BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7915

Length=1143
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007018026.1|  BTB/POZ domain-containing protein isoform 2        329   2e-104   
ref|XP_009759339.1|  PREDICTED: BTB/POZ domain-containing protein...    334   5e-103   Nicotiana sylvestris
ref|XP_009631572.1|  PREDICTED: BTB/POZ domain-containing protein...    333   1e-102   Nicotiana tomentosiformis
ref|XP_009631574.1|  PREDICTED: BTB/POZ domain-containing protein...    333   2e-102   
ref|XP_010320455.1|  PREDICTED: BTB/POZ domain-containing protein...    333   2e-102   Solanum lycopersicum
ref|XP_006342129.1|  PREDICTED: BTB/POZ domain-containing protein...    330   2e-101   Solanum tuberosum [potatoes]
ref|XP_009631576.1|  PREDICTED: BTB/POZ domain-containing protein...    329   4e-101   Nicotiana tomentosiformis
ref|XP_006342130.1|  PREDICTED: BTB/POZ domain-containing protein...    328   9e-101   Solanum tuberosum [potatoes]
ref|XP_004238427.1|  PREDICTED: BTB/POZ domain-containing protein...    328   1e-100   Solanum lycopersicum
ref|XP_007018027.1|  BTB/POZ domain-containing protein isoform 3        327   2e-100   
ref|XP_007018025.1|  BTB/POZ domain-containing protein isoform 1        327   2e-100   
gb|EYU36560.1|  hypothetical protein MIMGU_mgv1a001528mg                323   7e-99    Erythranthe guttata [common monkey flower]
ref|XP_006473784.1|  PREDICTED: BTB/POZ domain-containing protein...    322   1e-98    Citrus sinensis [apfelsine]
gb|KHG01113.1|  hypothetical protein F383_22949                         322   2e-98    Gossypium arboreum [tree cotton]
ref|XP_006435355.1|  hypothetical protein CICLE_v10003249mg             322   3e-98    
ref|XP_006473785.1|  PREDICTED: BTB/POZ domain-containing protein...    320   8e-98    Citrus sinensis [apfelsine]
emb|CBI40712.3|  unnamed protein product                                320   1e-97    Vitis vinifera
gb|KDP36794.1|  hypothetical protein JCGZ_08085                         311   2e-97    Jatropha curcas
gb|KJB57964.1|  hypothetical protein B456_009G187700                    319   2e-97    Gossypium raimondii
ref|XP_002270675.1|  PREDICTED: BTB/POZ domain-containing protein...    318   6e-97    Vitis vinifera
ref|XP_010266159.1|  PREDICTED: BTB/POZ domain-containing protein...    317   9e-97    Nelumbo nucifera [Indian lotus]
ref|XP_011074097.1|  PREDICTED: BTB/POZ domain-containing protein...    317   1e-96    Sesamum indicum [beniseed]
emb|CDP07293.1|  unnamed protein product                                316   3e-96    Coffea canephora [robusta coffee]
ref|XP_002307790.1|  BTB/POZ domain-containing family protein           316   3e-96    
ref|XP_010094552.1|  BTB/POZ domain-containing protein                  315   1e-95    Morus notabilis
ref|XP_012073656.1|  PREDICTED: BTB/POZ domain-containing protein...    310   5e-95    Jatropha curcas
ref|XP_006410166.1|  hypothetical protein EUTSA_v10016264mg             312   7e-95    Eutrema salsugineum [saltwater cress]
ref|XP_011041233.1|  PREDICTED: BTB/POZ domain-containing protein...    311   1e-94    Populus euphratica
ref|XP_011013905.1|  PREDICTED: BTB/POZ domain-containing protein...    311   1e-94    Populus euphratica
ref|XP_008221133.1|  PREDICTED: BTB/POZ domain-containing protein...    311   1e-94    Prunus mume [ume]
ref|XP_008781287.1|  PREDICTED: BTB/POZ domain-containing protein...    311   2e-94    
ref|XP_008781284.1|  PREDICTED: BTB/POZ domain-containing protein...    311   2e-94    
ref|XP_012073654.1|  PREDICTED: BTB/POZ domain-containing protein...    310   4e-94    Jatropha curcas
ref|XP_002300643.1|  BTB/POZ domain-containing family protein           310   6e-94    Populus trichocarpa [western balsam poplar]
ref|XP_010556054.1|  PREDICTED: BTB/POZ domain-containing protein...    309   9e-94    Tarenaya hassleriana [spider flower]
ref|XP_011034879.1|  PREDICTED: BTB/POZ domain-containing protein...    309   1e-93    Populus euphratica
ref|XP_011034881.1|  PREDICTED: BTB/POZ domain-containing protein...    309   1e-93    Populus euphratica
ref|XP_007221940.1|  hypothetical protein PRUPE_ppa001540mg             308   2e-93    Prunus persica
ref|XP_004291228.1|  PREDICTED: BTB/POZ domain-containing protein...    307   5e-93    Fragaria vesca subsp. vesca
gb|AAB63077.1|  unknown protein                                         300   4e-92    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH56763.1|  AT2G30600                                              296   4e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008377081.1|  PREDICTED: BTB/POZ domain-containing protein...    304   9e-92    
ref|XP_008377080.1|  PREDICTED: BTB/POZ domain-containing protein...    304   1e-91    Malus domestica [apple tree]
ref|XP_008377082.1|  PREDICTED: BTB/POZ domain-containing protein...    303   1e-91    
ref|XP_004145539.1|  PREDICTED: BTB/POZ domain-containing protein...    303   3e-91    Cucumis sativus [cucumbers]
ref|XP_002510674.1|  protein binding protein, putative                  303   4e-91    Ricinus communis
ref|XP_010469825.1|  PREDICTED: BTB/POZ domain-containing protein...    303   5e-91    Camelina sativa [gold-of-pleasure]
ref|XP_009141084.1|  PREDICTED: BTB/POZ domain-containing protein...    301   1e-90    Brassica rapa
ref|XP_008452951.1|  PREDICTED: BTB/POZ domain-containing protein...    301   1e-90    Cucumis melo [Oriental melon]
ref|XP_009141083.1|  PREDICTED: BTB/POZ domain-containing protein...    301   2e-90    Brassica rapa
gb|KFK23322.1|  hypothetical protein AALP_AAs74635U001200               301   2e-90    Arabis alpina [alpine rockcress]
ref|XP_010469824.1|  PREDICTED: BTB/POZ domain-containing protein...    300   6e-90    Camelina sativa [gold-of-pleasure]
ref|NP_180618.2|  BTB/POZ domain-containing protein                     299   1e-89    Arabidopsis thaliana [mouse-ear cress]
gb|EPS65824.1|  hypothetical protein M569_08953                         298   1e-89    Genlisea aurea
emb|CDY29657.1|  BnaA04g17700D                                          299   2e-89    Brassica napus [oilseed rape]
ref|XP_002879271.1|  BTB/POZ domain-containing protein                  297   4e-89    
ref|NP_001189642.1|  BTB/POZ domain-containing protein                  298   4e-89    Arabidopsis thaliana [mouse-ear cress]
dbj|BAD93995.1|  hypothetical protein                                   297   5e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469826.1|  PREDICTED: BTB/POZ domain-containing protein...    297   6e-89    Camelina sativa [gold-of-pleasure]
ref|XP_010510327.1|  PREDICTED: BTB/POZ domain-containing protein...    296   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010692549.1|  PREDICTED: BTB/POZ domain-containing protein...    295   2e-88    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010935266.1|  PREDICTED: BTB/POZ domain-containing protein...    295   2e-88    
ref|XP_010414240.1|  PREDICTED: BTB/POZ domain-containing protein...    295   3e-88    
ref|XP_006293695.1|  hypothetical protein CARUB_v10022653mg             295   3e-88    Capsella rubella
emb|CDX97805.1|  BnaC04g41340D                                          295   3e-88    
ref|XP_010061166.1|  PREDICTED: BTB/POZ domain-containing protein...    288   1e-85    Eucalyptus grandis [rose gum]
ref|XP_010061165.1|  PREDICTED: BTB/POZ domain-containing protein...    287   4e-85    Eucalyptus grandis [rose gum]
ref|XP_006596518.1|  PREDICTED: BTB/POZ domain-containing protein...    279   4e-83    
ref|XP_003545003.1|  PREDICTED: BTB/POZ domain-containing protein...    278   5e-82    Glycine max [soybeans]
ref|XP_006596517.1|  PREDICTED: BTB/POZ domain-containing protein...    278   6e-82    
gb|KEH28127.1|  BTB/POZ domain plant protein                            273   2e-81    Medicago truncatula
ref|XP_009418296.1|  PREDICTED: BTB/POZ domain-containing protein...    276   2e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007160598.1|  hypothetical protein PHAVU_001G001100g             276   4e-81    Phaseolus vulgaris [French bean]
gb|AES98295.2|  BTB/POZ domain plant protein                            270   5e-79    Medicago truncatula
ref|XP_003615337.1|  Kelch-like protein                                 270   2e-78    
gb|ERM96145.1|  hypothetical protein AMTR_s00001p00041750               264   2e-76    Amborella trichopoda
ref|XP_004512608.1|  PREDICTED: BTB/POZ domain-containing protein...    263   2e-76    Cicer arietinum [garbanzo]
ref|XP_011628891.1|  PREDICTED: BTB/POZ domain-containing protein...    263   2e-76    Amborella trichopoda
ref|XP_004512607.1|  PREDICTED: BTB/POZ domain-containing protein...    264   2e-76    Cicer arietinum [garbanzo]
dbj|BAK07994.1|  predicted protein                                      252   5e-75    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC79014.1|  hypothetical protein OsI_19541                          257   5e-74    Oryza sativa Indica Group [Indian rice]
gb|AAV43802.1|  unknown protein                                         255   2e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006664953.1|  PREDICTED: BTB/POZ domain-containing protein...    253   1e-72    Oryza brachyantha
ref|XP_003561246.1|  PREDICTED: BTB/POZ domain-containing protein...    252   4e-72    Brachypodium distachyon [annual false brome]
emb|CDM85346.1|  unnamed protein product                                249   5e-71    Triticum aestivum [Canadian hard winter wheat]
ref|XP_002437659.1|  hypothetical protein SORBIDRAFT_10g000240          246   5e-70    Sorghum bicolor [broomcorn]
ref|XP_004964253.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    243   8e-69    
gb|EEE63337.1|  hypothetical protein OsJ_18148                          212   4e-58    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001751401.1|  predicted protein                                  180   7e-47    
ref|XP_002965955.1|  hypothetical protein SELMODRAFT_84039              175   5e-45    
ref|XP_002962812.1|  hypothetical protein SELMODRAFT_438140             175   6e-45    
ref|XP_005845262.1|  hypothetical protein CHLNCDRAFT_58586              109   2e-22    Chlorella variabilis
gb|KDD75170.1|  hypothetical protein H632_c829p0                      99.8    2e-20    Helicosporidium sp. ATCC 50920
gb|KIY99757.1|  hypothetical protein MNEG_8204                        87.8    2e-15    Monoraphidium neglectum
ref|XP_005708288.1|  ubiquitin-protein ligase isoform 1               64.3    9e-08    Galdieria sulphuraria
ref|XP_005708289.1|  ubiquitin-protein ligase isoform 2               64.3    1e-07    Galdieria sulphuraria
ref|XP_002500926.1|  predicted protein                                61.6    2e-07    Micromonas commoda
ref|XP_005708947.1|  ubiquitin-protein ligase                         61.6    8e-07    Galdieria sulphuraria
ref|XP_006014397.1|  PREDICTED: C3 and PZP-like alpha-2-macroglob...  52.0    1e-04    Latimeria chalumnae



>ref|XP_007018026.1| BTB/POZ domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOY15251.1| BTB/POZ domain-containing protein isoform 2 [Theobroma cacao]
Length=495

 Score =   329 bits (843),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 166/190 (87%), Gaps = 5/190 (3%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             ME K KKFLTVAPFECAWR DL+FREAGRGCVAFDAFAHNDVTVVFRE+VGSQHYHYKRD
Sbjct  1     MEKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKRD  60

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +SPHYTVIIGSHRNRRLKIEVDG+TVVD A V LCCSS FQSYWI IYDGLISIGKGRYP
Sbjct  61    NSPHYTVIIGSHRNRRLKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYDGLISIGKGRYP  120

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD---YVGCDS  1104
             FQNL  QW DS PNCSVQYVGLSSWDKHVGYRNVNVLP+ QNH+ LWKQVD   Y G D 
Sbjct  121   FQNLVFQWLDSNPNCSVQYVGLSSWDKHVGYRNVNVLPLMQNHLLLWKQVDCGEYNGED-  179

Query  1105  EDANTELEDR  1134
              D + ELE+ 
Sbjct  180   -DGDEELENE  188



>ref|XP_009759339.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nicotiana 
sylvestris]
Length=810

 Score =   334 bits (856),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 168/195 (86%), Gaps = 2/195 (1%)
 Frame = +1

Query  565   GETMEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHY  744
             GE M+ K KKFLTVAPFECAW +DLRFREAGRGCVAFDAFAHNDVT+VFRE VGSQHYHY
Sbjct  19    GEMMDKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFAHNDVTIVFREQVGSQHYHY  78

Query  745   KRDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKG  924
             KRD+ PHYTVIIGSHRN+R KIEVDG+TVVD A V LCCSS FQSYWI IYDGLISIGKG
Sbjct  79    KRDNCPHYTVIIGSHRNKRFKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYDGLISIGKG  138

Query  925   RYPFQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCD-  1101
             RYPFQNLC QW DS PNCSVQYVGLSSWDKHVGYRNVNVLP+T NH+SLWK VDYV  D 
Sbjct  139   RYPFQNLCFQWLDSNPNCSVQYVGLSSWDKHVGYRNVNVLPVTPNHLSLWKHVDYVEHDL  198

Query  1102  -SEDANTELEDRAGD  1143
               +D   ELED+  +
Sbjct  199   GEDDLEQELEDQIAN  213



>ref|XP_009631572.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Nicotiana tomentosiformis]
Length=826

 Score =   333 bits (854),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 167/195 (86%), Gaps = 2/195 (1%)
 Frame = +1

Query  565   GETMEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHY  744
             GE +E K KKFLTVAPFECAW +DLRFREAGRGCVAFDAFAHNDVTVVFRE VGSQHYHY
Sbjct  21    GEMLEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFAHNDVTVVFREQVGSQHYHY  80

Query  745   KRDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKG  924
             KRD+ PHYTVIIGSHRN+R KIEVDG+TVVD A V LCCSS FQSYWI IYDGLISIGKG
Sbjct  81    KRDNCPHYTVIIGSHRNKRFKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYDGLISIGKG  140

Query  925   RYPFQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCD-  1101
             RYPFQNLC QW DS PNC+VQYVGLSSWDKHVGYRNVNVLP+T NH+SLWK VDYV  D 
Sbjct  141   RYPFQNLCFQWLDSNPNCTVQYVGLSSWDKHVGYRNVNVLPVTPNHLSLWKHVDYVEHDL  200

Query  1102  -SEDANTELEDRAGD  1143
               +D   ELED   +
Sbjct  201   GEDDLEQELEDEIAN  215



>ref|XP_009631574.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009631575.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Nicotiana tomentosiformis]
Length=824

 Score =   333 bits (853),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 167/195 (86%), Gaps = 2/195 (1%)
 Frame = +1

Query  565   GETMEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHY  744
             GE +E K KKFLTVAPFECAW +DLRFREAGRGCVAFDAFAHNDVTVVFRE VGSQHYHY
Sbjct  19    GEMLEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFAHNDVTVVFREQVGSQHYHY  78

Query  745   KRDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKG  924
             KRD+ PHYTVIIGSHRN+R KIEVDG+TVVD A V LCCSS FQSYWI IYDGLISIGKG
Sbjct  79    KRDNCPHYTVIIGSHRNKRFKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYDGLISIGKG  138

Query  925   RYPFQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCD-  1101
             RYPFQNLC QW DS PNC+VQYVGLSSWDKHVGYRNVNVLP+T NH+SLWK VDYV  D 
Sbjct  139   RYPFQNLCFQWLDSNPNCTVQYVGLSSWDKHVGYRNVNVLPVTPNHLSLWKHVDYVEHDL  198

Query  1102  -SEDANTELEDRAGD  1143
               +D   ELED   +
Sbjct  199   GEDDLEQELEDEIAN  213



>ref|XP_010320455.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Solanum lycopersicum]
Length=824

 Score =   333 bits (853),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 167/192 (87%), Gaps = 2/192 (1%)
 Frame = +1

Query  562   EGETMEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYH  741
             +GE ME K KKFLTVAPFECAW +DLRFREAGRGCVAFDAFAHNDVTVVFRE VGSQHYH
Sbjct  18    QGEMMEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFAHNDVTVVFREQVGSQHYH  77

Query  742   YKRDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGK  921
             YKRD+ PHYTVIIGSHRN+RLKIEVDG+TVVD A V LCCSS FQSYWI IYDGLISIGK
Sbjct  78    YKRDNCPHYTVIIGSHRNKRLKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYDGLISIGK  137

Query  922   GRYPFQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCD  1101
             GRYPFQNLC QW DS PNC+VQY+GLSSWDKHVGYRNVNVLP T NH+SLWK VD+V  D
Sbjct  138   GRYPFQNLCFQWLDSNPNCTVQYIGLSSWDKHVGYRNVNVLPATPNHLSLWKHVDFVEHD  197

Query  1102  --SEDANTELED  1131
                +D   ELED
Sbjct  198   FGEDDLEQELED  209



>ref|XP_006342129.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Solanum tuberosum]
Length=824

 Score =   330 bits (846),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 165/190 (87%), Gaps = 2/190 (1%)
 Frame = +1

Query  568   ETMEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYK  747
             E ME K KKFLTVAPFECAW +DLRFREAGRGCVAFDAFAHNDVTVVFRE VGSQHYHYK
Sbjct  20    EMMEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFAHNDVTVVFREQVGSQHYHYK  79

Query  748   RDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGR  927
             RD+ PHYTVIIGSHRN+RLKIEVDG+TVVD A V LCCSS FQSYWI IYDGLISIGKGR
Sbjct  80    RDNCPHYTVIIGSHRNKRLKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYDGLISIGKGR  139

Query  928   YPFQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCD--  1101
             YPFQNLC QW DS PNC+VQY+GLSSWDKHVGYRNVNVLP T NH+SLWK VD+V  D  
Sbjct  140   YPFQNLCFQWLDSNPNCTVQYIGLSSWDKHVGYRNVNVLPATPNHLSLWKHVDFVEHDFG  199

Query  1102  SEDANTELED  1131
              +D   ELED
Sbjct  200   EDDLEQELED  209



>ref|XP_009631576.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X3 [Nicotiana tomentosiformis]
Length=804

 Score =   329 bits (843),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 165/192 (86%), Gaps = 2/192 (1%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             +E K KKFLTVAPFECAW +DLRFREAGRGCVAFDAFAHNDVTVVFRE VGSQHYHYKRD
Sbjct  2     LEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFAHNDVTVVFREQVGSQHYHYKRD  61

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             + PHYTVIIGSHRN+R KIEVDG+TVVD A V LCCSS FQSYWI IYDGLISIGKGRYP
Sbjct  62    NCPHYTVIIGSHRNKRFKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYDGLISIGKGRYP  121

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCD--SE  1107
             FQNLC QW DS PNC+VQYVGLSSWDKHVGYRNVNVLP+T NH+SLWK VDYV  D   +
Sbjct  122   FQNLCFQWLDSNPNCTVQYVGLSSWDKHVGYRNVNVLPVTPNHLSLWKHVDYVEHDLGED  181

Query  1108  DANTELEDRAGD  1143
             D   ELED   +
Sbjct  182   DLEQELEDEIAN  193



>ref|XP_006342130.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006342131.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Solanum tuberosum]
Length=804

 Score =   328 bits (840),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 164/188 (87%), Gaps = 2/188 (1%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             ME K KKFLTVAPFECAW +DLRFREAGRGCVAFDAFAHNDVTVVFRE VGSQHYHYKRD
Sbjct  2     MEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFAHNDVTVVFREQVGSQHYHYKRD  61

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             + PHYTVIIGSHRN+RLKIEVDG+TVVD A V LCCSS FQSYWI IYDGLISIGKGRYP
Sbjct  62    NCPHYTVIIGSHRNKRLKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYDGLISIGKGRYP  121

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCD--SE  1107
             FQNLC QW DS PNC+VQY+GLSSWDKHVGYRNVNVLP T NH+SLWK VD+V  D   +
Sbjct  122   FQNLCFQWLDSNPNCTVQYIGLSSWDKHVGYRNVNVLPATPNHLSLWKHVDFVEHDFGED  181

Query  1108  DANTELED  1131
             D   ELED
Sbjct  182   DLEQELED  189



>ref|XP_004238427.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010320456.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Solanum lycopersicum]
Length=804

 Score =   328 bits (840),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 164/188 (87%), Gaps = 2/188 (1%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             ME K KKFLTVAPFECAW +DLRFREAGRGCVAFDAFAHNDVTVVFRE VGSQHYHYKRD
Sbjct  2     MEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFAHNDVTVVFREQVGSQHYHYKRD  61

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             + PHYTVIIGSHRN+RLKIEVDG+TVVD A V LCCSS FQSYWI IYDGLISIGKGRYP
Sbjct  62    NCPHYTVIIGSHRNKRLKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYDGLISIGKGRYP  121

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCD--SE  1107
             FQNLC QW DS PNC+VQY+GLSSWDKHVGYRNVNVLP T NH+SLWK VD+V  D   +
Sbjct  122   FQNLCFQWLDSNPNCTVQYIGLSSWDKHVGYRNVNVLPATPNHLSLWKHVDFVEHDFGED  181

Query  1108  DANTELED  1131
             D   ELED
Sbjct  182   DLEQELED  189



>ref|XP_007018027.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY15252.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
Length=789

 Score =   327 bits (838),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 166/190 (87%), Gaps = 5/190 (3%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             ME K KKFLTVAPFECAWR DL+FREAGRGCVAFDAFAHNDVTVVFRE+VGSQHYHYKRD
Sbjct  1     MEKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKRD  60

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +SPHYTVIIGSHRNRRLKIEVDG+TVVD A V LCCSS FQSYWI IYDGLISIGKGRYP
Sbjct  61    NSPHYTVIIGSHRNRRLKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYDGLISIGKGRYP  120

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD---YVGCDS  1104
             FQNL  QW DS PNCSVQYVGLSSWDKHVGYRNVNVLP+ QNH+ LWKQVD   Y G D 
Sbjct  121   FQNLVFQWLDSNPNCSVQYVGLSSWDKHVGYRNVNVLPLMQNHLLLWKQVDCGEYNGED-  179

Query  1105  EDANTELEDR  1134
              D + ELE+ 
Sbjct  180   -DGDEELENE  188



>ref|XP_007018025.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY15250.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
Length=805

 Score =   327 bits (838),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 166/190 (87%), Gaps = 5/190 (3%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             ME K KKFLTVAPFECAWR DL+FREAGRGCVAFDAFAHNDVTVVFRE+VGSQHYHYKRD
Sbjct  1     MEKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKRD  60

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +SPHYTVIIGSHRNRRLKIEVDG+TVVD A V LCCSS FQSYWI IYDGLISIGKGRYP
Sbjct  61    NSPHYTVIIGSHRNRRLKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYDGLISIGKGRYP  120

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD---YVGCDS  1104
             FQNL  QW DS PNCSVQYVGLSSWDKHVGYRNVNVLP+ QNH+ LWKQVD   Y G D 
Sbjct  121   FQNLVFQWLDSNPNCSVQYVGLSSWDKHVGYRNVNVLPLMQNHLLLWKQVDCGEYNGED-  179

Query  1105  EDANTELEDR  1134
              D + ELE+ 
Sbjct  180   -DGDEELENE  188



>gb|EYU36560.1| hypothetical protein MIMGU_mgv1a001528mg [Erythranthe guttata]
Length=802

 Score =   323 bits (828),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             ME K KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFRE  GSQHYHYKRD
Sbjct  1     MEKKQKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREKTGSQHYHYKRD  60

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +SPHYTVIIGSHRN+RL IEVDG+TVVDV  VDL CSSTFQSYWI IYDGLISIGKGRYP
Sbjct  61    NSPHYTVIIGSHRNKRLNIEVDGKTVVDVTGVDLYCSSTFQSYWISIYDGLISIGKGRYP  120

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             FQNL  QW DS PNCSVQYVGLSSWD+HVGYRN+NVLP+TQNH+SLWK +D
Sbjct  121   FQNLVFQWLDSNPNCSVQYVGLSSWDRHVGYRNINVLPLTQNHVSLWKHID  171



>ref|XP_006473784.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Citrus sinensis]
Length=817

 Score =   322 bits (826),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 170/198 (86%), Gaps = 9/198 (5%)
 Frame = +1

Query  565   GETMEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHY  744
             G+  E K KKFLTVAPFECAWR DL+FREAGRGCVAF+AFAHNDVTVVFRE+VGSQHYHY
Sbjct  10    GKMAEKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFEAFAHNDVTVVFRENVGSQHYHY  69

Query  745   KRDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKG  924
             KRD+SPHYTVIIGS+RNRRLKIEV+G+TVVDVA V LCCSS FQSYWI IYDGLISIGKG
Sbjct  70    KRDNSPHYTVIIGSNRNRRLKIEVNGKTVVDVAGVGLCCSSAFQSYWISIYDGLISIGKG  129

Query  925   RYPFQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCDS  1104
             RYPFQNL  QW DS PNCSV+YVGLSSWDKHVGYRNVNVLP+TQNHI LWK VD   CD 
Sbjct  130   RYPFQNLVFQWLDSSPNCSVRYVGLSSWDKHVGYRNVNVLPLTQNHIMLWKHVD---CDK  186

Query  1105  ----EDANTEL--EDRAG  1140
                 ED + E+  ++R G
Sbjct  187   YEEEEDGDVEMMIDERTG  204



>gb|KHG01113.1| hypothetical protein F383_22949 [Gossypium arboreum]
Length=802

 Score =   322 bits (824),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 165/189 (87%), Gaps = 6/189 (3%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             ME K KKFLTVAPFECAW  DL+FREAGRGCV+FDAFAHNDVTVVFRE+VGSQHYHYKRD
Sbjct  1     METKEKKFLTVAPFECAWIKDLKFREAGRGCVSFDAFAHNDVTVVFRENVGSQHYHYKRD  60

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +SPHYTVIIGSHRN RLKIEVDG+TVVDV  + LCCSS FQSYWI IYDGLISIGKGRYP
Sbjct  61    NSPHYTVIIGSHRNSRLKIEVDGKTVVDVVGIGLCCSSAFQSYWISIYDGLISIGKGRYP  120

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQV--DYVGCDSE  1107
             FQNL  +W D+ PNCSVQYVGLSSWDKHVGYRNVNVLP+TQNH+SLWKQV  +Y G    
Sbjct  121   FQNLVFEWLDTNPNCSVQYVGLSSWDKHVGYRNVNVLPLTQNHLSLWKQVNSEYNG----  176

Query  1108  DANTELEDR  1134
             D + ELED 
Sbjct  177   DGDEELEDE  185



>ref|XP_006435355.1| hypothetical protein CICLE_v10003249mg [Citrus clementina]
 gb|ESR48595.1| hypothetical protein CICLE_v10003249mg [Citrus clementina]
Length=818

 Score =   322 bits (824),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 168/194 (87%), Gaps = 9/194 (5%)
 Frame = +1

Query  577   EIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDD  756
             E K KKFLTVAPFECAWR DL+FREAGRGCVAF+AFAHNDVTVVFRE+VGSQHYHYKRD+
Sbjct  3     EKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFEAFAHNDVTVVFRENVGSQHYHYKRDN  62

Query  757   SPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPF  936
             SPHYTVIIGS+RNRRLKIEVDG+TVVDVA V LCCSS FQSYWI IYDGLISIGKGRYPF
Sbjct  63    SPHYTVIIGSNRNRRLKIEVDGKTVVDVAGVGLCCSSAFQSYWISIYDGLISIGKGRYPF  122

Query  937   QNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCDS----  1104
             QNL  QW DS PNCSV+YVGLSSWDKHVGYRNVNVLP+TQNHI LWK VD   CD     
Sbjct  123   QNLVFQWLDSSPNCSVRYVGLSSWDKHVGYRNVNVLPLTQNHIMLWKHVD---CDKYEEE  179

Query  1105  EDANTEL--EDRAG  1140
             ED + E+  ++R G
Sbjct  180   EDGDVEMMIDERTG  193



>ref|XP_006473785.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Citrus sinensis]
 ref|XP_006473786.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Citrus sinensis]
 gb|KDO85089.1| hypothetical protein CISIN_1g040529mg [Citrus sinensis]
Length=806

 Score =   320 bits (820),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 168/194 (87%), Gaps = 9/194 (5%)
 Frame = +1

Query  577   EIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDD  756
             E K KKFLTVAPFECAWR DL+FREAGRGCVAF+AFAHNDVTVVFRE+VGSQHYHYKRD+
Sbjct  3     EKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFEAFAHNDVTVVFRENVGSQHYHYKRDN  62

Query  757   SPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPF  936
             SPHYTVIIGS+RNRRLKIEV+G+TVVDVA V LCCSS FQSYWI IYDGLISIGKGRYPF
Sbjct  63    SPHYTVIIGSNRNRRLKIEVNGKTVVDVAGVGLCCSSAFQSYWISIYDGLISIGKGRYPF  122

Query  937   QNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCDS----  1104
             QNL  QW DS PNCSV+YVGLSSWDKHVGYRNVNVLP+TQNHI LWK VD   CD     
Sbjct  123   QNLVFQWLDSSPNCSVRYVGLSSWDKHVGYRNVNVLPLTQNHIMLWKHVD---CDKYEEE  179

Query  1105  EDANTEL--EDRAG  1140
             ED + E+  ++R G
Sbjct  180   EDGDVEMMIDERTG  193



>emb|CBI40712.3| unnamed protein product [Vitis vinifera]
Length=789

 Score =   320 bits (819),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             +E K KKFLTVAPFECAWR DLRFREAGRGCVAF+AFAHNDVT+VFRE VGSQHYHYKRD
Sbjct  2     IEKKQKKFLTVAPFECAWRKDLRFREAGRGCVAFEAFAHNDVTLVFRESVGSQHYHYKRD  61

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +SPHYTVI+GSHRNRRLKIEVDG+TVVDVA + LCCSS FQSYWI IYDGLISIGKGRYP
Sbjct  62    NSPHYTVILGSHRNRRLKIEVDGKTVVDVAGIGLCCSSAFQSYWISIYDGLISIGKGRYP  121

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCDSEDA  1113
             FQNL  QW DS PNCSVQYVGLSSWDKHVGYRNVNVLP+T NHISLW+  +YV  +    
Sbjct  122   FQNLVFQWLDSNPNCSVQYVGLSSWDKHVGYRNVNVLPLTHNHISLWQHDEYVSYEKWGL  181

Query  1114  NTELE  1128
                LE
Sbjct  182   ENFLE  186



>gb|KDP36794.1| hypothetical protein JCGZ_08085 [Jatropha curcas]
Length=506

 Score =   311 bits (797),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K KKFLTVAPF+CAWR DL+FREAGRGCVAFDAFAHNDVT+VFRE+VGSQHYHYKRD+SP
Sbjct  5     KEKKFLTVAPFQCAWRKDLKFREAGRGCVAFDAFAHNDVTIVFRENVGSQHYHYKRDNSP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQN  942
             HYTVI+GSHRNRRLKIEVDG+TVVD   + LCCSS FQSYWI +YDGLISIGKGRYPFQN
Sbjct  65    HYTVILGSHRNRRLKIEVDGKTVVDAEGIGLCCSSAFQSYWICLYDGLISIGKGRYPFQN  124

Query  943   LCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCDSEDANTE  1122
             L  QW DS PNCSV+YVGLSSWDKHVGYRNVNVLP+  NH+ LWKQVD    + +D   E
Sbjct  125   LVFQWLDSSPNCSVRYVGLSSWDKHVGYRNVNVLPLPHNHVLLWKQVDSGEYEDKDDGGE  184

Query  1123  LED  1131
               D
Sbjct  185   YLD  187



>gb|KJB57964.1| hypothetical protein B456_009G187700 [Gossypium raimondii]
 gb|KJB57965.1| hypothetical protein B456_009G187700 [Gossypium raimondii]
Length=802

 Score =   319 bits (818),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 164/189 (87%), Gaps = 6/189 (3%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             ME K KKFLTVAPFECAW  DL+FREAGRGCV+FDAFAHNDVTVVFRE+VGSQHYHYKRD
Sbjct  1     METKEKKFLTVAPFECAWIKDLKFREAGRGCVSFDAFAHNDVTVVFRENVGSQHYHYKRD  60

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +SPHYTVIIGSHRN RLKIEVDG+TVVDV  + LCCSS FQSYWI IYDGLISIGKGRYP
Sbjct  61    NSPHYTVIIGSHRNSRLKIEVDGKTVVDVVGIGLCCSSAFQSYWISIYDGLISIGKGRYP  120

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQV--DYVGCDSE  1107
             FQNL  +W D+ PNCSVQYVGLSSWDKHVGYRNVNVLP+TQNH+SLWKQV  +Y G    
Sbjct  121   FQNLVFEWLDTNPNCSVQYVGLSSWDKHVGYRNVNVLPLTQNHLSLWKQVNSEYNG----  176

Query  1108  DANTELEDR  1134
             D + EL D 
Sbjct  177   DGDEELGDE  185



>ref|XP_002270675.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Vitis 
vinifera]
Length=806

 Score =   318 bits (815),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             +E K KKFLTVAPFECAWR DLRFREAGRGCVAF+AFAHNDVT+VFRE VGSQHYHYKRD
Sbjct  2     IEKKQKKFLTVAPFECAWRKDLRFREAGRGCVAFEAFAHNDVTLVFRESVGSQHYHYKRD  61

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +SPHYTVI+GSHRNRRLKIEVDG+TVVDVA + LCCSS FQSYWI IYDGLISIGKGRYP
Sbjct  62    NSPHYTVILGSHRNRRLKIEVDGKTVVDVAGIGLCCSSAFQSYWISIYDGLISIGKGRYP  121

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQV  1083
             FQNL  QW DS PNCSVQYVGLSSWDKHVGYRNVNVLP+T NHISLW+ V
Sbjct  122   FQNLVFQWLDSNPNCSVQYVGLSSWDKHVGYRNVNVLPLTHNHISLWQHV  171



>ref|XP_010266159.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266161.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266162.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266163.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
Length=806

 Score =   317 bits (813),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 162/187 (87%), Gaps = 1/187 (1%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K KKFLTVAPFECAWR +LRFR AGRGCVAF+AFAHNDVTVVFREHVGSQHYHYK D+SP
Sbjct  5     KQKKFLTVAPFECAWRKELRFRVAGRGCVAFEAFAHNDVTVVFREHVGSQHYHYKTDNSP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQN  942
             +YTV++GSHRNRRLKIEVDG+TVVDVA V LCCSS F+SYWI IYDGLISIGKG +PFQN
Sbjct  65    NYTVVLGSHRNRRLKIEVDGKTVVDVAGVGLCCSSAFRSYWISIYDGLISIGKGPFPFQN  124

Query  943   LCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDY-VGCDSEDANT  1119
                QW DS PNC VQYVGLSSWDKHVGYRNVNVLP+TQNHISLWKQ+DY  G   ED   
Sbjct  125   PVFQWLDSNPNCKVQYVGLSSWDKHVGYRNVNVLPLTQNHISLWKQLDYDEGEGEEDNQE  184

Query  1120  ELEDRAG  1140
             ELED  G
Sbjct  185   ELEDGYG  191



>ref|XP_011074097.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Sesamum 
indicum]
Length=804

 Score =   317 bits (813),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             ME K KKFLTVAPF+CAW DDLRFREAGRGCVAFDAFAHNDVTVVFRE+ GSQHYHYKRD
Sbjct  1     MEKKQKKFLTVAPFQCAWHDDLRFREAGRGCVAFDAFAHNDVTVVFRENAGSQHYHYKRD  60

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +SPHYTVIIGSHRN+RL IEV+G+TVVDVA VDL CSSTFQSYWI IYDGLISIGKGRYP
Sbjct  61    NSPHYTVIIGSHRNKRLNIEVNGKTVVDVAGVDLYCSSTFQSYWISIYDGLISIGKGRYP  120

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             FQNL  QW DS PN SVQYVGLSSWD+HVGYRN+NVLP+TQNHISLWK VD
Sbjct  121   FQNLVFQWLDSNPNRSVQYVGLSSWDRHVGYRNINVLPLTQNHISLWKHVD  171



>emb|CDP07293.1| unnamed protein product [Coffea canephora]
Length=802

 Score =   316 bits (810),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 167/191 (87%), Gaps = 1/191 (1%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             +E K KKFLTVAPFECAW DDL+FREAGRGCVAFDAFAHNDVT+VFREHVGSQ  HYKRD
Sbjct  2     IEKKQKKFLTVAPFECAWCDDLKFREAGRGCVAFDAFAHNDVTIVFREHVGSQQCHYKRD  61

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             ++PHYTVIIGSH+N+RLKIEVDG TVVDVA + LCCSS FQSYWI +YDGLISIGKGRYP
Sbjct  62    NNPHYTVIIGSHKNKRLKIEVDGETVVDVAGIGLCCSSAFQSYWISVYDGLISIGKGRYP  121

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCDS-ED  1110
             FQN+C QW DSKPNC+VQYVGLSSWDKHVGYRNVNVLP+TQNH++LW+ V+    D  ++
Sbjct  122   FQNICFQWLDSKPNCAVQYVGLSSWDKHVGYRNVNVLPLTQNHLTLWRHVESDERDKCDN  181

Query  1111  ANTELEDRAGD  1143
             +  ELE+   D
Sbjct  182   SEEELENEIAD  192



>ref|XP_002307790.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE94786.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=806

 Score =   316 bits (810),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 163/188 (87%), Gaps = 5/188 (3%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             +E K KKFLTVAPF+CAWR DL+FREAGRGCVAFDAFAHNDVTVVFRE+VGSQHYHYKRD
Sbjct  2     IEEKEKKFLTVAPFQCAWRKDLKFREAGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKRD  61

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +SPHYTVI+GSHRNRRLKIEVDG+TVVD   V LCCSS FQSYWI IYDGLIS+GKGRYP
Sbjct  62    NSPHYTVILGSHRNRRLKIEVDGKTVVDEEGVALCCSSMFQSYWISIYDGLISVGKGRYP  121

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD---YVGCDS  1104
             FQNL  QW DS PNCSV+YVGLSSWDKHVGYRNVNVLP+ +NH+ LWKQVD   Y G D 
Sbjct  122   FQNLVFQWLDSNPNCSVRYVGLSSWDKHVGYRNVNVLPLPKNHMLLWKQVDSGEYEGTD-  180

Query  1105  EDANTELE  1128
              D   ELE
Sbjct  181   -DGEEELE  187



>ref|XP_010094552.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB56306.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=810

 Score =   315 bits (806),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             ME K K+FLTVAPFECAWR DL+FREAGRGCVAF+AFAHNDVT+VFRE+VGSQHYHYKRD
Sbjct  2     MEKKEKEFLTVAPFECAWRKDLKFREAGRGCVAFEAFAHNDVTLVFRENVGSQHYHYKRD  61

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             ++PHYTVI+GSHRNRRL+IEVDG+TVVDV  V LCCSS+FQSYWI IYDGLI IGKGRYP
Sbjct  62    NTPHYTVILGSHRNRRLRIEVDGKTVVDVEGVGLCCSSSFQSYWISIYDGLICIGKGRYP  121

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             FQN+  QW DS PNCSV+YVGLSSWDKHVGYRNVNVLP+ QNH+SLWK VD
Sbjct  122   FQNIVFQWLDSNPNCSVRYVGLSSWDKHVGYRNVNVLPVIQNHLSLWKHVD  172



>ref|XP_012073656.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Jatropha curcas]
Length=694

 Score =   310 bits (794),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K KKFLTVAPF+CAWR DL+FREAGRGCVAFDAFAHNDVT+VFRE+VGSQHYHYKRD+SP
Sbjct  5     KEKKFLTVAPFQCAWRKDLKFREAGRGCVAFDAFAHNDVTIVFRENVGSQHYHYKRDNSP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQN  942
             HYTVI+GSHRNRRLKIEVDG+TVVD   + LCCSS FQSYWI +YDGLISIGKGRYPFQN
Sbjct  65    HYTVILGSHRNRRLKIEVDGKTVVDAEGIGLCCSSAFQSYWICLYDGLISIGKGRYPFQN  124

Query  943   LCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCDSEDANTE  1122
             L  QW DS PNCSV+YVGLSSWDKHVGYRNVNVLP+  NH+ LWKQVD    + +D   E
Sbjct  125   LVFQWLDSSPNCSVRYVGLSSWDKHVGYRNVNVLPLPHNHVLLWKQVDSGEYEDKDDGGE  184

Query  1123  LED  1131
               D
Sbjct  185   YLD  187



>ref|XP_006410166.1| hypothetical protein EUTSA_v10016264mg [Eutrema salsugineum]
 gb|ESQ51619.1| hypothetical protein EUTSA_v10016264mg [Eutrema salsugineum]
Length=806

 Score =   312 bits (800),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +1

Query  580   IKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDS  759
             +K KKFLTVAPFECAW DDL+FREAGRGCVAFDAFAHNDVTVVFRE+VGSQHYHYK+D+S
Sbjct  4     LKEKKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKKDNS  63

Query  760   PHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQ  939
             PHY VIIGS+RNRRLKI+VDG++VVD  + DLCCS  F+SYWI IYDGLISIGKGRYPFQ
Sbjct  64    PHYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCCSLEFESYWISIYDGLISIGKGRYPFQ  123

Query  940   NLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCDSEDANT  1119
             NL  QW DSKPNCSVQYVGLSSWDKHVGYRNV+V P+T NHISLWKQVD      E+ + 
Sbjct  124   NLVFQWQDSKPNCSVQYVGLSSWDKHVGYRNVSVFPVTHNHISLWKQVDCREVKGEEPDD  183

Query  1120  E  1122
             E
Sbjct  184   E  184



>ref|XP_011041233.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
 ref|XP_011041234.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
Length=806

 Score =   311 bits (798),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 162/188 (86%), Gaps = 5/188 (3%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             +E K KKFLTVAPF+CAWR DL+FREAGRGCVAFDAFA NDVTVVFRE+VGSQHYHYKRD
Sbjct  2     IEEKEKKFLTVAPFQCAWRKDLKFREAGRGCVAFDAFACNDVTVVFRENVGSQHYHYKRD  61

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +SPHYTVI+GSHRNRRLKIEVDG+TVVD   V LCCSS FQSYWI IYDGLIS+GKGRYP
Sbjct  62    NSPHYTVILGSHRNRRLKIEVDGKTVVDEEGVALCCSSMFQSYWISIYDGLISVGKGRYP  121

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD---YVGCDS  1104
             FQNL  QW DS PNCS++YVGLSSWDKHVGYRNVNVLP+ +NH+ LWKQVD   Y G D 
Sbjct  122   FQNLVFQWLDSNPNCSIRYVGLSSWDKHVGYRNVNVLPLPKNHMLLWKQVDSGEYEGTD-  180

Query  1105  EDANTELE  1128
              D   ELE
Sbjct  181   -DGEEELE  187



>ref|XP_011013905.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
 ref|XP_011013907.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
Length=806

 Score =   311 bits (798),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 162/188 (86%), Gaps = 5/188 (3%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             +E K KKFLTVAPF+CAWR DL+FREAGRGCVAFDAFA NDVTVVFRE+VGSQHYHYKRD
Sbjct  2     IEEKEKKFLTVAPFQCAWRKDLKFREAGRGCVAFDAFACNDVTVVFRENVGSQHYHYKRD  61

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +SPHYTVI+GSHRNRRLKIEVDG+TVVD   V LCCSS FQSYWI IYDGLIS+GKGRYP
Sbjct  62    NSPHYTVILGSHRNRRLKIEVDGKTVVDEEGVALCCSSMFQSYWISIYDGLISVGKGRYP  121

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD---YVGCDS  1104
             FQNL  QW DS PNCS++YVGLSSWDKHVGYRNVNVLP+ +NH+ LWKQVD   Y G D 
Sbjct  122   FQNLVFQWLDSNPNCSIRYVGLSSWDKHVGYRNVNVLPLPKNHMLLWKQVDSGEYEGTD-  180

Query  1105  EDANTELE  1128
              D   ELE
Sbjct  181   -DGEEELE  187



>ref|XP_008221133.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221134.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221135.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221136.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
Length=805

 Score =   311 bits (798),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             M+ K KKFLTVAPFECAWR DL+FREAGRGCVAF+AFAHNDVT+VFRE+VGSQHYHYKRD
Sbjct  2     MDKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFEAFAHNDVTLVFRENVGSQHYHYKRD  61

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +SPHYTVI+GSHRNRRLKIEVDG TVVDV  V LCCSS FQSYWI I DGLISIGKGRYP
Sbjct  62    NSPHYTVILGSHRNRRLKIEVDGNTVVDVEGVGLCCSSAFQSYWISICDGLISIGKGRYP  121

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             FQNL  QW DS PNCSV+YVGLSSWDKHVGYRNV+VLP+T NHISLWK VD
Sbjct  122   FQNLVFQWLDSNPNCSVRYVGLSSWDKHVGYRNVSVLPLTHNHISLWKHVD  172



>ref|XP_008781287.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Phoenix dactylifera]
Length=803

 Score =   311 bits (797),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 160/190 (84%), Gaps = 8/190 (4%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K KKFLTVAPFECAWR++LRFREAGRGCVAF+AFA NDVT+VFRE VGSQHYHYK D+ P
Sbjct  5     KQKKFLTVAPFECAWREELRFREAGRGCVAFEAFAQNDVTLVFREQVGSQHYHYKMDNGP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQN  942
             +YTVI+GSHRNRRLKIEVDG+TVVDVA + LCCSSTFQSYWIGIYDGLISIGKGRYPFQN
Sbjct  65    NYTVILGSHRNRRLKIEVDGKTVVDVAGIGLCCSSTFQSYWIGIYDGLISIGKGRYPFQN  124

Query  943   LCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCD-------  1101
             L  +W DSKPN SVQYVGLSSWDKHVGYRN+ VLP+T NH SLW  +DY  CD       
Sbjct  125   LVFEWLDSKPNYSVQYVGLSSWDKHVGYRNITVLPLTPNHNSLWSHIDYKECDVGDDEDG  184

Query  1102  -SEDANTELE  1128
              SEDA    E
Sbjct  185   RSEDATDGFE  194



>ref|XP_008781284.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008781285.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008781286.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
Length=805

 Score =   311 bits (797),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 160/190 (84%), Gaps = 8/190 (4%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K KKFLTVAPFECAWR++LRFREAGRGCVAF+AFA NDVT+VFRE VGSQHYHYK D+ P
Sbjct  5     KQKKFLTVAPFECAWREELRFREAGRGCVAFEAFAQNDVTLVFREQVGSQHYHYKMDNGP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQN  942
             +YTVI+GSHRNRRLKIEVDG+TVVDVA + LCCSSTFQSYWIGIYDGLISIGKGRYPFQN
Sbjct  65    NYTVILGSHRNRRLKIEVDGKTVVDVAGIGLCCSSTFQSYWIGIYDGLISIGKGRYPFQN  124

Query  943   LCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCD-------  1101
             L  +W DSKPN SVQYVGLSSWDKHVGYRN+ VLP+T NH SLW  +DY  CD       
Sbjct  125   LVFEWLDSKPNYSVQYVGLSSWDKHVGYRNITVLPLTPNHNSLWSHIDYKECDVGDDEDG  184

Query  1102  -SEDANTELE  1128
              SEDA    E
Sbjct  185   RSEDATDGFE  194



>ref|XP_012073654.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Jatropha curcas]
 ref|XP_012073655.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Jatropha curcas]
Length=804

 Score =   310 bits (795),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K KKFLTVAPF+CAWR DL+FREAGRGCVAFDAFAHNDVT+VFRE+VGSQHYHYKRD+SP
Sbjct  5     KEKKFLTVAPFQCAWRKDLKFREAGRGCVAFDAFAHNDVTIVFRENVGSQHYHYKRDNSP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQN  942
             HYTVI+GSHRNRRLKIEVDG+TVVD   + LCCSS FQSYWI +YDGLISIGKGRYPFQN
Sbjct  65    HYTVILGSHRNRRLKIEVDGKTVVDAEGIGLCCSSAFQSYWICLYDGLISIGKGRYPFQN  124

Query  943   LCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCDSEDANTE  1122
             L  QW DS PNCSV+YVGLSSWDKHVGYRNVNVLP+  NH+ LWKQVD    + +D   E
Sbjct  125   LVFQWLDSSPNCSVRYVGLSSWDKHVGYRNVNVLPLPHNHVLLWKQVDSGEYEDKDDGGE  184

Query  1123  LED  1131
               D
Sbjct  185   YLD  187



>ref|XP_002300643.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE79916.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=801

 Score =   310 bits (794),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = +1

Query  580   IKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDS  759
             I+  KFLTVAPF+CAWR DL+FREAGRGCVAFDAFAHNDVTVVFRE+VGSQHYHYKRD+S
Sbjct  2     IEENKFLTVAPFQCAWRKDLKFREAGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKRDNS  61

Query  760   PHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQ  939
             PHYTVI+GSHRNRRLKIEVDG+TVVD   V LCCSSTFQSYWI IYDGLIS+GKGRYPFQ
Sbjct  62    PHYTVILGSHRNRRLKIEVDGKTVVDEEGVALCCSSTFQSYWISIYDGLISVGKGRYPFQ  121

Query  940   NLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             NL  QW DS PNCSV+YVGLS WDKHVGYRNVNVLP+  NH+ LWKQVD
Sbjct  122   NLVFQWLDSNPNCSVRYVGLSCWDKHVGYRNVNVLPLPNNHMLLWKQVD  170



>ref|XP_010556054.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
 ref|XP_010556055.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
 ref|XP_010556056.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
Length=804

 Score =   309 bits (792),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = +1

Query  580   IKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDS  759
             I+ KKFLTVAPFECAWR+DL+FRE GRGCVAFDAFAHNDVTVVFRE+VGS+HYHYK+D+S
Sbjct  4     IQEKKFLTVAPFECAWREDLKFREPGRGCVAFDAFAHNDVTVVFRENVGSRHYHYKKDNS  63

Query  760   PHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQ  939
             PHY VIIGS+RNRRLKI VDGR  VD   + LCCSS FQSYWIGIYDGLISIG+GRYPFQ
Sbjct  64    PHYIVIIGSNRNRRLKILVDGRVAVDEEGIGLCCSSGFQSYWIGIYDGLISIGEGRYPFQ  123

Query  940   NLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             NL  QWHD+KPNC+VQYVGLSSWDKHVGYRNV+V P+TQNHI LWKQVD
Sbjct  124   NLVFQWHDTKPNCNVQYVGLSSWDKHVGYRNVSVFPLTQNHILLWKQVD  172



>ref|XP_011034879.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Populus euphratica]
 ref|XP_011034880.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Populus euphratica]
Length=808

 Score =   309 bits (792),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = +1

Query  580   IKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDS  759
             I+ KKFLTVAPF+CAWR DL+FREAGRGCV FDAFAHNDVTVVFRE+VGSQHYHYKRD+S
Sbjct  2     IEEKKFLTVAPFQCAWRKDLKFREAGRGCVTFDAFAHNDVTVVFRENVGSQHYHYKRDNS  61

Query  760   PHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQ  939
             PHYTVI+GSHRNRRLKIEVDG+TVVD   V LCCSSTFQSYWI IYDGLIS+GKGRYPFQ
Sbjct  62    PHYTVILGSHRNRRLKIEVDGKTVVDEEGVALCCSSTFQSYWICIYDGLISVGKGRYPFQ  121

Query  940   NLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             NL  QW DS PNCSV+YVGLS WDKHVGYRNVNVLP+  NH+ LWKQVD
Sbjct  122   NLVFQWLDSNPNCSVRYVGLSCWDKHVGYRNVNVLPLPNNHMLLWKQVD  170



>ref|XP_011034881.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Populus euphratica]
Length=801

 Score =   309 bits (791),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = +1

Query  580   IKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDS  759
             I+ KKFLTVAPF+CAWR DL+FREAGRGCV FDAFAHNDVTVVFRE+VGSQHYHYKRD+S
Sbjct  2     IEEKKFLTVAPFQCAWRKDLKFREAGRGCVTFDAFAHNDVTVVFRENVGSQHYHYKRDNS  61

Query  760   PHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQ  939
             PHYTVI+GSHRNRRLKIEVDG+TVVD   V LCCSSTFQSYWI IYDGLIS+GKGRYPFQ
Sbjct  62    PHYTVILGSHRNRRLKIEVDGKTVVDEEGVALCCSSTFQSYWICIYDGLISVGKGRYPFQ  121

Query  940   NLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             NL  QW DS PNCSV+YVGLS WDKHVGYRNVNVLP+  NH+ LWKQVD
Sbjct  122   NLVFQWLDSNPNCSVRYVGLSCWDKHVGYRNVNVLPLPNNHMLLWKQVD  170



>ref|XP_007221940.1| hypothetical protein PRUPE_ppa001540mg [Prunus persica]
 gb|EMJ23139.1| hypothetical protein PRUPE_ppa001540mg [Prunus persica]
Length=805

 Score =   308 bits (790),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             M+ K KKFLTVAPFECAWR DL+FREAGRGCVAF+AFAHNDVT+VFRE+VGSQH HYKRD
Sbjct  2     MDKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFEAFAHNDVTLVFRENVGSQHNHYKRD  61

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +SPHYTVI+GSHRNRRLKIEVDG TVVDV  V LCCSS FQSYWI I DGLISIGKGRYP
Sbjct  62    NSPHYTVILGSHRNRRLKIEVDGNTVVDVEGVGLCCSSAFQSYWISICDGLISIGKGRYP  121

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             FQNL  QW DS PNCSV+YVGLSSWDKHVGYRNV+VLP+T NHISLWK VD
Sbjct  122   FQNLVFQWLDSNPNCSVRYVGLSSWDKHVGYRNVSVLPLTHNHISLWKHVD  172



>ref|XP_004291228.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria 
vesca subsp. vesca]
 ref|XP_011459073.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria 
vesca subsp. vesca]
Length=803

 Score =   307 bits (787),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             ME K  KFLTVAPFECAWR+DL+FREAGRGCVAF+AFAHNDVT+VFRE+VGSQHYHYK+D
Sbjct  1     MEKKENKFLTVAPFECAWRNDLKFREAGRGCVAFEAFAHNDVTLVFRENVGSQHYHYKKD  60

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             ++PHYTVI+GSHRNRRLKIEVDG+TVVDV  V LC SS FQSYWI I DGLISIGKGRYP
Sbjct  61    NTPHYTVILGSHRNRRLKIEVDGKTVVDVEGVGLCSSSAFQSYWISICDGLISIGKGRYP  120

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             FQNL  QW DS PNCSV+YVGLSSWDKHVGYRNV+V+P+TQNHISLWK +D
Sbjct  121   FQNLVFQWLDSHPNCSVRYVGLSSWDKHVGYRNVSVIPLTQNHISLWKNLD  171



>gb|AAB63077.1| unknown protein [Arabidopsis thaliana]
Length=586

 Score =   300 bits (767),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHNDVTVVFRE+VG+QHYHYK+D+SP
Sbjct  5     KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNSP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYDGLISIGKGRYPFQ  939
             HY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  FQSYWI IYDGLISIGKGRYPFQ
Sbjct  65    HYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFQSYWISIYDGLISIGKGRYPFQ  124

Query  940   NLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             NL  +W D KPNC+VQYVGLSSWDKHVGYRNV+V P+T NHI LWKQVD
Sbjct  125   NLVFKWQDPKPNCNVQYVGLSSWDKHVGYRNVSVFPVTHNHILLWKQVD  173



>dbj|BAH56763.1| AT2G30600 [Arabidopsis thaliana]
Length=481

 Score =   296 bits (759),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHNDVTVVFRE+VG+QHYHYK+D+SP
Sbjct  5     KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNSP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYDGLISIGKGRYPFQ  939
             HY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  F+SYWI IYDGLISIGKGRYPFQ
Sbjct  65    HYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFRSYWISIYDGLISIGKGRYPFQ  124

Query  940   NLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             NL  +W D KPNC+VQYVGLSSWDKHVGYRNV+V P+T NHI LWKQVD
Sbjct  125   NLVFKWQDPKPNCNVQYVGLSSWDKHVGYRNVSVFPVTHNHILLWKQVD  173



>ref|XP_008377081.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Malus domestica]
Length=803

 Score =   304 bits (779),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             M+ K KKFLTVAPFECAWR DL+FRE+GRGCVAF+AFAHNDVT+VFRE+VGSQHYHYKRD
Sbjct  2     MDKKEKKFLTVAPFECAWRKDLKFRESGRGCVAFEAFAHNDVTLVFRENVGSQHYHYKRD  61

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +SPHYTVI+GSHRNRRLKIEVDG TVVDV  V LC SS FQSYWI I DGLISIGKG+YP
Sbjct  62    NSPHYTVILGSHRNRRLKIEVDGNTVVDVEGVGLCSSSAFQSYWISICDGLISIGKGKYP  121

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             FQNL  QW DS PNC+V+Y+GLSSWDKHVGYRNV+VLP+T+NHISLWK VD
Sbjct  122   FQNLVFQWLDSHPNCAVRYIGLSSWDKHVGYRNVSVLPLTRNHISLWKHVD  172



>ref|XP_008377080.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Malus domestica]
Length=805

 Score =   304 bits (778),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             M+ K KKFLTVAPFECAWR DL+FRE+GRGCVAF+AFAHNDVT+VFRE+VGSQHYHYKRD
Sbjct  2     MDKKEKKFLTVAPFECAWRKDLKFRESGRGCVAFEAFAHNDVTLVFRENVGSQHYHYKRD  61

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +SPHYTVI+GSHRNRRLKIEVDG TVVDV  V LC SS FQSYWI I DGLISIGKG+YP
Sbjct  62    NSPHYTVILGSHRNRRLKIEVDGNTVVDVEGVGLCSSSAFQSYWISICDGLISIGKGKYP  121

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             FQNL  QW DS PNC+V+Y+GLSSWDKHVGYRNV+VLP+T+NHISLWK VD
Sbjct  122   FQNLVFQWLDSHPNCAVRYIGLSSWDKHVGYRNVSVLPLTRNHISLWKHVD  172



>ref|XP_008377082.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X3 [Malus domestica]
Length=797

 Score =   303 bits (777),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             M+ K KKFLTVAPFECAWR DL+FRE+GRGCVAF+AFAHNDVT+VFRE+VGSQHYHYKRD
Sbjct  2     MDKKEKKFLTVAPFECAWRKDLKFRESGRGCVAFEAFAHNDVTLVFRENVGSQHYHYKRD  61

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +SPHYTVI+GSHRNRRLKIEVDG TVVDV  V LC SS FQSYWI I DGLISIGKG+YP
Sbjct  62    NSPHYTVILGSHRNRRLKIEVDGNTVVDVEGVGLCSSSAFQSYWISICDGLISIGKGKYP  121

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             FQNL  QW DS PNC+V+Y+GLSSWDKHVGYRNV+VLP+T+NHISLWK VD
Sbjct  122   FQNLVFQWLDSHPNCAVRYIGLSSWDKHVGYRNVSVLPLTRNHISLWKHVD  172



>ref|XP_004145539.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
sativus]
 ref|XP_011654264.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
sativus]
 gb|KGN55497.1| hypothetical protein Csa_4G658570 [Cucumis sativus]
Length=806

 Score =   303 bits (776),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             M+ K K  +TVAPFECAW  DLRFREAGRGCVAF+A AHNDVT+VFRE+VGSQHYHYKRD
Sbjct  2     MDKKEKNSITVAPFECAWLKDLRFREAGRGCVAFEASAHNDVTLVFRENVGSQHYHYKRD  61

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
              SPHYTVIIGSHRNRRL+I  DGRTVVDV  V LC SS FQSYWI +YDGLISIGKGRYP
Sbjct  62    MSPHYTVIIGSHRNRRLRIIADGRTVVDVEGVALCSSSAFQSYWISVYDGLISIGKGRYP  121

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCDSEDA  1113
             FQN+  QW D+ PNCS+QY+GLSSWDKHVGYRNVNVLP+TQ+HISLWK VD      +D 
Sbjct  122   FQNMVFQWLDTNPNCSIQYIGLSSWDKHVGYRNVNVLPLTQDHISLWKHVDNGDEGEDDV  181

Query  1114  NTELEDRAGD  1143
               E ED   D
Sbjct  182   ELEFEDEYKD  191



>ref|XP_002510674.1| protein binding protein, putative [Ricinus communis]
 gb|EEF52861.1| protein binding protein, putative [Ricinus communis]
Length=806

 Score =   303 bits (775),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             +E K KKFLTVAPF+CAWR DL+FREAGRGCVAFDAFAHNDVT+VFRE+VGSQHYHYKRD
Sbjct  2     IEEKEKKFLTVAPFQCAWRKDLKFREAGRGCVAFDAFAHNDVTLVFRENVGSQHYHYKRD  61

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +SPHYTVI+GSHRNRRLKIEV+G+TVVD   + LC S  FQSYWI IYDGLIS+GKGRYP
Sbjct  62    NSPHYTVILGSHRNRRLKIEVNGKTVVDAEGIGLCSSFAFQSYWICIYDGLISVGKGRYP  121

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             FQNL  QW DS PNC+VQYVGLSSWDKHVGYRNVNVLP+  NH+ LW+QVD
Sbjct  122   FQNLVFQWLDSNPNCNVQYVGLSSWDKHVGYRNVNVLPLPHNHMLLWEQVD  172



>ref|XP_010469825.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Camelina sativa]
Length=818

 Score =   303 bits (775),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 157/177 (89%), Gaps = 1/177 (1%)
 Frame = +1

Query  559   CEGETMEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHY  738
             C+G+ + +K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHNDVTVVFRE+VG+QHY
Sbjct  6     CKGKMVAVKENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHY  65

Query  739   HYKRDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYDGLISI  915
             HYK+D+SPHY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  F+SYWI IYDGLISI
Sbjct  66    HYKKDNSPHYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFESYWISIYDGLISI  125

Query  916   GKGRYPFQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             GKGRYPFQNL  +W DSKPN +VQYVGLSSWDKHVGYRNV+V P+T NHI LWKQVD
Sbjct  126   GKGRYPFQNLVFKWQDSKPNLNVQYVGLSSWDKHVGYRNVSVFPVTHNHILLWKQVD  182



>ref|XP_009141084.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Brassica rapa]
 ref|XP_009141086.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Brassica rapa]
Length=801

 Score =   301 bits (771),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K  KFLTVAPFECAW DDL+FRE GRGCVAFDAFAHNDVTVVFRE+VGSQHYHYK+D+SP
Sbjct  5     KENKFLTVAPFECAWSDDLKFREPGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKKDNSP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYDGLISIGKGRYPFQ  939
             HY VIIGS+RNRRLKI+VDG +VVD  S DLC CS  F+SYWI IYDGL+SIGKGRYPFQ
Sbjct  65    HYIVIIGSNRNRRLKIQVDGESVVDEESSDLCRCSLEFESYWISIYDGLVSIGKGRYPFQ  124

Query  940   NLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCDSEDANT  1119
             NL  QW DSKPNCSVQYVGLSSWDKHVGYRNV+V P+T++ ISLWKQVDY     ++   
Sbjct  125   NLVFQWQDSKPNCSVQYVGLSSWDKHVGYRNVSVFPVTRDRISLWKQVDYREVKGDEVEE  184

Query  1120  E  1122
             E
Sbjct  185   E  185



>ref|XP_008452951.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
 ref|XP_008452952.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
 ref|XP_008452953.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
Length=806

 Score =   301 bits (771),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             M+ K K  +TVAPFECAW  DLRFREAGRGCVAF+A AHNDVT+VFRE+VGSQHYHYKRD
Sbjct  2     MDKKEKNSITVAPFECAWLKDLRFREAGRGCVAFEASAHNDVTLVFRENVGSQHYHYKRD  61

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
              SPHYTVIIGSHRNRRL+I  DGRTVVD   V LC SS FQSYWI +YDGLISIGKGRYP
Sbjct  62    MSPHYTVIIGSHRNRRLRIIADGRTVVDEEGVALCSSSAFQSYWISVYDGLISIGKGRYP  121

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCDSEDA  1113
             FQN+  QW D+ PNCSVQY+GLSSWDKHVGYRNVNVLP+TQ+HISLWK VD      +D 
Sbjct  122   FQNMVFQWLDTNPNCSVQYIGLSSWDKHVGYRNVNVLPLTQDHISLWKHVDNGDEGEDDV  181

Query  1114  NTELEDRAGD  1143
               E ED   D
Sbjct  182   ELEFEDEYKD  191



>ref|XP_009141083.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Brassica rapa]
Length=806

 Score =   301 bits (770),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K  KFLTVAPFECAW DDL+FRE GRGCVAFDAFAHNDVTVVFRE+VGSQHYHYK+D+SP
Sbjct  10    KENKFLTVAPFECAWSDDLKFREPGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKKDNSP  69

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYDGLISIGKGRYPFQ  939
             HY VIIGS+RNRRLKI+VDG +VVD  S DLC CS  F+SYWI IYDGL+SIGKGRYPFQ
Sbjct  70    HYIVIIGSNRNRRLKIQVDGESVVDEESSDLCRCSLEFESYWISIYDGLVSIGKGRYPFQ  129

Query  940   NLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCDSEDANT  1119
             NL  QW DSKPNCSVQYVGLSSWDKHVGYRNV+V P+T++ ISLWKQVDY     ++   
Sbjct  130   NLVFQWQDSKPNCSVQYVGLSSWDKHVGYRNVSVFPVTRDRISLWKQVDYREVKGDEVEE  189

Query  1120  E  1122
             E
Sbjct  190   E  190



>gb|KFK23322.1| hypothetical protein AALP_AAs74635U001200 [Arabis alpina]
Length=807

 Score =   301 bits (770),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K KK+LTVAPFECAW DDL+FREAGRGCVAFDAFAHNDVTVVFRE+ GSQHYHYK+D+SP
Sbjct  5     KEKKYLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENAGSQHYHYKKDNSP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYDGLISIGKGRYPFQ  939
             HY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  F+SYWI IYDGLISIGKGRYPFQ
Sbjct  65    HYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFESYWISIYDGLISIGKGRYPFQ  124

Query  940   NLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             NL  QW DSKPNC+VQYVGLSSWDKHVGYRNV+V P+T NHI LWKQVD
Sbjct  125   NLVFQWQDSKPNCTVQYVGLSSWDKHVGYRNVSVFPVTHNHILLWKQVD  173



>ref|XP_010469824.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Camelina sativa]
Length=823

 Score =   300 bits (767),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 156/176 (89%), Gaps = 1/176 (1%)
 Frame = +1

Query  562   EGETMEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYH  741
             +G+ + +K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHNDVTVVFRE+VG+QHYH
Sbjct  12    KGKMVAVKENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYH  71

Query  742   YKRDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYDGLISIG  918
             YK+D+SPHY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  F+SYWI IYDGLISIG
Sbjct  72    YKKDNSPHYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFESYWISIYDGLISIG  131

Query  919   KGRYPFQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             KGRYPFQNL  +W DSKPN +VQYVGLSSWDKHVGYRNV+V P+T NHI LWKQVD
Sbjct  132   KGRYPFQNLVFKWQDSKPNLNVQYVGLSSWDKHVGYRNVSVFPVTHNHILLWKQVD  187



>ref|NP_180618.2| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_850151.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_001031447.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_001031448.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 sp|Q8LEV3.1|Y2060_ARATH RecName: Full=BTB/POZ domain-containing protein At2g30600 [Arabidopsis 
thaliana]
 gb|AAM62449.1| unknown [Arabidopsis thaliana]
 dbj|BAD42918.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43840.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44307.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08413.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08414.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08415.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08416.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=809

 Score =   299 bits (765),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHNDVTVVFRE+VG+QHYHYK+D+SP
Sbjct  5     KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNSP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYDGLISIGKGRYPFQ  939
             HY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  FQSYWI IYDGLISIGKGRYPFQ
Sbjct  65    HYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFQSYWISIYDGLISIGKGRYPFQ  124

Query  940   NLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             NL  +W D KPNC+VQYVGLSSWDKHVGYRNV+V P+T NHI LWKQVD
Sbjct  125   NLVFKWQDPKPNCNVQYVGLSSWDKHVGYRNVSVFPVTHNHILLWKQVD  173



>gb|EPS65824.1| hypothetical protein M569_08953, partial [Genlisea aurea]
Length=780

 Score =   298 bits (763),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             ME K K+FLTVAPFECAW DDLRFREAGRGCVAFDAFAHNDVT+VFRE+ GSQ YHYKRD
Sbjct  1     MENKHKRFLTVAPFECAWHDDLRFREAGRGCVAFDAFAHNDVTIVFRENAGSQQYHYKRD  60

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
              SPHYTVIIGSHRN+R  I V+G+TVVDV+ +DL CSS FQSYWI IYDGLISIGKGRYP
Sbjct  61    SSPHYTVIIGSHRNKRFNILVNGKTVVDVSGIDLYCSSKFQSYWISIYDGLISIGKGRYP  120

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             FQNL  QW DS P  SVQYVGLSSWD+HVGYRNVN++P  QNH+SLWK VD
Sbjct  121   FQNLVFQWLDSNPIHSVQYVGLSSWDRHVGYRNVNIMPFMQNHLSLWKHVD  171



>emb|CDY29657.1| BnaA04g17700D [Brassica napus]
Length=844

 Score =   299 bits (765),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K  KFLTVAPFECAW DDL+FRE GRGCVAFDAFAHNDVTVVFRE+VGSQHYHYK+D+SP
Sbjct  5     KENKFLTVAPFECAWSDDLKFREPGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKKDNSP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYDGLISIGKGRYPFQ  939
             HY VIIGS+RNRRLKI+VDG +VVD  + DLC CS  F+SYWI IYDGL+SIGKGRYPFQ
Sbjct  65    HYIVIIGSNRNRRLKIQVDGESVVDEEASDLCRCSLEFESYWISIYDGLVSIGKGRYPFQ  124

Query  940   NLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCDSEDANT  1119
             NL  QW D+KPNCSVQYVGLSSWDKHVGYRNV+V P+T++ ISLWKQVDY     ++   
Sbjct  125   NLVFQWQDAKPNCSVQYVGLSSWDKHVGYRNVSVFPVTRDRISLWKQVDYREVKGDEVEE  184

Query  1120  E  1122
             E
Sbjct  185   E  185



>ref|XP_002879271.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55530.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=809

 Score =   297 bits (761),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHNDVTVVFRE+VG+QHYHYK+D+SP
Sbjct  5     KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNSP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYDGLISIGKGRYPFQ  939
             HY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  F+SYWI IYDGLISIGKGRYPFQ
Sbjct  65    HYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFESYWISIYDGLISIGKGRYPFQ  124

Query  940   NLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             NL  +W D KPNC+VQYVGLSSWDKHVGYRNV+V P+T NHI LWKQVD
Sbjct  125   NLVFKWQDPKPNCNVQYVGLSSWDKHVGYRNVSVFPVTHNHILLWKQVD  173



>ref|NP_001189642.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08417.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=855

 Score =   298 bits (763),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHNDVTVVFRE+VG+QHYHYK+D+SP
Sbjct  5     KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNSP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYDGLISIGKGRYPFQ  939
             HY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  FQSYWI IYDGLISIGKGRYPFQ
Sbjct  65    HYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFQSYWISIYDGLISIGKGRYPFQ  124

Query  940   NLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             NL  +W D KPNC+VQYVGLSSWDKHVGYRNV+V P+T NHI LWKQVD
Sbjct  125   NLVFKWQDPKPNCNVQYVGLSSWDKHVGYRNVSVFPVTHNHILLWKQVD  173



>dbj|BAD93995.1| hypothetical protein [Arabidopsis thaliana]
Length=812

 Score =   297 bits (760),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 150/166 (90%), Gaps = 1/166 (1%)
 Frame = +1

Query  592   KFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSPHYT  771
             KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHNDVTVVFRE+VG+QHYHYK+D+SPHY 
Sbjct  11    KFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNSPHYI  70

Query  772   VIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYDGLISIGKGRYPFQNLC  948
             VIIGS+RNRRLKI+VDG++VVD  + DLC CS  FQSYWI IYDGLISIGKGRYPFQNL 
Sbjct  71    VIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFQSYWISIYDGLISIGKGRYPFQNLV  130

Query  949   LQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
              +W D KPNC+VQYVGLSSWDKHVGYRNV+V P+T NHI LWKQVD
Sbjct  131   FKWQDPKPNCNVQYVGLSSWDKHVGYRNVSVFPVTHNHILLWKQVD  176



>ref|XP_010469826.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469827.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469828.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469829.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
Length=809

 Score =   297 bits (760),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 152/170 (89%), Gaps = 1/170 (1%)
 Frame = +1

Query  580   IKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDS  759
             +K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHNDVTVVFRE+VG+QHYHYK+D+S
Sbjct  4     VKENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNS  63

Query  760   PHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYDGLISIGKGRYPF  936
             PHY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  F+SYWI IYDGLISIGKGRYPF
Sbjct  64    PHYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFESYWISIYDGLISIGKGRYPF  123

Query  937   QNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             QNL  +W DSKPN +VQYVGLSSWDKHVGYRNV+V P+T NHI LWKQVD
Sbjct  124   QNLVFKWQDSKPNLNVQYVGLSSWDKHVGYRNVSVFPVTHNHILLWKQVD  173



>ref|XP_010510327.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Camelina 
sativa]
 ref|XP_010510328.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Camelina 
sativa]
Length=809

 Score =   296 bits (757),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHNDVTVVFRE+VG+QHYHYK+D+SP
Sbjct  5     KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNSP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYDGLISIGKGRYPFQ  939
             HY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  F+SYWI IYDGLISIGKGRYPFQ
Sbjct  65    HYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFESYWISIYDGLISIGKGRYPFQ  124

Query  940   NLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             NL  +W DSKPN +VQYVGLSSWDKHVGYRNV+V P+T NHI LWKQVD
Sbjct  125   NLVFKWQDSKPNLNVQYVGLSSWDKHVGYRNVSVFPVTHNHILLWKQVD  173



>ref|XP_010692549.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010692550.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Beta 
vulgaris subsp. vulgaris]
Length=805

 Score =   295 bits (756),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K +KFLTVAPFECAW+ + +F+EAGRGCV F+AFA NDVTVVFREHVGSQ+YHYK D SP
Sbjct  5     KQQKFLTVAPFECAWQKEFKFKEAGRGCVVFEAFARNDVTVVFREHVGSQYYHYKTDSSP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQN  942
             HYTV++GSHRNRRLKIEVDG+ VVDV  + LC S+ FQSYWI IYDGLI IG GRYPFQN
Sbjct  65    HYTVVLGSHRNRRLKIEVDGKAVVDVEGIGLCSSAAFQSYWISIYDGLICIGNGRYPFQN  124

Query  943   LCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             +  QW DS PNCSVQYVGLSSWDKHVGYRNVNVLP+TQNHISLWKQ+D
Sbjct  125   VVFQWLDSNPNCSVQYVGLSSWDKHVGYRNVNVLPLTQNHISLWKQLD  172



>ref|XP_010935266.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
 ref|XP_010935267.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
 ref|XP_010935268.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
Length=805

 Score =   295 bits (755),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 155/184 (84%), Gaps = 5/184 (3%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K KKFLTVAPFECAWR++LRFREAGRGCVAF+AFA NDVT+VFRE VGSQHYHYK D+ P
Sbjct  5     KQKKFLTVAPFECAWREELRFREAGRGCVAFEAFAQNDVTLVFREQVGSQHYHYKMDNGP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQN  942
             +YTVI+GSHRNRRLKIEVDG+T VDVA + LCCSSTFQSYWI IYDGLISIGKG+YPFQN
Sbjct  65    NYTVILGSHRNRRLKIEVDGKTAVDVAGIGLCCSSTFQSYWISIYDGLISIGKGKYPFQN  124

Query  943   LCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDY----VGCDSED  1110
                +W DS PN +VQYVGLSSWDKHVGYRN+ VLP+T NH  LW  ++Y    VG D ED
Sbjct  125   PVFEWLDSNPNYNVQYVGLSSWDKHVGYRNIIVLPLTPNHNRLWSHINYKEYDVG-DDED  183

Query  1111  ANTE  1122
              N E
Sbjct  184   GNLE  187



>ref|XP_010414240.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Camelina 
sativa]
Length=824

 Score =   295 bits (756),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 157/177 (89%), Gaps = 2/177 (1%)
 Frame = +1

Query  562   EGETMEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYH  741
             +G+ + +K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHNDVTVVFRE+VG+QHYH
Sbjct  12    KGKMVAVKENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYH  71

Query  742   YKRDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYDGLISIG  918
             YK+D+SPHY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  F+SYWI IYDGLISIG
Sbjct  72    YKKDNSPHYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFESYWISIYDGLISIG  131

Query  919   KGRYPFQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVL-PITQNHISLWKQVD  1086
             KGRYPFQNL  +W DSKPN +VQYVGLSSWDKHVGYRNV+V+ P+T NHI LWKQVD
Sbjct  132   KGRYPFQNLVFKWQDSKPNLNVQYVGLSSWDKHVGYRNVSVVFPVTHNHILLWKQVD  188



>ref|XP_006293695.1| hypothetical protein CARUB_v10022653mg [Capsella rubella]
 gb|EOA26593.1| hypothetical protein CARUB_v10022653mg [Capsella rubella]
Length=809

 Score =   295 bits (755),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHNDVTVVFRE+VG+QHYHYK+D+SP
Sbjct  5     KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNSP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYDGLISIGKGRYPFQ  939
             HY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  F+SYWI IYDGLISIGKGRYPFQ
Sbjct  65    HYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFESYWISIYDGLISIGKGRYPFQ  124

Query  940   NLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD  1086
             NL  +W DSKPN +VQYVGLSSWDKHVGYRNV+V P+T NHI LWKQVD
Sbjct  125   NLVFKWQDSKPNLNVQYVGLSSWDKHVGYRNVSVFPVTHNHILLWKQVD  173



>emb|CDX97805.1| BnaC04g41340D [Brassica napus]
Length=796

 Score =   295 bits (754),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 155/183 (85%), Gaps = 8/183 (4%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K  KFLTVAPFECAW DDL+FRE GRGCVAFDAFAHNDVTVVFRE+VGSQHYHYK+D+ P
Sbjct  5     KENKFLTVAPFECAWSDDLKFREPGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKKDNCP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYDGLISIGKGRYPFQ  939
             HY VIIGS+RNRRLKI+VDG +VVD  + DLC CS  F+SYWI IYDGL+SIGKGRYPFQ
Sbjct  65    HYIVIIGSNRNRRLKIQVDGASVVDEEASDLCRCSLEFESYWISIYDGLVSIGKGRYPFQ  124

Query  940   NLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQV---DYV----GC  1098
             NL  QW D+KPNCSVQYVGLSSWDKHVGYRNV+V P+T NHISLW+QV    +V    GC
Sbjct  125   NLVFQWQDAKPNCSVQYVGLSSWDKHVGYRNVSVFPVTHNHISLWRQVGDEKFVEEGNGC  184

Query  1099  DSE  1107
             D E
Sbjct  185   DYE  187



>ref|XP_010061166.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Eucalyptus grandis]
 gb|KCW68087.1| hypothetical protein EUGRSUZ_F01772 [Eucalyptus grandis]
 gb|KCW68088.1| hypothetical protein EUGRSUZ_F01772 [Eucalyptus grandis]
Length=802

 Score =   288 bits (736),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 155/192 (81%), Gaps = 6/192 (3%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             M  K KKF+ VAPFECAW +DL FREAGRGCVAF+A A NDVTVVFRE+VGSQHYHYKRD
Sbjct  1     MAEKEKKFVRVAPFECAWSEDLMFREAGRGCVAFEASARNDVTVVFRENVGSQHYHYKRD  60

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +SPHYTVI+GSHRNRR KIEVDG+T VD   + LC SS FQSYWI IYDGLIS+G+GRYP
Sbjct  61    NSPHYTVILGSHRNRRFKIEVDGKTAVDEVGMALCSSSAFQSYWISIYDGLISVGQGRYP  120

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYV------G  1095
             FQNL  QW D+ PN SV+YVGLSSWDKHVGYRNV+VLP+TQ+ ISLWKQVD+       G
Sbjct  121   FQNLVFQWLDTNPNRSVRYVGLSSWDKHVGYRNVSVLPLTQHPISLWKQVDWSEHKGEEG  180

Query  1096  CDSEDANTELED  1131
              D E+   E  D
Sbjct  181   KDDEELGEECSD  192



>ref|XP_010061165.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Eucalyptus grandis]
Length=853

 Score =   287 bits (735),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 155/192 (81%), Gaps = 6/192 (3%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             M  K KKF+ VAPFECAW +DL FREAGRGCVAF+A A NDVTVVFRE+VGSQHYHYKRD
Sbjct  52    MAEKEKKFVRVAPFECAWSEDLMFREAGRGCVAFEASARNDVTVVFRENVGSQHYHYKRD  111

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +SPHYTVI+GSHRNRR KIEVDG+T VD   + LC SS FQSYWI IYDGLIS+G+GRYP
Sbjct  112   NSPHYTVILGSHRNRRFKIEVDGKTAVDEVGMALCSSSAFQSYWISIYDGLISVGQGRYP  171

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYV------G  1095
             FQNL  QW D+ PN SV+YVGLSSWDKHVGYRNV+VLP+TQ+ ISLWKQVD+       G
Sbjct  172   FQNLVFQWLDTNPNRSVRYVGLSSWDKHVGYRNVSVLPLTQHPISLWKQVDWSEHKGEEG  231

Query  1096  CDSEDANTELED  1131
              D E+   E  D
Sbjct  232   KDDEELGEECSD  243



>ref|XP_006596518.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Glycine max]
Length=714

 Score =   279 bits (714),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 149/177 (84%), Gaps = 3/177 (2%)
 Frame = +1

Query  592   KFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSPHYT  771
             KFLTV PFECAWR+DL+FREAGRGCVAF+AFA NDVT+VFRE+VGSQ YHYKRD SPHYT
Sbjct  4     KFLTVPPFECAWREDLKFREAGRGCVAFEAFACNDVTLVFRENVGSQGYHYKRDSSPHYT  63

Query  772   VIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQNLCL  951
             +I+GSHRNRRL+IEV+G+ VVDVA V LCCSS+FQSYWI IYDGLISIG G+YPFQ++  
Sbjct  64    IILGSHRNRRLRIEVNGKAVVDVAGVGLCCSSSFQSYWISIYDGLISIGNGKYPFQDVVF  123

Query  952   QWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQV---DYVGCDSEDA  1113
             QW DS PNC+VQY+GLSSWDKHV YRNVNVL +T  H+ L K V   DY   D  DA
Sbjct  124   QWLDSYPNCNVQYIGLSSWDKHVKYRNVNVLSLTHTHVPLSKHVVFGDYQVEDEVDA  180



>ref|XP_003545003.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Glycine max]
 gb|KHN12601.1| BTB/POZ domain-containing protein [Glycine soja]
Length=802

 Score =   278 bits (712),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 149/177 (84%), Gaps = 3/177 (2%)
 Frame = +1

Query  592   KFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSPHYT  771
             KFLTV PFECAWR+DL+FREAGRGCVAF+AFA NDVT+VFRE+VGSQ YHYKRD SPHYT
Sbjct  4     KFLTVPPFECAWREDLKFREAGRGCVAFEAFACNDVTLVFRENVGSQGYHYKRDSSPHYT  63

Query  772   VIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQNLCL  951
             +I+GSHRNRRL+IEV+G+ VVDVA V LCCSS+FQSYWI IYDGLISIG G+YPFQ++  
Sbjct  64    IILGSHRNRRLRIEVNGKAVVDVAGVGLCCSSSFQSYWISIYDGLISIGNGKYPFQDVVF  123

Query  952   QWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQV---DYVGCDSEDA  1113
             QW DS PNC+VQY+GLSSWDKHV YRNVNVL +T  H+ L K V   DY   D  DA
Sbjct  124   QWLDSYPNCNVQYIGLSSWDKHVKYRNVNVLSLTHTHVPLSKHVVFGDYQVEDEVDA  180



>ref|XP_006596517.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Glycine max]
Length=806

 Score =   278 bits (711),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 149/177 (84%), Gaps = 3/177 (2%)
 Frame = +1

Query  592   KFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSPHYT  771
             KFLTV PFECAWR+DL+FREAGRGCVAF+AFA NDVT+VFRE+VGSQ YHYKRD SPHYT
Sbjct  4     KFLTVPPFECAWREDLKFREAGRGCVAFEAFACNDVTLVFRENVGSQGYHYKRDSSPHYT  63

Query  772   VIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQNLCL  951
             +I+GSHRNRRL+IEV+G+ VVDVA V LCCSS+FQSYWI IYDGLISIG G+YPFQ++  
Sbjct  64    IILGSHRNRRLRIEVNGKAVVDVAGVGLCCSSSFQSYWISIYDGLISIGNGKYPFQDVVF  123

Query  952   QWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQV---DYVGCDSEDA  1113
             QW DS PNC+VQY+GLSSWDKHV YRNVNVL +T  H+ L K V   DY   D  DA
Sbjct  124   QWLDSYPNCNVQYIGLSSWDKHVKYRNVNVLSLTHTHVPLSKHVVFGDYQVEDEVDA  180



>gb|KEH28127.1| BTB/POZ domain plant protein [Medicago truncatula]
Length=614

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +1

Query  589   KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSPHY  768
             +KFLTV PFECAWR+DL+F+EAGRGCVAFDAFA NDVT+VFRE+VGSQ YHYKRD SPHY
Sbjct  3     EKFLTVPPFECAWREDLKFQEAGRGCVAFDAFACNDVTLVFRENVGSQGYHYKRDSSPHY  62

Query  769   TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQNLC  948
             TVI+GSHRNRRLKIEV+G TVVDV  V LCCS++FQSYWI IYDG ISIG G+YPFQ++ 
Sbjct  63    TVILGSHRNRRLKIEVNGETVVDVVGVGLCCSNSFQSYWISIYDGFISIGNGKYPFQDVV  122

Query  949   LQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCDSEDANT  1119
              QW DS+PNC+VQY+GLSSWDKHV YRNVNVL +    + L K + +     ED  T
Sbjct  123   FQWSDSRPNCNVQYIGLSSWDKHVKYRNVNVLSLKHTLMPLSKHMLFGDYQVEDDVT  179



>ref|XP_009418296.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418297.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418298.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418299.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418300.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418301.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
Length=803

 Score =   276 bits (707),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 147/169 (87%), Gaps = 1/169 (1%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K KKFLTVAPF+C WR++LRF+EAGRGCVAF+AFA NDVT+VFRE VGSQHYHYK D++P
Sbjct  5     KQKKFLTVAPFKCVWREELRFKEAGRGCVAFEAFAQNDVTLVFREQVGSQHYHYKMDNNP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQN  942
             +YT+I GSHRNRRLKIE  G+TVVDVA V L CSS FQSYWI IYDGLISIGKG+YPFQN
Sbjct  65    NYTIIFGSHRNRRLKIEASGKTVVDVAGVGL-CSSAFQSYWISIYDGLISIGKGKYPFQN  123

Query  943   LCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDY  1089
             L  +WHDS+PN +VQY+GLSSWDKHVGYRN+++L +  +H +LW  +DY
Sbjct  124   LVFEWHDSEPNFNVQYIGLSSWDKHVGYRNISILHMPSHHNALWSHIDY  172



>ref|XP_007160598.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 ref|XP_007160599.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 gb|ESW32592.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 gb|ESW32593.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
Length=802

 Score =   276 bits (705),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 149/177 (84%), Gaps = 3/177 (2%)
 Frame = +1

Query  592   KFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSPHYT  771
             KFLTV PFECAWR+DL+FREAGRGCVAF+AFA NDVT+VFRE+VGSQ YHYKRD SPHYT
Sbjct  4     KFLTVPPFECAWREDLKFREAGRGCVAFEAFACNDVTLVFRENVGSQGYHYKRDSSPHYT  63

Query  772   VIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQNLCL  951
             +I+GSHRNRRL+IEV+G+ VVD+A V LCCSS+FQSYWI IYDGLISIG G+YPFQ++  
Sbjct  64    IILGSHRNRRLRIEVNGKAVVDIAGVGLCCSSSFQSYWISIYDGLISIGHGKYPFQDVVF  123

Query  952   QWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQV---DYVGCDSEDA  1113
             QW DS PNC+VQY+GLSSWDKHV YRNVNVL +T  H+ L K V   DY   D  DA
Sbjct  124   QWLDSCPNCNVQYIGLSSWDKHVKYRNVNVLSLTHTHMPLSKHVVFGDYQVEDELDA  180



>gb|AES98295.2| BTB/POZ domain plant protein [Medicago truncatula]
Length=799

 Score =   270 bits (691),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = +1

Query  589   KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSPHY  768
             +KFLTV PFECAWR+DL+F+EAGRGCVAFDAFA NDVT+VFRE+VGSQ YHYKRD SPHY
Sbjct  3     EKFLTVPPFECAWREDLKFQEAGRGCVAFDAFACNDVTLVFRENVGSQGYHYKRDSSPHY  62

Query  769   TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQNLC  948
             TVI+GSHRNRRLKIEV+G TVVDV  V LCCS++FQSYWI IYDG ISIG G+YPFQ++ 
Sbjct  63    TVILGSHRNRRLKIEVNGETVVDVVGVGLCCSNSFQSYWISIYDGFISIGNGKYPFQDVV  122

Query  949   LQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCDSED  1110
              QW DS+PNC+VQY+GLSSWDKHV YRNVNVL +    + L K + +     ED
Sbjct  123   FQWSDSRPNCNVQYIGLSSWDKHVKYRNVNVLSLKHTLMPLSKHMLFGDYQVED  176



>ref|XP_003615337.1| Kelch-like protein [Medicago truncatula]
Length=884

 Score =   270 bits (689),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = +1

Query  589   KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSPHY  768
             +KFLTV PFECAWR+DL+F+EAGRGCVAFDAFA NDVT+VFRE+VGSQ YHYKRD SPHY
Sbjct  88    EKFLTVPPFECAWREDLKFQEAGRGCVAFDAFACNDVTLVFRENVGSQGYHYKRDSSPHY  147

Query  769   TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQNLC  948
             TVI+GSHRNRRLKIEV+G TVVDV  V LCCS++FQSYWI IYDG ISIG G+YPFQ++ 
Sbjct  148   TVILGSHRNRRLKIEVNGETVVDVVGVGLCCSNSFQSYWISIYDGFISIGNGKYPFQDVV  207

Query  949   LQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYVGCDSED  1110
              QW DS+PNC+VQY+GLSSWDKHV YRNVNVL +    + L K + +     ED
Sbjct  208   FQWSDSRPNCNVQYIGLSSWDKHVKYRNVNVLSLKHTLMPLSKHMLFGDYQVED  261



>gb|ERM96145.1| hypothetical protein AMTR_s00001p00041750 [Amborella trichopoda]
Length=827

 Score =   264 bits (674),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 147/181 (81%), Gaps = 2/181 (1%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K KKFLTVAPFEC W  + RFR+AGRGCV F+AFA ND+TVVFREH G+Q+YHYK D++P
Sbjct  28    KQKKFLTVAPFECVWLME-RFRDAGRGCVTFEAFARNDITVVFREHAGTQNYHYKTDNTP  86

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQN  942
             HYTVI+GSHRNRRLKIEVDG++VVDVA + LCC+S FQSYWI   DGLISIGKG+YPFQ+
Sbjct  87    HYTVILGSHRNRRLKIEVDGKSVVDVAGIGLCCTSGFQSYWISFCDGLISIGKGQYPFQD  146

Query  943   LCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQ-NHISLWKQVDYVGCDSEDANT  1119
             +  QW  S+PNC VQYVGLSSWDKHVGYRNV V+P+ Q N+I+L K V+    D  D   
Sbjct  147   VVFQWLHSEPNCKVQYVGLSSWDKHVGYRNVTVMPLHQMNYITLQKHVNNTILDLSDDEE  206

Query  1120  E  1122
             E
Sbjct  207   E  207



>ref|XP_004512608.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Cicer arietinum]
 ref|XP_004512609.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Cicer arietinum]
 ref|XP_004512610.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X4 [Cicer arietinum]
Length=795

 Score =   263 bits (673),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +1

Query  589   KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSPHY  768
             +KFLTVAPFECAWR+DL+FREAGRGCV F+AFA NDVT+VFRE+VGSQ YHYKRD SPHY
Sbjct  3     EKFLTVAPFECAWREDLKFREAGRGCVTFEAFACNDVTLVFRENVGSQGYHYKRDSSPHY  62

Query  769   TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQNLC  948
             T+I+GSHRNRRL+IEV+G+TVVD A V LC S+TFQSYWI IYDGLISIG G+YPFQ++ 
Sbjct  63    TIILGSHRNRRLRIEVNGKTVVDAAGVGLCGSNTFQSYWISIYDGLISIGNGKYPFQDVV  122

Query  949   LQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPIT  1053
              QW DS PNC+VQY+GLSSWDKHV YRNV VL + 
Sbjct  123   FQWSDSNPNCNVQYIGLSSWDKHVKYRNVTVLSLA  157



>ref|XP_011628891.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Amborella 
trichopoda]
Length=805

 Score =   263 bits (673),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 147/181 (81%), Gaps = 2/181 (1%)
 Frame = +1

Query  583   KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSP  762
             K KKFLTVAPFEC W  + RFR+AGRGCV F+AFA ND+TVVFREH G+Q+YHYK D++P
Sbjct  6     KQKKFLTVAPFECVWLME-RFRDAGRGCVTFEAFARNDITVVFREHAGTQNYHYKTDNTP  64

Query  763   HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQN  942
             HYTVI+GSHRNRRLKIEVDG++VVDVA + LCC+S FQSYWI   DGLISIGKG+YPFQ+
Sbjct  65    HYTVILGSHRNRRLKIEVDGKSVVDVAGIGLCCTSGFQSYWISFCDGLISIGKGQYPFQD  124

Query  943   LCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQ-NHISLWKQVDYVGCDSEDANT  1119
             +  QW  S+PNC VQYVGLSSWDKHVGYRNV V+P+ Q N+I+L K V+    D  D   
Sbjct  125   VVFQWLHSEPNCKVQYVGLSSWDKHVGYRNVTVMPLHQMNYITLQKHVNNTILDLSDDEE  184

Query  1120  E  1122
             E
Sbjct  185   E  185



>ref|XP_004512607.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Cicer arietinum]
Length=815

 Score =   264 bits (674),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +1

Query  589   KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSPHY  768
             +KFLTVAPFECAWR+DL+FREAGRGCV F+AFA NDVT+VFRE+VGSQ YHYKRD SPHY
Sbjct  23    EKFLTVAPFECAWREDLKFREAGRGCVTFEAFACNDVTLVFRENVGSQGYHYKRDSSPHY  82

Query  769   TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQNLC  948
             T+I+GSHRNRRL+IEV+G+TVVD A V LC S+TFQSYWI IYDGLISIG G+YPFQ++ 
Sbjct  83    TIILGSHRNRRLRIEVNGKTVVDAAGVGLCGSNTFQSYWISIYDGLISIGNGKYPFQDVV  142

Query  949   LQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPIT  1053
              QW DS PNC+VQY+GLSSWDKHV YRNV VL + 
Sbjct  143   FQWSDSNPNCNVQYIGLSSWDKHVKYRNVTVLSLA  177



>dbj|BAK07994.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=487

 Score =   252 bits (644),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = +1

Query  589   KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSPHY  768
             K+ LTVAPFECAW ++ RF EAGRGC+AF+A A NDVT+VFRE +GSQHYHYK D S HY
Sbjct  7     KRSLTVAPFECAWGEEFRFVEAGRGCIAFEASAQNDVTLVFREQLGSQHYHYKMDSSRHY  66

Query  769   TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQNLC  948
              VI+GSHRN+RLKIEVDGRTVVD A V LC SS+FQSYWI IYDGLISIG+GR+P  N+ 
Sbjct  67    AVILGSHRNKRLKIEVDGRTVVDEAGVGLCRSSSFQSYWISIYDGLISIGQGRHPNNNVL  126

Query  949   LQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYV  1092
              QW D  PN  VQYVGLSSWDKHVGYRN++VLP    +   W Q++Y 
Sbjct  127   FQWLDPDPNRKVQYVGLSSWDKHVGYRNISVLPSAPQNSIRWSQIEYA  174



>gb|EEC79014.1| hypothetical protein OsI_19541 [Oryza sativa Indica Group]
Length=806

 Score =   257 bits (656),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 145/183 (79%), Gaps = 2/183 (1%)
 Frame = +1

Query  589   KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSPHY  768
             K+ +TVAPFECAW ++ RFREAGRGC+ F+A AHNDVT+VFRE  GSQHYHYK D+S HY
Sbjct  7     KRSITVAPFECAWDEEFRFREAGRGCITFEASAHNDVTLVFREQPGSQHYHYKMDNSRHY  66

Query  769   TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQNLC  948
              VI+GSHRN+RLKIEVDG+TVVDVA + LCCSS+FQSYWI IYDGLISIG+GR+P  N+ 
Sbjct  67    IVILGSHRNKRLKIEVDGKTVVDVAGIGLCCSSSFQSYWISIYDGLISIGQGRHPNNNIL  126

Query  949   LQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD--YVGCDSEDANTE  1122
              QW D  PN +VQYVGLSSWDKHVGYRN++++P    +  LW Q++  YV  D    +T 
Sbjct  127   FQWLDPDPNRNVQYVGLSSWDKHVGYRNISLMPSAPQNSILWSQIECAYVEPDGAGGHTR  186

Query  1123  LED  1131
              ++
Sbjct  187   KQE  189



>gb|AAV43802.1| unknown protein [Oryza sativa Japonica Group]
Length=806

 Score =   255 bits (652),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 144/183 (79%), Gaps = 2/183 (1%)
 Frame = +1

Query  589   KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSPHY  768
             K+ +TVAPFECAW ++ RFRE GRGC+ F+A AHNDVT+VFRE  GSQHYHYK D+S HY
Sbjct  7     KRSITVAPFECAWDEEFRFRETGRGCITFEASAHNDVTLVFREQPGSQHYHYKMDNSRHY  66

Query  769   TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQNLC  948
              VI+GSHRN+RLKIEVDG+TVVDVA + LCCSS+FQSYWI IYDGLISIG+GR+P  N+ 
Sbjct  67    IVILGSHRNKRLKIEVDGKTVVDVAGIGLCCSSSFQSYWISIYDGLISIGQGRHPNNNIL  126

Query  949   LQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD--YVGCDSEDANTE  1122
              QW D  PN +VQYVGLSSWDKHVGYRN++++P    +  LW Q++  YV  D    +T 
Sbjct  127   FQWLDPDPNRNVQYVGLSSWDKHVGYRNISLMPSAPQNSILWSQIECAYVEPDGAGGHTR  186

Query  1123  LED  1131
              ++
Sbjct  187   KQE  189



>ref|XP_006664953.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Oryza 
brachyantha]
Length=805

 Score =   253 bits (646),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 147/188 (78%), Gaps = 3/188 (2%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRD  753
             ME K K+ +TVAPFECAW +  +FREAGRGC+ F+A A ND+T+VFRE  GSQHYHYK D
Sbjct  3     MEEK-KRSITVAPFECAWDEGFQFREAGRGCITFEASAQNDITLVFREQPGSQHYHYKMD  61

Query  754   DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYP  933
             +S HYTVI+GSHRN+RLKIEVDG+TVVDVA + LCCSS FQSYWI IYDGLISIG+GR+P
Sbjct  62    NSRHYTVILGSHRNKRLKIEVDGKTVVDVAGIGLCCSSCFQSYWISIYDGLISIGQGRHP  121

Query  934   FQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVD--YVGCDSE  1107
              +N+  QW D  PN +VQYVGLSSWDKHVGYRN++++P    +  LW Q++  YV  D  
Sbjct  122   NKNILFQWLDPDPNQNVQYVGLSSWDKHVGYRNISLMPSAPQNSILWSQIECTYVERDGA  181

Query  1108  DANTELED  1131
               +T  E+
Sbjct  182   AGHTRKEE  189



>ref|XP_003561246.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Brachypodium 
distachyon]
Length=812

 Score =   252 bits (643),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 134/172 (78%), Gaps = 0/172 (0%)
 Frame = +1

Query  577   EIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDD  756
             E   K+ LTVAPFECAW +  RF EAGRGCVAF+A A NDVT+VFRE +GSQHYHYK D 
Sbjct  6     EEPKKRSLTVAPFECAWDEQFRFTEAGRGCVAFEASAQNDVTLVFREQLGSQHYHYKMDT  65

Query  757   SPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPF  936
             + HYTVI+GSHRN+RLKIEVDGRTVVD A V LC SS FQSYWI IYDGLISIG+GR+P 
Sbjct  66    TRHYTVILGSHRNKRLKIEVDGRTVVDQAGVGLCRSSAFQSYWISIYDGLISIGEGRHPN  125

Query  937   QNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYV  1092
              NL   W D  PN +VQYVGLSSWDKHVGYRN++VLP    +  LW Q+ Y 
Sbjct  126   NNLLFHWLDPDPNRNVQYVGLSSWDKHVGYRNISVLPSAPRNSILWSQIQYA  177



>emb|CDM85346.1| unnamed protein product [Triticum aestivum]
Length=805

 Score =   249 bits (635),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = +1

Query  589   KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSPHY  768
             K+ LTVAPF+CAW ++ RF EAGRGC+AF+A A NDVT+VFRE  GSQHYHYK D S HY
Sbjct  7     KRSLTVAPFKCAWGEEFRFVEAGRGCIAFEASAQNDVTLVFREQPGSQHYHYKMDSSRHY  66

Query  769   TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQNLC  948
              VI+GSHRN+RLKIEVDGRTVVD A V LC SS+FQSYWI IYDGLISIG+GR+P  N+ 
Sbjct  67    AVILGSHRNKRLKIEVDGRTVVDEAGVGLCRSSSFQSYWISIYDGLISIGQGRHPNNNVL  126

Query  949   LQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDYV  1092
              QW D  PN +VQYVGLSSWDKHVGYRN++VLP    +   W Q++Y 
Sbjct  127   FQWLDPDPNQNVQYVGLSSWDKHVGYRNISVLPSAPQNSIRWSQIEYA  174



>ref|XP_002437659.1| hypothetical protein SORBIDRAFT_10g000240 [Sorghum bicolor]
 gb|EER89026.1| hypothetical protein SORBIDRAFT_10g000240 [Sorghum bicolor]
Length=807

 Score =   246 bits (628),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = +1

Query  589   KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSPHY  768
             K+ LTVAPFECAW ++LRF E GRGC+AF+A A NDVT+VFR  +GSQHYHYK D S HY
Sbjct  8     KRSLTVAPFECAWAEELRFGEPGRGCIAFEASAQNDVTLVFRHLLGSQHYHYKTDTSRHY  67

Query  769   TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQNLC  948
             TVI+GSHRN+RLKIEVDG T VDV +V LCCSS+FQSYWI IYDG ISIG+G++P  NL 
Sbjct  68    TVILGSHRNKRLKIEVDGITAVDVTAVGLCCSSSFQSYWISIYDGCISIGQGKHPSNNLL  127

Query  949   LQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQVDY  1089
              QW D  PN  VQYVGLSSWDKHVGYRN+++LP    +   W Q++Y
Sbjct  128   FQWLDPDPNPHVQYVGLSSWDKHVGYRNISLLPSAPPNSIFWTQIEY  174



>ref|XP_004964253.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At2g30600-like [Setaria italica]
Length=862

 Score =   243 bits (621),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = +1

Query  568   ETMEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYK  747
             E +E   K+ LTVAPFECAW ++LRFRE GRGCV+F+A AHNDVT+VFR H GS HYHYK
Sbjct  2     EFVEETKKRSLTVAPFECAWGEELRFREPGRGCVSFEASAHNDVTLVFRHHPGSHHYHYK  61

Query  748   RDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGR  927
              D S HYTVI+GSHRN+RL+I+VDG TV DVA+  LCCS++FQ++WI I DGLI+IG+GR
Sbjct  62    MDTSRHYTVILGSHRNKRLRIQVDGATVADVAAPGLCCSNSFQAFWITICDGLITIGQGR  121

Query  928   YPFQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHISLWKQ  1080
             +P  NL  QW D  PN  VQYVGLSSWDKHVGYRN+++LP    +  LW Q
Sbjct  122   HPNTNLLFQWLDPDPNPDVQYVGLSSWDKHVGYRNISILPAAPQYSILWTQ  172



>gb|EEE63337.1| hypothetical protein OsJ_18148 [Oryza sativa Japonica Group]
Length=734

 Score =   212 bits (540),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 124/160 (78%), Gaps = 3/160 (2%)
 Frame = +1

Query  661   GCVAFDAFAHNDVTVVFREH-VGSQHYHYKRDDSPHYTVIIGSHRNRRLKIEVDGRTVVD  837
             GC+ F+A AHNDVT+VFR   +GSQHYHYK D+S HY VI+GSHRN+RLKIEVDG+TVVD
Sbjct  12    GCITFEASAHNDVTLVFRRTTLGSQHYHYKMDNSRHYIVILGSHRNKRLKIEVDGKTVVD  71

Query  838   VASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQNLCLQWHDSKPNCSVQYVGLSSWDKH  1017
             VA + LCCSS+FQSYWI IYDGLISIG+GR+P  N+  QW D  PN +VQYVGLSSWDKH
Sbjct  72    VAGIGLCCSSSFQSYWISIYDGLISIGQGRHPNNNILFQWLDPDPNRNVQYVGLSSWDKH  131

Query  1018  VGYRNVNVLPITQNHISLWKQVD--YVGCDSEDANTELED  1131
             VGYRN++++P    +  LW Q++  YV  D    +T  ++
Sbjct  132   VGYRNISLMPSAPQNSILWSQIECAYVEPDGAGGHTRKQE  171



>ref|XP_001751401.1| predicted protein [Physcomitrella patens]
 gb|EDQ83718.1| predicted protein, partial [Physcomitrella patens]
Length=784

 Score =   180 bits (457),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 111/152 (73%), Gaps = 6/152 (4%)
 Frame = +1

Query  598   LTVAPFECAWR--DDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYKRDDSPHYT  771
             L V PF+CAW   D+  F   GRGCVAF+A A NDVT+VF+EH G +HY  + D  P+YT
Sbjct  1     LVVPPFDCAWLMGDEQSFLTPGRGCVAFEARAANDVTIVFKEHPGCKHY--RTDLGPNYT  58

Query  772   VIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGRYPFQNLCL  951
             +I+GSH NRRLK+ VDG+TVVDVA + L C STF+ YWI + DG I +GKG  P Q++  
Sbjct  59    IILGSHGNRRLKMLVDGKTVVDVADIVL-CPSTFERYWISVLDGRIIVGKGE-PGQSIVH  116

Query  952   QWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLP  1047
             +W D  PN  ++YVGLSSWDKHVGYRNV VLP
Sbjct  117   EWSDPSPNFKIKYVGLSSWDKHVGYRNVRVLP  148



>ref|XP_002965955.1| hypothetical protein SELMODRAFT_84039 [Selaginella moellendorffii]
 gb|EFJ33375.1| hypothetical protein SELMODRAFT_84039 [Selaginella moellendorffii]
Length=772

 Score =   175 bits (444),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 112/158 (71%), Gaps = 6/158 (4%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAW--RDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYK  747
             M++     L V PF+CAW   ++LRF EAGRGCVAF+A A NDVTV+F+E  G +HY  +
Sbjct  2     MKLVENNVLVVPPFDCAWLFEEELRFPEAGRGCVAFEARAENDVTVIFKELAGCKHY--R  59

Query  748   RDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGR  927
              D  P+YTVIIGS+ N+RLKI  +GRTVVDVA   +     F+ YWI + +G I +GKG 
Sbjct  60    TDSDPNYTVIIGSNLNKRLKIAANGRTVVDVAG-PVVSPLVFERYWISVDEGSIVVGKGE  118

Query  928   YPFQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNV  1041
                QN+  QW D +PNC VQ+VGLSSWDKHVGYRN++V
Sbjct  119   LG-QNVVYQWVDPEPNCKVQFVGLSSWDKHVGYRNISV  155



>ref|XP_002962812.1| hypothetical protein SELMODRAFT_438140 [Selaginella moellendorffii]
 gb|EFJ36275.1| hypothetical protein SELMODRAFT_438140 [Selaginella moellendorffii]
Length=792

 Score =   175 bits (444),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 112/158 (71%), Gaps = 6/158 (4%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAW--RDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHYK  747
             M++     L V PF+CAW   ++LRF EAGRGCVAF+A A NDVTV+F+E  G +HY  +
Sbjct  1     MKLVENNVLVVPPFDCAWLFEEELRFPEAGRGCVAFEARAENDVTVIFKELAGCKHY--R  58

Query  748   RDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYDGLISIGKGR  927
              D  P+YTVIIGS+ N+RLKI  +GRTVVDVA   +     F+ YWI + +G I +GKG 
Sbjct  59    TDSDPNYTVIIGSNLNKRLKIAANGRTVVDVAG-PVVSPLVFERYWISVDEGSIVVGKGE  117

Query  928   YPFQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNV  1041
                QN+  QW D +PNC VQ+VGLSSWDKHVGYRN++V
Sbjct  118   LG-QNVVYQWVDPEPNCKVQFVGLSSWDKHVGYRNISV  154



>ref|XP_005845262.1| hypothetical protein CHLNCDRAFT_58586 [Chlorella variabilis]
 gb|EFN53160.1| hypothetical protein CHLNCDRAFT_58586 [Chlorella variabilis]
Length=669

 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 90/173 (52%), Gaps = 25/173 (14%)
 Frame = +1

Query  598   LTVAPFECAWR--DDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYHY---------  744
             L VAP E  W    +L+ ++ GRGC++F+     D TV+ ++  GS+ + +         
Sbjct  15    LVVAPMEAVWLTGSELQLQD-GRGCLSFEVKGDTDATVLLKQQSGSRRWQHLALGAAAAA  73

Query  745   -------KRDDSP---HYTVIIGSHRNRRLKIEVDGRT--VVDVASVDLCCSSTFQSYWI  888
                        SP   +YT+I+GSHRN  LK E DG    +V  A      SS+F  YW+
Sbjct  74    AANGQPAAGRGSPVEQNYTIILGSHRNSCLKFEKDGELCCMVPTAPEAKLSSSSFSKYWL  133

Query  889   GIYDGLISIGKGRYPFQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLP  1047
                 G IS+G G  P  NLC  W D  P  ++ Y GLS+WDKHVGYRN+ + P
Sbjct  134   NFDGGAISVGTGE-PGDNLCYTWTDPDPIPNIHYAGLSAWDKHVGYRNLCMHP  185



>gb|KDD75170.1| hypothetical protein H632_c829p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=285

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 86/174 (49%), Gaps = 24/174 (14%)
 Frame = +1

Query  595   FLTVAPFECAWRDDLRF---REAGRGCVAFDAFAHNDVTVVFREHVGSQHYHY----KRD  753
              + V PFECAW  D  F   RE  RGC+ F+    ND T++ +   GS+ + +     R 
Sbjct  7     LVIVPPFECAWLQDPEFVFKRE--RGCLTFEVKGENDATILLKPQPGSRRWQHLSAVPRA  64

Query  754   DS------------PHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSS--TFQSYWIG  891
             ++             +YT+I+GSHRN  LKIE +G        +   C S  +F  +WI 
Sbjct  65    EAGLHADAVGGVVESNYTIILGSHRNSCLKIEKNGELCCMATHLPEGCLSPQSFVRFWIS  124

Query  892   IYDGLISIGKGRYPFQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPIT  1053
                G I +G+G  P +     W D+     + Y GLSSWDKH+ YR + VLP +
Sbjct  125   YDAGSIVVGRGE-PGRRSFFCWKDAHAVPGIAYAGLSSWDKHLAYRGIKVLPTS  177



>gb|KIY99757.1| hypothetical protein MNEG_8204 [Monoraphidium neglectum]
Length=725

 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 80/172 (47%), Gaps = 37/172 (22%)
 Frame = +1

Query  574   MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVGSQHYH-YKR  750
             + +  +  L V PFEC                       NDVTV+F+   G++ +    R
Sbjct  2     LRVNSRDVLVVPPFEC----------------------DNDVTVIFKAVAGAKRWQPLAR  39

Query  751   DDSP--------HYTVIIGSHRNRRLKIEVDGRTVVDVASVD--LCCSSTFQSYWIGIYD  900
                         +YTVI+GSHRN RLK E +G  +  V  VD     S  F  +W+   D
Sbjct  40    PRGAEGAASVEDNYTVILGSHRNSRLKFEKNGEEMELVQGVDGARVGSRDFSPFWVNCQD  99

Query  901   GLISIGKGRYPFQNLCLQWHDSKPN---CSVQYVGLSSWDKHVGYRNVNVLP  1047
             G I++G G  P   +  +W D +P      V++ GLS WD+HV YRNV VLP
Sbjct  100   GAITVGSGE-PGAGIAHRWVDPRPGDLARGVRHAGLSCWDRHVSYRNVRVLP  150



>ref|XP_005708288.1| ubiquitin-protein ligase isoform 1 [Galdieria sulphuraria]
 gb|EME31768.1| ubiquitin-protein ligase isoform 1 [Galdieria sulphuraria]
Length=944

 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 82/165 (50%), Gaps = 22/165 (13%)
 Frame = +1

Query  625   WRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVG--SQHYHYKRDDSPH---YTVIIGSH  789
             W D ++   +G G  +F+A   +D+ V+F  +    S+    + +++ H   Y V+IGSH
Sbjct  34    WLDGIQLPPSGSGVFSFEARGTSDIDVLFSSYPEKVSEDEQVELEENLHRADYEVVIGSH  93

Query  790   RNRRLKIEVDG----RTVVDVA--SVDLCCSST----------FQSYWIGIYDGLISIGK  921
              N R  I   G     ++V V   S DL    +          F+ YWI I +GL+++GK
Sbjct  94    CNTRSVIRKRGVLRASSLVGVGKESADLNSFGSPSHSYYTTWDFERYWICIGEGLLAVGK  153

Query  922   GRYPFQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQ  1056
             G    +++ L W D  P      VG+SSW++ V +R + + P+ +
Sbjct  154   GNLG-ESIFLYWEDPFPIRDALSVGISSWNRPVVFRFIELTPMPE  197



>ref|XP_005708289.1| ubiquitin-protein ligase isoform 2 [Galdieria sulphuraria]
 gb|EME31769.1| ubiquitin-protein ligase isoform 2 [Galdieria sulphuraria]
Length=960

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 82/165 (50%), Gaps = 22/165 (13%)
 Frame = +1

Query  625   WRDDLRFREAGRGCVAFDAFAHNDVTVVFREHVG--SQHYHYKRDDSPH---YTVIIGSH  789
             W D ++   +G G  +F+A   +D+ V+F  +    S+    + +++ H   Y V+IGSH
Sbjct  34    WLDGIQLPPSGSGVFSFEARGTSDIDVLFSSYPEKVSEDEQVELEENLHRADYEVVIGSH  93

Query  790   RNRRLKIEVDG----RTVVDVA--SVDLCCSST----------FQSYWIGIYDGLISIGK  921
              N R  I   G     ++V V   S DL    +          F+ YWI I +GL+++GK
Sbjct  94    CNTRSVIRKRGVLRASSLVGVGKESADLNSFGSPSHSYYTTWDFERYWICIGEGLLAVGK  153

Query  922   GRYPFQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQ  1056
             G    +++ L W D  P      VG+SSW++ V +R + + P+ +
Sbjct  154   GNLG-ESIFLYWEDPFPIRDALSVGISSWNRPVVFRFIELTPMPE  197



>ref|XP_002500926.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62184.1| predicted protein [Micromonas sp. RCC299]
Length=243

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 87/183 (48%), Gaps = 39/183 (21%)
 Frame = +1

Query  595   FLTVAPFECAWRDD-------LRFREAGRG-CVAFDAFAHNDVTVVFREHVGSQ------  732
              L V PF+CAW              E G G  V+FDA A +DVTV+ +    S+      
Sbjct  9     VLVVPPFDCAWLSSPDAESLTTASSEGGEGIVVSFDAKADSDVTVILKGRRTSKSELDSR  68

Query  733   ------HYHYKRDD-----SPHYTVIIGSHRNRRLKIEVDGRTVVDVA---SVDLCCS--  864
                   H+  ++DD     +  Y VIIGSHRN    IE +GR VV++A   +V L  +  
Sbjct  69    PARRLDHWSGRQDDPAKVDASTYLVIIGSHRNSACVIEKNGR-VVELAKGPAVPLLPARG  127

Query  865   -STFQSYWIGIYD--GLISIGKGRYPFQNLCLQWHDSKPNC-SVQYVGLSSWDKHVGYRN  1032
                F   ++  Y   G + +G G    ++L   W D +P+   +  +GLS+WD +  YR+
Sbjct  128   RDAFTRCFVSWYPKRGALVVGVG----EHLRHAWVDPEPHTDPICEIGLSTWDDYAQYRD  183

Query  1033  VNV  1041
             + V
Sbjct  184   IEV  186



>ref|XP_005708947.1| ubiquitin-protein ligase [Galdieria sulphuraria]
 gb|EME32427.1| ubiquitin-protein ligase [Galdieria sulphuraria]
Length=970

 Score = 61.6 bits (148),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 49/169 (29%), Positives = 75/169 (44%), Gaps = 23/169 (14%)
 Frame = +1

Query  625   WRDDLRFREAGRGCVAFDAFAHNDVTVVFRE-----HVGSQHYHYKRDDSPHYTVIIGSH  789
             W   L+F   G G V F+A   +D+ V F       H   Q    +      Y  +IGS+
Sbjct  34    WLSGLQFPFPGNGIVCFEARGASDIGVFFSSTPEDVHEDDQVLTVESSQRAEYETVIGSY  93

Query  790   RNRRLKIEVDG--RTVVDV---ASVDLCCSST------------FQSYWIGIYDGLISIG  918
              N++  I   G  R +  +   + V+   ++T            F+ YWI I DG+I +G
Sbjct  94    CNKKSVIRKRGVVRALSSIGVGSGVEQSTTTTAAAWQSFDNSWNFEKYWICIKDGVIVVG  153

Query  919   KGRYPFQNLCLQWHDSKPNCSVQYVGLSSWDKHVGYRNVNVLPITQNHI  1065
             KG      + L+W DS+P  S   +G+SSW + V +    V P T+  I
Sbjct  154   KGSVG-SCVFLKWEDSEPVRSSFQIGVSSWHQPVIFCFFEVFPTTEGLI  201



>ref|XP_006014397.1| PREDICTED: C3 and PZP-like alpha-2-macroglobulin domain-containing 
protein 8-like, partial [Latimeria chalumnae]
Length=174

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 49/97 (51%), Gaps = 9/97 (9%)
 Frame = +1

Query  739   HYKRDDSPHYT-----VIIGSHRNRRLKIEVD--GRTVVDVASVDLCCSSTFQSYWIGIY  897
             H+     PH T     ++IG  +N R  I +   G  VV   +VD+     F+++WI   
Sbjct  35    HFALSSGPHDTAEMIEIVIGGQQNSRTWISISKMGDPVVAANTVDILSWDEFRNFWISWK  94

Query  898   DGLISIGKGRYPFQN-LCLQWHDSKPNCSVQYVGLSS  1005
              G+I +G G  P  N L +QW ++K    V+Y+G S+
Sbjct  95    HGIIQVGYGVQPSMNSLIVQWAEAK-QPEVKYIGFST  130



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3113196583600