F  +     P   LR +A L+     D+SL IK 
Sbjct  62    PNYYLSLMEFRDLTLRRLQKFVDQKFFSTFDYLNDP---LRFMAGLETLASVDYSLCIKA  118

Query  1045  GVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSST  1224
             GVHF L GG I   GT++HH  +L   +   + GCF MTELGHGSNV GIET  TYD  T
Sbjct  119   GVHFTLCGGTIAKLGTEKHHKTFLPRLDTLELPGCFGMTELGHGSNVMGIETQATYDEET  178

Query  1225  GEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             GEFVINTP ++A K+ IGGAA H     VF+QL + GK +G H F+
Sbjct  179   GEFVINTPTDTASKFWIGGAAQHGKVCTVFAQLTVRGKWEGPHVFV  224



>ref|XP_642669.1| acyl-CoA oxidase [Dictyostelium discoideum AX4]
 gb|EAL68701.1| acyl-CoA oxidase [Dictyostelium discoideum AX4]
Length=638

 Score =   147 bits (371),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 136/260 (52%), Gaps = 29/260 (11%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGH  774
             ME    R  + T HL+  N C+ +              P+  E   SFD   + K +  +
Sbjct  1     MESTIRRIQINTLHLLSNNDCLSE------------IDPQYMEIKQSFDANLLNKYLFPY  48

Query  775   NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW  954
              LE ++ L      S  +N  +      + P F  S+EQ RE+T  +   L +       
Sbjct  49    ELELKESL------STFWNNEN----FLLQPSFGLSLEQDRELTFNQFKKLMELATKHFG  98

Query  955   LT--EKGPEAELRKLALLDVTTIFDH-SLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDS  1125
             L   E+ P    +K+A+      F + S++  +GVHF L+G +I F G++    K+    
Sbjct  99    LIDLERNP----KKIAVFTQGYRFQNPSVTTLMGVHFSLFGASIVFLGSEEQRKKYTEKV  154

Query  1126  ENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHT  1305
             E   + GCF++TELGHGSNV+ IET+  YD    EF+IN+P  ++QKY IGG+A +ATHT
Sbjct  155   EKLEIIGCFSLTELGHGSNVQSIETIAEYDHDKEEFIINSPTITSQKYFIGGSAKNATHT  214

Query  1306  VVFSQLNIDGKNQGVHAFIA  1365
             ++ +QL + GK +GVHAF+A
Sbjct  215   IIMAQLKVSGKMEGVHAFVA  234



>ref|XP_002677851.1| acyl-coenzyme A oxidase [Naegleria gruberi]
 gb|EFC45107.1| acyl-coenzyme A oxidase [Naegleria gruberi]
Length=750

 Score =   148 bits (373),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 94/290 (32%), Positives = 154/290 (53%), Gaps = 31/290 (11%)
 Frame = +1

Query  520   STSAEANVCLKLNQLWRLESSSLSSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIG  699
             +TSA   + + LN L    +S L+        +   +   I++  C     ++Q++P +G
Sbjct  9     NTSANRRLAVHLNHLVPSTTSPLAQQAS----SSNNSSSTIEQQVCAGQ--IIQANPTLG  62

Query  700   YTPPELSEPAAS---------FDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGK  852
             YT P       S         FDV +M+  ++G    ++  +Y  +    L    +    
Sbjct  63    YTYPNEENDRYSSISYNYNHTFDVKKMQAWLNGSF--DKKAMYKFLDNPLLLKRST----  116

Query  853   VYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSL  1032
                    N   E+ RE+T++++A+L   G++R    +K PE  L +L   + T + + S 
Sbjct  117   -------NMPKEEARELTLQQVAFLCKSGLYRISDMKKTPELILNRL---ENTGLIESSS  166

Query  1033  SIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTY  1212
             ++KLGV   L+ G+I   GTK+HHDK+L+ +E   + G FAMTE+ HGSNVR ++T  T+
Sbjct  167   NVKLGVQLVLFAGSILNLGTKKHHDKYLKAAECIELPGMFAMTEIEHGSNVRQLQTTATF  226

Query  1213  DSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             D +T EF+INTP + A K+ +G AA H     VF++L + GK+ GVHAF+
Sbjct  227   DENTNEFIINTPNKGAVKWWLGNAACHGVMATVFARLILKGKDYGVHAFL  276



>gb|EFA78930.1| acyl-CoA oxidase [Polysphondylium pallidum PN500]
Length=657

 Score =   145 bits (366),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/218 (37%), Positives = 124/218 (57%), Gaps = 11/218 (5%)
 Frame = +1

Query  712   ELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQ  891
             E   P  S D+  ++ L+DG    +R  +  L+  S+ F       ++++      S E 
Sbjct  40    ENEHPLRSPDIDMLKHLLDGDFKRDRTQIRQLIQNSKSFE------EIHLIESI--SPEV  91

Query  892   QREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGG  1071
              RE T++ +  + D  +      +  PE   + L+  +  +I D S+ +K  V + LWGG
Sbjct  92    HRERTIQAVREVIDLSIVSVTDMKDNPE---KFLSWFETVSICDLSVVLKFAVQYNLWGG  148

Query  1072  AIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPC  1251
              + F GTK+HHDK+L D  N  + G F +TELGHGSNV+G+ET +TYD++TGEF+IN+P 
Sbjct  149   TVLFLGTKKHHDKYLNDISNGKLLGVFGLTELGHGSNVQGLETTSTYDNATGEFIINSPT  208

Query  1252  ESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
              ++QKY  G  + H     VF++L +DG + GVHAFI 
Sbjct  209   WTSQKYWPGNISAHGQMATVFARLIVDGTDHGVHAFIV  246



>ref|XP_009061608.1| hypothetical protein LOTGIDRAFT_127454 [Lottia gigantea]
 gb|ESO87713.1| hypothetical protein LOTGIDRAFT_127454 [Lottia gigantea]
Length=599

 Score =   144 bits (364),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKL  1044
             P +N ++ ++R++ ++R+  + D G+      +  P   LR  A  ++ ++ D +++ K+
Sbjct  30    PRYNLTLREERDVALQRLQRICDAGLISVLDFKNNP---LRIFAAHELASVIDPAMTTKM  86

Query  1045  GVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSST  1224
              V F L+GG I   GT+RHHDK L+  +N    GCF +TELG+G+N   +ET  TYDS+T
Sbjct  87    TVQFNLFGGTILKLGTQRHHDKLLKGIDNLNDVGCFGLTELGYGNNAVEMETTATYDSAT  146

Query  1225  GEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              EF++NTP   AQKY I   A HA H +VFSQL +DGKN G+H  +
Sbjct  147   KEFIVNTPSTLAQKYWITNGAVHAKHCIVFSQLIVDGKNHGIHGVL  192



>gb|EFA80269.1| hypothetical protein PPL_07095 [Polysphondylium pallidum PN500]
Length=3352

 Score =   148 bits (373),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/231 (36%), Positives = 137/231 (59%), Gaps = 15/231 (6%)
 Frame = +1

Query  676   LQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEE-RDWLYGLMIQSRLFNPRSRGGK  852
             ++ S  I     E+S    + DV +++  +DG +L + +D +   + ++    P  R   
Sbjct  1233  IEDSSIIQIGETEISSIVPNVDVDQLKLKLDGKDLSKFKDQVRRFLEET----PSIRSS-  1287

Query  853   VYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSL  1032
             V   P       + RE+ +++I  LS  G+F       G E   +   L+++ + +++++
Sbjct  1288  VAGLPS-----AEYRELVLQQIKDLSKSGLFNITDIRDGVE---KTCGLMEILSSYNNNI  1339

Query  1033  SIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTY  1212
             + KLGVH+ L+GG +   GT+RH +K++  +    + GCF+MTE+GHGSNVRGIET  TY
Sbjct  1340  TTKLGVHYSLFGGTVLLLGTQRH-EKYIEPANKLDIVGCFSMTEVGHGSNVRGIETTATY  1398

Query  1213  DSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             D++T EF+INTP  S+QK+ IGGA  HA  T VF++L ++ K+ GVHAF+ 
Sbjct  1399  DAATKEFIINTPTPSSQKFWIGGAYLHAHFTTVFARLILNKKDHGVHAFVV  1449



>ref|WP_013062161.1| acyl-CoA oxidase [Salinibacter ruber]
 emb|CBH24828.1| acyl-Coenzyme A oxidase [Salinibacter ruber M8]
Length=768

 Score =   144 bits (363),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 102/281 (36%), Positives = 140/281 (50%), Gaps = 32/281 (11%)
 Frame = +1

Query  529   AEANVCLKLNQLWRLESSSLSSMEKA-NFRTHVLTRHLIQENPCVDDDILLQSSPCIGYT  705
             A ANV      L      +L  +E A N     + R L+ E P        + SP     
Sbjct  94    ALANVGGDGTALPEASRRALEDIEAALNIDGEEVVRDLLGERP--------EPSPV----  141

Query  706   PPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSM  885
                  EP A FD   MR+L+DG + E R+      I++ L +P      V+ + D     
Sbjct  142   -----EPEAPFDTDAMRRLLDGPHAELRE-----DIRTLLQDP------VFEYQD-GLGT  184

Query  886   EQQREITMRRIAYLSDCGVFR-GWLTEKGPEAELRK-LALLDVTTIFDHSLSIKLGVHFF  1059
             E  RE  +R   +L+D G+    +    G   ++ K +   +     D SL +K GV F 
Sbjct  185   EAYREQVLRWCEHLADQGLGALAYPDAYGGGGDMEKFIVAFETLAYHDLSLVVKFGVQFG  244

Query  1060  LWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVI  1239
             L+GG+I   GT+RHH+++L       + GCFAMTE GHGSNVR +ET   YD +T EFVI
Sbjct  245   LFGGSIHHLGTERHHEEYLDRVGTLDLPGCFAMTEWGHGSNVRELETTARYDPTTEEFVI  304

Query  1240  NTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             NTP + A+K  IG AA H     VF+QL  DG+  GVHAF+
Sbjct  305   NTPHDGARKEWIGNAAAHGQVATVFAQLRTDGEEHGVHAFL  345



>ref|WP_011404446.1| acyl-CoA oxidase [Salinibacter ruber]
 ref|YP_445820.1| acyl-coenzyme A oxidase I [Salinibacter ruber DSM 13855]
 gb|ABC46051.1| acyl-coenzyme A oxidase I, putative [Salinibacter ruber DSM 13855]
Length=786

 Score =   144 bits (363),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 102/281 (36%), Positives = 140/281 (50%), Gaps = 32/281 (11%)
 Frame = +1

Query  529   AEANVCLKLNQLWRLESSSLSSMEKA-NFRTHVLTRHLIQENPCVDDDILLQSSPCIGYT  705
             A ANV      L      +L  +E A N     + R L+ E P        + SP     
Sbjct  112   ALANVGGDGTALPEASRRALEDIEAALNIDGEEVVRDLLGERP--------EPSPV----  159

Query  706   PPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSM  885
                  EP A FD   MR+L+DG + E R+      I++ L +P      V+ + D     
Sbjct  160   -----EPEAPFDTDAMRRLLDGPHAELRE-----DIRTLLQDP------VFEYQD-GLGT  202

Query  886   EQQREITMRRIAYLSDCGVFR-GWLTEKGPEAELRK-LALLDVTTIFDHSLSIKLGVHFF  1059
             E  RE  +R   +L+D G+    +    G   ++ K +   +     D SL +K GV F 
Sbjct  203   EAYREQVLRWCEHLADQGLGALAYPDAYGGGGDMEKFIVAFETLAYHDLSLVVKFGVQFG  262

Query  1060  LWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVI  1239
             L+GG+I   GT+RHH+++L       + GCFAMTE GHGSNVR +ET   YD +T EFVI
Sbjct  263   LFGGSIHHLGTERHHEEYLDRVGTLDLPGCFAMTEWGHGSNVRELETTARYDPTTEEFVI  322

Query  1240  NTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             NTP + A+K  IG AA H     VF+QL  DG+  GVHAF+
Sbjct  323   NTPHDGARKEWIGNAAAHGQVATVFAQLRTDGEEHGVHAFL  363



>ref|XP_003288089.1| hypothetical protein DICPUDRAFT_152296 [Dictyostelium purpureum]
 gb|EGC35351.1| hypothetical protein DICPUDRAFT_152296 [Dictyostelium purpureum]
Length=617

 Score =   142 bits (357),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 90/128 (70%), Gaps = 1/128 (1%)
 Frame = +1

Query  982   LRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMT  1161
              R   ++++  +F++++  KLGVHF L+GG I F GT+RH  K++ D+      GCF+MT
Sbjct  101   FRYAGIVEMLALFNNNICTKLGVHFTLFGGTIMFLGTERHQ-KYIEDANTLKTVGCFSMT  159

Query  1162  ELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKN  1341
             E+GHGSNVRGIET   YD ST EF+IN+P  ++QK+ IGG+  HAT+T VF+ L I G N
Sbjct  160   EIGHGSNVRGIETTAHYDPSTKEFIINSPTPTSQKFWIGGSYLHATYTTVFANLIIKGVN  219

Query  1342  QGVHAFIA  1365
              GVHAF+ 
Sbjct  220   HGVHAFVV  227



>ref|WP_039855121.1| acyl-CoA oxidase [Gordonia sputi]
Length=683

 Score =   142 bits (359),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 132/244 (54%), Gaps = 22/244 (9%)
 Frame = +1

Query  652   PCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFN  831
             P  DDD  + ++   G    ELS+      V  +R ++DG     RD +           
Sbjct  11    PATDDDPSIDTA---GADSSELSDAERDLLVDNLRYVLDGRWRATRDEV-----------  56

Query  832   PRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLD  1005
              R R  +  + PD ++++EQ R   +  +  LS+ G    G+  + G   ++   +  ++
Sbjct  57    -RRRANRADLLPDPSRTLEQARARILDEMRELSEEGFAAAGFGADHGGTGDVGASITAIE  115

Query  1006  VTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNV  1185
             +    D SL +K GV + LWGGA++  GT RHH+K++ D+ +  + GCFAMTE GHGSNV
Sbjct  116   MLGYADLSLMVKAGVQWGLWGGAVENLGTARHHEKYVADTISLDLLGCFAMTETGHGSNV  175

Query  1186  RGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQ-----GV  1350
             + +ET  TYD++T EFVI++P  SA+K  IGGAA HA    VF+QL   G  Q     GV
Sbjct  176   QELETTATYDATTKEFVIHSPTPSARKDYIGGAAEHARMASVFAQLITAGPGQEPESYGV  235

Query  1351  HAFI  1362
             H F+
Sbjct  236   HCFV  239



>dbj|GAB38637.1| putative acyl-CoA oxidase [Gordonia sputi NBRC 100414]
Length=724

 Score =   142 bits (358),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 132/244 (54%), Gaps = 22/244 (9%)
 Frame = +1

Query  652   PCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFN  831
             P  DDD  + ++   G    ELS+      V  +R ++DG     RD +           
Sbjct  52    PATDDDPSIDTA---GADSSELSDAERDLLVDNLRYVLDGRWRATRDEV-----------  97

Query  832   PRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLD  1005
              R R  +  + PD ++++EQ R   +  +  LS+ G    G+  + G   ++   +  ++
Sbjct  98    -RRRANRADLLPDPSRTLEQARARILDEMRELSEEGFAAAGFGADHGGTGDVGASITAIE  156

Query  1006  VTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNV  1185
             +    D SL +K GV + LWGGA++  GT RHH+K++ D+ +  + GCFAMTE GHGSNV
Sbjct  157   MLGYADLSLMVKAGVQWGLWGGAVENLGTARHHEKYVADTISLDLLGCFAMTETGHGSNV  216

Query  1186  RGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQ-----GV  1350
             + +ET  TYD++T EFVI++P  SA+K  IGGAA HA    VF+QL   G  Q     GV
Sbjct  217   QELETTATYDATTKEFVIHSPTPSARKDYIGGAAEHARMASVFAQLITAGPGQEPESYGV  276

Query  1351  HAFI  1362
             H F+
Sbjct  277   HCFV  280



>ref|WP_030226700.1| acyl-CoA oxidase [Streptomyces lavendulae]
Length=656

 Score =   141 bits (356),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 125/229 (55%), Gaps = 19/229 (8%)
 Frame = +1

Query  682   SSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYG-LMIQSRLFNPRSRGGKVY  858
             S+P   Y  PE+  PA       +  ++DG     RD + G L   S + +     G   
Sbjct  7     SAPATAYAQPEIDVPA-------LTAVLDGEYAGIRDLVRGNLTTYSSILDEADELG---  56

Query  859   VWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLS  1035
                  +   E+ RE+ ++ +A     G+  G+  E G   ++   +A  +     D S+ 
Sbjct  57    ----IDAYRERVREVVVK-MAATGQTGM--GFPVEYGGGGDVGASIAAFETLAFGDLSVL  109

Query  1036  IKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYD  1215
             +K+GV F L+GGAI   GT RHH+ +L       + G FAMTE GHGSNV+ + TV TYD
Sbjct  110   VKVGVQFGLFGGAILHLGTGRHHEAYLPGLITGELMGSFAMTETGHGSNVQALGTVATYD  169

Query  1216  SSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             S+TGEFVI TP + A+K  IG AA HA   VVF+QL +DG++QGVHAF+
Sbjct  170   SATGEFVITTPDDDARKDYIGNAARHAELAVVFAQLEVDGRSQGVHAFV  218



>gb|ELT92145.1| hypothetical protein CAPTEDRAFT_182867 [Capitella teleta]
Length=680

 Score =   141 bits (356),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 110/209 (53%), Gaps = 15/209 (7%)
 Frame = +1

Query  736   FDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRR  915
             F++  M +L+D  NLE R      + +  +             P ++  +   RE+  +R
Sbjct  82    FNIPAMTELLDNDNLEMRQKYRAFLSEGTM------------TPKYDIPLAAHRELAQKR  129

Query  916   IAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTK  1095
             +  + D G       +   E  LR  A  ++  I D  +++K+ V F L+GG +   GTK
Sbjct  130   LKTICDAGFIS---VKDFIENPLRIFAAHELAAILDPDMAVKMTVQFNLFGGTVLKLGTK  186

Query  1096  RHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSI  1275
             RHHD  L   ++    GCF +TELG G+N   +ET   YD  +GEFVINTP E AQKY I
Sbjct  187   RHHDVLLAGIDSLDDVGCFGLTELGFGNNAIEMETTAVYDKESGEFVINTPTELAQKYWI  246

Query  1276  GGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
                A HA H VVF+QL++DGK QG+H  +
Sbjct  247   TNGAVHAKHCVVFAQLSVDGKQQGIHGIL  275



>gb|KEP51916.1| acyl-coenzyme A oxidase 3, peroxisomal protein [Rhizoctonia solani 
123E]
Length=671

 Score =   141 bits (355),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 91/258 (35%), Positives = 136/258 (53%), Gaps = 36/258 (14%)
 Frame = +1

Query  616   THVLTRHLIQENPC---------VDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMD  768
             +HVL   L    PC         +D D+L   +P   YTPP      A+F+V E++++ D
Sbjct  5     SHVLPHGL---TPCHSHTRTILALDHDLLTTMAP---YTPP-----PATFNVNELKRVFD  53

Query  769   GHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFR  948
               N ++RD    L  +  LF PR            N S+  +RE+ + R+  +S+  +  
Sbjct  54    HDNFDKRDAFRALADEP-LFVPR-----------HNVSLSYERELALDRLKRVSETKMIS  101

Query  949   GWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSE  1128
              +  EK P   L  +A  +   + D S + K+ V + L+GG +   GT RH  K+L   +
Sbjct  102   VFDFEKNP---LNVMAAHEFAGMLDPSFTTKMTVQYNLFGGTVLKLGTSRHR-KYLHGVD  157

Query  1129  NYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTV  1308
             +  V GCFA+TELG+G+N   +ET   +D  T EF+INTP   AQKY I  +A HA + V
Sbjct  158   DMSVIGCFALTELGYGNNAVEMETTAIWDPKTKEFIINTPSVIAQKYWITNSAVHANYAV  217

Query  1309  VFSQLNIDGKNQGVHAFI  1362
             VF+QL   G N+G+HAF+
Sbjct  218   VFAQLIFQGTNEGIHAFL  235



>emb|CCO32276.1| hypothetical protein BN14_06332 [Rhizoctonia solani AG-1 IB]
Length=532

 Score =   139 bits (351),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 122/215 (57%), Gaps = 16/215 (7%)
 Frame = +1

Query  718   SEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQR  897
             + P ASF V E++++ D  N ++RD  Y  +    LF PR            N S+  +R
Sbjct  5     APPPASFKVEELKRVFDHDNFDKRD-AYRALADEPLFVPRH-----------NVSLSYER  52

Query  898   EITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAI  1077
             E+ + R+  +S+  +   +  EK P   L  +A  +++ + D S + K+ V + L+GG +
Sbjct  53    ELALDRLKRVSETKMISVFDFEKNP---LNVMAAHELSGMLDPSFTTKMTVQYNLFGGTV  109

Query  1078  QFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCES  1257
                GT RH  K+L   ++  V GCFA+TELG+G+N   +ET   +D  T EF+INTP   
Sbjct  110   LKLGTSRHR-KYLHGVDDMSVIGCFALTELGYGNNAVEMETTAIWDPKTKEFIINTPSVI  168

Query  1258  AQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             AQKY I  +A HA + VVF+QL  +G N+G+HAF+
Sbjct  169   AQKYWITNSAVHANYAVVFAQLIFEGTNEGIHAFL  203



>ref|WP_030389344.1| acyl-CoA oxidase [Streptomyces sp. NRRL S-241]
Length=654

 Score =   140 bits (353),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 128/229 (56%), Gaps = 19/229 (8%)
 Frame = +1

Query  682   SSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLY-GLMIQSRLFNPRSRGGKVY  858
             S+P  GY  PE+       DV+ + +++DG     RD +   L+  + +       G   
Sbjct  8     STPATGYVQPEI-------DVSALAEVLDGEYAGIRDLVRTNLVTYASVLEEADELG---  57

Query  859   VWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLS  1035
                  +   E+ REI ++ +A     G+  G+ TE G   ++   +A  +     D S+ 
Sbjct  58    ----LDAFRERVREIVVK-MAATGQTGM--GFPTEYGGGGDVGASIAAFETLAFGDLSVL  110

Query  1036  IKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYD  1215
             +K+GV F L+GGAI   GT+RHHD +L       + GCFAMTE GHGSNV+ + TV  YD
Sbjct  111   VKVGVQFGLFGGAILHLGTERHHDTYLPGLITGELMGCFAMTETGHGSNVQALGTVARYD  170

Query  1216  SSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             S++ EFVI TP + A+K  IG AA HA   VVF+QL +DG+++GVHAF+
Sbjct  171   SASREFVITTPDDRARKDYIGNAARHAELAVVFAQLEVDGRSRGVHAFV  219



>ref|XP_002166799.2| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Hydra 
vulgaris]
Length=641

 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/209 (35%), Positives = 118/209 (56%), Gaps = 15/209 (7%)
 Frame = +1

Query  736   FDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRR  915
             F+V +M +L+D  N + R   +   +   +F P+           +N S+ ++RE+ ++R
Sbjct  47    FNVEKMTELLDHDNHKMRKD-FRKFLSDPIFTPK-----------YNISLVEEREVALKR  94

Query  916   IAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTK  1095
             +  + D G    +   K P   L+  A  ++ +I D +++ K+ V F L+GG +   GT 
Sbjct  95    LKKICDAGFISVFDFHKNP---LKIFAAHELASIMDPAMATKMTVQFNLFGGTVLKLGTD  151

Query  1096  RHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSI  1275
             RHH + L+  ++    GCF +TELG+G+N   +ET+  YD +T EF+INTP   AQKY I
Sbjct  152   RHHKQLLKGIDSLEDIGCFGLTELGYGNNAVEMETIAVYDKTTDEFIINTPSTLAQKYWI  211

Query  1276  GGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
                A HA H VVF+QLN++G   G+H F+
Sbjct  212   TNGAVHAKHCVVFAQLNVEGTEHGIHGFL  240



>ref|WP_043324301.1| acyl-CoA oxidase, partial [Corallococcus coralloides]
Length=781

 Score =   141 bits (355),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = +1

Query  991   LALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELG  1170
             +A  +    FD SL IK GVHF L+G +I F GTKRHH ++L    +  + GCFAM+ELG
Sbjct  238   IAAFETMAFFDLSLVIKAGVHFGLFGSSILFLGTKRHHQQYLPRVASLELPGCFAMSELG  297

Query  1171  HGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGV  1350
             HGSNVR  ETV  YD++TGEFV++TP E+A+K  IG AA HA    VF+QL +DG+  GV
Sbjct  298   HGSNVRDCETVARYDAATGEFVLHTPSETARKEWIGNAARHARIATVFAQLEVDGERLGV  357

Query  1351  HAFI  1362
             HA +
Sbjct  358   HALL  361



>gb|AFE09438.1| putative acyl-CoA dehydrogenase [Corallococcus coralloides DSM 
2259]
Length=804

 Score =   141 bits (355),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = +1

Query  991   LALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELG  1170
             +A  +    FD SL IK GVHF L+G +I F GTKRHH ++L    +  + GCFAM+ELG
Sbjct  238   IAAFETMAFFDLSLVIKAGVHFGLFGSSILFLGTKRHHQQYLPRVASLELPGCFAMSELG  297

Query  1171  HGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGV  1350
             HGSNVR  ETV  YD++TGEFV++TP E+A+K  IG AA HA    VF+QL +DG+  GV
Sbjct  298   HGSNVRDCETVARYDAATGEFVLHTPSETARKEWIGNAARHARIATVFAQLEVDGERLGV  357

Query  1351  HAFI  1362
             HA +
Sbjct  358   HALL  361



>ref|XP_002950277.1| hypothetical protein VOLCADRAFT_104659 [Volvox carteri f. nagariensis]
 gb|EFJ48478.1| hypothetical protein VOLCADRAFT_104659 [Volvox carteri f. nagariensis]
Length=629

 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 88/260 (34%), Positives = 132/260 (51%), Gaps = 39/260 (15%)
 Frame = +1

Query  586   LSSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLM  765
             ++S EKA  R  VL R +   N          ++  +   P E            M+  +
Sbjct  1     MTSTEKATERLQVLARQVTAGN----------ATTRLAVCPKE------------MKDFL  38

Query  766   DGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVF  945
                N E R+ +Y  + +  L+ P           +  Q + + RE T++R+       V 
Sbjct  39    VHDNKELREAIYEFL-KDDLYRP-----------NHYQGLMEFREQTLQRLKKF----VA  82

Query  946   RGWLTEKGPEAELRK-LALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRD  1122
             + + + +    E R+ +A L+     D+SL+IK GVHF L GG I   GT  HH+K+L  
Sbjct  83    QKFFSVRDYTNEPRRFMAALESLMYADYSLAIKAGVHFTLCGGTIAKLGTAYHHNKYLPG  142

Query  1123  SENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATH  1302
              ++  + GCF MTELGHGSNV GIET   YD ++G+F+INTP + A KY IGG+  H   
Sbjct  143   MDDLTLPGCFGMTELGHGSNVMGIETTAVYDKASGQFIINTPNDEASKYWIGGSGQHGKI  202

Query  1303  TVVFSQLNIDGKNQGVHAFI  1362
               VF+QL ++G+ QG H F+
Sbjct  203   CAVFAQLTVNGQWQGPHVFV  222



>emb|CEL63350.1| hypothetical protein RSOLAG1IB_05394 [Rhizoctonia solani AG-1 
IB]
Length=638

 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 122/215 (57%), Gaps = 16/215 (7%)
 Frame = +1

Query  718   SEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQR  897
             + P ASF V E++++ D  N ++RD  Y  +    LF PR            N S+  +R
Sbjct  5     APPPASFKVEELKRVFDHDNFDKRD-AYRALADEPLFVPR-----------HNVSLSYER  52

Query  898   EITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAI  1077
             E+ + R+  +S+  +   +  EK P   L  +A  +++ + D S + K+ V + L+GG +
Sbjct  53    ELALDRLKRVSETKMISVFDFEKNP---LNVMAAHELSGMLDPSFTTKMTVQYNLFGGTV  109

Query  1078  QFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCES  1257
                GT RH  K+L   ++  V GCFA+TELG+G+N   +ET   +D  T EF+INTP   
Sbjct  110   LKLGTSRHR-KYLHGVDDMSVIGCFALTELGYGNNAVEMETTAIWDPKTKEFIINTPSVI  168

Query  1258  AQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             AQKY I  +A HA + VVF+QL  +G N+G+HAF+
Sbjct  169   AQKYWITNSAVHANYAVVFAQLIFEGTNEGIHAFL  203



>ref|WP_007237397.1| acyl-CoA oxidase [Gordonia otitidis]
 dbj|GAB33138.1| putative acyl-CoA oxidase [Gordonia otitidis NBRC 100426]
Length=681

 Score =   139 bits (350),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 121/214 (57%), Gaps = 19/214 (9%)
 Frame = +1

Query  742   VAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIA  921
             V  +R ++DG     RD            + R+R  +  + PD ++++EQ R   +  + 
Sbjct  44    VDNLRYVLDGRWRATRD------------DVRTRSNRADLLPDPSRTLEQARTRILDEMR  91

Query  922   YLSDCG-VFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTK  1095
              LS  G    G+  + G   ++   +  +++    D SL +K GV + LWGGA++  GT 
Sbjct  92    ELSAQGFASAGFGADHGGTGDIGASITAIEMLGYADLSLMVKAGVQWGLWGGAVENLGTA  151

Query  1096  RHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSI  1275
             RHH+K++ D+ N  + GCFAMTE GHGSNV+ +ET  TYD++T EFVI++P  SA+K  I
Sbjct  152   RHHEKYVADTINLDLLGCFAMTETGHGSNVQALETTATYDAATKEFVIHSPTPSARKDYI  211

Query  1276  GGAANHATHTVVFSQLNIDGKNQ-----GVHAFI  1362
             GGAA HA +  VF+QL   G  Q     GVH F+
Sbjct  212   GGAAEHARYAAVFAQLITAGPGQEPESYGVHCFV  245



>ref|XP_004339964.1| acylCoA dehydrogenase, middle domain containing protein [Acanthamoeba 
castellanii str. Neff]
 gb|ELR17948.1| acylCoA dehydrogenase, middle domain containing protein [Acanthamoeba 
castellanii str. Neff]
Length=742

 Score =   139 bits (351),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 107/174 (61%), Gaps = 15/174 (9%)
 Frame = +1

Query  868   DFNQSMEQQREITMRRIAYLSDCGVFRGWLTEK------GPEAELRKLAL---LDVTTIF  1020
             +F  S E QRE  ++++ +++     +GW +        GP A          L+    +
Sbjct  110   NFELSKEDQRERVLQQVRWIAA----KGWASLDMLKYVFGPSAREDPTMYCNSLEPFIGY  165

Query  1021  DHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIET  1200
             D S++IK GVHF L+GG++   GT+RH  KW   + N    GCFAMTELGHGSNV+GI T
Sbjct  166   DGSIAIKAGVHFLLFGGSVVNLGTERHQ-KWYDATNNLAEGGCFAMTELGHGSNVQGIGT  224

Query  1201  VTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
                YD +TGEFVINTP +  +K+ IG AA HA + VVF+QLN+DG+  GVHAF+
Sbjct  225   TAVYDKATGEFVINTPTDVDRKWWIGHAA-HAKNAVVFAQLNVDGQEHGVHAFV  277



>gb|EMS62187.1| Acyl-coenzyme A oxidase 3, peroxisomal [Triticum urartu]
Length=221

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  1156  MTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDG  1335
             MTELGHGSNVRGIETV TYDS TGEFVINTPCESAQKY IGGAANHATHT+VF+QL+I+G
Sbjct  1     MTELGHGSNVRGIETVATYDSKTGEFVINTPCESAQKYWIGGAANHATHTIVFAQLHING  60

Query  1336  KNQGVHAFIA  1365
             +N+GVHAFIA
Sbjct  61    RNEGVHAFIA  70



>ref|XP_003294150.1| hypothetical protein DICPUDRAFT_58874 [Dictyostelium purpureum]
 gb|EGC29318.1| hypothetical protein DICPUDRAFT_58874 [Dictyostelium purpureum]
Length=638

 Score =   138 bits (347),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 133/237 (56%), Gaps = 14/237 (6%)
 Frame = +1

Query  658   VDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPR  837
             + +  +LQ++  +    P+  E   SF+   + + +  +  E R  L  +          
Sbjct  11    ISNSFILQTNN-VSNIDPQFIEAQNSFNPQALYRFLFPYEPELRSRLAEVW---------  60

Query  838   SRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTI  1017
              +  K+ +   F  S+E +RE +  +   L +  V R   +    E   RKLA+   +  
Sbjct  61    -KTDKLLLKDSFGLSLEGEREQSFIQFKRLME--VLRQNFSLYDLERNPRKLAVFTQSYR  117

Query  1018  F-DHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGI  1194
             F + S++  +GVHF L+G +I F G+    +K+++  E   V GCF++TELGHGSNV+ I
Sbjct  118   FVNISVTTLIGVHFSLFGASILFLGSNEQREKYIKKIETLEVVGCFSLTELGHGSNVQQI  177

Query  1195  ETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             ET+  YD +T EF+IN+P  ++QKY IGGAA +A+HT++ +QL + GK +GVHAF+A
Sbjct  178   ETIAEYDHNTQEFIINSPTITSQKYFIGGAAKNASHTIIMAQLKVAGKMEGVHAFVA  234



>ref|WP_044187894.1| acyl-CoA oxidase [Hyalangium minutum]
 gb|KFE69122.1| Acyl-coenzyme A oxidase 1, peroxisomal [Hyalangium minutum]
Length=781

 Score =   139 bits (350),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 89/235 (38%), Positives = 122/235 (52%), Gaps = 38/235 (16%)
 Frame = +1

Query  703   TPPELSEPA---ASFDVAEMRKLMDGH----NLEERDWLYGLMIQSRLFNPRSRGG---K  852
             TPP LS  A   ASFDV ++R +++          R WL       R  + R       +
Sbjct  150   TPPPLSRAAPAPASFDVDKLRPILERTYPDVRARVRQWLAHPAF--RYVDERDTSAYREQ  207

Query  853   VYVWPDFNQSMEQQREITMRRIAYLSDC-----GVFRGWLTEKGPEAELRKLALLDVTTI  1017
             V+ W      ++Q  +  + +IAY  D      G F               +A  +    
Sbjct  208   VFSW------LKQLADRGLGKIAYPDDLSKVDLGAF---------------IAAFETLAS  246

Query  1018  FDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIE  1197
             FD SL +K+GV+F L+GG+I F GT+RHH + L    +  + GCFAM+EL HGSNVR +E
Sbjct  247   FDLSLVVKVGVNFGLFGGSIYFLGTERHHRQVLPKVASLELPGCFAMSELAHGSNVRDVE  306

Query  1198  TVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             TV  YD  TGEFV++TP E A+K  IG AA HA    VF+QL + G+  GVHA +
Sbjct  307   TVAIYDDITGEFVVHTPSEGARKEWIGNAAQHARLATVFAQLEVKGERHGVHALL  361



>ref|XP_002672633.1| peroxisomal acyl-CoA oxidase [Naegleria gruberi]
 gb|EFC39889.1| peroxisomal acyl-CoA oxidase [Naegleria gruberi]
Length=601

 Score =   137 bits (346),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 103/164 (63%), Gaps = 4/164 (2%)
 Frame = +1

Query  871   FNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGV  1050
              N + E+ RE+ ++++ +L   G F     +K PE  L+++       I D S+++KLGV
Sbjct  15    INITKEEAREVALKQVIFLCQSGYFNVTDMKKNPELFLQRME----AGIIDASMNVKLGV  70

Query  1051  HFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGE  1230
                L+ G+I   GTK+HHD +L+ +E   + G FAMTE+ HGSNVR ++T   +D  T E
Sbjct  71    QLLLFAGSIMNLGTKKHHDLYLKRAERCELPGAFAMTEIEHGSNVRELKTTAIFDEQTNE  130

Query  1231  FVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             FV+NTP + A K+ +G AA HAT   VF++L + GK+ GVHAF+
Sbjct  131   FVLNTPNKGAIKWWLGNAACHATMATVFARLILKGKDYGVHAFL  174



>gb|EUC54225.1| acyl-coenzyme A oxidase 3, peroxisomal protein, partial [Rhizoctonia 
solani AG-3 Rhs1AP]
Length=610

 Score =   137 bits (345),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 122/221 (55%), Gaps = 21/221 (10%)
 Frame = +1

Query  700   YTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQ  879
             YTPP      A+F+V E++++ D  N ++RD    L  +  LF PR            N 
Sbjct  4     YTPPP-----ATFNVNELKRVFDHDNFDKRDAFRALADEP-LFVPR-----------HNV  46

Query  880   SMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFF  1059
             S+  +RE+ + R+  +S+  +   +  EK P   L  +A  +   + D S + K+ V + 
Sbjct  47    SLSYERELALDRLKRVSETKMISVFDFEKNP---LNVMAAHEFAGMLDPSFTTKMTVQYN  103

Query  1060  LWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVI  1239
             L+GG +   GT RH  K+L   ++  V GCFA+TELG+G+N   +ET   +D  T EF+I
Sbjct  104   LFGGTVLKLGTSRHR-KYLHGVDDMSVIGCFALTELGYGNNAVEMETTAIWDPKTKEFII  162

Query  1240  NTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             NTP   AQKY I  +A HA + VVF+QL   G N+G+HAF+
Sbjct  163   NTPSVIAQKYWITNSAVHANYAVVFAQLIFQGTNEGIHAFL  203



>ref|XP_007537568.1| PREDICTED: acyl-coenzyme A oxidase-like protein, partial [Erinaceus 
europaeus]
Length=402

 Score =   135 bits (339),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 120/216 (56%), Gaps = 15/216 (7%)
 Frame = +1

Query  724   PAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREI  903
             P      + + + +DG     +D L  L+  S LF  R           ++ S+++ R +
Sbjct  5     PDLGLQDSALNRYLDGDFWSLKDELCRLLGGSPLFRQR-----------YDLSLDEMRAL  53

Query  904   TMRRIAYLSDCGVFRGWLTEKGPEAE---LRKLALLDVTTIFDHSLSIKLGVHFFLWGGA  1074
             T +R+ +     + +  + E+  + +    R L + +V +I D +  +K G+ ++L+GGA
Sbjct  54    TFQRVKFTMGLPLLKRAIQEQAEKKKNFVSRSLVIGEVISIADMATGVKCGIIYWLFGGA  113

Query  1075  IQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCE  1254
             ++  G+ RH  KWL+  +     G FAMTE GHGSNVRGI+T  T+D ST EFVI+TPCE
Sbjct  114   VRNLGSPRHVTKWLQPLQEQKYTGMFAMTERGHGSNVRGIQTEATFDLSTQEFVIDTPCE  173

Query  1255  SAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              A+K  IG A     +  VF+QL I+GK+QG H FI
Sbjct  174   DAEKMYIGNAM-QGNYAAVFAQLIINGKSQGPHCFI  208



>ref|WP_005169429.1| putative acyl-CoA oxidase [Gordonia aichiensis]
 dbj|GAC46989.1| putative acyl-CoA oxidase [Gordonia aichiensis NBRC 108223]
Length=685

 Score =   137 bits (346),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 129/241 (54%), Gaps = 19/241 (8%)
 Frame = +1

Query  661   DDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRS  840
             DD  + ++ P        LS+      V  +R ++DG     RD            + R 
Sbjct  13    DDAPVDETRPASADDAGALSDDERELLVDNLRYVLDGRWRATRD------------DVRR  60

Query  841   RGGKVYVWPDFNQSMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLDVTT  1014
             R  +  + PD ++++EQ R   +  +  LS+ G    G+  + G   ++   +  +++  
Sbjct  61    RANRADLLPDPSRTLEQARARVLDEMRELSEEGFAAAGFGADHGGTGDVGASITAIEMLG  120

Query  1015  IFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGI  1194
               D SL +K GV + LWGGA++  GT RHH+K++ D+ +  + GCFAMTE GHGSNV+ +
Sbjct  121   YADLSLMVKAGVQWGLWGGAVENLGTARHHEKYVADTISLDLLGCFAMTETGHGSNVQEL  180

Query  1195  ETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQ-----GVHAF  1359
             ET  TYD++T EFVI++P  SA+K  IGGAA HA    VF+QL   G  Q     GVH F
Sbjct  181   ETTATYDAATKEFVIHSPTPSARKDYIGGAAEHARMASVFAQLITAGPGQEPESYGVHCF  240

Query  1360  I  1362
             +
Sbjct  241   V  241



>ref|WP_043394213.1| acyl-CoA oxidase [Cystobacter violaceus]
 gb|KFA92834.1| acyl-CoA oxidase [Cystobacter violaceus Cb vi76]
Length=779

 Score =   138 bits (347),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 86/126 (68%), Gaps = 0/126 (0%)
 Frame = +1

Query  985   RKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTE  1164
             R +A  +  + FD SL +K GVHF L+GG+I F GT+ HH ++L    +  + GCFAM+E
Sbjct  234   RFIAAFETLSFFDLSLVVKAGVHFGLFGGSIYFLGTEHHHRQYLPHVASVELPGCFAMSE  293

Query  1165  LGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQ  1344
             LGHGSNVR +ET+  YD+  GEFV++TP ESA+K  IG AA HA    VF+QL + G+  
Sbjct  294   LGHGSNVRDVETLARYDAERGEFVVHTPSESARKEWIGNAAQHARLATVFAQLEVKGERH  353

Query  1345  GVHAFI  1362
             GVHA +
Sbjct  354   GVHALL  359



>ref|WP_002637005.1| acyl-CoA dehydrogenase [Myxococcus sp. (contaminant ex DSM 436)]
 gb|ERK90529.1| Acyl-coenzyme A oxidase 1, peroxisomal protein [Myxococcus sp. 
(contaminant ex DSM 436)]
Length=777

 Score =   137 bits (344),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 123/222 (55%), Gaps = 16/222 (7%)
 Frame = +1

Query  709   PELSEPAA--SFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQS  882
             P   EP A  SFD   +R+++D    E R       ++  L +P       + + D  + 
Sbjct  149   PSRVEPRAPTSFDPEALRQVLDRTYPETR-----AQVRKWLADP------AFRYTD-TRD  196

Query  883   MEQQREITMRRIAYLSDCGVFR-GWLTEKGPEAELRK-LALLDVTTIFDHSLSIKLGVHF  1056
               + R+  +  +  L+D G+ R  +  +    ++L   L   +    FD SL IK GVHF
Sbjct  197   TTKYRDQVLTWLKALADQGLGRIAFPKDNETRSDLGPFLTAFETMAYFDLSLVIKAGVHF  256

Query  1057  FLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFV  1236
              L+G +I F GT++HH K+L    +  + GCFAM+ELGHGSNVR +ETV  YD  TGEFV
Sbjct  257   GLFGASILFLGTEKHHQKYLPQVASLELPGCFAMSELGHGSNVRDVETVARYDVETGEFV  316

Query  1237  INTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             ++TP E+A+K  IG AA H     VF+QL + G++ GVHA +
Sbjct  317   VHTPTETARKEWIGNAARHGRIATVFAQLEVGGRSLGVHALL  358



>ref|XP_003288045.1| hypothetical protein DICPUDRAFT_78883 [Dictyostelium purpureum]
 gb|EGC35432.1| hypothetical protein DICPUDRAFT_78883 [Dictyostelium purpureum]
Length=663

 Score =   135 bits (341),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 121/219 (55%), Gaps = 14/219 (6%)
 Frame = +1

Query  709   PELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSME  888
             P L+E     ++  ++ ++DG    +RD L  L  +S  F+       ++      Q+++
Sbjct  28    PHLNETP---NLKTLKSILDGEYHFDRDRLKELFEESSTFDEIFLNKSIHTDEHREQTLK  84

Query  889   QQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWG  1068
               +EI   +I  LSD         EK P+   + L   +  ++ D S+S+K  V + LWG
Sbjct  85    ACKEIIQLQIVKLSDM--------EKNPK---KFLNWFETISLCDPSVSLKFAVQYNLWG  133

Query  1069  GAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTP  1248
             G I F GTK+HH+++L   EN  + G F +TELGHGSNV G+ET  TYD +  EF+IN+P
Sbjct  134   GTILFLGTKKHHERYLDGIENGSILGVFGLTELGHGSNVNGLETTATYDEANQEFIINSP  193

Query  1249  CESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
               ++QKY  G  + H     VF++L + G ++G+HAF+ 
Sbjct  194   TWNSQKYWPGNISRHGQMATVFARLILRGVDKGIHAFVV  232



>ref|WP_015352554.1| acyl-CoA dehydrogenase [Myxococcus stipitatus]
 gb|AGC48300.1| acyl-CoA dehydrogenase [Myxococcus stipitatus DSM 14675]
Length=780

 Score =   137 bits (344),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 104/172 (60%), Gaps = 4/172 (2%)
 Frame = +1

Query  856   YVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPE--AELRK-LALLDVTTIFDH  1026
             + +P   Q   +QRE     +  L+D G+ R    E G E  A+L   +A  +    FD 
Sbjct  191   FRYPTSPQDTGKQREQVFDWMKQLADQGLGRIAFPE-GNETGADLGAFIAAFETLAFFDL  249

Query  1027  SLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVT  1206
             SL +K+GVHF L+G ++ F GT+RHH ++L    +  + GCFAM+ELGHGSNVR ++TV 
Sbjct  250   SLVVKVGVHFGLFGASVLFLGTERHHREYLPKVASLELPGCFAMSELGHGSNVRDVKTVA  309

Query  1207  TYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              YD+  G FV++TP +SA+K  IG AA H     VF+QL + GK  GVHA +
Sbjct  310   RYDAEAGNFVVHTPSDSARKEWIGNAAKHGRIATVFAQLEVGGKALGVHALL  361



>ref|XP_643323.1| acyl-CoA oxidase [Dictyostelium discoideum AX4]
 gb|EAL69332.1| acyl-CoA oxidase [Dictyostelium discoideum AX4]
Length=628

 Score =   135 bits (340),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 90/127 (71%), Gaps = 1/127 (1%)
 Frame = +1

Query  985   RKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTE  1164
             R   ++++ +++++++  KLGVH+ L+GG I F GT RH +K++ D+      GCFAMTE
Sbjct  110   RYAGVVEMFSLYNNNVCTKLGVHYTLFGGTIMFLGTSRH-EKYIEDANTLKTMGCFAMTE  168

Query  1165  LGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQ  1344
             +GHGSNVRGIET   YD  T EF+I++P  +++K+ IGG+  HAT+T VF+ L IDG N 
Sbjct  169   IGHGSNVRGIETTAHYDKQTKEFIIHSPTPTSEKFWIGGSYLHATYTTVFANLIIDGTNY  228

Query  1345  GVHAFIA  1365
             GVHA + 
Sbjct  229   GVHALVV  235



>ref|XP_005843308.1| hypothetical protein CHLNCDRAFT_59273 [Chlorella variabilis]
 gb|EFN51206.1| hypothetical protein CHLNCDRAFT_59273 [Chlorella variabilis]
Length=642

 Score =   135 bits (339),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKL  1044
             P+++ SM   RE+T +R+A       F  +   + P   L+  A L+     D+SL+IK 
Sbjct  66    PNYHLSMAGFRELTSQRMAKFVGQRFFSVFDYTRDP---LKFQAALECLNFCDYSLAIKD  122

Query  1045  GVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSST  1224
             GVHF L GG I   GT++HH   LR  +   + GCFAMTELGHGSNV GIET   YD +T
Sbjct  123   GVHFTLCGGTIAKLGTEKHH-PILRKMDTLELPGCFAMTELGHGSNVMGIETTAQYDPAT  181

Query  1225  GEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              EFVINTP   A K+ IGG A  A  + VF+QL ++GK +G H F+
Sbjct  182   REFVINTPNNEASKFWIGGMAQTAKVSAVFAQLTVNGKWEGPHVFV  227



>ref|WP_015360696.1| acyl-CoA oxidase domain-containing protein [Nonlabens dokdonensis]
 gb|AGC75198.1| acyl-CoA oxidase domain-containing protein [Nonlabens dokdonensis 
DSW-6]
Length=768

 Score =   135 bits (341),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/236 (32%), Positives = 130/236 (55%), Gaps = 22/236 (9%)
 Frame = +1

Query  673   LLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLM------IQSRLFNP  834
             + +++P  GY    +++P   + V +++ L+  +N + +  +  ++      I+S   + 
Sbjct  133   VYETNPVQGYQTFTINKPKKGYSV-QLKTLLQHYNADLKTRVQNILDKHKEAIESYDDDL  191

Query  835   RSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTT  1014
              +R  KV+ W       ++  +  + ++AY S  G         G ++ ++  A+ +   
Sbjct  192   ITRKEKVFKW------TKELADAGLGKLAYPSAYG---------GSDSMVQYAAVFEELA  236

Query  1015  IFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGI  1194
              +D SL+IK GVHF L+GG+++  GT  HHDK+L+D     + GCFAMTE+ HGSNV+ +
Sbjct  237   KYDLSLTIKFGVHFGLFGGSVESLGTTYHHDKYLKDIGTMALPGCFAMTEMYHGSNVKAL  296

Query  1195  ETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             +T   Y   T  F+INTP +  +K  IG A  HA    VF+QL +DG+  G+HAF+
Sbjct  297   QTTAIYQPETNSFIINTPSQHDRKTYIGNAGLHAQMATVFAQLIVDGEEHGIHAFL  352



>ref|WP_030760334.1| MULTISPECIES: acyl-CoA oxidase [Streptomyces]
Length=660

 Score =   134 bits (338),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 122/229 (53%), Gaps = 19/229 (8%)
 Frame = +1

Query  682   SSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLY-GLMIQSRLFNPRSRGGKVY  858
             S+P  GY  P++  PA       + +++DG     RD +   L   S +           
Sbjct  7     SAPATGYVQPDVDVPA-------LTEVLDGGYAGIRDLVRTNLATHSSILEEADE-----  54

Query  859   VWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLS  1035
                D +   E+ RE+ +  +A     G+  G+  E G   ++   +A  +     D S+ 
Sbjct  55    --LDIDAFRERVREVVVA-MAATGQTGM--GFPFEYGGGGDIGASIAAFETLAFGDLSVL  109

Query  1036  IKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYD  1215
             +K GV F L+GGAI   GT+RHH  +L D     + GCFAMTE GHGSNV+ + TV  YD
Sbjct  110   VKTGVQFGLFGGAILHLGTERHHKAYLPDLITGKLMGCFAMTETGHGSNVQALGTVARYD  169

Query  1216  SSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             ++  EFVI TP +SA+K  IG AA HA   VVF+QL +DG++ GVHAF+
Sbjct  170   AAGREFVITTPDDSARKDYIGNAARHAELAVVFAQLEVDGRSHGVHAFV  218



>ref|XP_005846795.1| hypothetical protein CHLNCDRAFT_135324 [Chlorella variabilis]
 gb|EFN54693.1| hypothetical protein CHLNCDRAFT_135324 [Chlorella variabilis]
Length=479

 Score =   132 bits (333),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 116/205 (57%), Gaps = 15/205 (7%)
 Frame = +1

Query  748   EMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYL  927
             E+++L++  + EER  +  LM +S LF PR      Y  P     + ++RE+ ++R+  L
Sbjct  52    ELQRLLEHDSFEERRRMKELM-KSELFIPR------YAVP-----LAEERELALQRLRVL  99

Query  928   SDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHD  1107
                G FR    E      +R  A  +     D S++ K+ V F L+GG I   GT+RHHD
Sbjct  100   CHSGNFR---IEDFRVDPMRIFAAHECAAFADPSMATKMTVQFNLFGGTILKLGTQRHHD  156

Query  1108  KWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAA  1287
               LR   +    GCFA+TELG+G+N   +ET  T+D++T EF+I+TP   AQKY I  +A
Sbjct  157   LLLRGITSLDDIGCFALTELGYGNNAVEMETTATFDAATDEFIIHTPTPLAQKYWITNSA  216

Query  1288  NHATHTVVFSQLNIDGKNQGVHAFI  1362
              HA   VVF+QL I G N G+H F+
Sbjct  217   IHAHWAVVFAQLLIGGTNHGIHGFL  241



>ref|WP_020172265.1| acyl-CoA oxidase [Gordonia polyisoprenivorans]
Length=684

 Score =   134 bits (337),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 121/224 (54%), Gaps = 19/224 (8%)
 Frame = +1

Query  712   ELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQ  891
             EL +      V  +R+ +DG     RD +            R R  +  + PD ++++++
Sbjct  37    ELDQATRELLVDGLRRTLDGRWRATRDSV------------RERANRSDLLPDPSRTLDE  84

Query  892   QREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLSIKLGVHFFLW  1065
              R   +  +  LS  G    G+ ++ G   ++   +  +++    D SL +K GV + L+
Sbjct  85    ARARVLEEMRELSSQGFAAAGFASDHGGTGDVGASITAIEMLGYADLSLMVKAGVQWGLF  144

Query  1066  GGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINT  1245
             GGA++  GTKRHHDK++ D  +  + GCFAMTE GHGSNV+ +ET  TYD  T EFVI++
Sbjct  145   GGAVENLGTKRHHDKYVSDIISLDLLGCFAMTETGHGSNVQALETTATYDPQTQEFVIDS  204

Query  1246  PCESAQKYSIGGAANHATHTVVFSQLNIDGKNQ-----GVHAFI  1362
             P  SA+K  IGGAA HA    VF+QL   G  Q     GVH F+
Sbjct  205   PTPSARKDYIGGAAQHARVAAVFAQLITAGPGQEPESHGVHCFV  248



>gb|ELU16781.1| hypothetical protein CAPTEDRAFT_177414 [Capitella teleta]
Length=594

 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 107/204 (52%), Gaps = 15/204 (7%)
 Frame = +1

Query  751   MRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLS  930
             M +L+D  N E R      + +  +             P ++  +   R++  +R+  + 
Sbjct  1     MTQLLDNDNFEMRQKYRAFLSEGNM------------TPKYDIPLAVHRDLAQQRLKAIC  48

Query  931   DCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDK  1110
             D G        + P   LR  A  ++  + D  ++IK+ V F L+GG +   GTKRHHD+
Sbjct  49    DAGFISVLDFIENP---LRIFAAHELAAVLDPDMTIKMTVQFNLFGGTVLKLGTKRHHDE  105

Query  1111  WLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAAN  1290
              L   ++    GCFA+TELG G+N   +ET   YD  T EFVINTP E AQKY I   A 
Sbjct  106   LLAGIDSLDDVGCFALTELGFGNNAIEMETTAVYDKDTDEFVINTPTELAQKYWITNGAV  165

Query  1291  HATHTVVFSQLNIDGKNQGVHAFI  1362
             HA H VVF+QL++DG +QG+H  +
Sbjct  166   HAKHCVVFAQLSVDGTHQGIHGIL  189



>dbj|GAM18567.1| hypothetical protein SAMD00019534_017420 [Acytostelium subglobosum 
LB1]
Length=672

 Score =   134 bits (336),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 88/260 (34%), Positives = 140/260 (54%), Gaps = 26/260 (10%)
 Frame = +1

Query  613   RTHVLTRHLIQEN---PCVDDDILLQSSPCIGYTPPELSEPAAS-FDVAEMRKLMDGH--  774
             R   LT HL  ++   P   +D      P    TP E   P    F V +++  + GH  
Sbjct  3     RIRSLTGHLGVDDSSSPLSTNDTASLVQPLKTSTPLEWRIPVLDDFKVEKLKSTILGHPD  62

Query  775   --NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFR  948
               N+E R  L   M +  LF P+              ++ +QRE+T++R+  +S+  + +
Sbjct  63    EENIENRRLLLEAM-RDPLFRPQ-----------LYATVPEQRELTLKRLRKVSELRILK  110

Query  949   -GWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDS  1125
              G + +K      R ++  +   + D SLS+K  VH+ L+ G++ F GT++H  ++  D 
Sbjct  111   MGEIAQKFK----RFVSFQESLVLCDMSLSVKSSVHWGLFAGSVVFLGTEKHR-QYFDDI  165

Query  1126  ENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHT  1305
             +   + GCFA+TE+GHGSNV+GIET+  YD+ T EFVI+TP ++AQK  IG A  H T  
Sbjct  166   DICNILGCFALTEMGHGSNVKGIETLAEYDNRTREFVIHTPNDTAQKMWIGNAGVHGTMA  225

Query  1306  VVFSQLNIDGKNQGVHAFIA  1365
              VF+ L ++G+N G+H F+ 
Sbjct  226   TVFANLVVNGENHGLHPFLV  245



>ref|WP_030697375.1| acyl-CoA oxidase [Streptomyces griseus]
Length=653

 Score =   134 bits (336),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/232 (37%), Positives = 126/232 (54%), Gaps = 25/232 (11%)
 Frame = +1

Query  682   SSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVY-  858
             S+   GYT PE+  PA       +  L+DG   E R+     +++S L        K Y 
Sbjct  7     STEASGYTQPEIDVPA-------LAALLDGEYAEIRE-----LVRSNL--------KTYA  46

Query  859   -VWPDFNQ-SMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLDVTTIFDH  1026
              +  + ++ S++  RE     +  ++  G    G+  E G   ++   +A  +     D 
Sbjct  47    SILDEADELSLDAYRERVRELVVEMAATGQTGMGFPREYGGGGDVGASIAAFETLAFGDL  106

Query  1027  SLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVT  1206
             S+ +K+GV F L+GGAI   GT+RHHD +L D     + GCFAMTE GHGSNV+ + TV 
Sbjct  107   SVLVKVGVQFGLFGGAILQLGTERHHDAYLPDLITGKLMGCFAMTETGHGSNVQKLGTVA  166

Query  1207  TYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              YD+ + EFV+ TP E A+K  IG AA H    VVF+QL +DG ++GVHAF+
Sbjct  167   RYDAQSQEFVLTTPDEQARKDYIGNAARHGEVAVVFAQLEVDGASEGVHAFV  218



>ref|WP_016696079.1| hypothetical protein, partial [Rhodococcus rhodochrous]
Length=304

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAELR-KLALLDVTTIFDHSLSI  1038
             P +    ++ R IT+ ++  L++ G    G+  E G   +    +A +++  + D SL +
Sbjct  34    PHYTPETDKARAITLEQMRILAEHGYAAAGFSVESGGTGDAGGAVASIEMLAMSDLSLMV  93

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K GV + L+GGA++  GT+RHH+K+++   +  V GCFAMTE GHGS+V+ +ET  TYD 
Sbjct  94    KAGVQWGLFGGAVENLGTERHHEKYVKRLIDLDVLGCFAMTETGHGSDVQSLETTATYDP  153

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              T EFVI++P  S++K  IGGAA HA    VF+QL   G+  GVH F+
Sbjct  154   DTQEFVIHSPTPSSRKDYIGGAAQHARFASVFAQLVTQGETHGVHCFV  201



>ref|WP_006437568.1| putative acyl-CoA oxidase [Gordonia amicalis]
 dbj|GAC54509.1| putative acyl-CoA oxidase [Gordonia amicalis NBRC 100051 = JCM 
11271]
Length=683

 Score =   133 bits (335),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 86/248 (35%), Positives = 130/248 (52%), Gaps = 23/248 (9%)
 Frame = +1

Query  640   IQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQS  819
             I + P VDD +    +P       ELS    +  V  +R ++DG     R+ +       
Sbjct  16    IAKEPTVDDPV----APAEVSADDELSADERALLVDNLRFVLDGRWRATRETV-------  64

Query  820   RLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKL  993
                  R    +  + PD ++++ + R  T+  +  L+  G    G+ ++ G   ++   +
Sbjct  65    -----RENSNRADLLPDSSRTLGESRAHTLEVMRELASQGFAAAGFASDHGGTGDIGASI  119

Query  994   ALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGH  1173
               +++    D SL +K GV + L+GGA++  GTKRHHDK++    N  V GCFAMTE GH
Sbjct  120   TAIEMLGYADLSLMVKAGVQWGLFGGAVENLGTKRHHDKYVPGIINMDVLGCFAMTETGH  179

Query  1174  GSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQ---  1344
             GSNV+ IET  TYD  T EFVI++P  S++K  IGGAA HA    VF+QL   G ++   
Sbjct  180   GSNVQAIETTATYDRDTREFVIHSPTPSSRKDYIGGAAEHARFAAVFAQLITGGPDEEPE  239

Query  1345  --GVHAFI  1362
               GVH F+
Sbjct  240   GRGVHCFV  247



>ref|WP_013993723.1| acyl-CoA oxidase [Zobellia galactanivorans]
 ref|YP_004736804.1| acyl-coenzyme A oxidase [Zobellia galactanivorans]
 emb|CAZ96523.1| Acyl-coenzyme A oxidase [Zobellia galactanivorans]
Length=754

 Score =   134 bits (337),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 112/177 (63%), Gaps = 12/177 (7%)
 Frame = +1

Query  853   VYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEA-----ELRKLALLDVTTI  1017
             ++ W + +++ E+ RE  ++++ +L+D    +G+     PEA     ++   A +    +
Sbjct  169   IFKW-EVHRNKEKFRETVLKQVKFLAD----KGYGAMAYPEAYGGTDDMEGYAYMFENMM  223

Query  1018  F-DHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGI  1194
             F D SLSIK GV F L+GG+IQ  GTK+HHD++L  +    + GCFAMTE GHGSNVRGI
Sbjct  224   FADGSLSIKFGVQFGLFGGSIQKLGTKKHHDQYLTKTGKTELLGCFAMTETGHGSNVRGI  283

Query  1195  ETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             +T  TY+ +T E VI+TP ++  K  IG A  H+    VF+QL ++GKN+GVHA + 
Sbjct  284   KTTATYNKATDEIVIHTPGKNDNKEYIGNAL-HSKMATVFAQLIVNGKNEGVHAILV  339



>ref|XP_002123442.2| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Ciona intestinalis]
Length=663

 Score =   133 bits (335),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/210 (35%), Positives = 113/210 (54%), Gaps = 15/210 (7%)
 Frame = +1

Query  733   SFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMR  912
             +FD ++M KL+D  N E R      M    +  PR           ++  + ++RE+ ++
Sbjct  62    TFDPSKMTKLLDHDNHEMRKKFREFM-SDPVMTPR-----------YDIPLAEEREVALQ  109

Query  913   RIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGT  1092
             R+  + D            P   LR  A  +++ I D +++ K+ V F L+GG++   GT
Sbjct  110   RLQRICDAKFISVTDFWTNP---LRIFAAHEISAIIDPAMATKMTVQFNLFGGSVVKLGT  166

Query  1093  KRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYS  1272
             KRHHD+ ++  +     GCF +TELG+G+N   +ET   YD  + EF+INTP   AQKY 
Sbjct  167   KRHHDQLIKGIDTLDDVGCFGLTELGYGNNAVEMETTAVYDKESKEFIINTPTTLAQKYW  226

Query  1273  IGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             I   A HA H +VF+QL IDG N+G+H  +
Sbjct  227   ITNGAVHAKHIIVFAQLLIDGDNKGIHGIL  256



>ref|WP_028638761.1| acyl-CoA oxidase [Nocardioides sp. URHA0032]
Length=653

 Score =   133 bits (334),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 86/239 (36%), Positives = 122/239 (51%), Gaps = 39/239 (16%)
 Frame = +1

Query  682   SSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYV  861
             + P  GY  PE+  PA       +  L+DG   E RD     ++++ L            
Sbjct  7     APPTTGYVQPEVDVPA-------LTALLDGRYAEVRD-----LVRANLAT----------  44

Query  862   WPDFNQSMEQQREITM-----------RRIAYLSDCGVFRGWLTEKGPEAEL-RKLALLD  1005
                +   +EQ  E+++             +A     G+  G+  E G   ++   +A  +
Sbjct  45    ---YADILEQAEELSVDDFRERVREVVVEMAATGQTGM--GFPEEYGGGGDIGASIAAFE  99

Query  1006  VTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNV  1185
                  D S+ +K+GV F L+GGAI   G+K HHD +L D  +  V GCFAMTE GHGSNV
Sbjct  100   TLAYGDLSVLVKVGVQFGLFGGAILQLGSKHHHDAYLADLVSGKVMGCFAMTETGHGSNV  159

Query  1186  RGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             + + TV TYD+   EFVI T  ESA+K  IG AA HA   VVF+QL + G ++GVHAF+
Sbjct  160   QALGTVATYDADAQEFVITTTTESARKDYIGNAAKHAELAVVFAQLEVGGTSEGVHAFV  218



>gb|EME62368.1| acyl-CoA oxidase [Rhodococcus ruber BKS 20-38]
Length=634

 Score =   133 bits (334),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLAL--LDVTTIFDHSLSI  1038
             P +   +++ R IT++++  L++ G  R    +          A+  +++  + D SL +
Sbjct  25    PHYTPDLDEARAITLKQMRMLAESGYARAGFAKAVGGGGDAGGAVASIEMLAMSDLSLMV  84

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K GV + L+GGAI+  GT RHHD+++    +  + GCFAMTE GHGS+V+ +ET  +YD 
Sbjct  85    KAGVQWGLFGGAIENLGTARHHDRYINPLIDLDLLGCFAMTETGHGSDVQSLETTASYDP  144

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              T EFVI++P  S++K  IGGAA HAT   VF+QL   GK+QGVH F+
Sbjct  145   GTEEFVIHSPTPSSRKDYIGGAAQHATVAAVFAQLITGGKSQGVHCFV  192



>ref|WP_040783005.1| acyl-CoA oxidase [Rhodococcus ruber]
Length=643

 Score =   133 bits (334),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLAL--LDVTTIFDHSLSI  1038
             P +   +++ R IT++++  L++ G  R    +          A+  +++  + D SL +
Sbjct  34    PHYTPDLDEARAITLKQMRMLAESGYARAGFAKAVGGGGDAGGAVASIEMLAMSDLSLMV  93

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K GV + L+GGAI+  GT RHHD+++    +  + GCFAMTE GHGS+V+ +ET  +YD 
Sbjct  94    KAGVQWGLFGGAIENLGTARHHDRYINPLIDLDLLGCFAMTETGHGSDVQSLETTASYDP  153

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              T EFVI++P  S++K  IGGAA HAT   VF+QL   GK+QGVH F+
Sbjct  154   GTEEFVIHSPTPSSRKDYIGGAAQHATVAAVFAQLITGGKSQGVHCFV  201



>ref|WP_028643473.1| acyl-CoA oxidase [Nocardioides sp. URHA0020]
Length=658

 Score =   133 bits (334),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 126/228 (55%), Gaps = 19/228 (8%)
 Frame = +1

Query  682   SSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYV  861
             S+P  GY  PE+  PA       +  L+DG   E R      ++++ L    S       
Sbjct  10    SAP--GYAEPEVDVPA-------LTALLDGRYAEVRQ-----LVRTNLATYASVLDDAED  55

Query  862   WPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLSI  1038
               D +   E+ R++ +  +A     G+  G+  E G   ++   +A  +     D S+ +
Sbjct  56    L-DVDAFRERVRDVVVE-MAATGQTGM--GFPEEYGGGGDIGASIAAFETLAFGDLSVLV  111

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K+GV F L+GGAI   GTKRHHD +L+D     + GCFAMTE GHGSNV+ + TV TYD 
Sbjct  112   KVGVQFGLFGGAILQLGTKRHHDAYLQDLVTGRLMGCFAMTETGHGSNVQALGTVATYDV  171

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             +T EFVI T  ++A+K  IG AA HA   VVF+QL + G+++GVHAF+
Sbjct  172   ATREFVITTHGDAARKDYIGNAAKHAEVAVVFAQLEVGGRSEGVHAFV  219



>gb|KFH61896.1| hypothetical protein MVEG_12230 [Mortierella verticillata NRRL 
6337]
Length=702

 Score =   133 bits (335),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 95/262 (36%), Positives = 134/262 (51%), Gaps = 23/262 (9%)
 Frame = +1

Query  589   SSMEKANFRTHVLTRHLIQENPCVDDDILLQSSPCIGYTPPELSE--PAASFDVAEMRK-  759
             S+   A+ R   +  HL  + PC     +    P     P +L+     ASF+V +M + 
Sbjct  3     SASHTASARLTAVQNHLTIQ-PCFQRHAIHNDQPT---GPADLARERANASFNVEDMTEV  58

Query  760   -LMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDC  936
              L    N+E     Y L+   R  + R R G  Y     + +  + RE TMR+IA   + 
Sbjct  59    ILRGKENVEALKLAYQLI--QRDPDLRMREGHHY-----DLTRAEDREQTMRQIARTIEL  111

Query  937   GVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWL  1116
                    T K P  +    AL      +  S S+++ VH  L+  A+  FGT    DKW+
Sbjct  112   KK-----TIKDPRLQQ---ALFMAMAFYSESYSMRMYVHDMLFKQALLLFGTAEQQDKWM  163

Query  1117  RDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHA  1296
              D EN+ V GCFAMTELGH SN+RG+ET +TYD +T EFVI++P  +A K+ IG +   A
Sbjct  164   DDIENWRVIGCFAMTELGHSSNLRGLETTSTYDRATNEFVIHSPTLTATKWWIGMSGETA  223

Query  1297  THTVVFSQLNIDGKNQGVHAFI  1362
             THTV   Q  IDG+N G++ FI
Sbjct  224   THTVAICQTVIDGENHGINWFI  245



>ref|XP_002128280.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Ciona intestinalis]
Length=654

 Score =   132 bits (333),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/209 (34%), Positives = 109/209 (52%), Gaps = 15/209 (7%)
 Frame = +1

Query  736   FDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRR  915
             FD+ E+  L+D  N E RD              R       + P +N  + ++R++ ++R
Sbjct  60    FDINELATLLDHDNHEMRDEF------------RKFVSDPIMTPKYNIPLAEERDVALKR  107

Query  916   IAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTK  1095
             +  + D G       +  P   LR  A  ++  I D ++S K+ V F L+GG +   GT+
Sbjct  108   LKRICDGGFISVLDFQHNP---LRIFAAHELAAIIDPAMSTKMTVQFNLFGGTVLKLGTE  164

Query  1096  RHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSI  1275
             RHH+K L+  +     GCF +TELG+G+N   +ET   YD  + EF+INTP   AQKY I
Sbjct  165   RHHEKLLKGIDTLDDVGCFGLTELGYGNNAVEMETTAVYDKESKEFIINTPTTLAQKYWI  224

Query  1276  GGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
                A HA H +VF+QL +  +  G+H F+
Sbjct  225   TNGAVHAKHIIVFAQLKVGDEEHGIHGFM  253



>ref|WP_033400952.1| acyl-CoA oxidase, partial [Actinokineospora enzanensis]
Length=634

 Score =   132 bits (333),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 101/164 (62%), Gaps = 2/164 (1%)
 Frame = +1

Query  880   SMEQQREITMRRIAYLSDCGVFR-GWLTEKGPEAEL-RKLALLDVTTIFDHSLSIKLGVH  1053
             + EQ R   +  +  L+  G  R G+ T  G E +    L   ++    D SL +K GV 
Sbjct  41    TTEQHRAQVLDELRALAKAGYPRHGFPTRYGGEGDTGATLTSFEMLGFGDLSLMVKAGVQ  100

Query  1054  FFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEF  1233
             + L+GGA++  GT+RHH+++LRD  +  + GCFAMTE GHGS+V+ + T  T+D  TGEF
Sbjct  101   WGLFGGAVEALGTERHHERYLRDIISLDLPGCFAMTETGHGSDVQHLRTTATHDPDTGEF  160

Query  1234  VINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             VINTP E+A+K  IG AA      VVF+QL +DG+ +GVHA  A
Sbjct  161   VINTPHEAARKDYIGNAARDGRAAVVFAQLIVDGRERGVHALFA  204



>ref|WP_014359023.1| acyl-CoA oxidase [Gordonia polyisoprenivorans]
 gb|AFA72118.1| acyl-CoA oxidase [Gordonia polyisoprenivorans VH2]
Length=684

 Score =   133 bits (334),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/224 (36%), Positives = 120/224 (54%), Gaps = 19/224 (8%)
 Frame = +1

Query  712   ELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQ  891
             EL +      V  +R+ +DG     RD +            R R  +  + PD + ++++
Sbjct  37    ELDQATRELLVDGLRRTLDGRWRATRDGV------------RERANRSDLLPDPSHTLDE  84

Query  892   QREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLSIKLGVHFFLW  1065
              R   +  +  LS  G    G+ ++ G   ++   +  +++    D SL +K GV + L+
Sbjct  85    ARARVLEEMRELSSQGFAAAGFASDHGGTGDVGASITAIEMLGYADLSLMVKAGVQWGLF  144

Query  1066  GGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINT  1245
             GGA++  GTKRHHD+++ D  +  + GCFAMTE GHGSNV+ +ET  TYD  T EFVI++
Sbjct  145   GGAVENLGTKRHHDRYVSDIISLDLLGCFAMTETGHGSNVQALETTATYDPQTQEFVIDS  204

Query  1246  PCESAQKYSIGGAANHATHTVVFSQLNIDGKNQ-----GVHAFI  1362
             P  SA+K  IGGAA HA    VF+QL   G  Q     GVH F+
Sbjct  205   PTPSARKDYIGGAAQHARVAAVFAQLITAGPGQEPESHGVHCFV  248



>ref|XP_004360487.1| acyl-CoA oxidase [Dictyostelium fasciculatum]
 gb|EGG22636.1| acyl-CoA oxidase [Dictyostelium fasciculatum]
Length=862

 Score =   134 bits (336),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 91/279 (33%), Positives = 142/279 (51%), Gaps = 48/279 (17%)
 Frame = +1

Query  595   MEKANFRTHVLTRHLIQENPCVDDDI--------LLQSSPCIGYTPPELSEPAASFDVAE  750
             ME A  R +V   HL Q N C    +        L  S+   G TP +         + E
Sbjct  1     MENATRRLNVTNNHL-QSNNCSAAAVQEQEVKENLTNSNIVGGSTPSQ---------IFE  50

Query  751   MRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRI----  918
             +++  D  +L E  + Y   ++ RL + + +G ++   P F  S+++ R++T+ +     
Sbjct  51    IQRPFDADSLNEFLFPYHRDLRKRLLS-QWKGSELLSRPAFGLSLKEDRDLTLTQYHEMM  109

Query  919   ----------AYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWG  1068
                        YL+D      W        +  +L  +  +T+F        GVH  L+G
Sbjct  110   KLSQGNLSVWDYLTDPSKVAAW-------TQCYRLRNIAASTLF--------GVHISLFG  154

Query  1069  GAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTP  1248
              +I F GT    +++L+  E+  + GCFA+TELGHGSNV+ IET+ TYD  T EFV+++P
Sbjct  155   CSILFLGTDEQRERYLKHVEDGSMMGCFALTELGHGSNVQAIETLATYDDKTQEFVLHSP  214

Query  1249  CESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
               ++QKY IGGAA HA  +VVF+QL +  K +GVHAF+ 
Sbjct  215   TTTSQKYFIGGAATHARWSVVFAQLRVGEKYEGVHAFVV  253



>ref|WP_013937938.1| acyl-CoA dehydrogenase [Myxococcus fulvus]
 gb|AEI64784.1| putative acyl-CoA dehydrogenase [Myxococcus fulvus HW-1]
Length=777

 Score =   133 bits (335),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 83/227 (37%), Positives = 123/227 (54%), Gaps = 15/227 (7%)
 Frame = +1

Query  688   PCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWP  867
             P    T  E  EP  SFD   +R ++D    E R       ++  L +P       Y + 
Sbjct  145   PAASPTRFEQREPT-SFDPVALRAVLDRTYPETR-----AQVRQWLADP------AYRYT  192

Query  868   DFNQSMEQQREITMRRIAYLSDCGVFR-GWLTEKGPEAELRK-LALLDVTTIFDHSLSIK  1041
             D  +   + R+  +  +  L+D G+ R  +  +    ++L   +   +    FD SL +K
Sbjct  193   D-TRDTAKYRDQVLAWLKALADQGLGRIAFPQDNETGSDLGAFITAFETLAYFDLSLVVK  251

Query  1042  LGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSS  1221
              GVHF L+G +I F GT++HH ++L    +  + GCFAM+ELGHGSNVR +ETV  YD+ 
Sbjct  252   AGVHFGLFGASILFLGTQKHHQQYLPRVASLELPGCFAMSELGHGSNVRDVETVARYDAE  311

Query  1222  TGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             TGEFV++TP E+A+K  IG AA H     VF+QL + G+  GVHA +
Sbjct  312   TGEFVVHTPSETARKEWIGNAARHGRIATVFAQLEVGGQALGVHALL  358



>gb|AAH22268.1| ACOXL protein, partial [Homo sapiens]
Length=333

 Score =   129 bits (323),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 102/167 (61%), Gaps = 4/167 (2%)
 Frame = +1

Query  871   FNQSMEQQREITMRRIAYLSDCGVFRGW---LTEKGPEAELRKLALLDVTTIFDHSLSIK  1041
             ++ S+++ R +T++R+ +  D  + +     L EK      R L + +V ++ D +  +K
Sbjct  48    YDLSLDEMRALTVQRVKFAMDLPLLKRAGQDLAEKTKNFVSRSLVIGEVLSMADMATGVK  107

Query  1042  LGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSS  1221
              G+ ++L+GGAI+  G+  H  KW +  +     G FAMTE GHGSN RGI+T  T+D S
Sbjct  108   CGIIYWLFGGAIRNLGSPEHVTKWFQPLQEQKYTGMFAMTERGHGSNARGIQTEATFDLS  167

Query  1222  TGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
               EFVI+TPCE+A+K  IG A  +  +  VF+QL IDG++QG H FI
Sbjct  168   AQEFVIDTPCENAEKMYIGNAM-YGNYAAVFAQLIIDGRSQGPHCFI  213



>gb|ELU36718.1| putative acyl-coenzyme a oxidase 3.2, peroxisomal [Rhizoctonia 
solani AG-1 IA]
Length=435

 Score =   130 bits (327),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 78/219 (36%), Positives = 120/219 (55%), Gaps = 20/219 (9%)
 Frame = +1

Query  718   SEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQR  897
             + P A F V E++++ D  N ++RD    L  +  LF PR            N S+  +R
Sbjct  5     APPPAYFKVEELKRVFDHDNFDKRDAFRALADEP-LFVPRH-----------NVSLSYER  52

Query  898   EITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAI  1077
             E+ + R+  +S+  +   +  EK P   L  +A  ++  + D S + K+ V + L+GG +
Sbjct  53    ELALDRLKRVSETKMISVFDFEKNP---LNVMAAHELAGMLDPSFTTKMTVQYNLFGGTV  109

Query  1078  QFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCES  1257
                GT RH  K+L   ++  V GCFA+TELG+G+N   +ET   +D  T EF+INTP   
Sbjct  110   LKLGTSRHR-KYLHGVDDMSVIGCFALTELGYGNNAVEMETTAIWDPKTKEFIINTPSVI  168

Query  1258  AQKYSIGG----AANHATHTVVFSQLNIDGKNQGVHAFI  1362
             AQKY I      +A HA + VVF+QL  +G N+G+HAF+
Sbjct  169   AQKYWITNVGDWSAVHANYAVVFAQLIFEGTNEGIHAFL  207



>ref|WP_023420722.1| MULTISPECIES: Acyl-coenzyme A oxidase 1, peroxisomal [Streptomyces]
 gb|ESP96104.1| Acyl-coenzyme A oxidase 1, peroxisomal [Streptomyces sp. GBA 
94-10]
 gb|ESQ02024.1| Acyl-coenzyme A oxidase 1, peroxisomal [Streptomyces sp. PVA 
94-07]
Length=653

 Score =   132 bits (333),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 85/232 (37%), Positives = 125/232 (54%), Gaps = 25/232 (11%)
 Frame = +1

Query  682   SSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVY-  858
             S+   GY  PE+  PA       +  L+DG   E R+     +++S L        K Y 
Sbjct  7     STEASGYVQPEIDVPA-------LAALLDGEYAEIRE-----LVRSNL--------KTYA  46

Query  859   -VWPDFNQ-SMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLDVTTIFDH  1026
              +  + ++ S++  RE     +  ++  G    G+  E G   ++   +A  +     D 
Sbjct  47    SILDEADELSLDAYRERVRELVVEMAATGQTGMGFPREYGGGGDVGASIAAFETLAYGDL  106

Query  1027  SLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVT  1206
             S+ +K+GV F L+GGAI   GT+RHHD +L D     + GCFAMTE GHGSNV+ + TV 
Sbjct  107   SVLVKVGVQFGLFGGAILQLGTERHHDAYLPDLITGKLMGCFAMTETGHGSNVQALGTVA  166

Query  1207  TYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              YD+ + EFV+ TP E A+K  IG AA H    VVF+QL +DG ++GVHAF+
Sbjct  167   RYDAQSQEFVLTTPGEQARKDYIGNAARHGEVAVVFAQLEVDGTSEGVHAFV  218



>ref|WP_033948443.1| acyl-CoA oxidase [Streptomyces sp. CNQ431]
Length=653

 Score =   132 bits (333),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 85/232 (37%), Positives = 125/232 (54%), Gaps = 25/232 (11%)
 Frame = +1

Query  682   SSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVY-  858
             S+   GY  PE+  PA       +  L+DG   E R+     +++S L        K Y 
Sbjct  7     STEASGYVQPEIDVPA-------LAALLDGEYAEIRE-----LVRSNL--------KTYA  46

Query  859   -VWPDFNQ-SMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLDVTTIFDH  1026
              +  + ++ S++  RE     +  ++  G    G+  E G   ++   +A  +     D 
Sbjct  47    SILDEADELSLDAYRERVRELVVEMAATGQTGMGFPREYGGGGDVGASIAAFETLAYGDL  106

Query  1027  SLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVT  1206
             S+ +K+GV F L+GGAI   GT+RHHD +L D     + GCFAMTE GHGSNV+ + TV 
Sbjct  107   SVLVKVGVQFGLFGGAILQLGTERHHDAYLPDLITGKLMGCFAMTETGHGSNVQALGTVA  166

Query  1207  TYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              YD+ + EFV+ TP E A+K  IG AA H    VVF+QL +DG ++GVHAF+
Sbjct  167   RYDAQSQEFVLTTPGEQARKDYIGNAARHGEVAVVFAQLEVDGTSEGVHAFV  218



>gb|ABF87186.1| putative acyl-CoA dehydrogenase [Myxococcus xanthus DK 1622]
Length=660

 Score =   132 bits (332),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +1

Query  1018  FDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIE  1197
             FD SL IK GVHF L+G +I F GT++HH K+L    +  + GCFAM+ELGHGSNVR +E
Sbjct  127   FDLSLVIKAGVHFGLFGASILFLGTEKHHRKYLPQVASLELPGCFAMSELGHGSNVRDVE  186

Query  1198  TVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             TV  YD+  GEFV++TP E+A+K  IG AA H     VF+QL + G+  GVHA +
Sbjct  187   TVARYDAEAGEFVVHTPTETARKEWIGNAARHGRIATVFAQLEVGGRVLGVHALL  241



>ref|WP_014773637.1| acyl-CoA oxidase [Belliella baltica]
 gb|AFL85697.1| acyl-CoA dehydrogenase [Belliella baltica DSM 15883]
Length=763

 Score =   132 bits (333),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 123/215 (57%), Gaps = 20/215 (9%)
 Frame = +1

Query  733   SFDVAEMRKLMDGH--NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREIT  906
             +F + EM  L+DG+  NL ++       +++ + +P       + + + ++S+  QRE  
Sbjct  147   NFGIQEMTALLDGNQANLIKK-------VKTVISDPS------FAYKE-HESLIAQREQV  192

Query  907   MRRIAYLSDCGVFRGWLTEK---GPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAI  1077
             ++    L+D G F  W   K   G +       +++  +  D S+ IK GV F LWG ++
Sbjct  193   LQWCKNLADQG-FGAWAFPKSANGKDDMEGYFTIMETLSYHDLSMVIKFGVQFGLWGMSV  251

Query  1078  QFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCES  1257
              F GT +HH K+L+D  +  + GCFAMTE GHGSNVRG+ET  TYD ++  F I+TP   
Sbjct  252   FFLGTDKHHQKYLKDIGSLKLPGCFAMTETGHGSNVRGLETTATYDHNSKTFTIHTPNPE  311

Query  1258  AQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             A+K  IG AA H     VF++L IDG++ GV+AFI
Sbjct  312   ARKEYIGNAAMHGQMATVFAKLIIDGEDYGVNAFI  346



>ref|WP_020478009.1| acyl-CoA dehydrogenase [Myxococcus xanthus]
Length=777

 Score =   132 bits (333),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +1

Query  1018  FDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIE  1197
             FD SL IK GVHF L+G +I F GT++HH K+L    +  + GCFAM+ELGHGSNVR +E
Sbjct  244   FDLSLVIKAGVHFGLFGASILFLGTEKHHRKYLPQVASLELPGCFAMSELGHGSNVRDVE  303

Query  1198  TVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             TV  YD+  GEFV++TP E+A+K  IG AA H     VF+QL + G+  GVHA +
Sbjct  304   TVARYDAEAGEFVVHTPTETARKEWIGNAARHGRIATVFAQLEVGGRVLGVHALL  358



>ref|WP_019291205.1| MULTISPECIES: acyl-CoA oxidase [Rhodococcus]
 gb|KHJ72238.1| acyl-CoA oxidase [Rhodococcus sp. Chr-9]
Length=648

 Score =   132 bits (331),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAELR-KLALLDVTTIFDHSLSI  1038
             P +    ++ R IT+ ++  L++ G    G+  E G   +    +A +++  + D SL +
Sbjct  34    PHYTPETDKARAITLEQMRILAEHGYAAAGFSVESGGTGDAGGAVASIEMLAMSDLSLMV  93

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K GV + L+GGAI+  GT+RHH+K+++   +  V GCFAMTE GHGS+V+ +ET  TYD 
Sbjct  94    KAGVQWGLFGGAIENLGTERHHEKYVKQLIDLDVLGCFAMTETGHGSDVQSLETTATYDP  153

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              T EFVI++P  S++K  IGGAA HA    VF+QL   G+  GVH F+
Sbjct  154   DTQEFVIHSPTPSSRKDYIGGAAQHARFAAVFAQLVTQGETHGVHCFV  201



>ref|WP_006552333.1| acyl-CoA oxidase [Rhodococcus pyridinivorans]
 gb|EHK83492.1| acyl-CoA oxidase [Rhodococcus pyridinivorans AK37]
Length=648

 Score =   132 bits (331),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAELR-KLALLDVTTIFDHSLSI  1038
             P +    ++ R IT+ ++  L++ G    G+  E G   +    +A +++  + D SL +
Sbjct  34    PHYTPETDKARAITLEQMRILAEHGYAAAGFSVESGGTGDAGGAVASIEMLAMSDLSLMV  93

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K GV + L+GGAI+  GT+RHH+K+++   +  V GCFAMTE GHGS+V+ +ET  TYD 
Sbjct  94    KAGVQWGLFGGAIENLGTERHHEKYVKQLIDLDVLGCFAMTETGHGSDVQSLETTATYDP  153

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              T EFVI++P  S++K  IGGAA HA    VF+QL   G+  GVH F+
Sbjct  154   DTQEFVIHSPTPSSRKDYIGGAAQHARFAAVFAQLVTQGETHGVHCFV  201



>ref|WP_024101715.1| acyl-CoA oxidase [Rhodococcus pyridinivorans]
 gb|AHD20855.1| acyl-CoA oxidase [Rhodococcus pyridinivorans SB3094]
Length=648

 Score =   132 bits (331),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAELR-KLALLDVTTIFDHSLSI  1038
             P +    ++ R IT+ ++  L++ G    G+  E G   +    +A +++  + D SL +
Sbjct  34    PHYTPETDKARAITLEQMRILAEHGYAAAGFSVESGGTGDAGGAVASIEMLAMSDLSLMV  93

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K GV + L+GGAI+  GT+RHH+K+++   +  V GCFAMTE GHGS+V+ +ET  TYD 
Sbjct  94    KAGVQWGLFGGAIENLGTERHHEKYVKQLIDLDVLGCFAMTETGHGSDVQSLETTATYDP  153

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              T EFVI++P  S++K  IGGAA HA    VF+QL   G+  GVH F+
Sbjct  154   DTQEFVIHSPTPSSRKDYIGGAAQHARFAAVFAQLVTQGETHGVHCFV  201



>gb|AAR00586.1|U77053_1 acyl-CoA oxidase [Phalaenopsis hybrid cultivar]
Length=709

 Score =   132 bits (332),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 99/285 (35%), Positives = 144/285 (51%), Gaps = 44/285 (15%)
 Frame = +1

Query  574   ESSSLSS---MEKANFRTHVLTRHLIQENPCVD-----DDILLQSSPCIGYTPPELSEPA  729
             + +SL+S    ++A  R   L+ HL+Q +P +D     D   +  SPC G        P 
Sbjct  16    QMTSLASEHDTQRALRRIQKLSLHLLQPSPFLDPESSGDKNWIVPSPCTG----GRGRPL  71

Query  730   ASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYV-WPDFNQSME----QQ  894
              S   AE+ + M G + E         IQ R+FN        +V  P+    +E      
Sbjct  72    LSVSRAELVEYMTGRHRE---------IQERVFN-------FFVSRPELQTPVEISTADH  115

Query  895   REITMRRI-AYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGG  1071
             R + MR++ A + + G+       + P       A+++     D SL IKLGV + LWGG
Sbjct  116   RVLCMRQLTALVREAGIRPFRYAIEDPSV---YFAIVEAVGGIDISLGIKLGVQYSLWGG  172

Query  1072  AIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPC  1251
             ++   GTK+H +K+ +  +N    GCFAMTEL HGSNV+G++T  T+D  T EFVINTP 
Sbjct  173   SVMNLGTKKHKEKYFKGIDNIDYPGCFAMTELHHGSNVQGLQTTATFDPLTDEFVINTPN  232

Query  1252  ESAQKYSIGGAANHATHTVVFSQLNI--DGK-----NQGVHAFIA  1365
             + A K+ IG AA H     VF++L +   GK     + GVHAFI 
Sbjct  233   DGAIKWWIGNAAVHGKFATVFARLILPFQGKGGKSIDMGVHAFIV  277



>ref|WP_039751994.1| acyl-CoA oxidase [Hassallia byssoidea]
 gb|KIF31115.1| acyl-CoA oxidase [Hassallia byssoidea VB512170]
Length=769

 Score =   132 bits (333),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/212 (37%), Positives = 118/212 (56%), Gaps = 14/212 (7%)
 Frame = +1

Query  733   SFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMR  912
             +FDV  +  L+DG   E         +++ + +P+ +    YV P     +   RE  + 
Sbjct  153   TFDVKALTALLDGDQAETIR-----KVKTVVADPQFK----YVDPG---DLNAYREKVLS  200

Query  913   RIAYLSDCGV-FRGWLTEKGPEAELRK-LALLDVTTIFDHSLSIKLGVHFFLWGGAIQFF  1086
                +L+  G     +  E G +A+++K  A+++  +  D S+ IK GV F LWG ++ F 
Sbjct  201   WCRHLAAQGFGAMAYPKEYGGQADMQKYFAIMEALSYHDLSMVIKFGVQFGLWGMSVYFL  260

Query  1087  GTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQK  1266
             GT++HH K+L+D     + GCFAMTE  HGSNV+GIET  TY+     F I+TP E A+K
Sbjct  261   GTEKHHKKYLKDIGTLELPGCFAMTETNHGSNVKGIETTATYNHEAKTFTIHTPNEFARK  320

Query  1267  YSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
               IG AA H     VF++L +DGK+ GV AF+
Sbjct  321   EYIGNAARHGQAATVFAKLILDGKDYGVSAFV  352



>gb|AAB67883.1| acyl-CoA oxidase homolog [Phalaenopsis hybrid cultivar]
Length=699

 Score =   132 bits (332),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 99/285 (35%), Positives = 144/285 (51%), Gaps = 44/285 (15%)
 Frame = +1

Query  574   ESSSLSS---MEKANFRTHVLTRHLIQENPCVD-----DDILLQSSPCIGYTPPELSEPA  729
             + +SL+S    ++A  R   L+ HL+Q +P +D     D   +  SPC G        P 
Sbjct  6     QMTSLASEHDTQQALRRIQKLSLHLLQPSPFLDPESSGDKNWIVPSPCTG----GRGRPL  61

Query  730   ASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYV-WPDFNQSME----QQ  894
              S   AE+ + M G + E         IQ R+FN        +V  P+    +E      
Sbjct  62    LSVSRAELVEYMKGRHRE---------IQERVFN-------FFVSRPELQTPVEISTADH  105

Query  895   REITMRRI-AYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGG  1071
             R + MR++ A + + G+       + P       A+++     D SL IKLGV + LWGG
Sbjct  106   RVLCMRQLTALVREAGIRPFRYAIEDPSV---YFAIVEAVGGIDISLGIKLGVQYSLWGG  162

Query  1072  AIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPC  1251
             ++   GTK+H +K+ +  +N    GCFAMTEL HGSNV+G++T  T+D  T EFVINTP 
Sbjct  163   SVMNLGTKKHKEKYFKGIDNIDYPGCFAMTELHHGSNVQGLQTTATFDPLTDEFVINTPN  222

Query  1252  ESAQKYSIGGAANHATHTVVFSQLNI--DGK-----NQGVHAFIA  1365
             + A K+ IG AA H     VF++L +   GK     + GVHAFI 
Sbjct  223   DGAIKWWIGNAAVHGKFATVFARLILPFQGKGGKSIDMGVHAFIV  267



>ref|WP_045823938.1| acyl-CoA oxidase [Williamsia sp. ARP1]
Length=671

 Score =   132 bits (331),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 89/225 (40%), Positives = 126/225 (56%), Gaps = 13/225 (6%)
 Frame = +1

Query  709   PELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSME  888
             P+LSE  A  D  +   L+D  NL  R  L G   ++R +  R+   +V + PD   +M+
Sbjct  14    PDLSETGAD-DTVDRELLVD--NL--RYTLDGRWRETRQYARRNMD-RVDLLPDPTLTMQ  67

Query  889   QQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLSIKLGVHFFL  1062
             + R+ T   I  L        G+ TE G   ++   +  +++    D SL +K GV + L
Sbjct  68    ESRDRTFEHIRELGKLDFAAAGFRTEHGGTGDVGASITAIEMLGYADLSLMVKAGVQWGL  127

Query  1063  WGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVIN  1242
             +GGAI+  GT+RHHDK+++   +  + GCFAMTE GHGSNV+ +ETV TYD  T EFV++
Sbjct  128   FGGAIENLGTQRHHDKYVKPLIDLDLLGCFAMTEKGHGSNVQALETVATYDRETDEFVVH  187

Query  1243  TPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQ-----GVHAFI  1362
             +   SA K  IGGAA HAT   VF+QL   G  Q     GVH F+
Sbjct  188   STTPSATKDYIGGAAQHATLATVFAQLVTAGPGQEPEDHGVHCFV  232



>ref|WP_033235472.1| acyl-CoA oxidase [Rhodococcus rhodochrous]
Length=643

 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 105/168 (63%), Gaps = 2/168 (1%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAELR-KLALLDVTTIFDHSLSI  1038
             P F  ++   R  T+ ++  L+D G    G+    G   +    +  +++  + D SL +
Sbjct  34    PHFTPNLAIARSKTLEQMRVLADLGYAANGFAVAHGGTGDAGGAVTSIEMLAMSDLSLMV  93

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K GV + L+GGAI+  GT+RHH  +++   +  + GCFAMTE GHGS+V+ +ET  TYD+
Sbjct  94    KAGVQWGLFGGAIENLGTERHHQAYVKPLIDLELLGCFAMTETGHGSDVQELETTATYDA  153

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             +TGEFVI++P  S++K  IGGAA HAT   VF+QL   G++QGVH F+
Sbjct  154   ATGEFVIDSPTPSSRKDYIGGAAEHATVAAVFAQLITGGESQGVHCFV  201



>ref|WP_006935934.1| MULTISPECIES: Acyl-coenzyme A oxidase 3, peroxisomal [Rhodococcus]
 emb|CCW11442.1| Acyl-coenzyme A oxidase 3, peroxisomal [Rhodococcus sp. EsD8]
 gb|ETT23206.1| Acyl-CoA oxidase [Rhodococcus rhodochrous ATCC 21198]
 gb|KDE11924.1| acyl-CoA oxidase [Rhodococcus sp. BCP1]
Length=645

 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLAL--LDVTTIFDHSLSI  1038
             P +   ++  R IT++++  L++ G  R   ++          A+  +++  + D SL +
Sbjct  34    PHYTPDLDAARAITLKQMRMLAESGYARAGFSKAVGGGGDAGGAVASIEMLAMSDLSLMV  93

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K GV + L+GGAI+  GT RHH+++L    +  + GCFAMTE GHGS+V+ +ET  +YD 
Sbjct  94    KAGVQWGLFGGAIENLGTTRHHERYLGPLIDLDLLGCFAMTETGHGSDVQSLETTASYDP  153

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              T EFVI++P  S++K  IGGAA HAT   VF+QL   GK+QGVH F+
Sbjct  154   GTEEFVIHSPTPSSRKDYIGGAAQHATVAAVFAQLITGGKSQGVHCFV  201



>ref|XP_503244.1| YALI0D24750p [Yarrowia lipolytica]
 sp|O74936.1|ACOX3_YARLI RecName: Full=Acyl-coenzyme A oxidase 3; Short=Acyl-CoA oxidase 
3 [Yarrowia lipolytica CLIB122]
 emb|CAA04661.1| Acyl-CoA oxidase 3 [Yarrowia lipolytica]
 emb|CAG81448.1| YALI0D24750p [Yarrowia lipolytica CLIB122]
Length=700

 Score =   132 bits (331),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 115/213 (54%), Gaps = 22/213 (10%)
 Frame = +1

Query  736   FDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRR  915
             F + +M + +  H  EE      + +  RL     R   + V  D++   EQ RE  + R
Sbjct  36    FPIKDMTEFL--HGGEEN-----VTMIERLMTELERDPVLNVSGDYDMPKEQLRETAVAR  88

Query  916   IAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTK  1095
             IA LS       W  +   EA LR      +  I D    I+LGVH  L+ GAI+  GTK
Sbjct  89    IAALSG-----HWKKDTEKEALLRS----QLHGIVDMGTRIRLGVHTGLFMGAIRGSGTK  139

Query  1096  RHHDKWLR----DSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQ  1263
               +D W+R    D + +   GCFAMTELGHGSNV G+ET  TY   T EF+INTP   A 
Sbjct  140   EQYDYWVRKGAADVKGFY--GCFAMTELGHGSNVAGLETTATYIQDTDEFIINTPNTGAT  197

Query  1264  KYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             K+ IGGAA+ ATHT  F++L +DGK+ GV  F+
Sbjct  198   KWWIGGAAHSATHTACFARLLVDGKDYGVKIFV  230



>ref|WP_031177408.1| acyl-CoA oxidase [Streptomyces sp. NRRL B-3253]
Length=653

 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 123/227 (54%), Gaps = 25/227 (11%)
 Frame = +1

Query  697   GYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVY--VWPD  870
             GY  PE+  PA       +  L+DG   E R+     +++S L        K Y  +  +
Sbjct  12    GYVQPEIDVPA-------LAALLDGEYAEIRE-----LVRSNL--------KTYASILEE  51

Query  871   FNQ-SMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLSIK  1041
              ++ S++  RE     +  ++  G    G+  E G   ++   +A  +     D S+ +K
Sbjct  52    ADELSLDAYRERVRELVVEMAATGQTGMGFPREYGGGGDVGASIAAFETLAFGDLSVLVK  111

Query  1042  LGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSS  1221
             +GV F L+GGAI   GT+RHHD +L D     + GCFAMTE GHGSNV+ + TV  YD+ 
Sbjct  112   VGVQFGLFGGAILQLGTERHHDAYLPDLITGKLMGCFAMTETGHGSNVQALGTVARYDAR  171

Query  1222  TGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             + EFV+ TP E A+K  IG AA H    VVF+QL +DG ++GVHAF+
Sbjct  172   SQEFVLTTPGEEARKDYIGNAARHGEVAVVFAQLEVDGTSEGVHAFV  218



>ref|WP_018894104.1| acyl-CoA oxidase [Streptomyces sp. CNY228]
Length=653

 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 123/227 (54%), Gaps = 25/227 (11%)
 Frame = +1

Query  697   GYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVY--VWPD  870
             GY  PE+  PA       +  L+DG   E R+     +++S L        K Y  +  +
Sbjct  12    GYVQPEIDVPA-------LAALLDGEYAEIRE-----LVRSNL--------KTYASILEE  51

Query  871   FNQ-SMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLSIK  1041
              ++ S++  RE     +  ++  G    G+  E G   ++   +A  +     D S+ +K
Sbjct  52    ADELSLDAYRERVRELVVEMAATGQTGMGFPREYGGGGDVGASIAAFETLAFGDLSVLVK  111

Query  1042  LGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSS  1221
             +GV F L+GGAI   GT+RHHD +L D     + GCFAMTE GHGSNV+ + TV  YD+ 
Sbjct  112   VGVQFGLFGGAILQLGTERHHDAYLPDLITGKLMGCFAMTETGHGSNVQALGTVARYDAR  171

Query  1222  TGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             + EFV+ TP E A+K  IG AA H    VVF+QL +DG ++GVHAF+
Sbjct  172   SQEFVLTTPGEEARKDYIGNAARHGEVAVVFAQLEVDGTSEGVHAFV  218



>ref|WP_008735487.1| acyl-CoA oxidase [Streptomyces sp. Mg1]
 gb|EDX20833.1| acyl-CoA oxidase domain containing protein [Streptomyces sp. 
Mg1]
Length=653

 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 123/229 (54%), Gaps = 19/229 (8%)
 Frame = +1

Query  682   SSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLY-GLMIQSRLFNPRSRGGKVY  858
             S+P  GY  P++       DV  +  ++DG     RD +   L   + +       G   
Sbjct  7     SAPATGYVQPDV-------DVPSLTSVLDGEYAGIRDLVRTNLATYASVLEEADELG---  56

Query  859   VWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLS  1035
                  +   ++ R++ ++ +A     G+  G+  E G   ++   +A  +     D S+ 
Sbjct  57    ----IDAFRDRVRDVVVK-MAATGQTGM--GFPAEYGGGGDVGASIAAFETLAFGDLSVL  109

Query  1036  IKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYD  1215
             +K+GV F L+GGAI   GT RHH  +L D     + GCFAMTE GHGSNV+ + TV  YD
Sbjct  110   VKVGVQFGLFGGAILHLGTGRHHAAYLPDLITGELMGCFAMTETGHGSNVQALGTVARYD  169

Query  1216  SSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             +++ EFVI TP + A+K  IG AA HA   VVF+QL +DG++QGVHAF+
Sbjct  170   TASREFVITTPGDHARKDYIGNAARHAELAVVFAQLEVDGRSQGVHAFV  218



>ref|WP_017680041.1| acyl-CoA oxidase [Rhodococcus ruber]
 emb|CDZ88808.1| putative acyl-CoA oxidase [Rhodococcus ruber]
Length=645

 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLAL--LDVTTIFDHSLSI  1038
             P +   +++ R IT++++  L++ G  R    +          A+  +++  + D SL +
Sbjct  34    PHYTPDLDEARAITLKQMRMLAESGYARAGFAKAVGGGGDAGGAVASIEMLAMSDLSLMV  93

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K GV + L+GGAI+  GT RHHD+++    +  + GCFAMTE GHGS+V+ +ET  +YD 
Sbjct  94    KAGVQWGLFGGAIENLGTARHHDRYIGPLIDLDLLGCFAMTETGHGSDVQSLETTASYDP  153

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              T EFV+++P  S++K  IGGAA HAT   VF+QL   GK+QGVH F+
Sbjct  154   GTEEFVVHSPTPSSRKDYIGGAAQHATVAAVFAQLITGGKSQGVHCFV  201



>ref|WP_003946657.1| MULTISPECIES: acyl-CoA oxidase [Streptomyces]
 gb|EFE79776.1| acyl-CoA oxidase domain-containing protein [Streptomyces albus 
J1074]
 gb|EKC93763.1| acyl-CoA dehydrogenase [Streptomyces sp. SM8]
 gb|AGI92041.1| Acyl-coenzyme A oxidase 1, peroxisomal [Streptomyces albus J1074]
Length=653

 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 123/227 (54%), Gaps = 25/227 (11%)
 Frame = +1

Query  697   GYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVY--VWPD  870
             GY  PE+  PA       +  L+DG   E R+     +++S L        K Y  +  +
Sbjct  12    GYVQPEIDVPA-------LAALLDGEYAEIRE-----LVRSNL--------KTYASILEE  51

Query  871   FNQ-SMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLSIK  1041
              ++ S++  RE     +  ++  G    G+  E G   ++   +A  +     D S+ +K
Sbjct  52    ADELSLDAYRERVRELVVEMAATGQTGMGFPREYGGGGDVGASIAAFETLAFGDLSVLVK  111

Query  1042  LGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSS  1221
             +GV F L+GGAI   GT+RHHD +L D     + GCFAMTE GHGSNV+ + TV  YD+ 
Sbjct  112   VGVQFGLFGGAILQLGTERHHDAYLPDLITGKLMGCFAMTETGHGSNVQALGTVARYDAR  171

Query  1222  TGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             + EFV+ TP E A+K  IG AA H    VVF+QL +DG ++GVHAF+
Sbjct  172   SQEFVLTTPGEEARKDYIGNAARHGEVAVVFAQLEVDGTSEGVHAFV  218



>ref|WP_045063823.1| acyl-CoA oxidase [Rhodococcus sp. AD45]
 gb|KJF23120.1| Acyl-CoA dehydrogenase, short-chain specific [Rhodococcus sp. 
AD45]
Length=643

 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 105/168 (63%), Gaps = 2/168 (1%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAELR-KLALLDVTTIFDHSLSI  1038
             P F  ++   R  T+ ++  L+D G    G+    G   +    +  +++  + D SL +
Sbjct  34    PHFTPNLAIARAKTLEQMRVLADLGYAANGFAVAHGGTGDAGGAVTSIEMLAMSDLSLMV  93

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K GV + L+GGAI+  GT+RHH  +++   +  + GCFAMTE GHGS+V+ +ET  TYD+
Sbjct  94    KAGVQWGLFGGAIENLGTERHHQAYVKPLIDLELLGCFAMTETGHGSDVQELETTATYDA  153

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             +TGEFVI++P  S++K  IGGAA HAT   VF+QL   G++QGVH F+
Sbjct  154   ATGEFVIDSPTPSSRKDYIGGAAEHATVAAVFAQLITGGESQGVHCFV  201



>ref|WP_033238735.1| acyl-CoA oxidase [Streptomyces griseus]
Length=653

 Score =   131 bits (330),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 123/227 (54%), Gaps = 25/227 (11%)
 Frame = +1

Query  697   GYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVY--VWPD  870
             GY  PE+  PA       +  L+DG   E R+     +++S L        K Y  +  +
Sbjct  12    GYVQPEIDVPA-------LAALLDGEYAEIRE-----LVRSNL--------KTYASILEE  51

Query  871   FNQ-SMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLSIK  1041
              ++ S++  RE     +  ++  G    G+  E G   ++   +A  +     D S+ +K
Sbjct  52    ADELSLDAYRERVRELVVEMAATGQTGMGFPREYGGGGDVGASIAAFETLAFGDLSVLVK  111

Query  1042  LGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSS  1221
             +GV F L+GGAI   GT+RHHD +L D     + GCFAMTE GHGSNV+ + TV  YD+ 
Sbjct  112   VGVQFGLFGGAILQLGTERHHDAYLPDLITGKLMGCFAMTETGHGSNVQALGTVARYDAR  171

Query  1222  TGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             + EFV+ TP E A+K  IG AA H    VVF+QL +DG ++GVHAF+
Sbjct  172   SQEFVLTTPGEEARKDYIGNAARHGEVAVVFAQLEVDGTSEGVHAFV  218



>gb|KDD73136.1| hypothetical protein H632_c2497p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=363

 Score =   128 bits (322),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 94/167 (56%), Gaps = 5/167 (3%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRI-AYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIK  1041
             P++   + +QR +T +R+ AY+S     R +      E  LR  A L+     D S ++K
Sbjct  27    PNYYMGVREQRAVTTQRVKAYMSQ----RFYDIADYVEDPLRFCAGLECPMFADFSTAVK  82

Query  1042  LGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSS  1221
             +GVH  L GG I   G      K+L   +   + GCF MTELGHGSNV GI T   YD +
Sbjct  83    MGVHATLCGGTIASLGNPAQKAKYLARMDTLELAGCFGMTELGHGSNVMGIRTRAEYDPA  142

Query  1222  TGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             T EFVI TP + A KY IGGAA  A    VF+QL + G++QGVH F+
Sbjct  143   TREFVITTPDDDASKYFIGGAAETAHICCVFAQLTVAGRDQGVHVFV  189



>ref|WP_016932641.1| acyl-CoA oxidase [Rhodococcus sp. R1101]
Length=648

 Score =   131 bits (330),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 103/168 (61%), Gaps = 2/168 (1%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLSI  1038
             P +    ++ R I + ++  L++ G    G+  E G   +    +A +++  + D SL +
Sbjct  34    PHYTPETDKARAIALEQMRLLAEHGYAAAGFSVESGGTGDAGSAVASIEMLAMSDLSLMV  93

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K GV + L+GGAI+  GT+RHH+K++R   +  V GCFAMTE GHGS+V+ +ET  TYD 
Sbjct  94    KAGVQWGLFGGAIENLGTERHHEKYVRRLIDLDVLGCFAMTETGHGSDVQSLETTATYDP  153

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              T EFVI++P  S++K  IGGAA HA    VF+QL   G+  GVH F+
Sbjct  154   DTQEFVIHSPTPSSRKDYIGGAAQHARFAAVFAQLVTQGETHGVHCFV  201



>gb|EFA78532.1| putative acyl-CoA oxidase [Polysphondylium pallidum PN500]
Length=669

 Score =   131 bits (330),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/214 (36%), Positives = 125/214 (58%), Gaps = 24/214 (11%)
 Frame = +1

Query  742   VAEMRKLMDGHN------LEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREI  903
             V ++++++ GH        E +  LY LM +  +F P               ++ +QR++
Sbjct  45    VDKLKEVLLGHPKPEEQVRETKQKLYELM-KDPIFRPHPYA-----------NVPEQRDL  92

Query  904   TMRRIAYLSDCGVFR-GWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQ  1080
             T++R+  ++  G+ + G + E+      R +A  +   + D SL++K  V + L+ G+I 
Sbjct  93    TLKRLKMVASLGILKMGEVAEQFK----RFVAFQESLVLSDMSLAVKSSVQWGLFAGSIV  148

Query  1081  FFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESA  1260
             F GT +H  K+ +D++   + GCFA+TELGHGSNV+G+ET+  YD ST EFVI+TP +SA
Sbjct  149   FLGTDKH-KKYYQDTDCLNILGCFALTELGHGSNVKGVETLAEYDHSTREFVIHTPNDSA  207

Query  1261  QKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             QK  IG A  H T+  VF+ L + G+N G+H F+
Sbjct  208   QKMWIGNAGQHGTYATVFANLVVKGENHGLHPFL  241



>ref|WP_010592066.1| acyl-CoA oxidase [Rhodococcus sp. P14]
Length=645

 Score =   131 bits (329),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLAL--LDVTTIFDHSLSI  1038
             P +   +++ R IT++++  L++ G  R    +          A+  +++  + D SL +
Sbjct  34    PHYTPDLDEARAITLKQMRMLAESGYARSGFAKAVGGGGDAGGAVASIEMLAMSDLSLMV  93

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K GV + L+GGAI+  GT RHHD+++    +  + GCFAMTE GHGS+V+ +ET  +YD 
Sbjct  94    KAGVQWGLFGGAIENLGTARHHDRYIGPLIDLDLLGCFAMTETGHGSDVQSLETTASYDP  153

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              T EFV+++P  S++K  IGGAA HAT   VF+QL   GK+QGVH F+
Sbjct  154   GTEEFVVHSPTPSSRKDYIGGAAQHATVAAVFAQLITGGKSQGVHCFV  201



>ref|XP_009441363.1| PREDICTED: acyl-coenzyme A oxidase-like protein [Pan troglodytes]
Length=371

 Score =   128 bits (321),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/221 (35%), Positives = 122/221 (55%), Gaps = 19/221 (9%)
 Frame = +1

Query  721   EPAASFDV----AEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSME  888
             EPA + D+    + + + +DG     ++ L  L+    LF  R           ++ S++
Sbjct  2     EPAPAPDLGLGDSSLHRYLDGDFWSLKNELRRLLGGCPLFRQR-----------YDLSLD  50

Query  889   QQREITMRRIAYLSDCGVFRGW---LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFF  1059
             + R +T++R+ +     + +     L EK      R L + +V ++ D +  +K G+ ++
Sbjct  51    EMRALTVQRVKFAMGLPLLKRAVQDLAEKTKNFVSRSLVIGEVLSMADMATGVKCGIIYW  110

Query  1060  LWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVI  1239
             L+GGAI+  G+  H  KW +  +     G FAMTE GHGSNVRGI+T  T+D S  EFVI
Sbjct  111   LFGGAIRNLGSPEHVTKWFQPLQEQKYTGMFAMTERGHGSNVRGIQTEATFDLSAQEFVI  170

Query  1240  NTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             +TPCE+A+K  IG A  +  +  VF+QL IDG++QG H FI
Sbjct  171   DTPCENAEKMYIGNAM-YGNYAAVFAQLIIDGRSQGPHCFI  210



>ref|XP_001639738.1| predicted protein [Nematostella vectensis]
 gb|EDO47675.1| predicted protein [Nematostella vectensis]
Length=594

 Score =   130 bits (328),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 112/204 (55%), Gaps = 14/204 (7%)
 Frame = +1

Query  751   MRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLS  930
             M +L+D  N E+R+    ++ +  L  P+           +N S++++R + ++R+  L 
Sbjct  1     MTRLLDHDNHEKREKFRKILSEDPLMKPK-----------YNISVDEERALALKRLKKLC  49

Query  931   DCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDK  1110
             D G          P       A  ++  + D S++ K+ V F L+GG +   GT+RHH K
Sbjct  50    DQGFISVLDFRHNPR---WIFAAHELAAVVDGSMATKMTVQFNLFGGTVLKLGTERHHSK  106

Query  1111  WLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAAN  1290
              L+  ++    GCF +TELG+G+N   +ET  TYD+ T EF++NTP   AQKY I   A 
Sbjct  107   LLKGIDSLEDVGCFGLTELGYGNNAVQMETTATYDNETQEFIVNTPSTLAQKYWITNGAC  166

Query  1291  HATHTVVFSQLNIDGKNQGVHAFI  1362
              A H VVF+QL ++GKN+G+H  +
Sbjct  167   DAHHIVVFAQLYVNGKNEGIHGVL  190



>ref|WP_010639493.1| acyl-CoA oxidase [Streptomyces sp. S4]
Length=653

 Score =   131 bits (329),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 122/227 (54%), Gaps = 25/227 (11%)
 Frame = +1

Query  697   GYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVY--VWPD  870
             GY  PE+  PA       +  L+DG   E R+     +++S L        K Y  +  +
Sbjct  12    GYVQPEIDVPA-------LAALLDGEYAEIRE-----LVRSNL--------KTYASILEE  51

Query  871   FNQ-SMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLSIK  1041
               + S++  RE     +  ++  G    G+  E G   ++   +A  +     D S+ +K
Sbjct  52    AEELSLDAYRERVRELVVEMAATGQTGMGFPREYGGGGDVGASIAAFETLAFGDLSVLVK  111

Query  1042  LGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSS  1221
             +GV F L+GGAI   GT+RHHD +L D     + GCFAMTE GHGSNV+ + TV  YD+ 
Sbjct  112   VGVQFGLFGGAILQLGTERHHDAYLPDLITGKLMGCFAMTETGHGSNVQALGTVARYDAR  171

Query  1222  TGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             + EFV+ TP E A+K  IG AA H    VVF+QL +DG ++GVHAF+
Sbjct  172   SQEFVLTTPGEEARKDYIGNAARHGEVAVVFAQLEVDGTSEGVHAFV  218



>ref|XP_001732973.1| acyl-CoA oxidase [Dictyostelium discoideum AX4]
 gb|EDR41097.1| acyl-CoA oxidase [Dictyostelium discoideum AX4]
Length=629

 Score =   130 bits (328),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 106/173 (61%), Gaps = 11/173 (6%)
 Frame = +1

Query  865   PDFNQS-----MEQQREITMRRIAYLSDCGVFRGWLTEKGPEAEL-RKLALLDVTTIFDH  1026
             P F ++     M   R++ + + A +++    RG +     +  L R +  L++  ++++
Sbjct  69    PKFKENFIGLDMATYRQLVLEQCAAIAN----RGLIHFTDIKNNLHRYIGALEMFALYNN  124

Query  1027  SLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVT  1206
             ++  KL V + L+GG I F GT RH +K++ D+      GCFAMTE+GHGSNVRGIET  
Sbjct  125   NILTKLSVQYTLFGGPIIFLGTSRH-EKYIEDANTLKTMGCFAMTEIGHGSNVRGIETTA  183

Query  1207  TYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
              YD  T EF+I++P  +++K+ IG A  HAT+ VVF+ L IDG N G+HAFI 
Sbjct  184   HYDKQTKEFIIHSPTPTSEKFWIGCAYLHATYAVVFANLIIDGTNYGIHAFIV  236



>ref|WP_027020615.1| acyl-CoA oxidase [Corynebacterium sputi]
Length=675

 Score =   130 bits (328),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 127/236 (54%), Gaps = 24/236 (10%)
 Frame = +1

Query  679   QSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVY  858
             Q S     T P   EPAA+ D+   +K++DG   E R+ L     +  L +P  R     
Sbjct  6     QISASRPQTLPSTPEPAAAKDI---QKVLDGRWWETRNRL-----REELNDPSYR-----  52

Query  859   VWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLT-EKGPEAEL-RKLALLDVTTIFDHSL  1032
               P ++  +E+ RE+ + R+  + D G+ +G  + E G   ++   L  +++    D S 
Sbjct  53    --PAYDLPLEEARELMVERLERIRDTGLPQGVFSKEHGGSGDIGATLTGMEMVGHADLST  110

Query  1033  SIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTY  1212
              +K GV + LWGGA+   GT+RH  K++    N  + GCFAMTE GHGS+V+ +ET  TY
Sbjct  111   MVKAGVQWGLWGGAVDALGTERHG-KYVEQIINLDLLGCFAMTERGHGSDVQSLETTATY  169

Query  1213  DSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNI------DGKNQGVHAFI  1362
             D  T EF++++P ESAQK  IG AA H     VF+QL+        G++ GVH  I
Sbjct  170   DKDTQEFIVHSPVESAQKCYIGNAAKHGRMAAVFAQLHTPDENGEPGESHGVHCLI  225



>ref|WP_018471012.1| acyl-CoA oxidase [Streptomyces sp. LaPpAH-202]
Length=653

 Score =   130 bits (327),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 122/227 (54%), Gaps = 25/227 (11%)
 Frame = +1

Query  697   GYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVY--VWPD  870
             GY  PE+  PA       +  L+DG   E R+     +++S L        K Y  +  +
Sbjct  12    GYVQPEIDVPA-------LAALLDGEYAEIRE-----LVRSNL--------KTYASILEE  51

Query  871   FNQ-SMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLSIK  1041
               + S++  RE     +  ++  G    G+  E G   ++   +A  +     D S+ +K
Sbjct  52    AEELSLDAYRERVRELVVEMAATGQTGMGFPREYGGGGDVGASIAAFETLAFGDLSVLVK  111

Query  1042  LGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSS  1221
             +GV F L+GGAI   GT+RHHD +L D     + GCFAMTE GHGSNV+ + TV  YD+ 
Sbjct  112   VGVQFGLFGGAILQLGTERHHDVYLPDLITGKLMGCFAMTETGHGSNVQALGTVARYDAR  171

Query  1222  TGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             + EFV+ TP E A+K  IG AA H    VVF+QL +DG ++GVHAF+
Sbjct  172   SQEFVLTTPGEEARKDYIGNAARHGEVAVVFAQLEVDGTSEGVHAFV  218



>ref|WP_017614281.1| acyl-CoA oxidase [Nocardiopsis salina]
Length=658

 Score =   130 bits (327),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 119/217 (55%), Gaps = 13/217 (6%)
 Frame = +1

Query  715   LSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQ  894
             ++E     D +E+R L+DG     R+    L+ Q   F P +             SME  
Sbjct  1     MTEQPLRADDSELRGLLDGRWAHVRERARDLL-QGEDFAPVN-----------GLSMEDH  48

Query  895   REITMRRIAYLSDCGV-FRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGG  1071
             R +T  R+A L++ G+   G+  E G   ++    +     + D SL +K+GV + L+GG
Sbjct  49    RALTTERLAKLAETGMQTYGFPEEVGGSGDVGASVVAFEMLVTDLSLMVKMGVQWGLFGG  108

Query  1072  AIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPC  1251
             AI   GT+RHH ++L  + +  + GCFAMTE GHGS+V+ + T  TYD  T EFV++TP 
Sbjct  109   AINALGTERHHHEYLPGAMSLDIPGCFAMTETGHGSDVQSLRTTATYDPKTEEFVVHTPD  168

Query  1252  ESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             ESA+K  IG AA      VVF+QL+  G + GVHA +
Sbjct  169   ESARKDYIGNAARDGRMAVVFAQLHSAGIDHGVHALM  205



>ref|XP_002953234.1| hypothetical protein VOLCADRAFT_93964 [Volvox carteri f. nagariensis]
 gb|EFJ45833.1| hypothetical protein VOLCADRAFT_93964 [Volvox carteri f. nagariensis]
Length=689

 Score =   130 bits (327),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 114/216 (53%), Gaps = 18/216 (8%)
 Frame = +1

Query  724   PAAS---FDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQ  894
             P+AS   FDV E+++++D  N E R  +   M              +YV P ++ S+  +
Sbjct  21    PSASRYPFDVKELQRILDHDNHEHRQAMKEFM-----------NDDLYV-PQYDISLRDE  68

Query  895   REITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLWGGA  1074
             RE+ ++R+  +   G          P    R  A  +V  + D S+  K+ V F L+GG 
Sbjct  69    RELALQRLKRVCRAGFISVTDFRTNP---FRIFAAHEVAALCDPSMGTKMTVQFNLFGGT  125

Query  1075  IQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCE  1254
             +   GT+RHH  +LRD +     GCFA+TELG G+N   ++T   YD  T EFVI+TP  
Sbjct  126   VLKLGTERHHGAFLRDIDQLDAVGCFALTELGFGNNAVEMQTTAEYDKDTQEFVIHTPGS  185

Query  1255  SAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              AQKY I  +A HA   VVF+QL +  + +G+H F+
Sbjct  186   LAQKYWITNSAVHAQWAVVFAQLTVAARQEGIHGFL  221



>ref|XP_004350494.1| hypothetical protein DFA_11547 [Dictyostelium fasciculatum]
 gb|EGG13786.1| hypothetical protein DFA_11547 [Dictyostelium fasciculatum]
Length=2331

 Score =   132 bits (332),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 88/122 (72%), Gaps = 1/122 (1%)
 Frame = +1

Query  1000  LDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGS  1179
             +++ + +++++  KLGVH+ LWGG I   GTKRH +K++  S+   + G F+MTE+GHGS
Sbjct  164   IEILSTYNNNICTKLGVHYSLWGGTILLLGTKRH-EKYIEPSDKLSIVGSFSMTEMGHGS  222

Query  1180  NVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAF  1359
             NVRG+ET  T+D +T EFV+++P  SA K  IGG A HA +T VF++L ID K+ GVHAF
Sbjct  223   NVRGLETTATFDRATKEFVVHSPSPSAYKVWIGGTALHAHYTTVFARLVIDSKDYGVHAF  282

Query  1360  IA  1365
             + 
Sbjct  283   VV  284



>ref|WP_035694733.1| acyl-CoA oxidase [Flavobacterium soli]
Length=753

 Score =   130 bits (328),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 83/125 (66%), Gaps = 0/125 (0%)
 Frame = +1

Query  991   LALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELG  1170
              A+++  +  D SL IK GV F LWG +IQ  GT++H++K+L+D     + GCFAMTE  
Sbjct  214   FAIMETLSYHDLSLVIKFGVQFGLWGMSIQSLGTEKHYEKYLKDIGTLDLPGCFAMTETH  273

Query  1171  HGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGV  1350
             HGSNV+GIET  TY+ S   F I+TP E AQK  IG AANH     VF++L IDG + GV
Sbjct  274   HGSNVKGIETTATYNHSAKTFTIHTPHEKAQKEYIGNAANHGRMATVFAKLIIDGHDYGV  333

Query  1351  HAFIA  1365
             +AFI 
Sbjct  334   NAFIV  338



>ref|WP_030112305.1| acyl-CoA oxidase, partial [Streptomyces californicus]
Length=345

 Score =   126 bits (317),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 118/230 (51%), Gaps = 31/230 (13%)
 Frame = +1

Query  697   GYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFN  876
             GY  PE+       DV  +  L+DG   E RD +              R   V   P  +
Sbjct  12    GYVQPEI-------DVKALGALLDGEYAEIRDLV--------------RANLVTHAPVLD  50

Query  877   QSME-------QQREITMRRIAYLSDCGVFRGWLTEKGPEAEL-RKLALLDVTTIFDHSL  1032
             ++ E       ++    +  +A     G+  G+ T  G   ++   +A  +   + D S+
Sbjct  51    EAEELDIDAFRERVRERVVEMAATGQTGM--GFPTRYGGGGDVGASIAAFETLALGDLSV  108

Query  1033  SIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTY  1212
              +K+GV F L+GGAI   GT+RHHD +L D     + GCFAMTE GHGSNV+ + TV  Y
Sbjct  109   LVKVGVQFGLFGGAILHLGTERHHDAYLPDLITGKLMGCFAMTETGHGSNVQALGTVARY  168

Query  1213  DSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             D++  EFVI T  + A+K  IG AA H    VVF+QL IDG ++GVHAF+
Sbjct  169   DAAAQEFVITTEGDQARKDYIGNAARHGELAVVFAQLEIDGTSEGVHAFV  218



>ref|WP_011753930.1| acyl-CoA oxidase [Nocardioides sp. JS614]
 gb|ABL79979.1| acyl-CoA oxidase domain protein [Nocardioides sp. JS614]
Length=657

 Score =   130 bits (326),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 85/225 (38%), Positives = 120/225 (53%), Gaps = 21/225 (9%)
 Frame = +1

Query  697   GYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFN  876
             GY  PE+  PA       +  L+DG     RD     ++++ L    S      +  D  
Sbjct  12    GYVQPEIDVPA-------LTALLDGRYAGVRD-----LVRTNLAEHAS------ILVDAE  53

Query  877   Q-SMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLSIKLG  1047
             + S++  RE  ++ +  ++  G    G+  E G    L   +A  +     D S+ +K+G
Sbjct  54    EMSIDDFREQVLKVVVEMAATGQTGMGFPEEYGGGCGLGASIAAFETLAYGDLSVLVKVG  113

Query  1048  VHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTG  1227
             V F L+GGAI   GT+RHH+ +L D     + GCFAMTE GHGSNV+ + TV TYD +T 
Sbjct  114   VQFGLFGGAILQLGTERHHEAYLADLITGKLMGCFAMTETGHGSNVQALGTVATYDPATE  173

Query  1228  EFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             EFVI T  E A+K  IG AA HA   VVF+QL + G  +GVHAF+
Sbjct  174   EFVITTTTEDARKDYIGNAAKHAEVAVVFAQLEVGGTTEGVHAFV  218



>ref|WP_040338148.1| acyl-CoA oxidase [Candidatus Blastococcus massiliensis]
Length=669

 Score =   130 bits (326),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAELR-KLALLDVTTIFDHSLSI  1038
             P + +SM++ RE   R    L+D G V  G+  + G E ++   +  +++    D SL +
Sbjct  27    PVYGESMQEARERVTRAAKKLADSGRVGYGFPKQYGGEDDMGGSVTSIEMLAFGDLSLMV  86

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K GV + L+GGA+Q  GTKR HD++L D+ ++ + GCFAMTE GHGS+V+ + T  TYD 
Sbjct  87    KAGVQWGLFGGAMQLLGTKRQHDEYLADAMSFDLPGCFAMTETGHGSDVQQLRTTCTYDP  146

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              T  F ++TP E+A+K  IG AA      VVF+QL   GKN GVHA++
Sbjct  147   ETQCFDLHTPHEAARKDYIGNAAEDGRMAVVFAQLITQGKNHGVHAWL  194



>ref|WP_042377454.1| acyl-CoA oxidase [Gordonia alkanivorans]
Length=683

 Score =   130 bits (327),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 88/248 (35%), Positives = 132/248 (53%), Gaps = 23/248 (9%)
 Frame = +1

Query  640   IQENPCVDDDILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQS  819
             I + P +DD +          TPP +S   A  D++   + +   NL  R  L G    +
Sbjct  16    IAKEPTLDDPV----------TPPGVS---ADDDLSADERALLVDNL--RFALDGRWRAT  60

Query  820   RLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKL  993
             R F  R    +  + PD ++++E+ R  T+  +  L+  G    G+  + G   ++   +
Sbjct  61    REF-VRENSNRADLLPDPSRTLEEARTHTLEVMRELASQGFASAGFAADHGGTGDIGSSI  119

Query  994   ALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGH  1173
               +++    D SL +K GV + L+GGA++  GTKRHHDK++    N  + GCFAMTE GH
Sbjct  120   TAIEMLGYADLSLMVKAGVQWGLFGGAVENLGTKRHHDKYVPGIINLDILGCFAMTETGH  179

Query  1174  GSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQ---  1344
             GSNV+ IET  TYD    EFVI++P  S++K  IGGAA HA    VF+QL   G ++   
Sbjct  180   GSNVQAIETTATYDRDAREFVIHSPTPSSRKDYIGGAAEHARFAAVFAQLITGGPDEEPE  239

Query  1345  --GVHAFI  1362
               GVH F+
Sbjct  240   GRGVHCFV  247



>ref|XP_005718655.1| acyl-CoA oxidase [Chondrus crispus]
 emb|CDF38750.1| acyl-CoA oxidase [Chondrus crispus]
Length=642

 Score =   130 bits (326),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 115/221 (52%), Gaps = 15/221 (7%)
 Frame = +1

Query  703   TPPELSEPAASFDVAEMRKLMDGH-NLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQ  879
             +P + S PAA    A  R L   H +L  R +    +++  +F  R           +N+
Sbjct  9     SPAQSSSPAAPSPEALSRLLYPAHRDLRARAFE---LLREPVFRLR-----------YNE  54

Query  880   SMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFF  1059
             ++  +R  T  RIA +   G+ R  ++        R   L+DV  + DHSL I+ GV+  
Sbjct  55    TVAMERSRTTARIARVRQAGLLRDTVSRANEAGSRRYDVLIDVLALLDHSLEIRFGVNLG  114

Query  1060  LWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVI  1239
             L+   I+  G++  +  WL   E+    GCFA+TELGHGSNVRGI+T   Y     +F I
Sbjct  115   LFCATIRRLGSEEQYTHWLPRIEDGRDVGCFALTELGHGSNVRGIQTTARYLPDVQQFEI  174

Query  1240  NTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             +TP + AQK+ IG AA  A   VVF+QL +D  + G+H FI
Sbjct  175   HTPHDLAQKFWIGAAAETANVAVVFAQLTVDAVHHGIHIFI  215



>ref|WP_035104505.1| acyl-CoA oxidase [Corynebacterium camporealensis]
 gb|KGL65610.1| acyl-CoA oxidase [Corynebacterium camporealensis]
Length=701

 Score =   130 bits (327),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 121/223 (54%), Gaps = 21/223 (9%)
 Frame = +1

Query  709   PELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSME  888
             P   +PA    V E++ L++G N E R  +            R  G    ++P  +  +E
Sbjct  43    PMKPDPAI---VPELQALLEGENPEFRARM------------REFGENPDLYPRSDLPLE  87

Query  889   QQREITMRRIAYLSDCGVF-RGWLTEKGPEAELRK-LALLDVTTIFDHSLSIKLGVHFFL  1062
             +QR  TM  +  + + G F  G+  E G  +  R  L  L+     + SL+IK GV + L
Sbjct  88    EQRRHTMEGVRAVGEEGYFLAGFREENGGSSNPRDALTTLEALASINGSLAIKSGVQWGL  147

Query  1063  WGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVIN  1242
             WGGA+   GT+RH + W R + +  V GCFAMTE GHGS+V+ +ETV TYD  T EFVI+
Sbjct  148   WGGAVDQLGTERHSE-WARKAASLEVPGCFAMTEHGHGSDVQSLETVATYDVETQEFVID  206

Query  1243  TPCESAQKYSIGGAANHATHTVVFSQL---NIDGKNQGVHAFI  1362
             TP +SA K  IG AA       VF+QL   + DG++ GVH FI
Sbjct  207   TPRDSAVKNYIGNAAADGRAAAVFAQLVTPDSDGRSNGVHCFI  249



>ref|WP_026810093.1| acyl-CoA oxidase [Arenibacter latericius]
Length=754

 Score =   130 bits (327),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/224 (36%), Positives = 128/224 (57%), Gaps = 24/224 (11%)
 Frame = +1

Query  715   LSEPAASF-DVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQ  891
             LSE  +++ +  E+  L+ G + +  + L  L+  S           ++ W + N+++++
Sbjct  133   LSEKTSNYYNAKEISNLLKGKHAQALENLAKLLSHS-----------LFAW-EVNRNLDE  180

Query  892   QREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTIFDH------SLSIKLGVH  1053
              R   + ++ YL + G+  G +    PEA   K  +     IF+H      SL++K GV 
Sbjct  181   FRNKVLTQVQYLGEKGI--GAIAY--PEAYGGKDDMELYANIFEHLMFLDGSLTVKFGVQ  236

Query  1054  FFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEF  1233
             F L+GG+I+  GTK+HHD++L+   N  + GCFAMTE GHGSNVRGI+T  TY+ +    
Sbjct  237   FGLFGGSIEKLGTKKHHDQYLKAIGNTSLLGCFAMTETGHGSNVRGIKTTATYNPTNDTI  296

Query  1234  VINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFIA  1365
             +I+TP ++  K  IG A  H T   VF+QL ++GKN+GVHA + 
Sbjct  297   IIHTPGKNDNKEYIGNAL-HGTMATVFAQLIVNGKNRGVHAILV  339



>ref|WP_043644508.1| hypothetical protein, partial [Nocardioides alkalitolerans]
Length=665

 Score =   130 bits (326),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 80/223 (36%), Positives = 120/223 (54%), Gaps = 17/223 (8%)
 Frame = +1

Query  697   GYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFN  876
             GY  P       + DV  + +++DG   E RD +   + +   +       +    P+F 
Sbjct  7     GYVQP-------TVDVPVLTRILDGRYAEVRDLVRTNLAE---YAGVLEDAETMTGPEFR  56

Query  877   QSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLSIKLGVH  1053
             + + +     ++ +A     G   G+  E G   ++   +A  +   + D S+ +K+GV 
Sbjct  57    ERVLE----IVQEMAKTGQTGF--GFPEEYGGGGDVGASIAAFETLAMGDLSVLVKVGVQ  110

Query  1054  FFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEF  1233
             F L+GGA+   GTKRHHD  L D  +    GCFAMTE GHGSNV+ + T  TYD  T EF
Sbjct  111   FGLFGGAVLQLGTKRHHDAHLSDIIHGRTLGCFAMTESGHGSNVQALATTATYDVGTDEF  170

Query  1234  VINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             V+ TP ++A+K  IG AA H    VVF+QL+I G++QGVHAF+
Sbjct  171   VVRTPHDAARKDYIGNAATHGELAVVFAQLHIGGESQGVHAFL  213



>ref|XP_003926782.1| PREDICTED: acyl-coenzyme A oxidase-like protein [Saimiri boliviensis 
boliviensis]
Length=659

 Score =   129 bits (325),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 105/179 (59%), Gaps = 4/179 (2%)
 Frame = +1

Query  835   RSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGW---LTEKGPEAELRKLALLD  1005
             R  GG       ++ S+++ R +T++R+ +     +F+G    L EK      R L + +
Sbjct  31    RLVGGCPLFRQRYDLSLDEMRALTVQRVKFTMGLPLFKGAFQDLAEKTKNFVSRSLVIGE  90

Query  1006  VTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNV  1185
             V ++ D +  +K G+ ++L+GGAI+  G+  H  KW +  +     G FAMTE GHGSNV
Sbjct  91    VLSMADMATGVKCGIIYWLFGGAIRNLGSPEHVTKWFQPLQEQKYTGMFAMTERGHGSNV  150

Query  1186  RGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             RGI+T  T+D S  EFVI+ PCE A+K  IG A  +  +  VF+QL IDG++QG H FI
Sbjct  151   RGIQTEATFDLSAQEFVIDRPCEDAEKMYIGNAM-YGNYAAVFAQLIIDGRSQGPHCFI  208



>ref|WP_006797234.1| acyl-CoA oxidase [Flavobacteria bacterium BBFL7]
 gb|EAS19960.1| acyl-CoA oxidase [Flavobacteria bacterium BBFL7]
Length=768

 Score =   130 bits (327),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 103/175 (59%), Gaps = 15/175 (9%)
 Frame = +1

Query  838   SRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTI  1017
             +R  KV+ W       ++  +  + ++AY +  G         G ++ ++  A+ +    
Sbjct  193   TRKEKVFKW------TKELADAGLGKLAYPNAYG---------GSDSMVQYAAVFEELAK  237

Query  1018  FDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIE  1197
             +D SL+IK GVHF L+GG+++  GT  HHDK+L+D  N  + GCFAMTE+ HGSNV+ ++
Sbjct  238   YDLSLTIKFGVHFGLFGGSVESLGTTYHHDKYLKDIGNMTLPGCFAMTEMHHGSNVKALQ  297

Query  1198  TVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             T   Y   +  F+I+TP +  +K  IG AA HA    VF+QL +DG+  G+HAF+
Sbjct  298   TTAIYQPDSNSFIIHTPSQHDRKTYIGNAAMHAQMATVFAQLIVDGEEHGIHAFL  352



>ref|WP_042532221.1| acyl-CoA oxidase [Corynebacterium singulare]
 gb|AJI79739.1| Acyl-coenzyme A oxidase [Corynebacterium singulare]
Length=692

 Score =   129 bits (325),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 117/223 (52%), Gaps = 21/223 (9%)
 Frame = +1

Query  709   PELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSME  888
             P   +PA +    E+  L+DG +   RD L   +    LF            P  +  M 
Sbjct  35    PSTPKPAVA---TELGALLDGPHAAFRDELRTFLNDPELF------------PKSHLPMA  79

Query  889   QQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTI--FDHSLSIKLGVHFFL  1062
             +QRE T   +A + D G F+  L      +    L+   +  +   D SL+IK GV + L
Sbjct  80    EQREHTFNNLAKVRDFGGFKHGLRRDNGGSGKPNLSTFTLEGLAWVDGSLAIKSGVQWGL  139

Query  1063  WGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVIN  1242
             WGGA+   GT+RH + W++ + N  + GCFAMTE GHGS+V+ +ET  TYD  T EFV++
Sbjct  140   WGGALDQLGTERHIE-WVQKAANLELPGCFAMTERGHGSDVQSLETTATYDPETQEFVVH  198

Query  1243  TPCESAQKYSIGGAANHATHTVVFSQL---NIDGKNQGVHAFI  1362
             TP ++A K  IG AA      VVF+QL     DG++ GVHA I
Sbjct  199   TPSDTAVKNYIGNAAKDGRAAVVFTQLITPESDGRSHGVHAII  241



>ref|WP_018102778.1| MULTISPECIES: acyl-CoA oxidase [Streptomyces]
Length=651

 Score =   129 bits (324),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 124/234 (53%), Gaps = 21/234 (9%)
 Frame = +1

Query  670   ILLQSSPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQ--SRLFNPRSR  843
             ++ +++P  GY  PE+       DV  + +++DG     RD +   ++   S L      
Sbjct  1     MVTENTPAAGYVQPEI-------DVPGLTRVLDGDYAGIRDLVRSNLVAYASVLEEAEEL  53

Query  844   GGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAEL-RKLALLDVTTIF  1020
             G   Y         E+ REI +  +A     G+  G+  E G   ++   +A  +     
Sbjct  54    GIDAY--------RERVREIVVE-MAATGQTGM--GFPEEYGGGGDVGASIAAFETLAFG  102

Query  1021  DHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIET  1200
             D S+ +K+GV F L+GGAI   GT+RHH  +L D     + GCFAMTE GHGS+V+ + T
Sbjct  103   DLSVLVKVGVQFGLFGGAILQLGTERHHRAYLPDLITGRLMGCFAMTETGHGSDVQSLGT  162

Query  1201  VTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             V  YD +T EFV+ TP + A K  IG AA HA   VVF+QL + GK +GVHAF+
Sbjct  163   VARYDPATQEFVLTTPDDEACKDYIGNAARHAELAVVFAQLEVAGKAEGVHAFV  216



>ref|XP_006500336.1| PREDICTED: acyl-coenzyme A oxidase-like protein isoform X1 [Mus 
musculus]
Length=655

 Score =   129 bits (324),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 112/208 (54%), Gaps = 21/208 (10%)
 Frame = +1

Query  757   KLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDC  936
             + +DG     ++ L   +  S LF PR           ++ S+E+ R +T +R+ ++   
Sbjct  16    RYLDGELWSLKNELRRALESSPLFQPR-----------YDLSLEEMRALTNQRVKFVLSL  64

Query  937   GVFRGWLTEKGPEAELRK------LALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKR  1098
              V +  L +   + E RK      L L +V  + D S+SIK G+ F L+GGAI   G+  
Sbjct  65    PVVKHVLLD---QEEKRKSFISQILILGEVLCMVDVSMSIKCGILFLLFGGAISNLGSPE  121

Query  1099  HHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIG  1278
             H  KW    +     G FAMTE GHGSNVRGI+T  T+D    EFVI+ PCE+A K  IG
Sbjct  122   HVTKWFWPLKEQKYTGMFAMTERGHGSNVRGIQTEATFDLDNQEFVIDMPCENAHKMYIG  181

Query  1279  GAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              A  H  +  VF+QL I+GK+QG H FI
Sbjct  182   NAM-HGNYAAVFAQLIIEGKSQGPHCFI  208



>ref|WP_037233366.1| acyl-CoA oxidase [Rhodococcus wratislaviensis]
 dbj|GAF46127.1| putative acyl-CoA oxidase [Rhodococcus wratislaviensis NBRC 100605]
Length=648

 Score =   129 bits (324),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLSI  1038
             P +   +++ R  T+ ++  L+  G    G+  + G   +    +  +++  + D SL +
Sbjct  35    PHYTPDLDEARAKTLAQLRLLASNGYAADGFAKDHGGTGDAGAAVTSIEMLAMSDLSLMV  94

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K GV + L+GGAI+  GT RHH+ +++   +  + GCFAMTE GHGS+V+ +ET  TYD+
Sbjct  95    KAGVQWGLFGGAIENLGTARHHEAYVKRLVDLDLLGCFAMTETGHGSDVQALETTATYDA  154

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
               GEFVI++P  S++K  IGGAA HAT   VF+QL   G++QGVH F+
Sbjct  155   DAGEFVIHSPTPSSRKDYIGGAAQHATMAAVFAQLITGGESQGVHCFV  202



>ref|XP_505264.1| YALI0F10857p [Yarrowia lipolytica]
 sp|O74935.1|ACOX2_YARLI RecName: Full=Acyl-coenzyme A oxidase 2; Short=Acyl-CoA oxidase 
2 [Yarrowia lipolytica CLIB122]
 emb|CAA04660.1| Acyl-CoA oxidase 2 [Yarrowia lipolytica]
 emb|CAG78071.1| YALI0F10857p [Yarrowia lipolytica CLIB122]
 gb|AGJ89973.1| acyl-CoA oxidase 2, partial [synthetic construct]
Length=700

 Score =   129 bits (325),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 85/215 (40%), Positives = 119/215 (55%), Gaps = 24/215 (11%)
 Frame = +1

Query  733   SFDVAEMRKLMDG--HNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREIT  906
             SF V EM   +DG   N  + + +   + +  LFN  +       + D N+  EQ RE+T
Sbjct  34    SFPVREMTYFLDGGEKNTLKNEQIMEEIERDPLFNNDN-------YYDLNK--EQIRELT  84

Query  907   MRRIAYLSDCGVFRGWLTEKGPEAELRK-LALLDVTTIFDHSLSIKLGVHFFLWGGAIQF  1083
             M R+A LS             PE +++K  AL+ +    D     +LGVH+ L+ GA++ 
Sbjct  85    MERVAKLS-------LFVRDQPEDDIKKRFALIGIA---DMGTYTRLGVHYGLFFGAVRG  134

Query  1084  FGTKRHHDKWLRDSENYLVK--GCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCES  1257
              GT      W+      L K  GCF+MTELGHGSN+ G+ET   YD  T EF+INTP  +
Sbjct  135   TGTAEQFGHWISKGAGDLRKFYGCFSMTELGHGSNLAGLETTAIYDEETDEFIINTPHIA  194

Query  1258  AQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             A K+ IGGAA+ ATHTVVF++L + GK+ GV  F+
Sbjct  195   ATKWWIGGAAHTATHTVVFARLIVKGKDYGVKTFV  229



>gb|AII09135.1| acyl-CoA oxidase [Rhodococcus opacus]
Length=648

 Score =   129 bits (324),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLSI  1038
             P +   +++ R  T+ ++  L+  G    G+  + G   +    +  +++  + D SL +
Sbjct  35    PHYTPDLDEARAKTLAQLRLLASNGYAADGFAKDHGGTGDAGAAVTSIEMLAMSDLSLMV  94

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K GV + L+GGAI+  GT RHH+ +++   +  + GCFAMTE GHGS+V+ +ET  TYD+
Sbjct  95    KAGVQWGLFGGAIENLGTARHHEAYVKRLVDLDLLGCFAMTETGHGSDVQALETTATYDA  154

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
               GEFVI++P  S++K  IGGAA HAT   VF+QL   G++QGVH F+
Sbjct  155   DAGEFVIHSPTPSSRKDYIGGAAQHATMAAVFAQLITGGESQGVHCFV  202



>ref|WP_010188978.1| acyl-CoA oxidase [Corynebacterium aurimucosum]
 gb|ACP33762.1| acyl-CoA oxidase [Corynebacterium aurimucosum ATCC 700975]
Length=694

 Score =   129 bits (325),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 87/231 (38%), Positives = 119/231 (52%), Gaps = 24/231 (10%)
 Frame = +1

Query  685   SPCIGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLMIQSRLFNPRSRGGKVYVW  864
             SP    T P+LS        AE+  L+DG +   R  L   +    LF            
Sbjct  32    SPHRLPTTPKLSV------AAELAALLDGPHAAFRQELRTFLNDPELF------------  73

Query  865   PDFNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAELRKLALLDVTTI--FDHSLSI  1038
             P  + SM +QR+ T   ++ + D G F   L      A    L+   +  +   D SL+I
Sbjct  74    PKADLSMAEQRQHTFENLSKVRDFGGFNHGLRSAHGGAGKPNLSTFTLEGLAWVDGSLAI  133

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K GV + LWGGA+   GT+RH D W+  + +  + GCFAMTE GHGS+V+ +ET  T+D 
Sbjct  134   KSGVQWGLWGGALDQLGTERHLD-WINKAASLELPGCFAMTERGHGSDVQSLETTATFDP  192

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQL---NIDGKNQGVHAFI  1362
              T EF+INTP +SA K  IG AA      VVF+QL   + DG++ GVHA I
Sbjct  193   ETDEFIINTPSDSAVKNYIGNAAKDGRAAVVFTQLITPDSDGRSHGVHAII  243



>ref|WP_009474726.1| MULTISPECIES: acyl-CoA oxidase [Rhodococcus]
 gb|ABG93854.1| acyl-CoA oxidase [Rhodococcus jostii RHA1]
 gb|EJI99874.1| acyl-CoA oxidase domain protein [Rhodococcus sp. JVH1]
Length=648

 Score =   129 bits (324),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLSI  1038
             P +   +++ R  T+ ++  L+  G    G+  + G   +    +  +++  + D SL +
Sbjct  35    PHYTPDLDEARAKTLAQLRLLASNGYAADGFAKDHGGTGDAGAAVTSIEMLAMSDLSLMV  94

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K GV + L+GGAI+  GT RHH+ +++   +  + GCFAMTE GHGS+V+ +ET  TYD+
Sbjct  95    KAGVQWGLFGGAIENLGTARHHEAYVKRLVDLDLLGCFAMTETGHGSDVQALETTATYDA  154

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
               GEFVI++P  S++K  IGGAA HAT   VF+QL   G++QGVH F+
Sbjct  155   DAGEFVIHSPTPSSRKDYIGGAAQHATMAAVFAQLITGGESQGVHCFV  202



>ref|XP_010269210.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal [Nelumbo nucifera]
Length=688

 Score =   129 bits (325),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 128/241 (53%), Gaps = 35/241 (15%)
 Frame = +1

Query  694   IGYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLYGLM--IQSRLF---NPRSRGGKVY  858
             +G  PPE   P      A ++  ++   L   D++ G    IQ R+F   N R       
Sbjct  32    LGRLPPE-ETPLQLLTCARVKLNVNASLLS--DYMRGKHREIQERIFEFFNSR-------  81

Query  859   VWPDFNQSME----QQREITMRRI-AYLSDCGV--FRGWLTEKGPEAELRKLALLDVTTI  1017
               PD    +E    + R++ MR++ A + + G+  F+  L + G     +  A+ +    
Sbjct  82    --PDLQTPVEISKDEHRDLCMRQLLALVREAGIRPFKYVLEDPG-----KYFAIAEAVGS  134

Query  1018  FDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIE  1197
              D SL IK+GV + LWGG++   GTK+H DK+    +N    GCFAMTEL HGSNV+GI+
Sbjct  135   VDMSLGIKMGVQYSLWGGSVLNLGTKKHRDKYYDGIDNLEYPGCFAMTELHHGSNVQGIQ  194

Query  1198  TVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQ------GVHAF  1359
             TV T+D ST EF+INTP + A K+ IG AA H     VF++L +  K+       GVHAF
Sbjct  195   TVATFDPSTDEFIINTPNDGAIKWWIGNAAVHGKFATVFAKLMLPCKDNEGVSDMGVHAF  254

Query  1360  I  1362
             I
Sbjct  255   I  255



>ref|WP_005251993.1| acyl-CoA oxidase [Rhodococcus opacus]
 gb|EHI40654.1| acyl-CoA oxidase [Rhodococcus opacus PD630]
 gb|AHK33409.1| Acyl-coenzyme A oxidase 3, peroxisomal [Rhodococcus opacus PD630]
Length=648

 Score =   129 bits (324),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLSI  1038
             P +   +++ R  T+ ++  L+  G    G+  + G   +    +  +++  + D SL +
Sbjct  35    PHYTPDLDEARAKTLAQLRLLASNGYAADGFAKDHGGTGDAGAAVTSIEMLAMSDLSLMV  94

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K GV + L+GGAI+  GT RHH+ +++   +  + GCFAMTE GHGS+V+ +ET  TYD+
Sbjct  95    KAGVQWGLFGGAIENLGTARHHEAYVKRLVDLDLLGCFAMTETGHGSDVQALETTATYDA  154

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
               GEFVI++P  S++K  IGGAA HAT   VF+QL   G++QGVH F+
Sbjct  155   DAGEFVIHSPTPSSRKDYIGGAAQHATMAAVFAQLITGGESQGVHCFV  202



>ref|WP_034942646.1| acyl-CoA oxidase [Geodermatophilaceae bacterium URHB0062]
Length=681

 Score =   129 bits (324),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLS-DCGVFRGWLTEKGPEAELR-KLALLDVTTIFDHSLSI  1038
             P + ++M++ RE   R    L+  C V  G+  E G E +    L  +++    D S+ +
Sbjct  38    PVYGETMQEARERVTRAAGKLAGSCRVGFGFPKEFGGEDDAGGSLTSIEMLAFGDLSVMV  97

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K GV + L+GGA+Q  GT+R HDK+LRD  ++ + GCFAMTE GHGS+V+ + T  TYD 
Sbjct  98    KAGVQWGLFGGALQLLGTRRQHDKYLRDVMSFDLPGCFAMTETGHGSDVQQLRTTCTYDP  157

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHA  1356
             +T  F ++TP ++A+K  IG AA      VVF+QL   GKNQGVHA
Sbjct  158   ATQCFDLHTPHQAARKDYIGNAAKDGRMAVVFAQLITGGKNQGVHA  203



>ref|WP_028418867.1| acyl-CoA oxidase [Streptomyces sp. SolWspMP-sol2th]
Length=653

 Score =   129 bits (324),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 84/224 (38%), Positives = 119/224 (53%), Gaps = 19/224 (8%)
 Frame = +1

Query  697   GYTPPELSEPAASFDVAEMRKLMDGHNLEERDWLY-GLMIQSRLFNPRSRGGKVYVWPDF  873
             GY  P+L  PA       +  L+DG   E RD +   L+  + +       G        
Sbjct  12    GYVQPQLDVPA-------LTGLLDGEYAEVRDLVRTNLVTYASVLEEAEELG-------I  57

Query  874   NQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAEL-RKLALLDVTTIFDHSLSIKLGV  1050
             +   E+ RE+ +  +A     G+  G+  E G   ++   +A  +     D S+ +K+GV
Sbjct  58    DAFRERVRELVVA-MAATGQTGM--GFPKEYGGGGDVGASIAAFETLAYGDLSVLVKVGV  114

Query  1051  HFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGE  1230
              F L+GGAI   GT+RHHD +L       + GCFAMTE GHGSNV+ + TV  YD++TGE
Sbjct  115   QFGLFGGAILHLGTERHHDAYLPRLITGELMGCFAMTETGHGSNVQALGTVARYDAATGE  174

Query  1231  FVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             FVI T  E A+K  IG AA H    VVF+QL + G ++GVHAF+
Sbjct  175   FVITTEGEQARKDYIGNAARHGELAVVFAQLEVGGTSEGVHAFV  218



>ref|XP_003287521.1| hypothetical protein DICPUDRAFT_97730 [Dictyostelium purpureum]
 gb|EGC35948.1| hypothetical protein DICPUDRAFT_97730 [Dictyostelium purpureum]
Length=690

 Score =   129 bits (324),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 84/201 (42%), Positives = 119/201 (59%), Gaps = 19/201 (9%)
 Frame = +1

Query  772   HNLEERDWLYGLMIQSRLFNPRSRGGKVYVWPDFNQSMEQQREITMRRIAYLSDCGVFRG  951
             HN+  RD L  +M    LF+            D N   E+QR  T++++  ++  G+F  
Sbjct  66    HNI--RDELNRIMSDKSLFHG-----------DVNLGKEEQRVQTLKQLLAIAQ-GIFDK  111

Query  952   WLTEKGP--EAELRKLALLDVTTIFDH-SLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRD  1122
              L +     E   + LA++D+ + FD  SL  KL V+ FL+G A+   GT+RHH K L +
Sbjct  112   GLVQITDLREDPSKILAMMDIVSQFDDDSLMTKLIVNNFLFGAAVFNLGTERHH-KLLPE  170

Query  1123  SENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATH  1302
              ++  + GCFAMTELGHGSNVR +ET  TYD  T EF+INTP  ++ K+ IG A  HAT 
Sbjct  171   IQSGRLLGCFAMTELGHGSNVRSLETTATYDPKTNEFIINTPLRTSTKWWIGNAG-HATI  229

Query  1303  TVVFSQLNIDGKNQGVHAFIA  1365
             + VF++L IDGK+Q VH F+ 
Sbjct  230   SSVFARLIIDGKDQEVHCFLV  250



>ref|WP_026453893.1| acyl-CoA oxidase [Actinopolyspora iraqiensis]
Length=631

 Score =   129 bits (323),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 104/178 (58%), Gaps = 16/178 (9%)
 Frame = +1

Query  850   KVYVWPDFNQSMEQQREITMRRIAYLSDCGVFR-GWLTEKGPEAELRKLALLDVTTIF--  1020
             +V   PD    +E QR  T  R+  L+D G  R G+     P A+     +      F  
Sbjct  33    EVATGPD----LEGQRARTAERMRRLADSGKPRLGF-----PPAQGGGGDVGGAVVSFEM  83

Query  1021  ----DHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVR  1188
                 D SL +K GV + L+GGA+Q  GT+RHH+++L +  +  + GCFAMTE GHGS+V+
Sbjct  84    LGLGDLSLMVKAGVQWGLFGGAVQLLGTERHHERYLGEIMSLDLPGCFAMTETGHGSDVQ  143

Query  1189  GIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
              + T  TYD+  GEFV++TP ESA+K  IG AA      VVF+QL  +G++ GVHAF+
Sbjct  144   NLRTTATYDAEAGEFVVHTPEESARKDYIGNAARDGRMAVVFAQLVTEGRSHGVHAFL  201



>ref|WP_018550940.1| acyl-CoA oxidase [Streptomyces sp. ATexAB-D23]
Length=653

 Score =   129 bits (324),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 81/124 (65%), Gaps = 0/124 (0%)
 Frame = +1

Query  991   LALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELG  1170
             +A  +     D S+ +K+GV F L+GGAI   GT+RHHD +L D     + GCFAMTE G
Sbjct  95    IAAFETLAFGDLSVLVKVGVQFGLFGGAILHLGTRRHHDAYLPDLITGRLMGCFAMTETG  154

Query  1171  HGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGV  1350
             HGSNV+ + TV TYD++  EFVI T  E A K  IG AA HA   VVF+QL + GK +GV
Sbjct  155   HGSNVQALGTVATYDAAAQEFVITTRGEEAGKDYIGNAARHAELAVVFAQLEVGGKGEGV  214

Query  1351  HAFI  1362
             HAF+
Sbjct  215   HAFV  218



>ref|WP_030332097.1| acyl-CoA oxidase [Streptomyces sp. NRRL B-1381]
Length=655

 Score =   129 bits (323),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 83/124 (67%), Gaps = 0/124 (0%)
 Frame = +1

Query  991   LALLDVTTIFDHSLSIKLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELG  1170
             +A  +   + D S+ +K+GV F L+GGAI   GT+RHHD +L D     + GCFAMTE G
Sbjct  95    IAAFETLALGDLSVLVKVGVQFGLFGGAILHLGTERHHDAYLPDLITGKLMGCFAMTETG  154

Query  1171  HGSNVRGIETVTTYDSSTGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGV  1350
             HGSNV+ + TV  YD++  EFVI T  + A+K  IG AA H    VVF+QL IDGK++GV
Sbjct  155   HGSNVQALGTVARYDAAAQEFVITTEGDQARKDYIGNAARHGELAVVFAQLEIDGKSEGV  214

Query  1351  HAFI  1362
             HAF+
Sbjct  215   HAFV  218



>ref|XP_003799352.1| PREDICTED: acyl-coenzyme A oxidase-like protein [Otolemur garnettii]
Length=632

 Score =   129 bits (323),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 105/167 (63%), Gaps = 4/167 (2%)
 Frame = +1

Query  871   FNQSMEQQREITMRRIAYLSDCGVFRGWLTEKGPEAEL---RKLALLDVTTIFDHSLSIK  1041
             ++ S+++ R +T++R+ +     + +  + E+  + +    R L + +V ++ D +  +K
Sbjct  46    YDLSLDEMRALTVQRVNFTMGLPLLKRAVQEQAEKTKNFVGRSLVIGEVLSMADMATGVK  105

Query  1042  LGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSS  1221
              G+ ++L+GGA++  G+ RH  KW +  +     G FAMTE GHGSNVRGI+T  T+D S
Sbjct  106   CGIIYWLFGGAVRNLGSPRHITKWFQPLQEQKYTGMFAMTERGHGSNVRGIQTEATFDRS  165

Query  1222  TGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
               EFVI+TPCE+A+K  IG A  H  +  VF+QL I+G++QG H FI
Sbjct  166   AQEFVIDTPCENAKKMYIGNAM-HGNYAAVFAQLIINGRSQGPHCFI  211



>gb|EAW50357.1| acyl-Coenzyme A oxidase-like, isoform CRA_a, partial [Homo sapiens]
Length=279

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 96/159 (60%), Gaps = 4/159 (3%)
 Frame = +1

Query  895   REITMRRIAYLSDCGVFRGW---LTEKGPEAELRKLALLDVTTIFDHSLSIKLGVHFFLW  1065
             R +T++R+ +  D  + +     L EK      R L + +V ++ D +  +K G+ ++L+
Sbjct  2     RALTVQRVKFAMDLPLLKRAGQDLAEKTKNFVSRSLVIGEVLSMADMATGVKCGIIYWLF  61

Query  1066  GGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDSSTGEFVINT  1245
             GGAI+  G+  H  KW +  +     G FAMTE GHGSN RGI+T  T+D S  EFVI+T
Sbjct  62    GGAIRNLGSPEHVTKWFQPLQEQKYTGMFAMTERGHGSNARGIQTEATFDLSAQEFVIDT  121

Query  1246  PCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             PCE+A+K  IG A  +  +  VF+QL IDG++QG H FI
Sbjct  122   PCENAEKMYIGNAM-YGNYAAVFAQLIIDGRSQGPHCFI  159



>ref|WP_014374170.1| acyl-CoA oxidase [Blastococcus saxobsidens]
 emb|CCG01253.1| Acyl-CoA dehydrogenase [Blastococcus saxobsidens DD2]
Length=679

 Score =   129 bits (323),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 102/168 (61%), Gaps = 2/168 (1%)
 Frame = +1

Query  865   PDFNQSMEQQREITMRRIAYLSDCG-VFRGWLTEKGPEAELR-KLALLDVTTIFDHSLSI  1038
             P + +SM + RE   R    L+  G V  G+  E G EA+    +  +++    D SL +
Sbjct  32    PVYGESMAEARERVTRAARTLAQSGRVGFGFPKEFGGEADAGGSVTSIEMLAFTDLSLMV  91

Query  1039  KLGVHFFLWGGAIQFFGTKRHHDKWLRDSENYLVKGCFAMTELGHGSNVRGIETVTTYDS  1218
             K GV + L+GGA+Q  GT+RHH+ +LRD  ++ + GCFAMTE GHGS+V+ + T  TYD 
Sbjct  92    KAGVQWGLFGGAVQLLGTRRHHETYLRDIMSFDLPGCFAMTETGHGSDVQQLRTTCTYDP  151

Query  1219  STGEFVINTPCESAQKYSIGGAANHATHTVVFSQLNIDGKNQGVHAFI  1362
             +T  F ++TP E+A+K  IG AA      VVF+QL   G N GVHA++
Sbjct  152   ATQTFDLHTPHEAARKDYIGNAAEDGRMAVVFAQLITQGTNHGVHAWL  199



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4048320925756