BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig785

Length=637
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009765278.1|  PREDICTED: uncharacterized protein LOC104216...    228   7e-69   Nicotiana sylvestris
ref|XP_009765281.1|  PREDICTED: E3 ubiquitin-protein ligase CHFR ...    226   9e-69   Nicotiana sylvestris
ref|XP_009610506.1|  PREDICTED: uncharacterized protein LOC104104...    224   2e-67   Nicotiana tomentosiformis
ref|XP_009610509.1|  PREDICTED: E3 ubiquitin-protein ligase CHFR ...    222   3e-67   Nicotiana tomentosiformis
ref|XP_006351347.1|  PREDICTED: uncharacterized protein LOC102597...    216   3e-64   Solanum tuberosum [potatoes]
ref|XP_006351348.1|  PREDICTED: uncharacterized protein LOC102597...    214   1e-63   Solanum tuberosum [potatoes]
ref|XP_004249287.1|  PREDICTED: uncharacterized protein LOC101263558    208   4e-61   
ref|XP_012068757.1|  PREDICTED: uncharacterized protein LOC105631291    184   3e-52   Jatropha curcas
emb|CBI29160.3|  unnamed protein product                                167   6e-46   Vitis vinifera
emb|CDP10151.1|  unnamed protein product                                162   3e-44   Coffea canephora [robusta coffee]
gb|ABK96344.1|  unknown                                                 162   5e-44   Populus trichocarpa x Populus deltoides
ref|XP_002304823.2|  hypothetical protein POPTR_0003s18860g             162   5e-44   Populus trichocarpa [western balsam poplar]
ref|XP_011020515.1|  PREDICTED: uncharacterized protein LOC105122866    160   1e-43   Populus euphratica
gb|KDO48650.1|  hypothetical protein CISIN_1g0162582mg                  154   9e-43   Citrus sinensis [apfelsine]
ref|XP_002276838.1|  PREDICTED: uncharacterized protein LOC100262520    158   1e-42   Vitis vinifera
ref|XP_008445920.1|  PREDICTED: uncharacterized protein LOC103488802    156   1e-41   Cucumis melo [Oriental melon]
ref|XP_006432513.1|  hypothetical protein CICLE_v10001427mg             155   2e-41   Citrus clementina [clementine]
ref|XP_011034631.1|  PREDICTED: uncharacterized protein LOC105132695    154   4e-41   Populus euphratica
ref|XP_011075114.1|  PREDICTED: uncharacterized protein LOC105159...    154   4e-41   Sesamum indicum [beniseed]
ref|XP_004147090.1|  PREDICTED: uncharacterized protein LOC101210945    154   7e-41   Cucumis sativus [cucumbers]
ref|XP_011075118.1|  PREDICTED: uncharacterized protein LOC105159...    152   1e-40   Sesamum indicum [beniseed]
ref|XP_006291209.1|  hypothetical protein CARUB_v10017338mg             154   1e-40   Capsella rubella
ref|XP_010504239.1|  PREDICTED: uncharacterized protein LOC104781301    153   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010427133.1|  PREDICTED: uncharacterized protein LOC104712035    152   8e-40   Camelina sativa [gold-of-pleasure]
emb|CDX78232.1|  BnaA09g34270D                                          151   9e-40   
ref|XP_009116123.1|  PREDICTED: uncharacterized protein LOC103841350    151   1e-39   Brassica rapa
ref|XP_002297702.1|  hypothetical protein POPTR_0001s07350g             150   1e-39   Populus trichocarpa [western balsam poplar]
gb|KCW65832.1|  hypothetical protein EUGRSUZ_G03178                     148   2e-39   Eucalyptus grandis [rose gum]
ref|XP_010067651.1|  PREDICTED: uncharacterized protein LOC104454492    149   2e-39   Eucalyptus grandis [rose gum]
gb|KCW65831.1|  hypothetical protein EUGRSUZ_G03178                     150   3e-39   Eucalyptus grandis [rose gum]
ref|XP_002525579.1|  ubiquitin-protein ligase, putative                 150   3e-39   Ricinus communis
ref|XP_010515962.1|  PREDICTED: uncharacterized protein LOC104791708    149   4e-39   Camelina sativa [gold-of-pleasure]
emb|CDX73486.1|  BnaC08g25170D                                          149   6e-39   
emb|CDX67597.1|  BnaA07g16370D                                          148   9e-39   
ref|NP_191004.1|  zinc ion binding protein                              148   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877973.1|  binding protein                                    148   2e-38   
ref|XP_008782756.1|  PREDICTED: uncharacterized protein LOC103702200    147   3e-38   Phoenix dactylifera
ref|XP_009103916.1|  PREDICTED: uncharacterized protein LOC103829975    146   7e-38   Brassica rapa
ref|XP_010689828.1|  PREDICTED: uncharacterized protein LOC104903488    144   2e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006403583.1|  hypothetical protein EUTSA_v10010421mg             144   5e-37   Eutrema salsugineum [saltwater cress]
gb|ACU19631.1|  unknown                                                 138   6e-37   Glycine max [soybeans]
gb|KJB67761.1|  hypothetical protein B456_010G208800                    141   3e-36   Gossypium raimondii
gb|KHF99857.1|  E3 ubiquitin-protein ligase CHFR                        141   4e-36   Gossypium arboreum [tree cotton]
ref|XP_003522869.1|  PREDICTED: uncharacterized protein LOC100813...    140   6e-36   Glycine max [soybeans]
ref|XP_010533372.1|  PREDICTED: uncharacterized protein LOC104809184    139   1e-35   Tarenaya hassleriana [spider flower]
ref|XP_007148770.1|  hypothetical protein PHAVU_005G012800g             138   5e-35   Phaseolus vulgaris [French bean]
ref|XP_010938114.1|  PREDICTED: uncharacterized protein LOC105057...    139   5e-35   
ref|XP_010921286.1|  PREDICTED: uncharacterized protein LOC105044901    138   7e-35   Elaeis guineensis
ref|XP_010938116.1|  PREDICTED: uncharacterized protein LOC105057...    137   1e-34   
ref|XP_007010628.1|  Zinc ion binding                                   137   1e-34   
gb|KEH32916.1|  zinc ion-binding protein, putative                      137   2e-34   Medicago truncatula
gb|ACU21424.1|  unknown                                                 132   3e-34   Glycine max [soybeans]
ref|XP_004516522.1|  PREDICTED: uncharacterized protein LOC101498396    136   3e-34   Cicer arietinum [garbanzo]
gb|KEH32917.1|  zinc ion-binding protein, putative                      135   5e-34   Medicago truncatula
ref|XP_003527531.1|  PREDICTED: uncharacterized protein LOC100813844    135   7e-34   Glycine max [soybeans]
gb|EYU39947.1|  hypothetical protein MIMGU_mgv1a009191mg                134   8e-34   Erythranthe guttata [common monkey flower]
gb|KHN26422.1|  Polycomb complex protein BMI-1                          134   1e-33   Glycine soja [wild soybean]
ref|XP_010091318.1|  E3 ubiquitin-protein ligase CHFR                   134   3e-33   
ref|XP_010276468.1|  PREDICTED: uncharacterized protein LOC104611195    131   1e-32   Nelumbo nucifera [Indian lotus]
ref|XP_009420238.1|  PREDICTED: uncharacterized protein LOC104000028    130   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010554493.1|  PREDICTED: uncharacterized protein LOC104824200    130   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_008375385.1|  PREDICTED: uncharacterized protein LOC103438629    129   8e-32   
ref|XP_008793368.1|  PREDICTED: uncharacterized protein LOC103709685    129   1e-31   
emb|CDM81302.1|  unnamed protein product                                128   2e-31   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008231724.1|  PREDICTED: uncharacterized protein LOC103330891    128   2e-31   Prunus mume [ume]
ref|XP_007218231.1|  hypothetical protein PRUPE_ppa007956mg             127   3e-31   Prunus persica
gb|KDO48653.1|  hypothetical protein CISIN_1g0162582mg                  121   7e-31   Citrus sinensis [apfelsine]
gb|EMS59099.1|  E3 ubiquitin-protein ligase CHFR                        126   4e-30   Triticum urartu
gb|KHN45782.1|  Polycomb complex protein BMI-1-B                        124   6e-30   Glycine soja [wild soybean]
gb|EMT10100.1|  E3 ubiquitin-protein ligase CHFR                        125   6e-30   
ref|XP_003559441.1|  PREDICTED: uncharacterized protein LOC100832811    123   2e-29   Brachypodium distachyon [annual false brome]
gb|ERM97187.1|  hypothetical protein AMTR_s00119p00030390               119   4e-29   Amborella trichopoda
ref|XP_006829771.2|  PREDICTED: uncharacterized protein LOC18425140     121   8e-29   Amborella trichopoda
ref|XP_006643640.1|  PREDICTED: uncharacterized protein LOC102704921    120   9e-29   Oryza brachyantha
ref|XP_004978719.1|  PREDICTED: E3 ubiquitin-protein ligase CHFR-...    120   2e-28   Setaria italica
ref|XP_004306461.1|  PREDICTED: uncharacterized protein LOC101299030    119   2e-28   Fragaria vesca subsp. vesca
ref|XP_003563481.1|  PREDICTED: E3 ubiquitin-protein ligase CHFR-...    120   2e-28   Brachypodium distachyon [annual false brome]
gb|EEC69773.1|  hypothetical protein OsI_00037                          119   6e-28   Oryza sativa Indica Group [Indian rice]
dbj|BAJ86803.1|  predicted protein                                      118   8e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001754304.1|  predicted protein                                  118   8e-28   
dbj|BAJ90412.1|  predicted protein                                      118   9e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001041762.2|  Os01g0104100                                       117   2e-27   
gb|EPS69962.1|  hypothetical protein M569_04796                         115   5e-27   Genlisea aurea
ref|XP_002444897.1|  hypothetical protein SORBIDRAFT_07g001060          112   2e-25   Sorghum bicolor [broomcorn]
gb|ACG25350.1|  hypothetical protein                                    110   5e-25   Zea mays [maize]
ref|NP_001140913.1|  LOC100272990                                       110   6e-25   Zea mays [maize]
ref|XP_004967927.1|  PREDICTED: E3 ubiquitin-protein ligase CHFR-...    110   6e-25   Setaria italica
ref|NP_001048384.1|  Os02g0795300                                       108   2e-24   
ref|XP_002981629.1|  hypothetical protein SELMODRAFT_154638             107   5e-24   Selaginella moellendorffii
gb|EEC74169.1|  hypothetical protein OsI_09273                          109   6e-24   Oryza sativa Indica Group [Indian rice]
gb|KJB73245.1|  hypothetical protein B456_011G224300                  95.5    4e-20   Gossypium raimondii
gb|KJB73244.1|  hypothetical protein B456_011G224300                  95.1    5e-20   Gossypium raimondii
emb|CDY07544.1|  BnaC06g15200D                                        87.0    5e-17   Brassica napus [oilseed rape]
dbj|BAH20367.1|  AT3G54360                                            81.3    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011402355.1|  hypothetical protein F751_5740                   82.8    7e-15   Auxenochlorella protothecoides
gb|AFW74750.1|  hypothetical protein ZEAMMB73_787325                  76.6    1e-13   
ref|XP_002946777.1|  hypothetical protein VOLCADRAFT_87094            66.6    2e-09   Volvox carteri f. nagariensis
ref|XP_005705744.1|  hypothetical protein isoform 1                   61.6    6e-08   Galdieria sulphuraria
gb|KDD75387.1|  hypothetical protein H632_c708p1                      58.9    8e-08   Helicosporidium sp. ATCC 50920
ref|XP_005705745.1|  hypothetical protein isoform 2                   61.2    8e-08   Galdieria sulphuraria
ref|XP_005844547.1|  hypothetical protein CHLNCDRAFT_58886            59.3    5e-07   Chlorella variabilis
ref|NP_989378.1|  E3 ubiquitin-protein ligase CHFR                    52.0    1e-04   Xenopus tropicalis [western clawed frog]
ref|XP_005432260.1|  PREDICTED: polycomb complex protein BMI-1        49.7    8e-04   



>ref|XP_009765278.1| PREDICTED: uncharacterized protein LOC104216841 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009765279.1| PREDICTED: uncharacterized protein LOC104216841 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009765280.1| PREDICTED: uncharacterized protein LOC104216841 isoform X1 [Nicotiana 
sylvestris]
Length=409

 Score =   228 bits (580),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 128/166 (77%), Gaps = 9/166 (5%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSE-KPKQESGEPAMVPSKCPFVHKQQAGS  319
            M PVCPFV+A+RPDD S+KKPGE+Q+KQ    E KPKQESGE A+V  KCPF +    G 
Sbjct  1    MKPVCPFVRASRPDDTSIKKPGENQNKQPASQESKPKQESGESAIVSPKCPFGY----GQ  56

Query  320  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL  499
            E KP + SGE A  S +CPFGY    G ENK KQ S +   +SPKCP G+DSQ FKLGP 
Sbjct  57   ETKPKEASGESAVASPQCPFGY----GQENKAKQESGESATVSPKCPFGYDSQAFKLGPF  112

Query  500  SCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            SCMICQALLYDCSRCVPCSHVFCK C++RFKDCPLCGAD+EKIE+D
Sbjct  113  SCMICQALLYDCSRCVPCSHVFCKACLSRFKDCPLCGADIEKIESD  158



>ref|XP_009765281.1| PREDICTED: E3 ubiquitin-protein ligase CHFR isoform X2 [Nicotiana 
sylvestris]
Length=347

 Score =   226 bits (575),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 128/166 (77%), Gaps = 9/166 (5%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSE-KPKQESGEPAMVPSKCPFVHKQQAGS  319
            M PVCPFV+A+RPDD S+KKPGE+Q+KQ    E KPKQESGE A+V  KCPF +    G 
Sbjct  1    MKPVCPFVRASRPDDTSIKKPGENQNKQPASQESKPKQESGESAIVSPKCPFGY----GQ  56

Query  320  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL  499
            E KP + SGE A  S +CPFGY    G ENK KQ S +   +SPKCP G+DSQ FKLGP 
Sbjct  57   ETKPKEASGESAVASPQCPFGY----GQENKAKQESGESATVSPKCPFGYDSQAFKLGPF  112

Query  500  SCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            SCMICQALLYDCSRCVPCSHVFCK C++RFKDCPLCGAD+EKIE+D
Sbjct  113  SCMICQALLYDCSRCVPCSHVFCKACLSRFKDCPLCGADIEKIESD  158



>ref|XP_009610506.1| PREDICTED: uncharacterized protein LOC104104198 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610507.1| PREDICTED: uncharacterized protein LOC104104198 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610508.1| PREDICTED: uncharacterized protein LOC104104198 isoform X1 [Nicotiana 
tomentosiformis]
Length=409

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 126/166 (76%), Gaps = 9/166 (5%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSE-KPKQESGEPAMVPSKCPFVHKQQAGS  319
            M PVCPFV+A+RPDD S KKPGE+Q+KQ    E KPKQES E A+V  KCPF +    G 
Sbjct  1    MKPVCPFVRASRPDDTSTKKPGENQNKQPASQESKPKQESRESAIVSPKCPFGY----GQ  56

Query  320  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL  499
            E KP + SGE A VS +CPFGY    G ENK KQ S +   +SPKCP G+DSQ FKLGP 
Sbjct  57   ESKPKEASGESAVVSPQCPFGY----GQENKAKQESGESATVSPKCPFGYDSQAFKLGPF  112

Query  500  SCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            SCMICQALLYDCSRCVPCSHVFCK C+ RFKDCPLCGAD+EKIE+D
Sbjct  113  SCMICQALLYDCSRCVPCSHVFCKACLLRFKDCPLCGADIEKIESD  158



>ref|XP_009610509.1| PREDICTED: E3 ubiquitin-protein ligase CHFR isoform X2 [Nicotiana 
tomentosiformis]
Length=347

 Score =   222 bits (565),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 126/166 (76%), Gaps = 9/166 (5%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSE-KPKQESGEPAMVPSKCPFVHKQQAGS  319
            M PVCPFV+A+RPDD S KKPGE+Q+KQ    E KPKQES E A+V  KCPF +    G 
Sbjct  1    MKPVCPFVRASRPDDTSTKKPGENQNKQPASQESKPKQESRESAIVSPKCPFGY----GQ  56

Query  320  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL  499
            E KP + SGE A VS +CPFGY    G ENK KQ S +   +SPKCP G+DSQ FKLGP 
Sbjct  57   ESKPKEASGESAVVSPQCPFGY----GQENKAKQESGESATVSPKCPFGYDSQAFKLGPF  112

Query  500  SCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            SCMICQALLYDCSRCVPCSHVFCK C+ RFKDCPLCGAD+EKIE+D
Sbjct  113  SCMICQALLYDCSRCVPCSHVFCKACLLRFKDCPLCGADIEKIESD  158



>ref|XP_006351347.1| PREDICTED: uncharacterized protein LOC102597556 isoform X1 [Solanum 
tuberosum]
Length=415

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 125/177 (71%), Gaps = 19/177 (11%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVH-------  301
            M PVCPF  A+RPDDA++ KP +   +Q     +PK+ESGE A V  KCPF +       
Sbjct  1    MIPVCPFAGASRPDDATLNKPHDENKQQA----QPKKESGEAATVSPKCPFGYDSTLKKP  56

Query  302  -----KQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLG  466
                 KQQ G E KP Q+SGE A VS KCPFGY    G E+KPKQ S +   MSPKCP G
Sbjct  57   CDDQNKQQDGQESKPKQDSGESATVSPKCPFGYD---GQESKPKQDSGESATMSPKCPFG  113

Query  467  FDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            +DSQ FKLGP SCMICQALLYD SRCVPCSHVFCK C++RFKDCPLCGAD+EKIEAD
Sbjct  114  YDSQAFKLGPFSCMICQALLYDSSRCVPCSHVFCKACLSRFKDCPLCGADIEKIEAD  170



>ref|XP_006351348.1| PREDICTED: uncharacterized protein LOC102597556 isoform X2 [Solanum 
tuberosum]
Length=400

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 122/165 (74%), Gaps = 10/165 (6%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            M PVCPF  A+RPDDA++ KP +   +Q     +PK+ESGE A V  KCPF +    G E
Sbjct  1    MIPVCPFAGASRPDDATLNKPHDENKQQ----AQPKKESGEAATVSPKCPFGYD---GQE  53

Query  323  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  502
             KP Q+SGE A VS KCPFGY    G E+KPKQ S +   MSPKCP G+DSQ FKLGP S
Sbjct  54   SKPKQDSGESATVSPKCPFGYD---GQESKPKQDSGESATMSPKCPFGYDSQAFKLGPFS  110

Query  503  CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            CMICQALLYD SRCVPCSHVFCK C++RFKDCPLCGAD+EKIEAD
Sbjct  111  CMICQALLYDSSRCVPCSHVFCKACLSRFKDCPLCGADIEKIEAD  155



>ref|XP_004249287.1| PREDICTED: uncharacterized protein LOC101263558 [Solanum lycopersicum]
Length=443

 Score =   208 bits (530),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 130/199 (65%), Gaps = 35/199 (18%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVH-------  301
            M PVCPF  A+RPDDA++ KP + ++KQ     KPK+ESGE A V  KCPF +       
Sbjct  1    MIPVCPFAGASRPDDATLNKPYD-ENKQQAQESKPKKESGEVATVSPKCPFGYDSTLKKP  59

Query  302  -----KQQAGSEIKPNQESGEQAKVSSKCPFGYT-QEA---------------------G  400
                 KQQ G E KP Q+SGE A VS KCPFGY  QE+                     G
Sbjct  60   CDDQNKQQDGQESKPKQDSGESATVSPKCPFGYDGQESKPKQDSGESATVSPKCPFGYDG  119

Query  401  GENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCI  580
             ++KPKQ S +   MSPKCP G+DSQ FKLGP SCMICQALLY+ SRCVPCSHVFCK C+
Sbjct  120  QKSKPKQDSGESATMSPKCPFGYDSQAFKLGPFSCMICQALLYESSRCVPCSHVFCKACL  179

Query  581  TRFKDCPLCGADVEKIEAD  637
            +RFKDCPLCGAD+EKIEAD
Sbjct  180  SRFKDCPLCGADIEKIEAD  198



>ref|XP_012068757.1| PREDICTED: uncharacterized protein LOC105631291 [Jatropha curcas]
 gb|KDP40599.1| hypothetical protein JCGZ_24598 [Jatropha curcas]
Length=393

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 118/168 (70%), Gaps = 27/168 (16%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSE--KPKQESGEPAMV-PSKCPFVHKQQA  313
            MTPVCPFVKAARPDD+S+KKPGE+ SK HG     K K++SG+ A   P+KCPF +    
Sbjct  1    MTPVCPFVKAARPDDSSLKKPGENPSK-HGAEHDGKGKKDSGDSATASPAKCPFGY----  55

Query  314  GSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLG  493
                       + A  S KCP GY   +         S K G +SPKCPLG+DSQ+FK+G
Sbjct  56   -----------DSANASPKCPVGYDSAS--------TSPKSGSISPKCPLGYDSQSFKIG  96

Query  494  PLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            PLSC++CQALL++ S+CVPCSHVFCK CI+RF+DCPLCGAD+EKIEAD
Sbjct  97   PLSCILCQALLFESSKCVPCSHVFCKACISRFRDCPLCGADIEKIEAD  144



>emb|CBI29160.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   167 bits (424),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 104/171 (61%), Gaps = 45/171 (26%)
 Frame = +2

Query  125  HGLLIKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHK  304
            H LLIKMTPVCPFVKAARPDDA+ +KP E                         CP  HK
Sbjct  20   HVLLIKMTPVCPFVKAARPDDATSRKPNE-------------------------CP--HK  52

Query  305  QQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTF  484
             Q   E K  ++SG+ A                    K+ S     +SPKCP G+DSQTF
Sbjct  53   HQLELEGKGKKDSGDSAST------------------KKDSVDAASISPKCPFGYDSQTF  94

Query  485  KLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            KLGPLSCMICQALL++ S+CVPCSHV+CK CI+RFKDCPLCGAD+EKIEAD
Sbjct  95   KLGPLSCMICQALLFESSKCVPCSHVYCKACISRFKDCPLCGADIEKIEAD  145



>emb|CDP10151.1| unnamed protein product [Coffea canephora]
Length=371

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 99/168 (59%), Gaps = 50/168 (30%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            MT VCPF KA RPDDA+VKK  E+QSK                                 
Sbjct  1    MTTVCPFAKAGRPDDAAVKKCPENQSK---------------------------------  27

Query  323  IKPNQESGEQAKVSSKCPFGY---TQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLG  493
                          SKCPFGY   T  AG E+KP+Q S +   ++PKCP G+DS TFKLG
Sbjct  28   --------------SKCPFGYDSATSAAGNESKPEQESGESARVTPKCPFGYDSDTFKLG  73

Query  494  PLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            P SCMICQALL+DCS+C+PCSHV+CKVCI R KDCPLCGAD+EKIE D
Sbjct  74   PFSCMICQALLFDCSKCIPCSHVYCKVCILRLKDCPLCGADIEKIEPD  121



>gb|ABK96344.1| unknown [Populus trichocarpa x Populus deltoides]
Length=363

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 103/165 (62%), Gaps = 52/165 (32%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            MTPVCPFVKA+RPDD S +KPGE                         CP  H    G+E
Sbjct  1    MTPVCPFVKASRPDDGSPRKPGE-------------------------CPIKH----GAE  31

Query  323  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  502
                 E G +AK          +E+GGE+           +SPKCP G+DSQTFKLGPLS
Sbjct  32   ----HEGGGKAK----------KESGGES---------ATVSPKCPFGYDSQTFKLGPLS  68

Query  503  CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            CMICQALL+DCS+CVPCSHV+CKVCI+RFKDCPLCGADVEKIEAD
Sbjct  69   CMICQALLFDCSKCVPCSHVYCKVCISRFKDCPLCGADVEKIEAD  113



>ref|XP_002304823.2| hypothetical protein POPTR_0003s18860g [Populus trichocarpa]
 gb|EEE79802.2| hypothetical protein POPTR_0003s18860g [Populus trichocarpa]
Length=371

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 103/165 (62%), Gaps = 52/165 (32%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            MTPVCPFVKA+RPDD S +KPGE                         CP  H    G+E
Sbjct  1    MTPVCPFVKASRPDDGSPRKPGE-------------------------CPIKH----GAE  31

Query  323  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  502
                 E G +AK          +E+GGE+           +SPKCP G+DSQTFKLGPLS
Sbjct  32   ----HEGGGKAK----------KESGGES---------ATVSPKCPFGYDSQTFKLGPLS  68

Query  503  CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            CMICQALL+DCS+CVPCSHV+CKVCI+RFKDCPLCGADVEKIEAD
Sbjct  69   CMICQALLFDCSKCVPCSHVYCKVCISRFKDCPLCGADVEKIEAD  113



>ref|XP_011020515.1| PREDICTED: uncharacterized protein LOC105122866 [Populus euphratica]
Length=363

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 98/165 (59%), Gaps = 52/165 (32%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            MTPVCPFVKA+RPDD S +KPGE                         CP  H       
Sbjct  1    MTPVCPFVKASRPDDGSPRKPGE-------------------------CPIKH-------  28

Query  323  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  502
                               G   E GG+ K K+ S +   +SPKCP G+DSQTFKLGPLS
Sbjct  29   -------------------GAEHEGGGKAK-KESSGESATVSPKCPFGYDSQTFKLGPLS  68

Query  503  CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            CMICQALL+DCS+CVPCSHV+CKVCI+RFKDCPLCGADVEKIEAD
Sbjct  69   CMICQALLFDCSKCVPCSHVYCKVCISRFKDCPLCGADVEKIEAD  113



>gb|KDO48650.1| hypothetical protein CISIN_1g0162582mg, partial [Citrus sinensis]
 gb|KDO48651.1| hypothetical protein CISIN_1g0162582mg, partial [Citrus sinensis]
 gb|KDO48652.1| hypothetical protein CISIN_1g0162582mg, partial [Citrus sinensis]
Length=192

 Score =   154 bits (388),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 106/165 (64%), Gaps = 29/165 (18%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            MTPVCPF KA RPDDAS +KPGE+ +K                  P++CPF       S+
Sbjct  1    MTPVCPFAKA-RPDDASPRKPGENSNK-----------------YPAECPF-------SK  35

Query  323  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  502
             +P+  +  +A  +S  P    Q     +K K  S     + PKCP G+D+Q+FK+GPLS
Sbjct  36   ARPDDAASRKAVENSAKP----QAEHDGDKAKSDSMDSASIPPKCPFGYDAQSFKIGPLS  91

Query  503  CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            CMICQALL++CS+C PCSHV+CK CI+RFKDCPLCGAD+EKIEAD
Sbjct  92   CMICQALLFECSKCTPCSHVYCKACISRFKDCPLCGADIEKIEAD  136



>ref|XP_002276838.1| PREDICTED: uncharacterized protein LOC100262520 [Vitis vinifera]
 ref|XP_010659029.1| PREDICTED: uncharacterized protein LOC100262520 [Vitis vinifera]
 ref|XP_010659030.1| PREDICTED: uncharacterized protein LOC100262520 [Vitis vinifera]
 ref|XP_010659031.1| PREDICTED: uncharacterized protein LOC100262520 [Vitis vinifera]
Length=369

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 99/165 (60%), Gaps = 45/165 (27%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            MTPVCPFVKAARPDDA+ +KP E                         CP  HK Q   E
Sbjct  1    MTPVCPFVKAARPDDATSRKPNE-------------------------CP--HKHQLELE  33

Query  323  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  502
             K  ++SG+ A                    K+ S     +SPKCP G+DSQTFKLGPLS
Sbjct  34   GKGKKDSGDSAST------------------KKDSVDAASISPKCPFGYDSQTFKLGPLS  75

Query  503  CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            CMICQALL++ S+CVPCSHV+CK CI+RFKDCPLCGAD+EKIEAD
Sbjct  76   CMICQALLFESSKCVPCSHVYCKACISRFKDCPLCGADIEKIEAD  120



>ref|XP_008445920.1| PREDICTED: uncharacterized protein LOC103488802 [Cucumis melo]
Length=404

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 104/175 (59%), Gaps = 36/175 (21%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKK-PGESQ-------SKQHGGSEKPKQESGEPAMVPSKCPFV  298
            MTPVCPFVK+ARPDDAS +K  GES              S KP+ ES         CPF 
Sbjct  1    MTPVCPFVKSARPDDASSRKHQGESACPFAKSGRSDDASSRKPQSESA--------CPFS  52

Query  299  H--KQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFD  472
               +    S ++ NQ  GE     ++   G    AGG                KCP G+D
Sbjct  53   KSVRSDDASSLEKNQAEGESN--GAEKDVGDAAGAGG----------------KCPFGYD  94

Query  473  SQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            SQTFK+GPLSCMICQALL++CSRCVPCSH+FCK CI+RF DCPLCGAD+EK+EAD
Sbjct  95   SQTFKIGPLSCMICQALLFECSRCVPCSHIFCKACISRFNDCPLCGADIEKVEAD  149



>ref|XP_006432513.1| hypothetical protein CICLE_v10001427mg [Citrus clementina]
 ref|XP_006432514.1| hypothetical protein CICLE_v10001427mg [Citrus clementina]
 ref|XP_006471276.1| PREDICTED: uncharacterized protein LOC102626165 [Citrus sinensis]
 gb|ESR45753.1| hypothetical protein CICLE_v10001427mg [Citrus clementina]
 gb|ESR45754.1| hypothetical protein CICLE_v10001427mg [Citrus clementina]
Length=392

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 106/165 (64%), Gaps = 29/165 (18%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            MTPVCPF KA RPDDAS +KPGE+ +K                  P++CPF       S+
Sbjct  1    MTPVCPFAKA-RPDDASPRKPGENSNK-----------------YPAECPF-------SK  35

Query  323  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  502
             +P+  +  +A  +S  P    Q     +K K  S     + PKCP G+D+Q+FK+GPLS
Sbjct  36   ARPDDAASRKAVENSAKP----QAEHDGDKAKSDSIDSASIPPKCPFGYDAQSFKIGPLS  91

Query  503  CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            CMICQALL++CS+C PCSHV+CK CI+RFKDCPLCGAD+EKIEAD
Sbjct  92   CMICQALLFECSKCTPCSHVYCKACISRFKDCPLCGADIEKIEAD  136



>ref|XP_011034631.1| PREDICTED: uncharacterized protein LOC105132695 [Populus euphratica]
 ref|XP_011034632.1| PREDICTED: uncharacterized protein LOC105132695 [Populus euphratica]
 ref|XP_011034633.1| PREDICTED: uncharacterized protein LOC105132695 [Populus euphratica]
Length=363

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 95/165 (58%), Gaps = 52/165 (32%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            MTPVCPFVKA+RPDD S +KPGE                         CP  H  +    
Sbjct  1    MTPVCPFVKASRPDDGSSRKPGE-------------------------CPEKHAAE----  31

Query  323  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  502
                                   E GG+ K + V     V SPKCP G+DSQTFKLGP S
Sbjct  32   ----------------------HEGGGKAKEESVGASATV-SPKCPFGYDSQTFKLGPHS  68

Query  503  CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            CMICQALL+DCS+CVPCSHV+CKVCI+RFKDCPLCGAD+E+IEAD
Sbjct  69   CMICQALLFDCSKCVPCSHVYCKVCISRFKDCPLCGADIERIEAD  113



>ref|XP_011075114.1| PREDICTED: uncharacterized protein LOC105159671 isoform X1 [Sesamum 
indicum]
 ref|XP_011075115.1| PREDICTED: uncharacterized protein LOC105159671 isoform X1 [Sesamum 
indicum]
 ref|XP_011075116.1| PREDICTED: uncharacterized protein LOC105159671 isoform X1 [Sesamum 
indicum]
 ref|XP_011075117.1| PREDICTED: uncharacterized protein LOC105159671 isoform X1 [Sesamum 
indicum]
Length=353

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 97/165 (59%), Gaps = 59/165 (36%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            MTPVCPF+KA+RPDDAS KKP E+Q                           +KQQA ++
Sbjct  1    MTPVCPFIKASRPDDASGKKPSENQ---------------------------NKQQAVND  33

Query  323  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  502
             KP Q+S                                 +SPKCP G+DSQTFKLGPLS
Sbjct  34   NKPQQDSA--------------------------------ISPKCPFGYDSQTFKLGPLS  61

Query  503  CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            C+ICQALL++CS+CVPCSHV+CK CI+RFKDCPLCGAD+EKIE D
Sbjct  62   CVICQALLFECSKCVPCSHVYCKACISRFKDCPLCGADIEKIEDD  106



>ref|XP_004147090.1| PREDICTED: uncharacterized protein LOC101210945 [Cucumis sativus]
 gb|KGN51585.1| hypothetical protein Csa_5G581690 [Cucumis sativus]
Length=404

 Score =   154 bits (389),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 102/175 (58%), Gaps = 36/175 (21%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKK-PGESQ-------SKQHGGSEKPKQESGEPAMVPSKCPFV  298
            MTPVCPFVK+ARPDDAS +K  GES              S KP+ ES         CP  
Sbjct  1    MTPVCPFVKSARPDDASSRKHQGESACPFAKSGRSDDASSRKPQSESA--------CPVS  52

Query  299  H--KQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFD  472
               +    S +K NQ                  EA      K V++  G    KCP G+D
Sbjct  53   KSVRSDDASSLKKNQ-----------------AEAESNGAEKDVADAAGA-GGKCPFGYD  94

Query  473  SQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            SQTFK+GPLSCMICQALL++CSRCVPC+H+FCK CI+RF DCPLCGAD+EKIEAD
Sbjct  95   SQTFKIGPLSCMICQALLFECSRCVPCTHIFCKACISRFNDCPLCGADIEKIEAD  149



>ref|XP_011075118.1| PREDICTED: uncharacterized protein LOC105159671 isoform X2 [Sesamum 
indicum]
Length=314

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 97/165 (59%), Gaps = 59/165 (36%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            MTPVCPF+KA+RPDDAS KKP E+Q                           +KQQA ++
Sbjct  1    MTPVCPFIKASRPDDASGKKPSENQ---------------------------NKQQAVND  33

Query  323  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  502
             KP Q+S                                 +SPKCP G+DSQTFKLGPLS
Sbjct  34   NKPQQDSA--------------------------------ISPKCPFGYDSQTFKLGPLS  61

Query  503  CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            C+ICQALL++CS+CVPCSHV+CK CI+RFKDCPLCGAD+EKIE D
Sbjct  62   CVICQALLFECSKCVPCSHVYCKACISRFKDCPLCGADIEKIEDD  106



>ref|XP_006291209.1| hypothetical protein CARUB_v10017338mg [Capsella rubella]
 gb|EOA24107.1| hypothetical protein CARUB_v10017338mg [Capsella rubella]
Length=415

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 106/172 (62%), Gaps = 23/172 (13%)
 Frame = +2

Query  146  TPVCPFVKAARPDDASVKKPGESQ------SKQHGGSEKPKQESGEPAMVPSKCPFVHKQ  307
            T VCPF KAARPDD S++K GE        SK     +   ++ GE A   S CPF    
Sbjct  3    TSVCPFSKAARPDDVSIRKQGEMNASGCPFSKAARPDDASARKQGETA--ASGCPF----  56

Query  308  QAGSEIKPNQESG-EQAKVSSK-CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQT  481
                  +P+  S   Q ++S+K CP    ++ G  NK    S     +  KCP G+DSQT
Sbjct  57   --SKSARPDDASARNQGEISNKGCP----EDEGKLNKD---STDSATVPAKCPFGYDSQT  107

Query  482  FKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            FKLGP SCM+CQALLY+ SRCVPC+HVFCKVC+ RFKDCPLCGAD+E IEAD
Sbjct  108  FKLGPFSCMLCQALLYESSRCVPCTHVFCKVCLARFKDCPLCGADIESIEAD  159



>ref|XP_010504239.1| PREDICTED: uncharacterized protein LOC104781301 [Camelina sativa]
Length=417

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 108/172 (63%), Gaps = 21/172 (12%)
 Frame = +2

Query  146  TPVCPFVKAARPDDAS-VKKPGES-------QSKQHGGSEKPKQESGEPAMVPSKCPFVH  301
            T VCPF KAARPDDAS  +K GE+        SK     +   ++ GE A   S CPF  
Sbjct  3    TSVCPFSKAARPDDASSTRKQGETAASGCPFSSKAARPDDASARKQGETA--ASGCPF--  58

Query  302  KQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQT  481
             + A S+    ++ GE A  S  CP    +E G  NK    S     +  KCP G+DSQT
Sbjct  59   SKSARSDDASARKKGEIA--SKGCP----EEEGKLNKD---STDSATVPAKCPFGYDSQT  109

Query  482  FKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            FKLGP SCM+CQALLYD SRCVPC+HVFCKVC++RFKDCPLCGAD+E I+AD
Sbjct  110  FKLGPFSCMLCQALLYDSSRCVPCTHVFCKVCLSRFKDCPLCGADIESIQAD  161



>ref|XP_010427133.1| PREDICTED: uncharacterized protein LOC104712035 [Camelina sativa]
Length=417

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 108/174 (62%), Gaps = 25/174 (14%)
 Frame = +2

Query  146  TPVCPFVKAARPDDAS-VKKPGES-------QSKQHGGSEKPKQESGEPAMVPSKCPFVH  301
            T VCPF KAARPDDAS  +K G+         SK     +   ++ GE A   S CPF  
Sbjct  3    TSVCPFSKAARPDDASSTRKQGDMTASGCPFSSKAARPDDASARKQGETA--ASGCPF--  58

Query  302  KQQAGSEIKPNQESG-EQAKVSSK-CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDS  475
                    +P+  S  +Q +++SK CP    +E G  NK    S     +  KCP G+DS
Sbjct  59   ----SKSARPDDASARKQGEIASKGCP----EEEGKLNKD---STDSATVPAKCPFGYDS  107

Query  476  QTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            QTFKLGP SCM+CQALLYD SRCVPC+HVFCKVC+TRFKDCPLCGAD+E I+AD
Sbjct  108  QTFKLGPFSCMLCQALLYDSSRCVPCTHVFCKVCLTRFKDCPLCGADIESIQAD  161



>emb|CDX78232.1| BnaA09g34270D [Brassica napus]
Length=409

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 103/168 (61%), Gaps = 19/168 (11%)
 Frame = +2

Query  146  TPVCPFVKAARPDDASVKKPGESQSKQ---HGGSEKPKQESGEPAMVPSKCPFVHKQQAG  316
            T VCPF KAARPDDAS  +     +        ++   ++ GE     S CPF       
Sbjct  3    TSVCPFSKAARPDDASAARKQADTTPSACPFSKADASARKQGET--TASACPFS------  54

Query  317  SEIKPNQESGEQAKVSSK-CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLG  493
               K +  + +Q +V+SK CP    +  G  NK +  +     +  KCP G+DSQTFKLG
Sbjct  55   ---KSDASARKQGEVASKGCP----ENEGRVNKEEDSTPDSATVPAKCPFGYDSQTFKLG  107

Query  494  PLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            P SCM+CQALLYD SRCVPC+HVFCKVC++RFKDCPLCGADVE IEAD
Sbjct  108  PFSCMLCQALLYDSSRCVPCTHVFCKVCVSRFKDCPLCGADVESIEAD  155



>ref|XP_009116123.1| PREDICTED: uncharacterized protein LOC103841350 [Brassica rapa]
Length=409

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 101/168 (60%), Gaps = 19/168 (11%)
 Frame = +2

Query  146  TPVCPFVKAARPDDASVKKPGESQSKQ---HGGSEKPKQESGEPAMVPSKCPFVHKQQAG  316
            T VCPF KAARPDDAS  +     +        ++   ++ GE     S CPF       
Sbjct  3    TSVCPFSKAARPDDASASRKQADTTPSVCPFSKADASARKQGET--TASGCPFS------  54

Query  317  SEIKPNQESGEQAKVSSK-CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLG  493
               K +  + +Q +V+SK CP       G  NK +  +     +  KCP G+DSQTFKLG
Sbjct  55   ---KSDASARKQGEVASKGCPVN----EGRVNKEEDSTTDSATVPAKCPFGYDSQTFKLG  107

Query  494  PLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            P SCM+CQALLYD SRCVPC+HVFCKVC+ RFKDCPLCGADVE IEAD
Sbjct  108  PFSCMLCQALLYDSSRCVPCTHVFCKVCVARFKDCPLCGADVESIEAD  155



>ref|XP_002297702.1| hypothetical protein POPTR_0001s07350g [Populus trichocarpa]
 gb|EEE82507.1| hypothetical protein POPTR_0001s07350g [Populus trichocarpa]
Length=363

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 93/165 (56%), Gaps = 52/165 (32%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            MT VCP VKA+RPDD S +KPGE                         CP  H  +    
Sbjct  1    MTTVCPLVKASRPDDGSSRKPGE-------------------------CPEKHAAE----  31

Query  323  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  502
                                   E GG+ K + V     V SPKCP G+DSQTFKLGP S
Sbjct  32   ----------------------HEGGGKAKKESVGASATV-SPKCPFGYDSQTFKLGPHS  68

Query  503  CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            CMICQALL+DCS+CVPCSHV+CKVCI+RFKDCPLCGAD+E+IEAD
Sbjct  69   CMICQALLFDCSKCVPCSHVYCKVCISRFKDCPLCGADIERIEAD  113



>gb|KCW65832.1| hypothetical protein EUGRSUZ_G03178 [Eucalyptus grandis]
Length=301

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 97/165 (59%), Gaps = 49/165 (30%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            M PVCPFVKA+RP+DA    P  S  K                         H+++AG++
Sbjct  1    MKPVCPFVKASRPEDA----PPPSSRK-------------------------HQKEAGAD  31

Query  323  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  502
                      A VS KCPFGY                 G +SPKCPLG+DSQTFKLGPLS
Sbjct  32   ---------PASVSPKCPFGY-----------DAPPDSGAISPKCPLGYDSQTFKLGPLS  71

Query  503  CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            CMICQALL+DC++CVPCSHVFCK CI RFKDCPLCGAD+E  EAD
Sbjct  72   CMICQALLFDCAKCVPCSHVFCKACILRFKDCPLCGADIEGTEAD  116



>ref|XP_010067651.1| PREDICTED: uncharacterized protein LOC104454492 [Eucalyptus grandis]
 ref|XP_010067652.1| PREDICTED: uncharacterized protein LOC104454492 [Eucalyptus grandis]
 gb|KCW65829.1| hypothetical protein EUGRSUZ_G03178 [Eucalyptus grandis]
 gb|KCW65830.1| hypothetical protein EUGRSUZ_G03178 [Eucalyptus grandis]
Length=366

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 99/165 (60%), Gaps = 49/165 (30%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            M PVCPFVKA+RP+DA    P  S  K                         H+++AG++
Sbjct  1    MKPVCPFVKASRPEDA----PPPSSRK-------------------------HQKEAGAD  31

Query  323  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  502
                      A VS KCPFGY       + P       G +SPKCPLG+DSQTFKLGPLS
Sbjct  32   ---------PASVSPKCPFGY-------DAPPD----SGAISPKCPLGYDSQTFKLGPLS  71

Query  503  CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            CMICQALL+DC++CVPCSHVFCK CI RFKDCPLCGAD+E  EAD
Sbjct  72   CMICQALLFDCAKCVPCSHVFCKACILRFKDCPLCGADIEGTEAD  116



>gb|KCW65831.1| hypothetical protein EUGRSUZ_G03178 [Eucalyptus grandis]
Length=396

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 99/165 (60%), Gaps = 49/165 (30%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            M PVCPFVKA+RP+DA    P  S  K                         H+++AG++
Sbjct  1    MKPVCPFVKASRPEDA----PPPSSRK-------------------------HQKEAGAD  31

Query  323  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  502
                      A VS KCPFGY       + P       G +SPKCPLG+DSQTFKLGPLS
Sbjct  32   ---------PASVSPKCPFGY-------DAPPD----SGAISPKCPLGYDSQTFKLGPLS  71

Query  503  CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            CMICQALL+DC++CVPCSHVFCK CI RFKDCPLCGAD+E  EAD
Sbjct  72   CMICQALLFDCAKCVPCSHVFCKACILRFKDCPLCGADIEGTEAD  116



>ref|XP_002525579.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF36838.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=392

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 106/170 (62%), Gaps = 36/170 (21%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            MTPVCPFVKA+RPDD+  KK  E+QSK                         H Q+   E
Sbjct  1    MTPVCPFVKASRPDDSPAKKTSENQSK-------------------------HGQEL--E  33

Query  323  IKPNQES---GEQAKVSS-KCPFGY-TQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFK  487
            +K  +ES   G+    +S KCPFGY +  A     PK  +  P     KCPLG+DS++FK
Sbjct  34   LKAKKESCGGGDSVNSNSPKCPFGYDSVNADANASPKSAATIPA----KCPLGYDSRSFK  89

Query  488  LGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            +GPLSC+ICQALL+D ++CVPC+H+FCK C++ F+DCPLCGAD+EK EA+
Sbjct  90   IGPLSCIICQALLFDTTKCVPCNHIFCKACVSPFRDCPLCGADIEKFEAE  139



>ref|XP_010515962.1| PREDICTED: uncharacterized protein LOC104791708 [Camelina sativa]
Length=408

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 102/176 (58%), Gaps = 38/176 (22%)
 Frame = +2

Query  146  TPVCPFVKAARPDDAS-VKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            T VCPF KAARPDDAS  +K G+                    M  S CPF  K  A  +
Sbjct  3    TSVCPFSKAARPDDASSTRKQGD--------------------MTASGCPFSSKA-ARPD  41

Query  323  IKPNQESGEQAKVSSKCPFGYT-----------QEAGGENKPKQVSEKPGVMSPKCPLGF  469
                ++ GE A  +S CPF  +           +E G  NK    S     +  KCP G+
Sbjct  42   DASARKQGETA--ASGCPFSKSARPDDGSKGCPEEEGKLNKD---STDSATVPAKCPFGY  96

Query  470  DSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            DSQTFKLGP SCM+CQALLYD SRCVPC+HVFCKVC+TRFKDCPLCGAD+E I+AD
Sbjct  97   DSQTFKLGPFSCMLCQALLYDSSRCVPCTHVFCKVCLTRFKDCPLCGADIESIQAD  152



>emb|CDX73486.1| BnaC08g25170D [Brassica napus]
Length=409

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 104/167 (62%), Gaps = 18/167 (11%)
 Frame = +2

Query  146  TPVCPFVKAARPDDASVKKPGESQSKQ--HGGSEKPKQESGEPAMVPSKCPFVHKQQAGS  319
            T VCPF KAARPDDAS +K  ++         ++   ++ GE     S CPF        
Sbjct  3    TSVCPFSKAARPDDASARKQADTTPSACPFSKADAFARKQGET--TASACPFS-------  53

Query  320  EIKPNQESGEQAKVSSK-CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGP  496
              K +  + +Q +V+SK CP    +  G   K +  +     +  KCP G+DSQTFKLGP
Sbjct  54   --KSDASARKQGEVASKGCP----ENEGIVQKEEDSTTDSATVPAKCPFGYDSQTFKLGP  107

Query  497  LSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
             SCM+CQALL++ SRCVPC+HVFCKVC++RFKDCPLCGADVE IEAD
Sbjct  108  FSCMLCQALLFESSRCVPCTHVFCKVCVSRFKDCPLCGADVESIEAD  154



>emb|CDX67597.1| BnaA07g16370D [Brassica napus]
Length=401

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 96/170 (56%), Gaps = 31/170 (18%)
 Frame = +2

Query  146  TPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI  325
            T VCPF KAARPD+AS                 PKQ        PS CPF          
Sbjct  3    TSVCPFSKAARPDNAS---------------SAPKQAD----TTPSACPF------SKST  37

Query  326  KPNQESGEQAKVSSKCPFGYTQEAGG------ENKPKQVSEKPGVMSPKCPLGFDSQTFK  487
            +P+     +   S+ CPF  + +A        E + +   E    +  KCP G+DSQTFK
Sbjct  38   RPDDTKQGETTASAACPFSKSADASAPSKGCPEKEGRLSKEDSATVPAKCPFGYDSQTFK  97

Query  488  LGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            LGP SCM+CQ+LL+D +RCVPC+HVFCKVC+ RFKDCPLCGAD+E IEAD
Sbjct  98   LGPFSCMLCQSLLFDSTRCVPCTHVFCKVCLARFKDCPLCGADIESIEAD  147



>ref|NP_191004.1| zinc ion binding protein [Arabidopsis thaliana]
 gb|AAK95259.1|AF410273_1 AT3g54360/T12E18_50 [Arabidopsis thaliana]
 emb|CAB81801.1| RING finger-like protein [Arabidopsis thaliana]
 gb|AAM63273.1| RING finger-like protein [Arabidopsis thaliana]
 gb|AAN18187.1| At3g54360/T12E18_50 [Arabidopsis thaliana]
 gb|AEE79220.1| zinc ion binding protein [Arabidopsis thaliana]
Length=405

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 99/178 (56%), Gaps = 37/178 (21%)
 Frame = +2

Query  137  IKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAG  316
            +  T VCPF KAARPDD S +K GE                    +  S CPF       
Sbjct  1    MTTTSVCPFSKAARPDDGSTRKQGE--------------------ITASGCPF------S  34

Query  317  SEIKPNQESGEQ--AKVSSKCPFGYT---QEAGGENKPKQV------SEKPGVMSPKCPL  463
               +P+  S  +     +S CPF  +    E G +  P+Q       S     +  KCP 
Sbjct  35   KAARPDDASARKQGETTASGCPFSKSARPDENGSKGCPEQEGNLNKDSTDSATVPAKCPF  94

Query  464  GFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            G+DSQTFKLGP SCM+CQALLY+ SRCVPC+HVFCKVC+TRFKDCPLCGAD+E IE D
Sbjct  95   GYDSQTFKLGPFSCMLCQALLYESSRCVPCTHVFCKVCLTRFKDCPLCGADIESIEVD  152



>ref|XP_002877973.1| binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54232.1| binding protein [Arabidopsis lyrata subsp. lyrata]
Length=415

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 105/172 (61%), Gaps = 23/172 (13%)
 Frame = +2

Query  146  TPVCPFVKAARPDDASVKKPGESQ------SKQHGGSEKPKQESGEPAMVPSKCPFVHKQ  307
            T VCPF KAARPDDAS +K G++       SK     +   ++ GE  +  S CPF    
Sbjct  3    TSVCPFSKAARPDDASTRKQGDTAASGCPFSKAARPDDASARKQGE--ITASGCPF----  56

Query  308  QAGSEIKPNQESG-EQAKVSSK-CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQT  481
                  +P+  S  +Q +++S  CP    +  G  NK    S     +  KCP G+DSQT
Sbjct  57   --SKAARPDDASARKQDEIASNGCP----EHEGKLNKD---STDSATVPAKCPFGYDSQT  107

Query  482  FKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            FKLGP SCM+CQALLY+ SRCVPC+HVFCKVC++RF DCPLCGAD+E IE D
Sbjct  108  FKLGPFSCMLCQALLYESSRCVPCTHVFCKVCVSRFNDCPLCGADIESIEVD  159



>ref|XP_008782756.1| PREDICTED: uncharacterized protein LOC103702200 [Phoenix dactylifera]
Length=428

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 103/176 (59%), Gaps = 11/176 (6%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGG-SEKPKQESGEPAMVPSKCPFVH-----K  304
            M+ VCPF KAA    +   K  E+ S+Q     +K   +S +   V   CP  H     +
Sbjct  1    MSFVCPFAKAAGAGASYPMKHEENHSRQQAECDDKGDTKSNDSTSVGDGCPMKHEGNYNR  60

Query  305  QQAGSEIKPNQESGEQAKVSSKCPFGY-----TQEAGGENKPKQVSEKPGVMSPKCPLGF  469
             QA  + K + +S +   V   CP  +       +A  ++K    S    V+SPKCP G+
Sbjct  61   HQAECDDKVDTKSNDSTSVGGGCPMKHEGNYNRHQAECDDKVDTKSNDSAVISPKCPFGY  120

Query  470  DSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            DS TFKLGPLSCMICQALLY  S+C+PCSH FCK CI+RFKDCPLCGAD+EKIE D
Sbjct  121  DSHTFKLGPLSCMICQALLYQSSKCLPCSHKFCKACISRFKDCPLCGADIEKIEPD  176



>ref|XP_009103916.1| PREDICTED: uncharacterized protein LOC103829975 [Brassica rapa]
Length=401

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 98/170 (58%), Gaps = 31/170 (18%)
 Frame = +2

Query  146  TPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI  325
            T VCPF KAARPD+AS                 PKQ        PS CPF    ++    
Sbjct  3    TSVCPFSKAARPDNAS---------------SAPKQAD----TTPSACPFSKAARSD---  40

Query  326  KPNQESGEQAKVSSKCPFGYTQEAGG------ENKPKQVSEKPGVMSPKCPLGFDSQTFK  487
              + + GE    S+ CPF  + +A        E + +   E    +  KCP G+DSQTFK
Sbjct  41   --DAKQGE-TTASAACPFSKSADASAPSKGCPEKEGRLSKEDSATVPAKCPFGYDSQTFK  97

Query  488  LGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            LGP SCM+CQ+LL+D +RCVPC+HVFCKVC+ RFKDCPLCGAD+E IEAD
Sbjct  98   LGPFSCMLCQSLLFDSTRCVPCTHVFCKVCLARFKDCPLCGADIESIEAD  147



>ref|XP_010689828.1| PREDICTED: uncharacterized protein LOC104903488 [Beta vulgaris 
subsp. vulgaris]
Length=363

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 93/165 (56%), Gaps = 55/165 (33%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            MTPVCPFVK ARPDDAS K+ GE+Q                                   
Sbjct  1    MTPVCPFVKVARPDDASSKRNGENQ-----------------------------------  25

Query  323  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  502
               N+ + E                  E+K K  S    ++ PKCPLG+DS +FK+GPLS
Sbjct  26   ---NKHAAEH-----------------ESKSKNESVDSAMIEPKCPLGYDSHSFKIGPLS  65

Query  503  CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            C++CQALL++ S+CVPCSH+FCK CI+RFKDCPLCGAD+EKIE+D
Sbjct  66   CVLCQALLFESSKCVPCSHIFCKACISRFKDCPLCGADIEKIESD  110



>ref|XP_006403583.1| hypothetical protein EUTSA_v10010421mg [Eutrema salsugineum]
 gb|ESQ45036.1| hypothetical protein EUTSA_v10010421mg [Eutrema salsugineum]
Length=408

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 100/175 (57%), Gaps = 37/175 (21%)
 Frame = +2

Query  146  TPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI  325
            T VCPF KAARPDDAS +K GE                    +  S CPF          
Sbjct  3    TSVCPFSKAARPDDASARKQGE--------------------VTASGCPF------SKAA  36

Query  326  KPNQESG-EQAKVS-SKCPFGYT------QEAGGENKPK---QVSEKPGVMSPKCPLGFD  472
            +P+  S  +Q +V+ S CPF          E   +  PK   + S     +  KCP G+D
Sbjct  37   RPDDASARKQGEVTASGCPFSKAARPNEGDEMASKESPKLESRDSTASATVPAKCPFGYD  96

Query  473  SQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            SQTFKLGP SCM+CQALLY+ SRCVPC+HVFCKVC++RFKDCPLCGAD+E I+ D
Sbjct  97   SQTFKLGPFSCMLCQALLYESSRCVPCTHVFCKVCLSRFKDCPLCGADIESIQPD  151



>gb|ACU19631.1| unknown [Glycine max]
Length=188

 Score =   138 bits (348),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 92/167 (55%), Gaps = 54/167 (32%)
 Frame = +2

Query  137  IKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAG  316
            + MTPVCPFVKAARPDD +  K                 +SGE +M         K QA 
Sbjct  1    MNMTPVCPFVKAARPDDNNASK-----------------KSGENSM---------KHQAE  34

Query  317  SEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGP  496
            SE K  +E  + A  S                            PKCP G+DSQ+FK+GP
Sbjct  35   SESKVKKEVNDSASTS----------------------------PKCPFGYDSQSFKIGP  66

Query  497  LSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            LSC +CQALL+D S+CVPCSHVFCK CI+RFKDCPLCGAD+ KIE D
Sbjct  67   LSCTVCQALLFDTSKCVPCSHVFCKACISRFKDCPLCGADIVKIEPD  113



>gb|KJB67761.1| hypothetical protein B456_010G208800 [Gossypium raimondii]
Length=365

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 90/164 (55%), Gaps = 61/164 (37%)
 Frame = +2

Query  146  TPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI  325
            TPVCPFVKAARPDD      G ++    GGSE  +++SG+ A V                
Sbjct  3    TPVCPFVKAARPDD-----NGSAKKSTVGGSEATRKDSGDTATV----------------  41

Query  326  KPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSC  505
                        S KCPFGY                            DS  FKLGPLSC
Sbjct  42   ------------SPKCPFGY----------------------------DSNNFKLGPLSC  61

Query  506  MICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            MICQALL+DC++C+PCSH+FCKVCI+RFKDCPLCGAD+EK+EAD
Sbjct  62   MICQALLFDCTKCIPCSHLFCKVCISRFKDCPLCGADIEKLEAD  105



>gb|KHF99857.1| E3 ubiquitin-protein ligase CHFR [Gossypium arboreum]
Length=365

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 90/164 (55%), Gaps = 61/164 (37%)
 Frame = +2

Query  146  TPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI  325
            TPVCPFVKAARPDD      G ++    GGSE  +++SG+ A V                
Sbjct  3    TPVCPFVKAARPDD-----NGSAKKSTVGGSEATRKDSGDSATV----------------  41

Query  326  KPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSC  505
                        S KCPFGY                            DS  FKLGPLSC
Sbjct  42   ------------SPKCPFGY----------------------------DSNNFKLGPLSC  61

Query  506  MICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            MICQALL+DC++C+PCSH+FCKVCI+RFKDCPLCGAD+EK+EAD
Sbjct  62   MICQALLFDCTKCIPCSHLFCKVCISRFKDCPLCGADIEKLEAD  105



>ref|XP_003522869.1| PREDICTED: uncharacterized protein LOC100813258 isoform X1 [Glycine 
max]
 ref|XP_006578395.1| PREDICTED: uncharacterized protein LOC100813258 isoform X2 [Glycine 
max]
Length=367

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 92/167 (55%), Gaps = 54/167 (32%)
 Frame = +2

Query  137  IKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAG  316
            + MTPVCPFVKAARPDD +  K                 +SGE +M         K QA 
Sbjct  1    MNMTPVCPFVKAARPDDNNASK-----------------KSGENSM---------KHQAE  34

Query  317  SEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGP  496
            SE K  +E  + A  S                            PKCP G+DSQ+FK+GP
Sbjct  35   SESKVKKEVNDSASTS----------------------------PKCPFGYDSQSFKIGP  66

Query  497  LSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            LSC +CQALL+D S+CVPCSHVFCK CI+RFKDCPLCGAD+ KIE D
Sbjct  67   LSCTVCQALLFDTSKCVPCSHVFCKACISRFKDCPLCGADIVKIEPD  113



>ref|XP_010533372.1| PREDICTED: uncharacterized protein LOC104809184 [Tarenaya hassleriana]
 ref|XP_010533373.1| PREDICTED: uncharacterized protein LOC104809184 [Tarenaya hassleriana]
Length=364

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 91/167 (54%), Gaps = 59/167 (35%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            MTPVCPF K+ARP+D+                                CP   ++ A   
Sbjct  1    MTPVCPFAKSARPEDS--------------------------------CPRKQRETAN--  26

Query  323  IKPNQESGEQAKVSSKCPFGYTQEAGGEN--KPKQVSEKPGVMSPKCPLGFDSQTFKLGP  496
                                   +AG EN  K K+ S +   +SPKCP G+DSQTFK+GP
Sbjct  27   -----------------------KAGSENECKAKKDSTESATVSPKCPFGYDSQTFKIGP  63

Query  497  LSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
             SCMICQALLY+ SRCVPC+HVFCK C++RFKDCPLCGAD+EKIEAD
Sbjct  64   FSCMICQALLYESSRCVPCTHVFCKACVSRFKDCPLCGADIEKIEAD  110



>ref|XP_007148770.1| hypothetical protein PHAVU_005G012800g [Phaseolus vulgaris]
 gb|ESW20764.1| hypothetical protein PHAVU_005G012800g [Phaseolus vulgaris]
Length=367

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 91/167 (54%), Gaps = 54/167 (32%)
 Frame = +2

Query  137  IKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAG  316
            + MTPVCPFVKAARPDD +  K                 + GE +M         K Q  
Sbjct  1    MNMTPVCPFVKAARPDDNNASK-----------------KLGENSM---------KHQVD  34

Query  317  SEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGP  496
            SE K  +E+ + A  S                            PKCP G+DSQ+FK+GP
Sbjct  35   SESKVKKEANDSASAS----------------------------PKCPFGYDSQSFKIGP  66

Query  497  LSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            LSC +CQALL+D S+CVPCSHVFCK CI+RFKDCPLCGAD+ KIE D
Sbjct  67   LSCTVCQALLFDTSKCVPCSHVFCKACISRFKDCPLCGADIVKIEPD  113



>ref|XP_010938114.1| PREDICTED: uncharacterized protein LOC105057260 isoform X1 [Elaeis 
guineensis]
Length=405

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 97/169 (57%), Gaps = 24/169 (14%)
 Frame = +2

Query  134  LIKMTPVCPFVKAARPDDASVKKPGESQSKQHGG-SEKPKQESGEPAMVPSKCPFVHKQQ  310
            L  M+ +CPF KAA  D     K  E+ S+Q     +   ++S   A +   CP  ++  
Sbjct  7    LSNMSSICPFAKAASADGGCPMKHEENHSQQQAKCDDNVDRKSHGSASIDGGCPVKYE--  64

Query  311  AGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKL  490
                       G+  K  ++C          ++K    +    V+SPKCP G+DS TFKL
Sbjct  65   -----------GDHNKHQAEC----------DDKADTKTNDSAVVSPKCPFGYDSHTFKL  103

Query  491  GPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            GPLSCMICQALLY  S+C+PC+H FCK CI+RFKDCPLCGAD+EKIEAD
Sbjct  104  GPLSCMICQALLYQSSKCLPCAHKFCKACISRFKDCPLCGADIEKIEAD  152



>ref|XP_010921286.1| PREDICTED: uncharacterized protein LOC105044901 [Elaeis guineensis]
Length=395

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 96/174 (55%), Gaps = 41/174 (24%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVH----KQQ  310
            M+ VCPF KAA  D               GG                 CP  H    +QQ
Sbjct  1    MSSVCPFAKAACAD---------------GG-----------------CPVKHEKQSRQQ  28

Query  311  AGSEIKPNQESGEQAKVSSKCPFGY-----TQEAGGENKPKQVSEKPGVMSPKCPLGFDS  475
            A  + K + +S + A V   CP  +       +A  ++K    S    V+SPKCP G+DS
Sbjct  29   AECDDKVDTKSNDSASVDGGCPMKHEGNYNRHKAECDDKVDTKSNDSAVVSPKCPFGYDS  88

Query  476  QTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
             TFKLGPLSCMICQALLY  S+C+PCSH FCKVCI+RFKDCPLCGAD+EKIE D
Sbjct  89   HTFKLGPLSCMICQALLYQSSKCLPCSHKFCKVCISRFKDCPLCGADIEKIEPD  142



>ref|XP_010938116.1| PREDICTED: uncharacterized protein LOC105057260 isoform X2 [Elaeis 
guineensis]
Length=396

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 96/166 (58%), Gaps = 24/166 (14%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGG-SEKPKQESGEPAMVPSKCPFVHKQQAGS  319
            M+ +CPF KAA  D     K  E+ S+Q     +   ++S   A +   CP  ++     
Sbjct  1    MSSICPFAKAASADGGCPMKHEENHSQQQAKCDDNVDRKSHGSASIDGGCPVKYE-----  55

Query  320  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL  499
                    G+  K  ++C          ++K    +    V+SPKCP G+DS TFKLGPL
Sbjct  56   --------GDHNKHQAEC----------DDKADTKTNDSAVVSPKCPFGYDSHTFKLGPL  97

Query  500  SCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            SCMICQALLY  S+C+PC+H FCK CI+RFKDCPLCGAD+EKIEAD
Sbjct  98   SCMICQALLYQSSKCLPCAHKFCKACISRFKDCPLCGADIEKIEAD  143



>ref|XP_007010628.1| Zinc ion binding [Theobroma cacao]
 gb|EOY19438.1| Zinc ion binding [Theobroma cacao]
Length=366

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 89/164 (54%), Gaps = 61/164 (37%)
 Frame = +2

Query  146  TPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI  325
            TPVCPFVKAARPDDA     G ++    GGSE  +++SG+ A V                
Sbjct  3    TPVCPFVKAARPDDA-----GSAKKAATGGSEAARKDSGDTATV----------------  41

Query  326  KPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSC  505
                        S KCPFGY                            DS  FKLGPLSC
Sbjct  42   ------------SPKCPFGY----------------------------DSNNFKLGPLSC  61

Query  506  MICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            MICQALL+D ++C+PCSH+FCKVCI+RFKDCPLCGAD+EK+E D
Sbjct  62   MICQALLFDSTKCIPCSHLFCKVCISRFKDCPLCGADIEKLEPD  105



>gb|KEH32916.1| zinc ion-binding protein, putative [Medicago truncatula]
Length=379

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 90/174 (52%), Gaps = 54/174 (31%)
 Frame = +2

Query  116  CRSHGLLIKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPF  295
            CR       M PVCPFVK  RPDD++  K     S +                       
Sbjct  5    CRFLLWRFNMKPVCPFVKIPRPDDSNASKKSNENSNK-----------------------  41

Query  296  VHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDS  475
             H  +  S++K                             K+V +   V SPKCPLG+DS
Sbjct  42   -HHVEHDSKVK-----------------------------KEVKDSASV-SPKCPLGYDS  70

Query  476  QTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            QTFK+GPLSCM+CQALL+D S+CVPCSHVFCK CI RFKDCPLCGAD+EKIE D
Sbjct  71   QTFKIGPLSCMVCQALLFDTSKCVPCSHVFCKACILRFKDCPLCGADIEKIEPD  124



>gb|ACU21424.1| unknown [Glycine max]
Length=189

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 89/167 (53%), Gaps = 54/167 (32%)
 Frame = +2

Query  137  IKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAG  316
            + MTPVCPFVKA+RPDD +  K                 +SGE +M         K Q  
Sbjct  1    MNMTPVCPFVKASRPDDNNASK-----------------KSGENSM---------KHQVE  34

Query  317  SEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGP  496
            SE K  +E  + A  S                            PKCP G+DS +FK+GP
Sbjct  35   SESKGKKEVNDSASTS----------------------------PKCPFGYDSHSFKIGP  66

Query  497  LSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            LSC +CQALL+D S+CVPCSHVFCK CI RFKDCPLCGAD+ KIE D
Sbjct  67   LSCTVCQALLFDTSKCVPCSHVFCKACILRFKDCPLCGADIVKIEPD  113



>ref|XP_004516522.1| PREDICTED: uncharacterized protein LOC101498396 [Cicer arietinum]
Length=365

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 93/166 (56%), Gaps = 56/166 (34%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASV-KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGS  319
            MTPVCPFVK  RPDD +  KK GE+ +K                         H  +  S
Sbjct  1    MTPVCPFVKIPRPDDNNASKKSGENSNK-------------------------HHAEHES  35

Query  320  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL  499
            ++K                             K+V++   V SPKCPLG+DSQTFK+GPL
Sbjct  36   KVK-----------------------------KEVNDSASV-SPKCPLGYDSQTFKIGPL  65

Query  500  SCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            SCM+CQALLY+ S+CVPCSHVFCK C++RFKDCPLCGAD+ KIE D
Sbjct  66   SCMVCQALLYETSKCVPCSHVFCKACVSRFKDCPLCGADIVKIEPD  111



>gb|KEH32917.1| zinc ion-binding protein, putative [Medicago truncatula]
Length=366

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 88/165 (53%), Gaps = 54/165 (33%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            M PVCPFVK  RPDD++  K     S +                        H  +  S+
Sbjct  1    MKPVCPFVKIPRPDDSNASKKSNENSNK------------------------HHVEHDSK  36

Query  323  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  502
            +K                             K+V +   V SPKCPLG+DSQTFK+GPLS
Sbjct  37   VK-----------------------------KEVKDSASV-SPKCPLGYDSQTFKIGPLS  66

Query  503  CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            CM+CQALL+D S+CVPCSHVFCK CI RFKDCPLCGAD+EKIE D
Sbjct  67   CMVCQALLFDTSKCVPCSHVFCKACILRFKDCPLCGADIEKIEPD  111



>ref|XP_003527531.1| PREDICTED: uncharacterized protein LOC100813844 [Glycine max]
Length=367

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 89/167 (53%), Gaps = 54/167 (32%)
 Frame = +2

Query  137  IKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAG  316
            + MTPVCPFVKA+RPDD +  K                 +SGE +M         K Q  
Sbjct  1    MNMTPVCPFVKASRPDDNNASK-----------------KSGENSM---------KHQVE  34

Query  317  SEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGP  496
            SE K  +E  + A  S                            PKCP G+DS +FK+GP
Sbjct  35   SESKGKKEVNDSASTS----------------------------PKCPFGYDSHSFKIGP  66

Query  497  LSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            LSC +CQALL+D S+CVPCSHVFCK CI RFKDCPLCGAD+ KIE D
Sbjct  67   LSCTVCQALLFDTSKCVPCSHVFCKACILRFKDCPLCGADIVKIEPD  113



>gb|EYU39947.1| hypothetical protein MIMGU_mgv1a009191mg [Erythranthe guttata]
Length=350

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 6/85 (7%)
 Frame = +2

Query  401  GENKPKQV------SEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHV  562
            GEN+ KQ       S++ G +SPKCP G+DSQTFKLGPLSCMICQALL+ CS+C+PCSHV
Sbjct  22   GENQNKQQTVNDSKSQQEGAISPKCPFGYDSQTFKLGPLSCMICQALLFQCSKCMPCSHV  81

Query  563  FCKVCITRFKDCPLCGADVEKIEAD  637
            +CK CI+RFKDCPLCGAD+EKIE D
Sbjct  82   YCKACISRFKDCPLCGADIEKIEDD  106



>gb|KHN26422.1| Polycomb complex protein BMI-1 [Glycine soja]
Length=365

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 88/165 (53%), Gaps = 54/165 (33%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            MTPVCPFVKA+RPDD +  K                 +SGE +M         K Q  SE
Sbjct  1    MTPVCPFVKASRPDDNNASK-----------------KSGENSM---------KHQVESE  34

Query  323  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  502
             K  +E  + A  S                            PKCP G+DS +FK+GPLS
Sbjct  35   SKGKKEVNDSASTS----------------------------PKCPFGYDSHSFKIGPLS  66

Query  503  CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            C +CQALL+D S+CVPCSHVFCK CI RFKDCPLCGAD+ KIE D
Sbjct  67   CTVCQALLFDTSKCVPCSHVFCKACILRFKDCPLCGADIVKIEPD  111



>ref|XP_010091318.1| E3 ubiquitin-protein ligase CHFR [Morus notabilis]
 gb|EXB44292.1| E3 ubiquitin-protein ligase CHFR [Morus notabilis]
Length=438

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 72/91 (79%), Gaps = 1/91 (1%)
 Frame = +2

Query  368  KCPFGY-TQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRC  544
            KCPFG+ +Q     NK +Q  ++  V+  KCP G+DSQTFKLGPLSC+ICQAL + CSRC
Sbjct  20   KCPFGFDSQTTTSNNKQQQQQQQSSVVEAKCPFGYDSQTFKLGPLSCVICQALTFQCSRC  79

Query  545  VPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            VPC+H FCK CI+RFKDCPLCGAD+EKIE D
Sbjct  80   VPCTHAFCKACISRFKDCPLCGADIEKIEED  110



>ref|XP_010276468.1| PREDICTED: uncharacterized protein LOC104611195 [Nelumbo nucifera]
 ref|XP_010276469.1| PREDICTED: uncharacterized protein LOC104611195 [Nelumbo nucifera]
 ref|XP_010276470.1| PREDICTED: uncharacterized protein LOC104611195 [Nelumbo nucifera]
Length=362

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 88/165 (53%), Gaps = 55/165 (33%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            MT VCPF K+ARPDDAS +K  ++ S+                                 
Sbjct  1    MTSVCPFAKSARPDDASPRKSMDNHSRDQA------------------------------  30

Query  323  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  502
                                   E GG  K ++ S+    +SPKCP G+DS TFKLGPLS
Sbjct  31   -----------------------EPGG--KVRRESDDSASVSPKCPFGYDSHTFKLGPLS  65

Query  503  CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            C+ICQALLY+ S+CVPCSH +CK CI+RFKDCPLCGAD+EKIE D
Sbjct  66   CVICQALLYESSKCVPCSHKYCKACISRFKDCPLCGADIEKIEPD  110



>ref|XP_009420238.1| PREDICTED: uncharacterized protein LOC104000028 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420239.1| PREDICTED: uncharacterized protein LOC104000028 [Musa acuminata 
subsp. malaccensis]
Length=365

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 71/99 (72%), Gaps = 4/99 (4%)
 Frame = +2

Query  353  AKVSSKCPF----GYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQA  520
            A V   CP        Q+A  ENK  + S     +SPKCP GFDS TFKLGPLSCMICQ+
Sbjct  11   ASVGGACPMKSVNNEKQQAENENKGDEESNPSDTVSPKCPYGFDSHTFKLGPLSCMICQS  70

Query  521  LLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            LLY  S+C+PCSH FC+VCI+RFKDCPLCGAD+EKIE D
Sbjct  71   LLYQSSKCIPCSHKFCRVCISRFKDCPLCGADIEKIEPD  109



>ref|XP_010554493.1| PREDICTED: uncharacterized protein LOC104824200 [Tarenaya hassleriana]
 ref|XP_010554494.1| PREDICTED: uncharacterized protein LOC104824200 [Tarenaya hassleriana]
 ref|XP_010554495.1| PREDICTED: uncharacterized protein LOC104824200 [Tarenaya hassleriana]
Length=367

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 87/165 (53%), Gaps = 55/165 (33%)
 Frame = +2

Query  143  MTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSE  322
            MT VCPF K+ARPD++                                CP   ++ A   
Sbjct  1    MTSVCPFAKSARPDES--------------------------------CPRKQREAA---  25

Query  323  IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLS  502
                         S  CP         E K K+       +SPKCP G+DSQTFK+GP S
Sbjct  26   -------------SKSCP-------ELEGKAKKDCTDSATVSPKCPFGYDSQTFKIGPFS  65

Query  503  CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            C+ICQALLY+ SRCVPC+HVFCK CI+RFKDCPLCGAD+EKIEAD
Sbjct  66   CVICQALLYETSRCVPCTHVFCKACISRFKDCPLCGADIEKIEAD  110



>ref|XP_008375385.1| PREDICTED: uncharacterized protein LOC103438629 [Malus domestica]
Length=364

 Score =   129 bits (324),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 5/91 (5%)
 Frame = +2

Query  371  CPFGYTQEAGGENKP--KQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRC  544
            CPF    +AG  ++P  K+ S     + PKCPLG+DSQTFKLGPLSCMIC AL++D ++C
Sbjct  6    CPFA---KAGRPSEPSKKETSADTATIPPKCPLGYDSQTFKLGPLSCMICHALMFDSAKC  62

Query  545  VPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            VPCSH FC+ CI+RFKDCPLCGAD+EKIEAD
Sbjct  63   VPCSHSFCQACISRFKDCPLCGADIEKIEAD  93



>ref|XP_008793368.1| PREDICTED: uncharacterized protein LOC103709685 [Phoenix dactylifera]
Length=378

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 78/117 (67%), Gaps = 5/117 (4%)
 Frame = +2

Query  302  KQQAGSEIKPNQESGEQAKVSSKCPFGYT-----QEAGGENKPKQVSEKPGVMSPKCPLG  466
            +QQA  +   + +S   A +   CP  +       +A  ++K    S    V+SPKCP G
Sbjct  9    QQQAKCDDNVDTKSSGSASIDVGCPMKHEGDYNKHQADCDDKADTKSNDSAVVSPKCPFG  68

Query  467  FDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            +DS TFKLGPLSCMICQALLY  S+C+PC+H FCK CI+RFKDCPLCGAD+EKIE D
Sbjct  69   YDSHTFKLGPLSCMICQALLYQSSKCLPCAHKFCKACISRFKDCPLCGADIEKIEPD  125



>emb|CDM81302.1| unnamed protein product [Triticum aestivum]
Length=373

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 83/127 (65%), Gaps = 6/127 (5%)
 Frame = +2

Query  275  VPSKCPFVHKQQAG-----SEIKPNQESGEQAKVSSKCPFGYTQEAGGENKP-KQVSEKP  436
            + S CPF      G     S+ KP++  G    V+ K      +E+G +    ++ +E P
Sbjct  1    MSSLCPFAKATTGGVCPMKSDKKPDKSGGAACPVTGKSHGSENKESGADRATGEEGAEDP  60

Query  437  GVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGAD  616
             V+  KCP G+DS TFKLGPLSCM+CQALL+D S+C+PCSH FCK CI+RFKDCPLCGAD
Sbjct  61   RVVPAKCPFGYDSNTFKLGPLSCMVCQALLHDASKCLPCSHKFCKACISRFKDCPLCGAD  120

Query  617  VEKIEAD  637
            +E IE D
Sbjct  121  IEGIEPD  127



>ref|XP_008231724.1| PREDICTED: uncharacterized protein LOC103330891 [Prunus mume]
Length=350

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +2

Query  416  KQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKD  595
            K+ S     +SPKCPLG+DSQTFKLGPLSCMIC ALL+D ++C PCSH FCK CI+RFKD
Sbjct  19   KESSADTATISPKCPLGYDSQTFKLGPLSCMICHALLFDSAKCAPCSHSFCKACISRFKD  78

Query  596  CPLCGADVEKIEAD  637
            CPLCGAD+EKIEAD
Sbjct  79   CPLCGADIEKIEAD  92



>ref|XP_007218231.1| hypothetical protein PRUPE_ppa007956mg [Prunus persica]
 gb|EMJ19430.1| hypothetical protein PRUPE_ppa007956mg [Prunus persica]
Length=350

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +2

Query  416  KQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKD  595
            K+ S     +SPKCPLG+DSQTFKLGPLSCMIC ALL+D ++ VPCSH FCK CI+RFKD
Sbjct  19   KESSADTATISPKCPLGYDSQTFKLGPLSCMICHALLFDSAKSVPCSHSFCKACISRFKD  78

Query  596  CPLCGADVEKIEAD  637
            CPLCGAD+EKIEAD
Sbjct  79   CPLCGADIEKIEAD  92



>gb|KDO48653.1| hypothetical protein CISIN_1g0162582mg, partial [Citrus sinensis]
Length=126

 Score =   121 bits (303),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  449  PKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKI  628
            PKCP G+D+Q+FK+GPLSCMICQALL++CS+C PCSHV+CK CI+RFKDCPLCGAD+EKI
Sbjct  8    PKCPFGYDAQSFKIGPLSCMICQALLFECSKCTPCSHVYCKACISRFKDCPLCGADIEKI  67

Query  629  EAD  637
            EAD
Sbjct  68   EAD  70



>gb|EMS59099.1| E3 ubiquitin-protein ligase CHFR [Triticum urartu]
Length=573

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 83/133 (62%), Gaps = 8/133 (6%)
 Frame = +2

Query  263  EPAMVPSKCPFVHKQQAG-----SEIKPNQESGEQA-KVSSKCPFGYTQEAGGENKPKQ-  421
            E   + S CPF      G     S+ KP++  G  A  V+ K      +E+G +    + 
Sbjct  94   ETIAMSSLCPFAKATTGGVCPMKSDKKPDKSGGGAACPVTGKSHGSENKESGADRAAGEE  153

Query  422  -VSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDC  598
               E P V+  KCP G+DS TFKLGPLSCM+CQALL+D S+C+PCSH FCK CI+RFKDC
Sbjct  154  GAEEDPRVVPAKCPFGYDSNTFKLGPLSCMVCQALLHDASKCMPCSHKFCKACISRFKDC  213

Query  599  PLCGADVEKIEAD  637
            PLCGAD+E IE D
Sbjct  214  PLCGADIEGIEPD  226



>gb|KHN45782.1| Polycomb complex protein BMI-1-B [Glycine soja]
Length=339

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +2

Query  389  QEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFC  568
             +A  E+K K+        SPKCP G+DSQ+FK+GPLSC +CQALL+D S+CVPCSHVFC
Sbjct  3    HQAESESKVKKEVNDSASTSPKCPFGYDSQSFKIGPLSCTVCQALLFDTSKCVPCSHVFC  62

Query  569  KVCITRFKDCPLCGADVEKIEAD  637
            K CI+RFKDCPLCGAD+ KIE D
Sbjct  63   KACISRFKDCPLCGADIVKIEPD  85



>gb|EMT10100.1| E3 ubiquitin-protein ligase CHFR [Aegilops tauschii]
Length=540

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 109/197 (55%), Gaps = 20/197 (10%)
 Frame = +2

Query  101  STEIQCRSHGLLIKMTPVCPFVK-----AARPDDASVKKPGESQSKQHG-GSEKPK---Q  253
            +TE     +G L  +  VC         +A   D++V     S +  HG G+   K   Q
Sbjct  73   NTEGGISMYGNLTIVLSVCQLTNWWVDTSANIHDSTVLMENGSPASVHGIGTTNLKFILQ  132

Query  254  E---SGEPAMVPSKCPFVHKQQAG-----SEIKPNQESGEQAKVSSKCPFGYTQEAGGEN  409
            E   + E   + S CPF      G     S+ KP++ SG    V+ K   G  +E   ++
Sbjct  133  EGTINKESIAMSSLCPFAKATTGGVCPMKSDKKPDKSSGAACPVTGKG--GEPKETSADH  190

Query  410  KP-KQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITR  586
               ++ +E P ++  KCP G+DS TFKLGPLSCM+CQALL+D S+C PCSH FCK CI+R
Sbjct  191  AAGEESAEDPRLVPAKCPFGYDSNTFKLGPLSCMVCQALLHDASKCKPCSHKFCKACISR  250

Query  587  FKDCPLCGADVEKIEAD  637
            FKDCPLCGAD+E +E D
Sbjct  251  FKDCPLCGADIEGVEPD  267



>ref|XP_003559441.1| PREDICTED: uncharacterized protein LOC100832811 [Brachypodium 
distachyon]
Length=380

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 79/132 (60%), Gaps = 11/132 (8%)
 Frame = +2

Query  275  VPSKCPFVHKQQAGSEI---KPNQES---GEQAKVSSKCPF-----GYTQEAGGENKPKQ  421
            + S CPF      G  +   K N+ S     +   SS CP      G   E  G +   +
Sbjct  1    MSSLCPFAKATTGGGGVCPMKSNKNSTVKSNKNDSSSVCPVTGKNNGEEHEESGTDHAGE  60

Query  422  VSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCP  601
             S  P V+  KCP G+DS TFKLGPLSCM+CQALL+D S+C PCSH FCK CI+RFKDCP
Sbjct  61   ESPDPRVVPAKCPFGYDSNTFKLGPLSCMVCQALLHDTSKCKPCSHKFCKACISRFKDCP  120

Query  602  LCGADVEKIEAD  637
            LCGAD+E +E D
Sbjct  121  LCGADIEGVEPD  132



>gb|ERM97187.1| hypothetical protein AMTR_s00119p00030390 [Amborella trichopoda]
Length=221

 Score =   119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  416  KQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKD  595
            K+ SE P  +SPKCP G+DS  FKLGPLSC+IC+ALL++ S+C+PCSH +CKVCI+RFKD
Sbjct  38   KEESEAPNTVSPKCPFGYDSHAFKLGPLSCVICRALLFETSKCLPCSHKYCKVCISRFKD  97

Query  596  CPLCGADVEKIEAD  637
            CP+CGAD+E+IE D
Sbjct  98   CPICGADIERIEPD  111



>ref|XP_006829771.2| PREDICTED: uncharacterized protein LOC18425140 [Amborella trichopoda]
Length=369

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  416  KQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKD  595
            K+ SE P  +SPKCP G+DS  FKLGPLSC+IC+ALL++ S+C+PCSH +CKVCI+RFKD
Sbjct  38   KEESEAPNTVSPKCPFGYDSHAFKLGPLSCVICRALLFETSKCLPCSHKYCKVCISRFKD  97

Query  596  CPLCGADVEKIEAD  637
            CP+CGAD+E+IE D
Sbjct  98   CPICGADIERIEPD  111



>ref|XP_006643640.1| PREDICTED: uncharacterized protein LOC102704921 [Oryza brachyantha]
Length=361

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 76/123 (62%), Gaps = 11/123 (9%)
 Frame = +2

Query  275  VPSKCPFVHKQQAGSE--IKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMS  448
            + S CPF     AG++  +K ++ +      ++ CP          +K     + P ++ 
Sbjct  1    MSSLCPFAKLASAGAKCPVKSDKNNS----TTASCPAN-----SHHHKEDDAQQNPSMVP  51

Query  449  PKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKI  628
            PKCP G+DS TFKLGPLSCM+C ALLY  S+C PCSH FCK CI RFKDCPLCGAD+E I
Sbjct  52   PKCPFGYDSNTFKLGPLSCMVCHALLYQTSKCTPCSHKFCKTCILRFKDCPLCGADIEGI  111

Query  629  EAD  637
            E D
Sbjct  112  EPD  114



>ref|XP_004978719.1| PREDICTED: E3 ubiquitin-protein ligase CHFR-like [Setaria italica]
Length=361

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 73/115 (63%), Gaps = 10/115 (9%)
 Frame = +2

Query  323  IKPNQESG------EQAKVSSKCPFGY----TQEAGGENKPKQVSEKPGVMSPKCPLGFD  472
            +K N+ SG          +S  CP        +E G     +  S  P ++  KCP G+D
Sbjct  1    MKSNRSSGGVCPAKSDKNISGVCPVTGKNHGAEEQGSTGNAEGKSSDPRLVPAKCPFGYD  60

Query  473  SQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            S TFKLGPLSCMICQALL++CSRC PCSH FCK C++RFKDCPLCGAD+E IE D
Sbjct  61   SGTFKLGPLSCMICQALLHECSRCKPCSHKFCKACVSRFKDCPLCGADIEGIEPD  115



>ref|XP_004306461.1| PREDICTED: uncharacterized protein LOC101299030 [Fragaria vesca 
subsp. vesca]
Length=338

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +2

Query  440  VMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADV  619
             +SPKCPLG+DSQTFKLGPLSCMIC ALL+D + CVPCSH FCK C++RFKDCPLCGAD+
Sbjct  30   TVSPKCPLGYDSQTFKLGPLSCMICHALLFDSANCVPCSHSFCKACVSRFKDCPLCGADI  89

Query  620  EKIE  631
            EK E
Sbjct  90   EKTE  93



>ref|XP_003563481.1| PREDICTED: E3 ubiquitin-protein ligase CHFR-like [Brachypodium 
distachyon]
Length=379

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 78/133 (59%), Gaps = 12/133 (9%)
 Frame = +2

Query  275  VPSKCPFVHKQQAGSEIKPNQESGEQAKV-------SSKCPF-----GYTQEAGGENKPK  418
            + S CPF      G  + P +     + V       SS CP      G   +  G +   
Sbjct  1    MSSLCPFAKATTGGGGVCPMKSDKNSSTVKSNKNDSSSVCPVTGKNNGEEHKESGTDHAG  60

Query  419  QVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDC  598
            + S  P ++  KCP G+DS TFKLGPLSCM+CQALL+D S+C PCSH FCK CI+RFKDC
Sbjct  61   EESPDPRMVPAKCPFGYDSNTFKLGPLSCMVCQALLHDTSKCKPCSHKFCKTCISRFKDC  120

Query  599  PLCGADVEKIEAD  637
            PLCGAD+E +E D
Sbjct  121  PLCGADIEGVEPD  133



>gb|EEC69773.1| hypothetical protein OsI_00037 [Oryza sativa Indica Group]
Length=409

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 82/137 (60%), Gaps = 8/137 (6%)
 Frame = +2

Query  230  GGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGEN  409
            G +  P  ++  P M  S CPF     AG+   P + S +     +K    +T +   +N
Sbjct  33   GVNNPPTIDTTNPIM-SSLCPFAKLASAGATC-PVKSSSD-----NKTTINHTDDDDDDN  85

Query  410  -KPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITR  586
             K    +  P V+ PKCP G+DS TFKLGPLSCM+C ALL+  S+C PCSH FCK CI R
Sbjct  86   EKTGNANTDPRVVPPKCPFGYDSNTFKLGPLSCMVCHALLHQSSKCTPCSHKFCKACILR  145

Query  587  FKDCPLCGADVEKIEAD  637
            FKDCPLCGAD++ IE D
Sbjct  146  FKDCPLCGADIQGIEPD  162



>dbj|BAJ86803.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=376

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 78/130 (60%), Gaps = 9/130 (7%)
 Frame = +2

Query  275  VPSKCPFVHKQQAG-----SEIKPNQESGEQA-KVSSKCPFGYTQEAGGENKPKQVSE--  430
            + S CPF      G     S+ KP++  G  A  V+ K   G  +E G +          
Sbjct  1    MSSLCPFAKATTGGVCPMKSDKKPDKSGGAAACPVTGKTHGGEDKETGADRAAAGEEGAE  60

Query  431  -KPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLC  607
              P ++  KCP G+DS TFKLGPLSCM+CQALL+D S+C PC+H FCK CI+RFKDCPLC
Sbjct  61   GDPRLVPAKCPFGYDSNTFKLGPLSCMVCQALLHDASKCKPCAHKFCKACISRFKDCPLC  120

Query  608  GADVEKIEAD  637
            GAD+E  E D
Sbjct  121  GADIEGFEPD  130



>ref|XP_001754304.1| predicted protein [Physcomitrella patens]
 gb|EDQ80754.1| predicted protein [Physcomitrella patens]
Length=372

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 72/113 (64%), Gaps = 16/113 (14%)
 Frame = +2

Query  338  ESGEQAKVSSKCPFGY-------------TQEAGGENKPKQVSEKPGVMSPKCPLGFDSQ  478
            E+ +   +S +CPFGY               E G E K +      G    KCPLG+DS 
Sbjct  13   EAKKSDNISGQCPFGYGKSEGSKESHENGVDEQGKERKDENTEASAG---GKCPLGYDSV  69

Query  479  TFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            +FK+GP SC++C+ALL+D SRCVPC H+FC+ CI+RF+DCPLCG D+E IE+D
Sbjct  70   SFKIGPFSCVLCRALLHDSSRCVPCRHIFCRGCISRFQDCPLCGLDIENIESD  122



>dbj|BAJ90412.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=376

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 78/130 (60%), Gaps = 9/130 (7%)
 Frame = +2

Query  275  VPSKCPFVHKQQAG-----SEIKPNQESGEQA-KVSSKCPFGYTQEAGGENKPKQVSE--  430
            + S CPF      G     S+ KP++  G  A  V+ K   G  +E G +          
Sbjct  1    MSSLCPFAKATTGGVCPMKSDKKPDKSGGAAACPVTGKTHGGEDKETGADRAAAGEEGAE  60

Query  431  -KPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLC  607
              P ++  KCP G+DS TFKLGPLSCM+CQALL+D S+C PC+H FCK CI+RFKDCPLC
Sbjct  61   GDPRLVPAKCPFGYDSNTFKLGPLSCMVCQALLHDASKCKPCAHKFCKACISRFKDCPLC  120

Query  608  GADVEKIEAD  637
            GAD+E  E D
Sbjct  121  GADIEGFEPD  130



>ref|NP_001041762.2| Os01g0104100 [Oryza sativa Japonica Group]
 dbj|BAD44834.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG96566.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53706.1| hypothetical protein OsJ_00033 [Oryza sativa Japonica Group]
 dbj|BAF03676.2| Os01g0104100 [Oryza sativa Japonica Group]
Length=363

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 76/122 (62%), Gaps = 7/122 (6%)
 Frame = +2

Query  275  VPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGEN-KPKQVSEKPGVMSP  451
            + S CPF     AG+   P + S +     +K    +T +   +N K    +  P V+ P
Sbjct  1    MSSLCPFAKLASAGATC-PVKSSSD-----NKTTINHTDDDDDDNEKTGNANTDPRVVPP  54

Query  452  KCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIE  631
            KCP G+DS TFKLGPLSCM+C ALL+  S+C PCSH FCK CI RFKDCPLCGAD++ IE
Sbjct  55   KCPFGYDSNTFKLGPLSCMVCHALLHQSSKCTPCSHKFCKACILRFKDCPLCGADIQGIE  114

Query  632  AD  637
             D
Sbjct  115  PD  116



>gb|EPS69962.1| hypothetical protein M569_04796, partial [Genlisea aurea]
Length=307

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  452  KCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIE  631
            KCP G+DSQTFKLGPLSCMICQALL++C +CVPCSH FC+ C+++FKDCPLCGAD++K++
Sbjct  1    KCPFGYDSQTFKLGPLSCMICQALLFECIKCVPCSHAFCRACVSKFKDCPLCGADIDKVD  60

Query  632  AD  637
             D
Sbjct  61   DD  62



>ref|XP_002444897.1| hypothetical protein SORBIDRAFT_07g001060 [Sorghum bicolor]
 gb|EES14392.1| hypothetical protein SORBIDRAFT_07g001060 [Sorghum bicolor]
Length=382

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 63/80 (79%), Gaps = 3/80 (4%)
 Frame = +2

Query  398  GGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVC  577
            GGE K    ++ P ++  KCP G+DS TFKLGPLSC++CQALL++ S+C PC+H FCK C
Sbjct  60   GGEEKG---TDDPRMVPAKCPFGYDSNTFKLGPLSCIVCQALLHESSKCKPCAHKFCKAC  116

Query  578  ITRFKDCPLCGADVEKIEAD  637
            I+RFKDCPLCGAD+E IE D
Sbjct  117  ISRFKDCPLCGADIEGIEPD  136



>gb|ACG25350.1| hypothetical protein [Zea mays]
Length=351

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +2

Query  434  PGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGA  613
            P V+  KCP G+DS TFKLGPLSC++CQALL++ S+C PC+H FCK CI+RFKDCPLCGA
Sbjct  66   PRVVPAKCPFGYDSNTFKLGPLSCIVCQALLHESSKCKPCAHKFCKACISRFKDCPLCGA  125

Query  614  DVEKIEAD  637
            D+E IE D
Sbjct  126  DIEGIEPD  133



>ref|NP_001140913.1| LOC100272990 [Zea mays]
 ref|XP_008672386.1| PREDICTED: LOC100272990 isoform X1 [Zea mays]
 gb|ACF84952.1| unknown [Zea mays]
 tpg|DAA53866.1| TPA: putative RING zinc finger domain and TPR repeat-containing 
protein domain protein isoform 1 [Zea mays]
 tpg|DAA53867.1| TPA: putative RING zinc finger domain and TPR repeat-containing 
protein domain protein isoform 2 [Zea mays]
 tpg|DAA53868.1| TPA: putative RING zinc finger domain and TPR repeat-containing 
protein domain protein isoform 3 [Zea mays]
Length=379

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +2

Query  434  PGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGA  613
            P V+  KCP G+DS TFKLGPLSC++CQALL++ S+C PC+H FCK CI+RFKDCPLCGA
Sbjct  66   PRVVPAKCPFGYDSNTFKLGPLSCIVCQALLHESSKCKPCAHKFCKACISRFKDCPLCGA  125

Query  614  DVEKIEAD  637
            D+E IE D
Sbjct  126  DIEGIEPD  133



>ref|XP_004967927.1| PREDICTED: E3 ubiquitin-protein ligase CHFR-like [Setaria italica]
Length=379

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +2

Query  434  PGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGA  613
            P ++  KCP G+DS TFKLGPLSC+ICQALL++ S+C PC+H FCK CI+RFKDCPLCGA
Sbjct  66   PRMVPAKCPFGYDSNTFKLGPLSCIICQALLHESSKCKPCAHKFCKACISRFKDCPLCGA  125

Query  614  DVEKIEAD  637
            D+E IE D
Sbjct  126  DIEGIEPD  133



>ref|NP_001048384.1| Os02g0795300 [Oryza sativa Japonica Group]
 dbj|BAD19269.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF10298.1| Os02g0795300 [Oryza sativa Japonica Group]
 dbj|BAG92291.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92078.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57969.1| hypothetical protein OsJ_08709 [Oryza sativa Japonica Group]
Length=365

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 74/126 (59%), Gaps = 12/126 (10%)
 Frame = +2

Query  275  VPSKCPFVHKQQAGSE--IKPNQESGEQAKVSSKCPFGYTQEAGGENKPK--QVSEKPGV  442
            + S CPF     AG+   +K + ++       + CP         ++  K    +  P V
Sbjct  1    MSSLCPFAKLASAGATCPVKSDNKT-------TSCPVTANNHTDDDDNEKTGNANTDPRV  53

Query  443  MSPKCPLGFDSQ-TFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADV  619
            +  KCP G+DS  TFKLGPLSC++C ALL+  S+C PCSH FCK CI RFKDCPLCGAD+
Sbjct  54   VPAKCPFGYDSNNTFKLGPLSCVVCHALLHQSSKCTPCSHKFCKACILRFKDCPLCGADI  113

Query  620  EKIEAD  637
            + IE D
Sbjct  114  QGIEPD  119



>ref|XP_002981629.1| hypothetical protein SELMODRAFT_154638 [Selaginella moellendorffii]
 gb|EFJ17444.1| hypothetical protein SELMODRAFT_154638 [Selaginella moellendorffii]
Length=338

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 60/89 (67%), Gaps = 12/89 (13%)
 Frame = +2

Query  371  CPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVP  550
            CPFG            +VS+     SPKCPLG+D+ +FKLGPLSC++C+ALL+  +RC+P
Sbjct  3    CPFG--------GATHEVSDS----SPKCPLGYDTASFKLGPLSCLVCRALLFKAARCLP  50

Query  551  CSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            C HVFC  CI RF DCPLCG D+  +E D
Sbjct  51   CRHVFCSACIARFSDCPLCGVDISGLEED  79



>gb|EEC74169.1| hypothetical protein OsI_09273 [Oryza sativa Indica Group]
Length=655

 Score =   109 bits (273),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 47/77 (61%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = +2

Query  410  KPKQVSEKPGVMSPKCPLGFDSQ-TFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITR  586
            K    +  P V+  KCP G+DS  TFKLGPLSC++C ALL+  S+C PCSH FCK CI R
Sbjct  333  KTGNANTDPRVVPAKCPFGYDSNNTFKLGPLSCVVCHALLHQSSKCTPCSHKFCKACILR  392

Query  587  FKDCPLCGADVEKIEAD  637
            FKDCPLCGAD++ IE D
Sbjct  393  FKDCPLCGADIQGIEPD  409



>gb|KJB73245.1| hypothetical protein B456_011G224300, partial [Gossypium raimondii]
Length=254

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  488  LGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            LGPLSCMICQALL+D ++C+PCSH+FC+VC +RFKDC LCGAD+EK+EAD
Sbjct  1    LGPLSCMICQALLFDFTKCIPCSHLFCQVCTSRFKDCLLCGADIEKLEAD  50



>gb|KJB73244.1| hypothetical protein B456_011G224300, partial [Gossypium raimondii]
Length=228

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  488  LGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            LGPLSCMICQALL+D ++C+PCSH+FC+VC +RFKDC LCGAD+EK+EAD
Sbjct  1    LGPLSCMICQALLFDFTKCIPCSHLFCQVCTSRFKDCLLCGADIEKLEAD  50



>emb|CDY07544.1| BnaC06g15200D [Brassica napus]
Length=298

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  506  MICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            M+CQ+LL+D +RCVPC+HVFCKVC+ RFKDCPLCGAD+E +EAD
Sbjct  1    MLCQSLLFDSTRCVPCTHVFCKVCLARFKDCPLCGADIESMEAD  44



>dbj|BAH20367.1| AT3G54360 [Arabidopsis thaliana]
Length=292

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  521  LLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD  637
            LLY+ SRCVPC+HVFCKVC+TRFKDCPLCGAD+E IE D
Sbjct  1    LLYESSRCVPCTHVFCKVCLTRFKDCPLCGADIESIEVD  39



>ref|XP_011402355.1| hypothetical protein F751_5740 [Auxenochlorella protothecoides]
 gb|KFM29302.1| hypothetical protein F751_5740 [Auxenochlorella protothecoides]
Length=506

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 85/166 (51%), Gaps = 21/166 (13%)
 Frame = +2

Query  149  PVCPFVKAARPDDASVKKPGESQSKQHGGSEK---PKQESGEPAMVPSKCPFVHKQQAGS  319
            P   F+  A+   + V  P  + S++  G+++   P Q S + A   + CPF H Q    
Sbjct  60   PFRRFMGGAKETSSPVPDPSRTPSERGNGNKEAGNPPQISVKAAAQAAGCPF-HSQI---  115

Query  320  EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTF-KLGP  496
                  E  E  K   KCPF     +GG     Q S   G  +PKCP+GF S+   KLG 
Sbjct  116  -----PEQAEAPKAPGKCPF---LASGG----AQPSTPVGSDAPKCPMGFSSEVQQKLGS  163

Query  497  LSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEA  634
              C++C++LL+DC R   C H +C+ CI R+ DCP+CGAD + + A
Sbjct  164  FHCVLCKSLLHDCVRTA-CRHEYCRACIERYHDCPICGADAQPLTA  208



>gb|AFW74750.1| hypothetical protein ZEAMMB73_787325 [Zea mays]
Length=192

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 49/74 (66%), Gaps = 4/74 (5%)
 Frame = +2

Query  401  GENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCI  580
            GE K K     P V+  K P G+DS T KLG LS ++CQ LL++  +C  C+H FCK CI
Sbjct  73   GEEKGKD----PHVVPAKRPFGYDSNTSKLGLLSSIVCQTLLHESRKCKLCTHKFCKACI  128

Query  581  TRFKDCPLCGADVE  622
            + FKD PLCGAD+E
Sbjct  129  SCFKDSPLCGADIE  142



>ref|XP_002946777.1| hypothetical protein VOLCADRAFT_87094 [Volvox carteri f. nagariensis]
 gb|EFJ52003.1| hypothetical protein VOLCADRAFT_87094 [Volvox carteri f. nagariensis]
Length=520

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +2

Query  455  CPLGFDSQTF---KLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEK  625
            CPLGF  Q     +L P  C++C+ LL+D      C H FC  C+ RF+DCP+CGAD++ 
Sbjct  4    CPLGFGGQGAGKDELSPYHCVLCRGLLHDPVVTSGCRHTFCAFCVRRFRDCPVCGADIDS  63

Query  626  IEAD  637
             + D
Sbjct  64   TKPD  67



>ref|XP_005705744.1| hypothetical protein isoform 1 [Galdieria sulphuraria]
 gb|EME29224.1| hypothetical protein isoform 1 [Galdieria sulphuraria]
Length=335

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 41/80 (51%), Gaps = 14/80 (18%)
 Frame = +2

Query  407  NKPKQVSEKPGVMSPKCPLGFDSQTFK------LGPLSCMICQALLYDCSRCVPCSHVFC  568
            NK  +V E        CP GF ++         + PL C +C ALLY+  R  PC H +C
Sbjct  19   NKANEVIE--------CPFGFGTRATSTEWEKAIAPLCCPLCHALLYETQRATPCGHCYC  70

Query  569  KVCITRFKDCPLCGADVEKI  628
            K C  + KDC LC AD+E+ 
Sbjct  71   KTCSFKVKDCLLCAADIEEF  90



>gb|KDD75387.1| hypothetical protein H632_c708p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=161

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 62/124 (50%), Gaps = 11/124 (9%)
 Frame = +2

Query  275  VPSKCPFVHK--QQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMS  448
            V + CPF  +   Q GSE   +   G  A ++       + +  GE      +E+ GV  
Sbjct  8    VAAGCPFHARLLAQQGSEAVESATEGVSASLAQVSLQRDSPDVSGE-----AAEEDGV--  60

Query  449  PKCPLGFDSQTF-KLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEK  625
             +CP+G+      +LG   C+IC++L  DCS  + C H FCK CI     C +CGADV +
Sbjct  61   AECPMGYGRSRLPRLGEFFCLICKSLYCDCS-VLGCGHRFCKGCIELAPSCLVCGADVGE  119

Query  626  IEAD  637
            + AD
Sbjct  120  VRAD  123



>ref|XP_005705745.1| hypothetical protein isoform 2 [Galdieria sulphuraria]
 gb|EME29225.1| hypothetical protein isoform 2 [Galdieria sulphuraria]
Length=350

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 41/80 (51%), Gaps = 14/80 (18%)
 Frame = +2

Query  407  NKPKQVSEKPGVMSPKCPLGFDSQTFK------LGPLSCMICQALLYDCSRCVPCSHVFC  568
            NK  +V E        CP GF ++         + PL C +C ALLY+  R  PC H +C
Sbjct  19   NKANEVIE--------CPFGFGTRATSTEWEKAIAPLCCPLCHALLYETQRATPCGHCYC  70

Query  569  KVCITRFKDCPLCGADVEKI  628
            K C  + KDC LC AD+E+ 
Sbjct  71   KTCSFKVKDCLLCAADIEEF  90



>ref|XP_005844547.1| hypothetical protein CHLNCDRAFT_58886 [Chlorella variabilis]
 gb|EFN52445.1| hypothetical protein CHLNCDRAFT_58886 [Chlorella variabilis]
Length=439

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 37/63 (59%), Gaps = 3/63 (5%)
 Frame = +2

Query  455  CPLGFDS--QTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKI  628
            CPLGF S  Q  +LG   C++C++L +DC     C H +C  CI   +DCP CGAD+  +
Sbjct  82   CPLGFGSSAQGPRLGQFHCLLCKSLFFDCV-VTSCGHRYCAGCIRDARDCPACGADITSL  140

Query  629  EAD  637
              D
Sbjct  141  APD  143



>ref|NP_989378.1| E3 ubiquitin-protein ligase CHFR [Xenopus (Silurana) tropicalis]
 sp|Q6P256.1|CHFR_XENTR RecName: Full=E3 ubiquitin-protein ligase CHFR; AltName: Full=Checkpoint 
with forkhead and RING finger domains protein [Xenopus 
(Silurana) tropicalis]
 gb|AAH64721.1| checkpoint with forkhead and ring finger domains [Xenopus (Silurana) 
tropicalis]
Length=626

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 62/136 (46%), Gaps = 22/136 (16%)
 Frame = +2

Query  287  CPFVHKQQA---GSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQ-------VSEKP  436
            C  ++K QA   G +++  ++SGE  +  S        E G    PK+        +   
Sbjct  177  CTLLYKSQASVPGVQLESGEKSGESLEGHSSTSDATAHEKGSLGPPKKRMRTEDLWTGNK  236

Query  437  GVMSPKCPLGF--DSQTFKLGP------LSCMICQALLYDCSRCVPCSHVFCKVCITRFK  592
             ++S  C  G   +S+T  + P      L+C+ICQ LL+DC    PC H FC  C + + 
Sbjct  237  NLVSASCSKGASDESKTPSMKPDKMEETLTCIICQELLHDCVSLQPCMHTFCAACYSGWM  296

Query  593  D----CPLCGADVEKI  628
            +    CP C   VE+I
Sbjct  297  ERSSLCPTCRCPVERI  312



>ref|XP_005432260.1| PREDICTED: polycomb complex protein BMI-1 [Falco cherrug]
Length=496

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 36/72 (50%), Gaps = 5/72 (7%)
 Frame = +2

Query  422  VSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF----  589
            V  + GV  P+  L ++ QT  +  L C++C     D +  + C H FCK CI R+    
Sbjct  162  VGLRRGVQKPELSLFWEKQTLGIN-LKCVLCGGDFIDATTIIECLHSFCKTCIVRYLETS  220

Query  590  KDCPLCGADVEK  625
            K CP+C   V K
Sbjct  221  KYCPICDVQVHK  232



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 970004890272