BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7767

Length=635
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABC47163.2|  CDPK1                                                   395   5e-133   Ipomoea nil [qian niu]
ref|XP_009786035.1|  PREDICTED: calcium-dependent protein kinase 3      315   1e-101   Nicotiana sylvestris
ref|XP_009620189.1|  PREDICTED: calcium-dependent protein kinase 3      310   1e-99    Nicotiana tomentosiformis
gb|ACH85192.1|  calcium-dependent protein kinase CDPK5                  310   2e-99    Nicotiana tabacum [American tobacco]
ref|XP_006352261.1|  PREDICTED: calcium-dependent protein kinase ...    299   2e-95    Solanum tuberosum [potatoes]
ref|XP_004244622.1|  PREDICTED: calcium-dependent protein kinase 3      296   2e-94    Solanum lycopersicum
gb|KDO76380.1|  hypothetical protein CISIN_1g010013mg                   281   2e-90    Citrus sinensis [apfelsine]
ref|XP_006439440.1|  hypothetical protein CICLE_v10019724mg             280   4e-90    
gb|KDO76378.1|  hypothetical protein CISIN_1g010013mg                   283   4e-90    Citrus sinensis [apfelsine]
ref|XP_006439442.1|  hypothetical protein CICLE_v10019724mg             282   7e-90    
gb|KDO76377.1|  hypothetical protein CISIN_1g010013mg                   284   8e-90    Citrus sinensis [apfelsine]
gb|KDO76379.1|  hypothetical protein CISIN_1g010013mg                   281   9e-90    Citrus sinensis [apfelsine]
ref|XP_010261434.1|  PREDICTED: calcium-dependent protein kinase ...    285   1e-89    Nelumbo nucifera [Indian lotus]
ref|XP_006439441.1|  hypothetical protein CICLE_v10019724mg             280   2e-89    
gb|KDO76376.1|  hypothetical protein CISIN_1g010013mg                   283   3e-89    Citrus sinensis [apfelsine]
ref|XP_006476469.1|  PREDICTED: calcium-dependent protein kinase ...    283   3e-89    Citrus sinensis [apfelsine]
ref|XP_006439443.1|  hypothetical protein CICLE_v10019724mg             283   6e-89    Citrus clementina [clementine]
emb|CAN61364.1|  hypothetical protein VITISV_032639                     280   2e-88    Vitis vinifera
ref|XP_006849377.1|  PREDICTED: calcium-dependent protein kinase 3      281   5e-88    Amborella trichopoda
ref|XP_012086799.1|  PREDICTED: calcium-dependent protein kinase 3      280   5e-88    Jatropha curcas
gb|AGS15000.1|  calcium-dependent protein kinase 3                      279   2e-87    Vitis amurensis
ref|XP_002272270.1|  PREDICTED: calcium-dependent protein kinase 3      279   2e-87    Vitis vinifera
ref|XP_010251583.1|  PREDICTED: calcium-dependent protein kinase ...    279   2e-87    Nelumbo nucifera [Indian lotus]
gb|EYU40050.1|  hypothetical protein MIMGU_mgv1a011511mg                270   4e-87    Erythranthe guttata [common monkey flower]
ref|XP_011073451.1|  PREDICTED: calcium-dependent protein kinase ...    278   4e-87    Sesamum indicum [beniseed]
ref|XP_002509886.1|  calcium-dependent protein kinase, putative         276   2e-86    Ricinus communis
gb|KEH21166.1|  calmodulin-domain kinase CDPK protein                   276   2e-86    Medicago truncatula
ref|XP_003517491.2|  PREDICTED: calcium-dependent protein kinase ...    276   2e-86    
ref|XP_007160124.1|  hypothetical protein PHAVU_002G294500g             276   3e-86    Phaseolus vulgaris [French bean]
gb|KJB52213.1|  hypothetical protein B456_008G251000                    276   4e-86    Gossypium raimondii
gb|KHG11508.1|  Calcium-dependent protein kinase 3                      276   5e-86    Gossypium arboreum [tree cotton]
ref|XP_007040388.1|  Calcium-dependent protein kinase 6 isoform 2       273   1e-85    
ref|XP_004503656.1|  PREDICTED: calcium-dependent protein kinase ...    274   1e-85    Cicer arietinum [garbanzo]
ref|XP_009334485.1|  PREDICTED: calcium-dependent protein kinase 3      274   2e-85    Pyrus x bretschneideri [bai li]
ref|XP_007209903.1|  hypothetical protein PRUPE_ppa004162mg             274   2e-85    Prunus persica
ref|XP_003538256.1|  PREDICTED: calcium-dependent protein kinase ...    273   2e-85    Glycine max [soybeans]
ref|XP_010055801.1|  PREDICTED: calcium-dependent protein kinase 3      274   2e-85    Eucalyptus grandis [rose gum]
ref|XP_007040387.1|  Calcium-dependent protein kinase 6 isoform 1       274   2e-85    
ref|XP_010106587.1|  Calcium-dependent protein kinase 3                 276   5e-85    
ref|XP_004511540.1|  PREDICTED: calcium-dependent protein kinase ...    271   9e-85    Cicer arietinum [garbanzo]
ref|XP_004298849.1|  PREDICTED: calcium-dependent protein kinase 3      272   9e-85    Fragaria vesca subsp. vesca
ref|XP_003525360.1|  PREDICTED: calcium-dependent protein kinase ...    271   1e-84    Glycine max [soybeans]
ref|XP_002298000.1|  calcium-dependent protein kinase 1                 269   8e-84    Populus trichocarpa [western balsam poplar]
ref|XP_002304529.2|  hypothetical protein POPTR_0003s13380g             269   2e-83    
ref|XP_010529626.1|  PREDICTED: calcium-dependent protein kinase ...    268   2e-83    Tarenaya hassleriana [spider flower]
gb|AIU98505.1|  calcium-dependent protein kinase                        267   6e-83    Musa acuminata AAA Group [Cavendish banana]
ref|XP_009386326.1|  PREDICTED: calcium-dependent protein kinase ...    267   7e-83    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010541306.1|  PREDICTED: calcium-dependent protein kinase 3      267   8e-83    Tarenaya hassleriana [spider flower]
ref|XP_009416404.1|  PREDICTED: calcium-dependent protein kinase ...    266   1e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011022588.1|  PREDICTED: calcium-dependent protein kinase ...    266   1e-82    Populus euphratica
ref|XP_008792394.1|  PREDICTED: calcium-dependent protein kinase ...    266   2e-82    Phoenix dactylifera
gb|AFW83320.1|  putative calcium-dependent protein kinase family ...    261   3e-82    
gb|KHG03431.1|  Calcium-dependent protein kinase 3                      266   1e-81    Gossypium arboreum [tree cotton]
ref|XP_011080890.1|  PREDICTED: calcium-dependent protein kinase 3      262   2e-81    Sesamum indicum [beniseed]
ref|XP_006655639.1|  PREDICTED: calcium-dependent protein kinase ...    262   2e-81    
ref|XP_011026960.1|  PREDICTED: calcium-dependent protein kinase 3      263   2e-81    Populus euphratica
gb|KFK28919.1|  hypothetical protein AALP_AA7G065000                    263   4e-81    Arabis alpina [alpine rockcress]
ref|XP_010924783.1|  PREDICTED: calcium-dependent protein kinase ...    263   4e-81    Elaeis guineensis
ref|XP_010924782.1|  PREDICTED: calcium-dependent protein kinase ...    263   5e-81    Elaeis guineensis
ref|NP_001169721.1|  uncharacterized LOC100383602                       262   5e-81    Zea mays [maize]
ref|NP_001152509.1|  calcium-dependent protein kinase, isoform 2        262   6e-81    Zea mays [maize]
ref|XP_006413532.1|  hypothetical protein EUTSA_v10024899mg             261   2e-80    Eutrema salsugineum [saltwater cress]
ref|XP_003569386.1|  PREDICTED: calcium-dependent protein kinase ...    261   2e-80    Brachypodium distachyon [annual false brome]
ref|XP_008451994.1|  PREDICTED: calcium-dependent protein kinase 3      261   2e-80    Cucumis melo [Oriental melon]
ref|XP_004961071.1|  PREDICTED: calcium-dependent protein kinase ...    261   2e-80    Setaria italica
ref|XP_004969206.1|  PREDICTED: calcium-dependent protein kinase ...    260   3e-80    Setaria italica
ref|XP_006283520.1|  hypothetical protein CARUB_v10004572mg             261   3e-80    Capsella rubella
gb|ABY59010.1|  calcium-dependent protein kinase                        260   3e-80    Triticum aestivum [Canadian hard winter wheat]
emb|CAF18446.1|  putative calcium-dependent protein kinase              260   3e-80    Triticum aestivum [Canadian hard winter wheat]
gb|EAZ12734.1|  hypothetical protein OsJ_02652                          260   3e-80    Oryza sativa Japonica Group [Japonica rice]
gb|EEC71113.1|  hypothetical protein OsI_02910                          260   3e-80    Oryza sativa Indica Group [Indian rice]
dbj|BAJ95679.1|  predicted protein                                      260   4e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010509303.1|  PREDICTED: calcium-dependent protein kinase 3      260   5e-80    Camelina sativa [gold-of-pleasure]
gb|AIU98501.1|  calcium-dependent protein kinase                        259   5e-80    Musa acuminata AAA Group [Cavendish banana]
ref|XP_009137374.1|  PREDICTED: calcium-dependent protein kinase ...    260   6e-80    Brassica rapa
ref|XP_010433881.1|  PREDICTED: calcium-dependent protein kinase ...    259   6e-80    Camelina sativa [gold-of-pleasure]
ref|XP_010439150.1|  PREDICTED: calcium-dependent protein kinase ...    259   6e-80    Camelina sativa [gold-of-pleasure]
gb|ACA63885.1|  calcium-dependent protein kinase                        259   7e-80    Hordeum vulgare [barley]
ref|XP_010676387.1|  PREDICTED: calcium-dependent protein kinase 3      259   7e-80    Beta vulgaris subsp. vulgaris [field beet]
gb|AFW81269.1|  putative calcium-dependent protein kinase family ...    258   8e-80    
ref|NP_001056455.1|  Os05g0585500                                       259   2e-79    
ref|XP_007158545.1|  hypothetical protein PHAVU_002G161200g             258   2e-79    Phaseolus vulgaris [French bean]
ref|XP_008656081.1|  PREDICTED: calcium-dependent protein kinase ...    258   2e-79    Zea mays [maize]
gb|KHG14847.1|  Calcium-dependent protein kinase 3                      258   3e-79    Gossypium arboreum [tree cotton]
gb|AHN16201.1|  CPK3-2.1                                                258   3e-79    Brassica napus [oilseed rape]
ref|XP_002867697.1|  calcium-dependent protein kinase 6                 257   4e-79    
ref|NP_194096.1|  calcium-dependent protein kinase 6                    258   4e-79    Arabidopsis thaliana [mouse-ear cress]
gb|AAL38596.1|AF446863_1  AT4g23650/F9D16_120                           258   4e-79    Arabidopsis thaliana [mouse-ear cress]
emb|CDY54853.1|  BnaC01g15460D                                          258   4e-79    Brassica napus [oilseed rape]
emb|CDY62741.1|  BnaC07g50270D                                          259   4e-79    Brassica napus [oilseed rape]
gb|KJB39672.1|  hypothetical protein B456_007G025000                    254   4e-79    Gossypium raimondii
gb|KJB39669.1|  hypothetical protein B456_007G025000                    254   5e-79    Gossypium raimondii
ref|XP_002455974.1|  hypothetical protein SORBIDRAFT_03g028340          257   6e-79    Sorghum bicolor [broomcorn]
ref|XP_002441592.1|  hypothetical protein SORBIDRAFT_09g029950          257   9e-79    Sorghum bicolor [broomcorn]
gb|KJB39670.1|  hypothetical protein B456_007G025000                    255   2e-78    Gossypium raimondii
dbj|BAD61167.1|  putative calcium-dependent protein kinase              260   2e-78    Oryza sativa Japonica Group [Japonica rice]
gb|KJB39673.1|  hypothetical protein B456_007G025000                    255   3e-78    Gossypium raimondii
ref|NP_001267714.1|  calcium-dependent protein kinase 3-like            255   3e-78    Cucumis sativus [cucumbers]
gb|AGG35973.1|  calcium-dependent protein kinase 3                      255   4e-78    Brassica napus [oilseed rape]
emb|CDY44125.1|  BnaA01g13330D                                          255   4e-78    Brassica napus [oilseed rape]
ref|XP_009137281.1|  PREDICTED: calcium-dependent protein kinase ...    254   5e-78    Brassica rapa
dbj|BAJ94561.1|  predicted protein                                      254   7e-78    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008802050.1|  PREDICTED: calcium-dependent protein kinase ...    254   1e-77    Phoenix dactylifera
gb|KEH27423.1|  calmodulin-domain kinase CDPK protein                   250   3e-77    Medicago truncatula
gb|EYU23402.1|  hypothetical protein MIMGU_mgv1a004683mg                252   4e-77    Erythranthe guttata [common monkey flower]
gb|KGN53365.1|  hypothetical protein Csa_4G050200                       252   4e-77    Cucumis sativus [cucumbers]
ref|XP_009406794.1|  PREDICTED: calcium-dependent protein kinase ...    250   5e-77    
gb|EPS65220.1|  hypothetical protein M569_09555                         249   2e-76    Genlisea aurea
ref|XP_003611046.1|  Calcium dependent protein kinase                   250   2e-76    Medicago truncatula
gb|EPS59027.1|  hypothetical protein M569_15783                         246   1e-75    Genlisea aurea
ref|XP_010673770.1|  PREDICTED: calcium-dependent protein kinase ...    248   1e-75    Beta vulgaris subsp. vulgaris [field beet]
tpg|DAA58514.1|  TPA: putative calcium-dependent protein kinase f...    246   3e-75    
ref|XP_009385897.1|  PREDICTED: calcium-dependent protein kinase ...    246   4e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008449648.1|  PREDICTED: calcium-dependent protein kinase ...    247   6e-75    Cucumis melo [Oriental melon]
ref|XP_009419685.1|  PREDICTED: calcium-dependent protein kinase ...    246   9e-75    Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS70504.1|  calcium dependent protein kinase 25                     246   2e-74    Genlisea aurea
ref|XP_002526062.1|  calcium-dependent protein kinase, putative         246   2e-74    Ricinus communis
ref|XP_004140192.1|  PREDICTED: calcium-dependent protein kinase 34     246   2e-74    Cucumis sativus [cucumbers]
ref|XP_009402456.1|  PREDICTED: calcium-dependent protein kinase ...    244   3e-74    
ref|XP_006349794.1|  PREDICTED: calcium-dependent protein kinase ...    244   5e-74    
gb|EYU46187.1|  hypothetical protein MIMGU_mgv1a004352mg                244   6e-74    Erythranthe guttata [common monkey flower]
ref|XP_009773532.1|  PREDICTED: calcium-dependent protein kinase ...    244   7e-74    Nicotiana sylvestris
ref|XP_006644382.1|  PREDICTED: calcium-dependent protein kinase ...    242   7e-74    Oryza brachyantha
ref|XP_004252886.1|  PREDICTED: calcium-dependent protein kinase ...    244   8e-74    Solanum lycopersicum
ref|XP_009627412.1|  PREDICTED: calcium-dependent protein kinase ...    244   8e-74    Nicotiana tomentosiformis
ref|XP_009789543.1|  PREDICTED: calcium-dependent protein kinase ...    243   1e-73    Nicotiana sylvestris
ref|XP_010536137.1|  PREDICTED: calcium-dependent protein kinase 17     243   1e-73    Tarenaya hassleriana [spider flower]
ref|XP_009630031.1|  PREDICTED: calcium-dependent protein kinase ...    243   2e-73    Nicotiana tomentosiformis
gb|KDO36585.1|  hypothetical protein CISIN_1g042977mg                   241   2e-73    Citrus sinensis [apfelsine]
ref|XP_003567831.1|  PREDICTED: calcium-dependent protein kinase ...    243   2e-73    Brachypodium distachyon [annual false brome]
ref|XP_004293141.1|  PREDICTED: calcium-dependent protein kinase 34     243   2e-73    Fragaria vesca subsp. vesca
ref|XP_006361005.1|  PREDICTED: calcium-dependent protein kinase ...    243   2e-73    Solanum tuberosum [potatoes]
ref|XP_009603797.1|  PREDICTED: calcium-dependent protein kinase ...    243   2e-73    Nicotiana tomentosiformis
ref|XP_010519814.1|  PREDICTED: calcium-dependent protein kinase ...    243   2e-73    Tarenaya hassleriana [spider flower]
ref|XP_009368734.1|  PREDICTED: calcium-dependent protein kinase ...    243   2e-73    Pyrus x bretschneideri [bai li]
ref|XP_008365176.1|  PREDICTED: calcium-dependent protein kinase ...    243   2e-73    
ref|XP_004980140.1|  PREDICTED: calcium-dependent protein kinase ...    243   2e-73    Setaria italica
emb|CAG27840.1|  calcium-dependent protein kinase 17                    243   2e-73    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
emb|CDP20327.1|  unnamed protein product                                242   3e-73    Coffea canephora [robusta coffee]
ref|XP_001771902.1|  predicted protein                                  241   3e-73    
ref|XP_010519813.1|  PREDICTED: calcium-dependent protein kinase ...    243   3e-73    Tarenaya hassleriana [spider flower]
emb|CDX97174.1|  BnaC09g44510D                                          242   3e-73    
ref|XP_009796949.1|  PREDICTED: calcium-dependent protein kinase ...    242   4e-73    Nicotiana sylvestris
ref|XP_009121874.1|  PREDICTED: calcium-dependent protein kinase 17     242   4e-73    Brassica rapa
gb|EYU35947.1|  hypothetical protein MIMGU_mgv1a004350mg                242   4e-73    Erythranthe guttata [common monkey flower]
gb|KJB21813.1|  hypothetical protein B456_004G015100                    242   4e-73    Gossypium raimondii
ref|XP_009125853.1|  PREDICTED: calcium-dependent protein kinase ...    241   5e-73    Brassica rapa
ref|XP_004228884.1|  PREDICTED: calcium-dependent protein kinase ...    242   5e-73    Solanum lycopersicum
ref|XP_004978350.1|  PREDICTED: calcium-dependent protein kinase ...    242   5e-73    
ref|XP_011080420.1|  PREDICTED: calcium-dependent protein kinase ...    241   6e-73    Sesamum indicum [beniseed]
ref|XP_006470577.1|  PREDICTED: calcium-dependent protein kinase ...    241   6e-73    Citrus sinensis [apfelsine]
ref|XP_007015253.1|  Calcium-dependent protein kinase 17                241   6e-73    Theobroma cacao [chocolate]
ref|XP_009412989.1|  PREDICTED: calcium-dependent protein kinase ...    241   7e-73    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006446309.1|  hypothetical protein CICLE_v10014854mg             241   8e-73    Citrus clementina [clementine]
gb|AFW82380.1|  putative calcium-dependent protein kinase family ...    232   8e-73    
gb|KJB09335.1|  hypothetical protein B456_001G135000                    241   9e-73    Gossypium raimondii
ref|XP_006356386.1|  PREDICTED: calcium-dependent protein kinase ...    241   1e-72    Solanum tuberosum [potatoes]
ref|XP_006289327.1|  hypothetical protein CARUB_v10002812mg             241   1e-72    Capsella rubella
ref|XP_010106395.1|  Calcium-dependent protein kinase 17                241   1e-72    Morus notabilis
ref|XP_006845045.1|  PREDICTED: calcium-dependent protein kinase 17     240   1e-72    Amborella trichopoda
ref|XP_010247475.1|  PREDICTED: calcium-dependent protein kinase 34     240   1e-72    Nelumbo nucifera [Indian lotus]
emb|CDX78468.1|  BnaA03g03800D                                          240   1e-72    
gb|AHG06449.1|  calcium-dependent protein kinase 17                     240   1e-72    Brassica napus [oilseed rape]
ref|NP_197437.1|  calcium-dependent protein kinase 34                   240   2e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010099802.1|  Calcium-dependent protein kinase 17                241   2e-72    Morus notabilis
emb|CDX70450.1|  BnaC03g05340D                                          240   2e-72    
emb|CDY13993.1|  BnaC09g38330D                                          240   2e-72    Brassica napus [oilseed rape]
ref|XP_012065867.1|  PREDICTED: calcium-dependent protein kinase 34     240   2e-72    
gb|KDP43197.1|  hypothetical protein JCGZ_22749                         240   2e-72    Jatropha curcas
gb|ABV22575.1|  calcium-dependent protein kinase                        243   2e-72    Physcomitrella patens
ref|XP_009120894.1|  PREDICTED: calcium-dependent protein kinase 34     240   2e-72    Brassica rapa
gb|AAZ76712.1|  calcium-dependent protein kinase 1                      240   2e-72    Petunia integrifolia subsp. inflata
ref|XP_002441304.1|  hypothetical protein SORBIDRAFT_09g024100          240   2e-72    Sorghum bicolor [broomcorn]
gb|AGG35954.1|  calcium-dependent protein kinase 34                     239   3e-72    Brassica napus [oilseed rape]
ref|XP_008227265.1|  PREDICTED: calcium-dependent protein kinase ...    240   3e-72    Prunus mume [ume]
ref|XP_010031714.1|  PREDICTED: calcium-dependent protein kinase ...    240   3e-72    Eucalyptus grandis [rose gum]
ref|XP_010419805.1|  PREDICTED: calcium-dependent protein kinase ...    239   3e-72    
ref|XP_003622837.1|  Calcium dependent protein kinase                   240   3e-72    
gb|ADE76782.1|  unknown                                                 231   3e-72    Picea sitchensis
ref|XP_007213195.1|  hypothetical protein PRUPE_ppa026653mg             240   3e-72    Prunus persica
ref|XP_010453282.1|  PREDICTED: calcium-dependent protein kinase 17     239   3e-72    Camelina sativa [gold-of-pleasure]
gb|KFK26202.1|  hypothetical protein AALP_AA8G215800                    239   3e-72    Arabis alpina [alpine rockcress]
ref|XP_003617233.1|  Calcium dependent protein kinase                   239   4e-72    Medicago truncatula
gb|KJB55472.1|  hypothetical protein B456_009G078000                    239   4e-72    Gossypium raimondii
emb|CDY63783.1|  BnaCnng42690D                                          239   4e-72    Brassica napus [oilseed rape]
ref|XP_002873943.1|  calcium-dependent protein kinase 34                239   5e-72    Arabidopsis lyrata subsp. lyrata
ref|XP_006399734.1|  hypothetical protein EUTSA_v10013236mg             239   5e-72    Eutrema salsugineum [saltwater cress]
ref|XP_004250895.1|  PREDICTED: calcium-dependent protein kinase ...    239   5e-72    Solanum lycopersicum
ref|XP_002871516.1|  calcium-dependent protein kinase 17                239   5e-72    
ref|XP_009126355.1|  PREDICTED: calcium-dependent protein kinase 34     239   5e-72    Brassica rapa
gb|EMT22025.1|  Calcium-dependent protein kinase 3                      238   6e-72    
ref|XP_010419806.1|  PREDICTED: calcium-dependent protein kinase ...    239   6e-72    Camelina sativa [gold-of-pleasure]
ref|XP_006289743.1|  hypothetical protein CARUB_v10003311mg             239   6e-72    Capsella rubella
ref|XP_004513232.1|  PREDICTED: calcium-dependent protein kinase ...    239   6e-72    
ref|XP_010454209.1|  PREDICTED: calcium-dependent protein kinase 34     239   6e-72    Camelina sativa [gold-of-pleasure]
ref|XP_010492994.1|  PREDICTED: calcium-dependent protein kinase ...    239   7e-72    Camelina sativa [gold-of-pleasure]
ref|XP_010420737.1|  PREDICTED: calcium-dependent protein kinase ...    238   7e-72    Camelina sativa [gold-of-pleasure]
gb|AAL59948.1|  putative calcium-dependent protein kinase               238   8e-72    Arabidopsis thaliana [mouse-ear cress]
ref|NP_196779.1|  calcium-dependent protein kinase 17                   238   9e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010904692.1|  PREDICTED: calcium-dependent protein kinase ...    238   9e-72    Elaeis guineensis
gb|EAY76207.1|  hypothetical protein OsI_04143                          238   9e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_006644875.1|  PREDICTED: calcium-dependent protein kinase ...    238   1e-71    Oryza brachyantha
ref|XP_006400491.1|  hypothetical protein EUTSA_v10013240mg             238   1e-71    Eutrema salsugineum [saltwater cress]
tpg|DAA57188.1|  TPA: putative calcium-dependent protein kinase f...    237   1e-71    
gb|KFK25494.1|  hypothetical protein AALP_AA8G122000                    238   2e-71    Arabis alpina [alpine rockcress]
gb|AGT17455.1|  hypothetical protein SHCRBa_258_F08_F_40                238   2e-71    Saccharum hybrid cultivar R570
gb|AGT15898.1|  calcium-dependent protein kinase                        238   2e-71    Saccharum hybrid cultivar R570
ref|NP_001044575.1|  Os01g0808400                                       237   2e-71    
ref|XP_002299975.2|  hypothetical protein POPTR_0001s28150g             237   2e-71    
dbj|BAA81749.1|  calcium-dependent protein kinase                       238   2e-71    Marchantia polymorpha
ref|XP_008674922.1|  PREDICTED: calcium-dependent protein kinase 34     237   2e-71    Zea mays [maize]
dbj|BAA81748.1|  calcium-dependent protein kinase                       238   2e-71    Marchantia polymorpha
gb|AGT17376.1|  calcium-dependent protein kinase                        238   3e-71    Saccharum hybrid cultivar R570
emb|CDY44912.1|  BnaA02g04170D                                          236   4e-71    Brassica napus [oilseed rape]
ref|XP_011024983.1|  PREDICTED: calcium-dependent protein kinase 17     237   4e-71    Populus euphratica
ref|XP_004491231.1|  PREDICTED: calcium-dependent protein kinase ...    236   4e-71    Cicer arietinum [garbanzo]
ref|XP_008786936.1|  PREDICTED: calcium-dependent protein kinase ...    236   4e-71    Phoenix dactylifera
ref|XP_008671573.1|  PREDICTED: calcium-dependent protein kinase ...    237   7e-71    Zea mays [maize]
gb|AFW84809.1|  putative calcium-dependent protein kinase family ...    234   8e-71    
ref|XP_001781985.1|  predicted protein                                  234   9e-71    
ref|XP_004961659.1|  PREDICTED: calcium-dependent protein kinase ...    237   9e-71    
ref|XP_009414363.1|  PREDICTED: calcium-dependent protein kinase 17     235   1e-70    
ref|XP_011009111.1|  PREDICTED: calcium-dependent protein kinase ...    235   1e-70    Populus euphratica
ref|XP_011014420.1|  PREDICTED: calcium-dependent protein kinase ...    235   1e-70    Populus euphratica
ref|XP_002313265.1|  calcium-dependent protein kinase                   235   1e-70    Populus trichocarpa [western balsam poplar]
ref|XP_008788593.1|  PREDICTED: calcium-dependent protein kinase ...    234   2e-70    Phoenix dactylifera
ref|XP_002276630.2|  PREDICTED: calcium-dependent protein kinase ...    235   2e-70    Vitis vinifera
ref|XP_008657141.1|  PREDICTED: calcium-dependent protein kinase ...    234   2e-70    Zea mays [maize]
ref|XP_010922091.1|  PREDICTED: calcium-dependent protein kinase ...    234   3e-70    Elaeis guineensis
ref|XP_003576346.1|  PREDICTED: calcium-dependent protein kinase ...    234   3e-70    Brachypodium distachyon [annual false brome]
emb|CAN62888.1|  hypothetical protein VITISV_025544                     235   3e-70    Vitis vinifera
gb|KHN23929.1|  Calcium-dependent protein kinase 17                     233   3e-70    Glycine soja [wild soybean]
gb|KDO62718.1|  hypothetical protein CISIN_1g0096582mg                  225   4e-70    Citrus sinensis [apfelsine]
gb|AGT16545.1|  calcium-dependent protein kinase 34                     234   5e-70    Saccharum hybrid cultivar R570
gb|KJB83565.1|  hypothetical protein B456_013G253100                    234   5e-70    Gossypium raimondii
ref|XP_002448943.1|  hypothetical protein SORBIDRAFT_05g002110          234   5e-70    Sorghum bicolor [broomcorn]
gb|KJB35709.1|  hypothetical protein B456_006G124800                    234   5e-70    Gossypium raimondii
ref|XP_003556786.1|  PREDICTED: calcium-dependent protein kinase ...    234   6e-70    Glycine max [soybeans]
ref|XP_009131258.1|  PREDICTED: calcium-dependent protein kinase ...    233   6e-70    Brassica rapa
ref|XP_008798404.1|  PREDICTED: calcium-dependent protein kinase ...    233   6e-70    Phoenix dactylifera
ref|XP_006655439.1|  PREDICTED: calcium-dependent protein kinase ...    232   8e-70    
gb|ABV22565.1|  calcium-dependent protein kinase                        234   8e-70    Physcomitrella patens
gb|KHN28162.1|  Calcium-dependent protein kinase 17                     232   9e-70    Glycine soja [wild soybean]
ref|XP_010269424.1|  PREDICTED: calcium-dependent protein kinase ...    233   9e-70    Nelumbo nucifera [Indian lotus]
dbj|BAK06838.1|  predicted protein                                      233   1e-69    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN38392.1|  Calcium-dependent protein kinase 17                     233   1e-69    Glycine soja [wild soybean]
ref|XP_007141507.1|  hypothetical protein PHAVU_008G201900g             233   1e-69    Phaseolus vulgaris [French bean]
ref|XP_010269425.1|  PREDICTED: calcium-dependent protein kinase ...    233   1e-69    Nelumbo nucifera [Indian lotus]
ref|NP_001266856.1|  calcium-dependent protein kinase                   233   1e-69    Zea mays [maize]
ref|XP_003528592.1|  PREDICTED: calcium-dependent protein kinase ...    233   1e-69    Glycine max [soybeans]
ref|XP_006575622.1|  PREDICTED: calcium-dependent protein kinase ...    233   1e-69    Glycine max [soybeans]
gb|AFW64738.1|  putative calcium-dependent protein kinase family ...    234   2e-69    
dbj|BAK06618.1|  predicted protein                                      232   3e-69    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB19075.1|  hypothetical protein B456_003G084000                    231   4e-69    Gossypium raimondii
ref|XP_003564438.1|  PREDICTED: calcium-dependent protein kinase 34     231   6e-69    Brachypodium distachyon [annual false brome]
gb|AFW82381.1|  putative calcium-dependent protein kinase family ...    233   6e-69    
ref|XP_002442700.1|  hypothetical protein SORBIDRAFT_08g001380          232   8e-69    Sorghum bicolor [broomcorn]
ref|XP_001768980.1|  predicted protein                                  229   9e-69    
ref|XP_003545165.1|  PREDICTED: calcium-dependent protein kinase ...    230   1e-68    Glycine max [soybeans]
ref|XP_009404695.1|  PREDICTED: calcium-dependent protein kinase ...    230   1e-68    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK07881.1|  predicted protein                                      229   2e-68    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE64198.1|  hypothetical protein OsJ_19030                          229   4e-68    Oryza sativa Japonica Group [Japonica rice]
gb|ABV22562.1|  calcium-dependent protein kinase                        230   4e-68    Physcomitrella patens
emb|CDX85697.1|  BnaA02g01160D                                          228   5e-68    
gb|AAT69647.1|  hypothetical protein                                    228   6e-68    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055912.1|  Os05g0491900                                       229   7e-68    
ref|XP_006452370.1|  hypothetical protein CICLE_v10007983mg             226   1e-67    
emb|CDX91168.1|  BnaC02g04290D                                          228   1e-67    
ref|XP_003568203.1|  PREDICTED: calcium-dependent protein kinase ...    227   2e-67    Brachypodium distachyon [annual false brome]
gb|KHN12036.1|  Calcium-dependent protein kinase 17                     228   2e-67    Glycine soja [wild soybean]
gb|EEC79448.1|  hypothetical protein OsI_20437                          226   3e-67    Oryza sativa Indica Group [Indian rice]
ref|XP_008806408.1|  PREDICTED: calcium-dependent protein kinase 2      227   3e-67    Phoenix dactylifera
emb|CBX25242.1|  hypothetical_protein                                   227   3e-67    Oryza brachyantha
ref|XP_006664312.1|  PREDICTED: calcium-dependent protein kinase ...    225   3e-67    
ref|XP_006662719.1|  PREDICTED: calcium-dependent protein kinase ...    226   5e-67    Oryza brachyantha
ref|XP_006452371.1|  hypothetical protein CICLE_v10007983mg             226   5e-67    Citrus clementina [clementine]
ref|XP_011627635.1|  PREDICTED: calcium-dependent protein kinase ...    223   5e-67    
emb|CBX25340.1|  hypothetical_protein                                   226   6e-67    Oryza brachyantha
ref|XP_007146136.1|  hypothetical protein PHAVU_006G015300g             226   7e-67    Phaseolus vulgaris [French bean]
gb|ERN17348.1|  hypothetical protein AMTR_s00037p00138680               222   7e-67    
ref|XP_003578964.1|  PREDICTED: calcium-dependent protein kinase ...    226   8e-67    
ref|XP_008804309.1|  PREDICTED: calcium-dependent protein kinase ...    225   1e-66    
gb|ABY59018.1|  calcium-dependent protein kinase                        225   1e-66    
ref|XP_010276092.1|  PREDICTED: calcium-dependent protein kinase ...    225   1e-66    
ref|XP_011090473.1|  PREDICTED: calcium-dependent protein kinase ...    224   1e-66    
ref|XP_010278695.1|  PREDICTED: calcium-dependent protein kinase ...    225   2e-66    
ref|XP_001767768.1|  cpk1 calcium-dependent protein kinase              225   2e-66    
ref|XP_002979552.1|  calcium dependent protein kinase 17                225   2e-66    
gb|KCW66999.1|  hypothetical protein EUGRSUZ_F007611                    219   2e-66    
ref|XP_002977722.1|  calcium dependent protein kinase 17                225   2e-66    
ref|XP_007020822.1|  Calmodulin-domain protein kinase 9 isoform 3       220   3e-66    
ref|XP_007020821.1|  Calmodulin-domain protein kinase 9 isoform 2       220   3e-66    
gb|AGT17166.1|  calcium-dependent protein kinase                        222   4e-66    
ref|XP_006475136.1|  PREDICTED: calcium-dependent protein kinase ...    227   4e-66    
ref|XP_002456506.1|  hypothetical protein SORBIDRAFT_03g037570          221   6e-66    
gb|ABA95733.1|  Calcium-dependent protein kinase, isoform 2, puta...    223   7e-66    
ref|NP_001065691.1|  Os11g0136600                                       223   7e-66    
ref|XP_004500067.1|  PREDICTED: calcium-dependent protein kinase ...    223   7e-66    
gb|KCW67039.1|  hypothetical protein EUGRSUZ_F00807                     222   8e-66    
gb|AAA61682.1|  calcium-dependent protein kinase                        221   9e-66    
ref|NP_001176777.1|  Os12g0133500                                       224   9e-66    
ref|XP_010060380.1|  PREDICTED: calcium-dependent protein kinase ...    223   1e-65    
gb|AAD17800.1|  Ca2+-dependent protein kinase                           222   2e-65    
gb|AET00506.2|  calcium-dependent kinase                                221   3e-65    
ref|XP_002891589.1|  calcium-dependent protein kinase 33                221   3e-65    
ref|XP_006657762.1|  PREDICTED: calcium-dependent protein kinase ...    221   3e-65    
gb|KDO78219.1|  hypothetical protein CISIN_1g009091mg                   219   4e-65    
ref|XP_010923910.1|  PREDICTED: calcium-dependent protein kinase ...    220   4e-65    
ref|XP_011096067.1|  PREDICTED: calcium-dependent protein kinase-...    221   5e-65    
gb|EMT33574.1|  Calcium-dependent protein kinase 34                     219   5e-65    
ref|XP_004491400.1|  PREDICTED: calcium-dependent protein kinase ...    221   5e-65    
ref|XP_007020820.1|  Calmodulin-domain protein kinase 9 isoform 1       221   6e-65    
gb|KHN02836.1|  Calcium-dependent protein kinase 9                      221   7e-65    
gb|ACJ61504.1|  calcium-dependent protein kinase                        221   8e-65    
emb|CDM84631.1|  unnamed protein product                                219   8e-65    
gb|KCW75309.1|  hypothetical protein EUGRSUZ_E04057                     220   9e-65    
ref|NP_175485.1|  calcium-dependent protein kinase 33                   220   9e-65    
ref|XP_007026068.1|  Calcium-dependent protein kinase 21 isoform 3      219   1e-64    
ref|XP_006657761.1|  PREDICTED: calcium-dependent protein kinase ...    221   1e-64    
ref|XP_010923909.1|  PREDICTED: calcium-dependent protein kinase ...    220   1e-64    
ref|XP_007026067.1|  Calcium-dependent protein kinase 21 isoform 2      219   1e-64    
gb|EMT05629.1|  Calcium-dependent protein kinase 34                     219   1e-64    
ref|XP_010057925.1|  PREDICTED: calcium-dependent protein kinase ...    220   1e-64    
gb|KCW75310.1|  hypothetical protein EUGRSUZ_E04057                     220   1e-64    
emb|CAA65500.1|  protein kinase                                         219   2e-64    
gb|ABE72958.1|  calcium dependent protein kinase 3                      219   2e-64    
gb|AFY10519.1|  calcium dependent protein kinase 1                      219   2e-64    
ref|XP_001782248.1|  predicted protein                                  218   2e-64    
gb|KEH33831.1|  calmodulin-domain kinase CDPK protein                   219   2e-64    
ref|XP_010461925.1|  PREDICTED: calcium-dependent protein kinase 33     219   2e-64    
gb|KDO78218.1|  hypothetical protein CISIN_1g009091mg                   219   3e-64    
ref|XP_006828852.1|  PREDICTED: calcium-dependent protein kinase ...    219   3e-64    
ref|NP_001235641.1|  calmodulin-like domain protein kinase isoenz...    219   3e-64    
gb|KDO78217.1|  hypothetical protein CISIN_1g009091mg                   219   4e-64    
ref|XP_007026066.1|  Calcium-dependent protein kinase 21 isoform 1      219   4e-64    
ref|XP_010060346.1|  PREDICTED: calcium-dependent protein kinase ...    219   4e-64    
ref|XP_009388872.1|  PREDICTED: calcium-dependent protein kinase ...    219   4e-64    
ref|XP_011086186.1|  PREDICTED: calcium-dependent protein kinase-...    219   4e-64    
emb|CAD70165.1|  calcium-dependent protein kinase                       219   4e-64    
ref|XP_002983821.1|  calcium dependent protein kinase 3                 218   5e-64    
gb|AFR11230.1|  calcium dependent protein kinase 1                      218   5e-64    
ref|NP_001059775.1|  Os07g0515100                                       218   5e-64    
ref|XP_010060348.1|  PREDICTED: calcium-dependent protein kinase ...    219   5e-64    
ref|XP_010092160.1|  Calcium-dependent protein kinase 9                 218   5e-64    
dbj|BAA13440.1|  calcium dependent protein kinase                       218   5e-64    
ref|XP_002989102.1|  calcium dependent protein kinase                   218   5e-64    
ref|XP_006467440.1|  PREDICTED: calcium-dependent protein kinase ...    218   5e-64    
ref|XP_007142270.1|  hypothetical protein PHAVU_008G266600g             218   6e-64    
ref|XP_004152931.1|  PREDICTED: calcium-dependent protein kinase-...    218   6e-64    
gb|KHN16772.1|  Calcium-dependent protein kinase 3                      207   6e-64    
ref|XP_011628928.1|  PREDICTED: calcium-dependent protein kinase ...    218   7e-64    
gb|KHG26977.1|  Calcium-dependent protein kinase 9                      218   7e-64    
ref|XP_007213894.1|  hypothetical protein PRUPE_ppa003830mg             218   7e-64    
ref|XP_008463413.1|  PREDICTED: calcium-dependent protein kinase-...    217   1e-63    
ref|XP_012091348.1|  PREDICTED: calcium-dependent protein kinase ...    218   1e-63    
gb|ADM14342.1|  calcium-dependent protein kinase 19                     217   1e-63    
emb|CDP04396.1|  unnamed protein product                                217   2e-63    
gb|EMS56466.1|  Calcium-dependent protein kinase 34                     217   2e-63    
ref|XP_008226901.1|  PREDICTED: calcium-dependent protein kinase 2      217   2e-63    
ref|XP_004294385.1|  PREDICTED: calcium-dependent protein kinase ...    217   2e-63    
ref|XP_006600312.1|  PREDICTED: calcium-dependent protein kinase ...    217   2e-63    
ref|XP_003519577.1|  PREDICTED: calcium-dependent protein kinase ...    216   2e-63    
ref|XP_010479536.1|  PREDICTED: calcium-dependent protein kinase ...    216   2e-63    
gb|AGJ83807.1|  calcium-dependent protein kinase 1e                     216   3e-63    
ref|XP_012070829.1|  PREDICTED: calcium-dependent protein kinase ...    216   3e-63    
gb|AGA83664.1|  calcium-dependent protein kinase 1                      216   3e-63    
gb|EYU33891.1|  hypothetical protein MIMGU_mgv1a004201mg                216   3e-63    
sp|P28582.2|CDPK_DAUCA  RecName: Full=Calcium-dependent protein k...    216   3e-63    
ref|NP_001266075.1|  calcium-dependent protein kinase 21-like           216   4e-63    
ref|XP_006303970.1|  hypothetical protein CARUB_v10008860mg             216   4e-63    
ref|XP_002284750.2|  PREDICTED: calcium-dependent protein kinase 29     216   4e-63    
gb|KJB81729.1|  hypothetical protein B456_013G159300                    214   5e-63    
emb|CDP05759.1|  unnamed protein product                                215   5e-63    
gb|KJB13681.1|  hypothetical protein B456_002G088800                    214   5e-63    
ref|NP_001105542.1|  calcium-dependent protein kinase 2                 215   5e-63    
gb|ACB71246.2|  calcium-dependent protein kinase 1                      216   5e-63    
gb|EMT23982.1|  Calcium-dependent protein kinase 17                     216   5e-63    
gb|KJB63479.1|  hypothetical protein B456_010G001300                    215   6e-63    
ref|NP_001280761.1|  calcium-dependent protein kinase 2-like            215   7e-63    
gb|KFK35914.1|  hypothetical protein AALP_AA4G052700                    214   7e-63    
ref|XP_002518484.1|  calcium-dependent protein kinase, putative         216   8e-63    
ref|XP_006827112.1|  PREDICTED: calcium-dependent protein kinase 34     215   8e-63    
ref|XP_009592788.1|  PREDICTED: calcium-dependent protein kinase 2      215   8e-63    
ref|XP_008800033.1|  PREDICTED: calcium-dependent protein kinase 29     214   9e-63    
ref|XP_008224828.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    215   9e-63    
ref|XP_003617547.1|  Calcium dependent protein kinase                   221   1e-62    
ref|NP_001105306.1|  calcium-dependent protein kinase                   214   1e-62    
ref|XP_002278179.1|  PREDICTED: calcium-dependent protein kinase 2      214   1e-62    
ref|XP_010686845.1|  PREDICTED: calcium-dependent protein kinase ...    216   1e-62    
ref|XP_009783685.1|  PREDICTED: calcium-dependent protein kinase ...    214   1e-62    
gb|KJB13679.1|  hypothetical protein B456_002G088800                    214   1e-62    
ref|XP_010501945.1|  PREDICTED: calcium-dependent protein kinase ...    215   1e-62    
gb|AAQ17506.1|  calcium dependent protein kinase 3                      214   1e-62    
gb|AGJ83805.1|  calcium-dependent protein kinase 1a                     214   1e-62    
gb|KJB81728.1|  hypothetical protein B456_013G159300                    213   2e-62    
ref|XP_007153943.1|  hypothetical protein PHAVU_003G078400g             214   2e-62    
dbj|BAE71239.1|  putative calcium dependent protein kinase              215   2e-62    
gb|KHG28675.1|  Calcium-dependent protein kinase 9                      214   2e-62    
ref|XP_009360996.1|  PREDICTED: calcium-dependent protein kinase ...    214   2e-62    
ref|XP_009357448.1|  PREDICTED: calcium-dependent protein kinase ...    214   2e-62    
gb|KHG17079.1|  Calcium-dependent protein kinase 9                      214   2e-62    
emb|CAA57157.1|  calcium-dependent protein kinase                       214   2e-62    
ref|XP_006449723.1|  hypothetical protein CICLE_v10014823mg             214   2e-62    
ref|XP_003563028.1|  PREDICTED: calcium-dependent protein kinase ...    214   3e-62    
gb|AEY99979.1|  calcium-dependent protein kinase                        213   3e-62    
ref|XP_008651864.1|  PREDICTED: calcium-dependent protein kinase ...    214   3e-62    
gb|ABC59619.1|  calcium-dependent protein kinase                        214   3e-62    
ref|XP_009798561.1|  PREDICTED: calcium-dependent protein kinase ...    213   3e-62    
gb|ACY78680.1|  calcium-dependent protein kinase 1                      214   3e-62    
gb|ABD98803.1|  calcium-dependent protein kinase                        214   3e-62    
dbj|BAJ99143.1|  predicted protein                                      213   3e-62    
ref|XP_010466227.1|  PREDICTED: calcium-dependent protein kinase ...    214   3e-62    
gb|KFK39368.1|  hypothetical protein AALP_AA3G235800                    213   3e-62    
ref|XP_004134759.1|  PREDICTED: calcium-dependent protein kinase ...    214   3e-62    
emb|CAN67210.1|  hypothetical protein VITISV_026712                     214   4e-62    
ref|XP_010508871.1|  PREDICTED: calcium-dependent protein kinase 9      213   4e-62    
ref|XP_009604147.1|  PREDICTED: calcium-dependent protein kinase ...    213   4e-62    
gb|ABB54456.1|  calcium-dependent protein kinase                        213   4e-62    
ref|XP_003610427.1|  Calcium-dependent protein kinase                   213   4e-62    
ref|XP_011095398.1|  PREDICTED: calcium-dependent protein kinase ...    213   5e-62    
ref|XP_002532559.1|  calcium-dependent protein kinase, putative         213   5e-62    
ref|XP_009334623.1|  PREDICTED: calcium-dependent protein kinase 29     214   5e-62    
ref|XP_011037643.1|  PREDICTED: calcium-dependent protein kinase-...    213   5e-62    
ref|XP_010266896.1|  PREDICTED: calcium-dependent protein kinase ...    213   6e-62    
emb|CDX91224.1|  BnaC02g26350D                                          210   6e-62    
ref|XP_008439982.1|  PREDICTED: calcium-dependent protein kinase 2      213   6e-62    
gb|KJB81727.1|  hypothetical protein B456_013G159300                    213   6e-62    
ref|XP_002883243.1|  calmodulin-domain protein kinase 9                 213   6e-62    
ref|XP_006297378.1|  hypothetical protein CARUB_v10013403mg             213   6e-62    
ref|XP_010545509.1|  PREDICTED: calcium-dependent protein kinase 33     213   7e-62    
gb|AIU98504.1|  calcium-dependent protein kinase                        212   7e-62    
gb|KHG10851.1|  Calcium-dependent protein kinase 21                     213   7e-62    
ref|XP_010266895.1|  PREDICTED: calcium-dependent protein kinase ...    213   7e-62    
ref|XP_008365060.1|  PREDICTED: calcium-dependent protein kinase 2      213   7e-62    
ref|XP_006406385.1|  hypothetical protein EUTSA_v10020475mg             213   8e-62    
gb|KJB69279.1|  hypothetical protein B456_011G014200                    213   8e-62    
ref|XP_002971737.1|  calcium-dependent protein kinase 17                211   8e-62    
ref|NP_001234582.1|  calcium-dependent protein kinase CDPK1             212   9e-62    
ref|NP_001275456.1|  calcium-dependent protein kinase 3                 213   9e-62    
gb|KJB62816.1|  hypothetical protein B456_009G438300                    212   9e-62    
gb|KDO84959.1|  hypothetical protein CISIN_1g010263mg                   208   9e-62    
ref|XP_002991556.1|  calcium dependent protein kinase 34                211   1e-61    
ref|XP_006389625.1|  hypothetical protein POPTR_0021s00750g             212   1e-61    
gb|AAP03014.1|  seed calcium dependent protein kinase c                 212   1e-61    
ref|XP_004957849.1|  PREDICTED: calcium-dependent protein kinase ...    212   1e-61    
gb|KFK30983.1|  hypothetical protein AALP_AA6G053500                    212   1e-61    
ref|XP_007146477.1|  hypothetical protein PHAVU_006G0437000g            210   1e-61    
ref|XP_001768977.1|  predicted protein                                  213   1e-61    
ref|NP_188676.1|  calmodulin-domain protein kinase 9                    212   2e-61    
gb|EPS59225.1|  calcium-dependent protein kinase 1                      211   2e-61    
gb|ABV22560.1|  calcium-dependent protein kinase                        212   2e-61    
ref|XP_009135689.1|  PREDICTED: calcium-dependent protein kinase 9      212   2e-61    
emb|CDX82244.1|  BnaA03g35770D                                          211   2e-61    
ref|XP_003529633.1|  PREDICTED: calcium-dependent protein kinase ...    211   2e-61    
gb|KCW68005.1|  hypothetical protein EUGRSUZ_F01694                     209   2e-61    
emb|CDY36037.1|  BnaC03g41610D                                          211   2e-61    
ref|XP_011047988.1|  PREDICTED: calcium-dependent protein kinase-...    211   2e-61    
gb|AIO04122.1|  calcium-dependent protein kinase                        211   3e-61    
ref|XP_003570118.1|  PREDICTED: calcium-dependent protein kinase ...    211   3e-61    
ref|XP_006452344.1|  hypothetical protein CICLE_v10007980mg             211   3e-61    
gb|AGG35978.1|  calcium-dependent protein kinase 9                      211   3e-61    
ref|XP_009360846.1|  PREDICTED: calcium-dependent protein kinase ...    211   3e-61    
gb|ABC59620.1|  calcium-dependent protein kinase                        211   3e-61    
gb|KCW68004.1|  hypothetical protein EUGRSUZ_F01694                     208   3e-61    
gb|ADZ52811.1|  calcium-dependent protein kinase 3                      211   3e-61    
ref|XP_011047987.1|  PREDICTED: calcium-dependent protein kinase-...    211   3e-61    
emb|CBI24256.3|  unnamed protein product                                210   4e-61    
ref|XP_004957848.1|  PREDICTED: calcium-dependent protein kinase ...    211   4e-61    
dbj|BAG87126.1|  unnamed protein product                                203   5e-61    
gb|ACR34538.1|  unknown                                                 210   5e-61    
gb|ABD98804.1|  calcium-dependent protein kinase                        210   6e-61    
gb|KJB68586.1|  hypothetical protein B456_010G252400                    209   8e-61    
ref|XP_011459094.1|  PREDICTED: calcium-dependent protein kinase ...    209   8e-61    
gb|AGG35970.1|  calcium-dependent protein kinase 21                     209   9e-61    
gb|AAD28192.2|  calcium-dependent protein kinase                        209   9e-61    
ref|NP_001275371.1|  calcium-dependent protein kinase 2                 209   1e-60    
ref|XP_006473713.1|  PREDICTED: calcium-dependent protein kinase ...    208   1e-60    
ref|XP_006346214.1|  PREDICTED: calcium-dependent protein kinase ...    209   1e-60    
ref|XP_007222396.1|  hypothetical protein PRUPE_ppa004027mg             209   1e-60    
ref|XP_002874811.1|  calcium-dependent protein kinase 21                209   1e-60    
ref|XP_006289661.1|  hypothetical protein CARUB_v10003219mg             209   1e-60    
ref|XP_009627158.1|  PREDICTED: calcium-dependent protein kinase ...    209   1e-60    
ref|XP_002510594.1|  calcium-dependent protein kinase, putative         209   1e-60    
ref|XP_008221211.1|  PREDICTED: calcium-dependent protein kinase 29     209   2e-60    
ref|XP_010061106.1|  PREDICTED: calcium-dependent protein kinase ...    209   2e-60    
ref|XP_007160628.1|  hypothetical protein PHAVU_001G003300g             205   2e-60    
ref|XP_010675716.1|  PREDICTED: calcium-dependent protein kinase ...    209   2e-60    
ref|XP_010422295.1|  PREDICTED: calcium-dependent protein kinase 21     209   2e-60    
ref|XP_010455773.1|  PREDICTED: calcium-dependent protein kinase ...    209   2e-60    
gb|AAK92828.1|  putative calcium dependent protein kinase               209   2e-60    
ref|NP_192381.1|  calcium-dependent protein kinase 21                   209   2e-60    
ref|NP_001275322.1|  calcium-dependent protein kinase                   209   2e-60    
ref|XP_004976604.1|  PREDICTED: calcium-dependent protein kinase ...    209   2e-60    
ref|NP_001234806.1|  calcium-dependent protein kinase                   209   2e-60    
ref|XP_004291330.1|  PREDICTED: calcium-dependent protein kinase ...    208   3e-60    
ref|XP_006473712.1|  PREDICTED: calcium-dependent protein kinase ...    208   3e-60    
ref|XP_010538709.1|  PREDICTED: calcium-dependent protein kinase ...    209   3e-60    
gb|KDO62703.1|  hypothetical protein CISIN_1g009382mg                   208   3e-60    
ref|XP_002305576.2|  hypothetical protein POPTR_0004s01530g             208   3e-60    
ref|XP_005849715.1|  hypothetical protein CHLNCDRAFT_30247              208   3e-60    



>gb|ABC47163.2| CDPK1 [Ipomoea nil]
 gb|AFO63177.1| calcium dependent protein kinase 1 [Ipomoea nil]
Length=514

 Score =   395 bits (1016),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 199/199 (100%), Positives = 199/199 (100%), Gaps = 0/199 (0%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVH  217
            MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLPPSQPPPPRPFLSGVGRVLGRPMEDVH
Sbjct  1    MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLPPSQPPPPRPFLSGVGRVLGRPMEDVH  60

Query  218  STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTG  397
            STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTG
Sbjct  61   STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTG  120

Query  398  HRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHS  577
            HRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHS
Sbjct  121  HRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHS  180

Query  578  MGVMHRDLKPENFLFLSSD  634
            MGVMHRDLKPENFLFLSSD
Sbjct  181  MGVMHRDLKPENFLFLSSD  199



>ref|XP_009786035.1| PREDICTED: calcium-dependent protein kinase 3 [Nicotiana sylvestris]
Length=514

 Score =   315 bits (808),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 173/199 (87%), Gaps = 0/199 (0%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVH  217
            MG+CNS  S      S+GG + PPP +     + PS  PPP   LSG+GRVLG+PMEDV 
Sbjct  1    MGNCNSSSSDQTTTISSGGATGPPPSETTGIRIIPSSQPPPPRPLSGIGRVLGKPMEDVR  60

Query  218  STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTG  397
            STYIFGGELGRGQFGVT+LVTH++T ++ ACKSIATRKL++ DDVDDVRREVQIMHHLTG
Sbjct  61   STYIFGGELGRGQFGVTFLVTHKQTHQQFACKSIATRKLIAADDVDDVRREVQIMHHLTG  120

Query  398  HRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHS  577
            HRNIVELKGT+ED++HVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTV+HYCHS
Sbjct  121  HRNIVELKGTFEDKHHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVVHYCHS  180

Query  578  MGVMHRDLKPENFLFLSSD  634
            MGVMHRDLKPENFLFLSSD
Sbjct  181  MGVMHRDLKPENFLFLSSD  199



>ref|XP_009620189.1| PREDICTED: calcium-dependent protein kinase 3 [Nicotiana tomentosiformis]
Length=514

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 174/199 (87%), Gaps = 0/199 (0%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVH  217
            MG+CNS  S     TS GG + PPP +     + PS  PPP   LSG+GRVLG+PME+V 
Sbjct  1    MGNCNSSSSDQTTTTSLGGATGPPPSETTGIRIIPSSQPPPPRPLSGIGRVLGKPMEEVR  60

Query  218  STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTG  397
            STYIFGGELGRGQFGVTYLVTH++TR++ ACKSIATRKL++ DDVDDVRREVQIMHHLTG
Sbjct  61   STYIFGGELGRGQFGVTYLVTHKQTRQQFACKSIATRKLIAADDVDDVRREVQIMHHLTG  120

Query  398  HRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHS  577
            HRNIVELKGT+ED++HVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTV+HYCHS
Sbjct  121  HRNIVELKGTFEDKHHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVVHYCHS  180

Query  578  MGVMHRDLKPENFLFLSSD  634
            MGVMHRDLKPENFLFLSSD
Sbjct  181  MGVMHRDLKPENFLFLSSD  199



>gb|ACH85192.1| calcium-dependent protein kinase CDPK5 [Nicotiana tabacum]
Length=514

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/199 (78%), Positives = 173/199 (87%), Gaps = 0/199 (0%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVH  217
            MG+CNS  S     T  GG + PPP +     + PS  PPP   LSG+GRVLG+PME+V 
Sbjct  1    MGNCNSSSSDQTTTTCLGGATGPPPSETTGIRIIPSSQPPPPRPLSGIGRVLGKPMEEVR  60

Query  218  STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTG  397
            STYIFGGELGRGQFGVTYLVTH++TR++ ACKSIATRKL++ DDVDDVRREVQIMHHLTG
Sbjct  61   STYIFGGELGRGQFGVTYLVTHKQTRQQFACKSIATRKLIAADDVDDVRREVQIMHHLTG  120

Query  398  HRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHS  577
            HRNIVELKGT+ED++HVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTV+HYCHS
Sbjct  121  HRNIVELKGTFEDKHHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVVHYCHS  180

Query  578  MGVMHRDLKPENFLFLSSD  634
            MGVMHRDLKPENFLFLSSD
Sbjct  181  MGVMHRDLKPENFLFLSSD  199



>ref|XP_006352261.1| PREDICTED: calcium-dependent protein kinase 3-like [Solanum tuberosum]
Length=517

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 167/218 (77%), Gaps = 35/218 (16%)
 Frame = +2

Query  38   MGSCNSIPSS--------------PFAATSAGG-----ESDPPPPKNDITVLppsqpppp  160
            MG+CNS+ S                 +A S  G      S  PPP+              
Sbjct  1    MGNCNSLSSDHPPPPAAAAGGGGGATSAPSTTGIRIIPSSQTPPPRP-------------  47

Query  161  rpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLS  340
                SG+GRVLGRPMEDV S YIFGGELGRGQFGVTYLVT++KTR++ ACKSIATRKL++
Sbjct  48   ---FSGIGRVLGRPMEDVRSIYIFGGELGRGQFGVTYLVTNKKTRQQFACKSIATRKLIN  104

Query  341  KDDVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSE  520
            KDDVDDVRREVQIMHHLTGHRNIVELKGT+ED++HVHLVMELCAGGELFDRIIAKGHYSE
Sbjct  105  KDDVDDVRREVQIMHHLTGHRNIVELKGTFEDKHHVHLVMELCAGGELFDRIIAKGHYSE  164

Query  521  RAAAGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            RAAAG+CRQMVTV+H CHSMGVMHRDLKPENFLFLSSD
Sbjct  165  RAAAGVCRQMVTVVHNCHSMGVMHRDLKPENFLFLSSD  202



>ref|XP_004244622.1| PREDICTED: calcium-dependent protein kinase 3 [Solanum lycopersicum]
Length=516

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = +2

Query  176  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  355
            G+GRVLGRPMEDV S YIFGGELGRGQFGVTYLVT++KTR++ ACKSIATRKL++KDDVD
Sbjct  49   GIGRVLGRPMEDVRSIYIFGGELGRGQFGVTYLVTNKKTRQQFACKSIATRKLINKDDVD  108

Query  356  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  535
            DVRREVQIMHHLTGHRNIVELKGT+ED++HVHLVMELCAGGELFDRIIAKGHYSERAAAG
Sbjct  109  DVRREVQIMHHLTGHRNIVELKGTFEDKHHVHLVMELCAGGELFDRIIAKGHYSERAAAG  168

Query  536  LCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            +CRQMVTV+H CHSMGVMHRDLKPENFLFLSSD
Sbjct  169  VCRQMVTVVHNCHSMGVMHRDLKPENFLFLSSD  201



>gb|KDO76380.1| hypothetical protein CISIN_1g010013mg [Citrus sinensis]
Length=350

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 160/204 (78%), Gaps = 6/204 (3%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  199
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  200  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  379
            PMEDV +TYIFG ELGRGQFGVTYLVTH+ T+++ ACKSI++RKL+++DDV+DVRREVQI
Sbjct  61   PMEDVRNTYIFGRELGRGQFGVTYLVTHKDTKQQFACKSISSRKLINRDDVEDVRREVQI  120

Query  380  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTV  559
            MHHLTGHRNIVELKG YEDR+ V+L+M+LCAGGELFDRIIAKGHYSERAAA LCRQMVTV
Sbjct  121  MHHLTGHRNIVELKGAYEDRHSVNLIMDLCAGGELFDRIIAKGHYSERAAANLCRQMVTV  180

Query  560  LHYCHSMGVMHRDLKPENFLFLSS  631
            +HYCHSMGVMHRDLKPENFLF SS
Sbjct  181  VHYCHSMGVMHRDLKPENFLFSSS  204



>ref|XP_006439440.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
 gb|ESR52680.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
Length=350

 Score =   280 bits (717),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 160/204 (78%), Gaps = 6/204 (3%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  199
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  200  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  379
            PMEDV +TYIFG ELGRGQFG+TYLVTH+ T+++ ACKSI++RKL+++DDV+DVRREVQI
Sbjct  61   PMEDVRNTYIFGRELGRGQFGITYLVTHKYTKQQFACKSISSRKLINRDDVEDVRREVQI  120

Query  380  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTV  559
            MHHLTGHRNIVELKG YEDR+ V+L+M+LCAGGELFDRIIAKGHYSERAAA LCRQMVTV
Sbjct  121  MHHLTGHRNIVELKGAYEDRHSVNLIMDLCAGGELFDRIIAKGHYSERAAANLCRQMVTV  180

Query  560  LHYCHSMGVMHRDLKPENFLFLSS  631
            +HYCHSMGVMHRDLKPENFLF SS
Sbjct  181  VHYCHSMGVMHRDLKPENFLFSSS  204



>gb|KDO76378.1| hypothetical protein CISIN_1g010013mg [Citrus sinensis]
Length=420

 Score =   283 bits (723),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 160/204 (78%), Gaps = 6/204 (3%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  199
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  200  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  379
            PMEDV +TYIFG ELGRGQFGVTYLVTH+ T+++ ACKSI++RKL+++DDV+DVRREVQI
Sbjct  61   PMEDVRNTYIFGRELGRGQFGVTYLVTHKDTKQQFACKSISSRKLINRDDVEDVRREVQI  120

Query  380  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTV  559
            MHHLTGHRNIVELKG YEDR+ V+L+M+LCAGGELFDRIIAKGHYSERAAA LCRQMVTV
Sbjct  121  MHHLTGHRNIVELKGAYEDRHSVNLIMDLCAGGELFDRIIAKGHYSERAAANLCRQMVTV  180

Query  560  LHYCHSMGVMHRDLKPENFLFLSS  631
            +HYCHSMGVMHRDLKPENFLF SS
Sbjct  181  VHYCHSMGVMHRDLKPENFLFSSS  204



>ref|XP_006439442.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
 gb|ESR52682.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
Length=420

 Score =   282 bits (722),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 160/204 (78%), Gaps = 6/204 (3%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  199
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  200  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  379
            PMEDV +TYIFG ELGRGQFG+TYLVTH+ T+++ ACKSI++RKL+++DDV+DVRREVQI
Sbjct  61   PMEDVRNTYIFGRELGRGQFGITYLVTHKYTKQQFACKSISSRKLINRDDVEDVRREVQI  120

Query  380  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTV  559
            MHHLTGHRNIVELKG YEDR+ V+L+M+LCAGGELFDRIIAKGHYSERAAA LCRQMVTV
Sbjct  121  MHHLTGHRNIVELKGAYEDRHSVNLIMDLCAGGELFDRIIAKGHYSERAAANLCRQMVTV  180

Query  560  LHYCHSMGVMHRDLKPENFLFLSS  631
            +HYCHSMGVMHRDLKPENFLF SS
Sbjct  181  VHYCHSMGVMHRDLKPENFLFSSS  204



>gb|KDO76377.1| hypothetical protein CISIN_1g010013mg [Citrus sinensis]
Length=480

 Score =   284 bits (726),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 160/204 (78%), Gaps = 6/204 (3%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  199
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  200  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  379
            PMEDV +TYIFG ELGRGQFGVTYLVTH+ T+++ ACKSI++RKL+++DDV+DVRREVQI
Sbjct  61   PMEDVRNTYIFGRELGRGQFGVTYLVTHKDTKQQFACKSISSRKLINRDDVEDVRREVQI  120

Query  380  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTV  559
            MHHLTGHRNIVELKG YEDR+ V+L+M+LCAGGELFDRIIAKGHYSERAAA LCRQMVTV
Sbjct  121  MHHLTGHRNIVELKGAYEDRHSVNLIMDLCAGGELFDRIIAKGHYSERAAANLCRQMVTV  180

Query  560  LHYCHSMGVMHRDLKPENFLFLSS  631
            +HYCHSMGVMHRDLKPENFLF SS
Sbjct  181  VHYCHSMGVMHRDLKPENFLFSSS  204



>gb|KDO76379.1| hypothetical protein CISIN_1g010013mg [Citrus sinensis]
Length=397

 Score =   281 bits (719),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 160/204 (78%), Gaps = 6/204 (3%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  199
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  200  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  379
            PMEDV +TYIFG ELGRGQFGVTYLVTH+ T+++ ACKSI++RKL+++DDV+DVRREVQI
Sbjct  61   PMEDVRNTYIFGRELGRGQFGVTYLVTHKDTKQQFACKSISSRKLINRDDVEDVRREVQI  120

Query  380  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTV  559
            MHHLTGHRNIVELKG YEDR+ V+L+M+LCAGGELFDRIIAKGHYSERAAA LCRQMVTV
Sbjct  121  MHHLTGHRNIVELKGAYEDRHSVNLIMDLCAGGELFDRIIAKGHYSERAAANLCRQMVTV  180

Query  560  LHYCHSMGVMHRDLKPENFLFLSS  631
            +HYCHSMGVMHRDLKPENFLF SS
Sbjct  181  VHYCHSMGVMHRDLKPENFLFSSS  204



>ref|XP_010261434.1| PREDICTED: calcium-dependent protein kinase 3-like [Nelumbo nucifera]
Length=531

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 165/216 (76%), Gaps = 17/216 (8%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGES--DPPPPKNDITVLppsqpppprpFL-------------  172
            MG+CN +PS+       G  +   PPP  N I V P  +P PP   L             
Sbjct  1    MGNCNGLPSNGDQLQPGGAANLHAPPPTNNVINVRPDDKPTPPPSILHQGPQQPPSFVHR  60

Query  173  --SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKD  346
              S  GRVLGRPMEDV STYIFG ELGRGQFGVTYLVTH++T+++ ACKSIATRKL+++D
Sbjct  61   PLSSTGRVLGRPMEDVRSTYIFGRELGRGQFGVTYLVTHKETKQQYACKSIATRKLVNRD  120

Query  347  DVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERA  526
            D++DVRREVQIMHHLTGHRNIVELKG YEDR  V+LVMELC GGELFDRIIAKGHYSERA
Sbjct  121  DIEDVRREVQIMHHLTGHRNIVELKGAYEDRQSVNLVMELCEGGELFDRIIAKGHYSERA  180

Query  527  AAGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            AA LCRQ+VTV+H CHSMGVMHRDLKPENFLFLS +
Sbjct  181  AAALCRQIVTVVHNCHSMGVMHRDLKPENFLFLSKE  216



>ref|XP_006439441.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
 gb|ESR52681.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
Length=397

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 160/204 (78%), Gaps = 6/204 (3%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  199
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  200  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  379
            PMEDV +TYIFG ELGRGQFG+TYLVTH+ T+++ ACKSI++RKL+++DDV+DVRREVQI
Sbjct  61   PMEDVRNTYIFGRELGRGQFGITYLVTHKYTKQQFACKSISSRKLINRDDVEDVRREVQI  120

Query  380  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTV  559
            MHHLTGHRNIVELKG YEDR+ V+L+M+LCAGGELFDRIIAKGHYSERAAA LCRQMVTV
Sbjct  121  MHHLTGHRNIVELKGAYEDRHSVNLIMDLCAGGELFDRIIAKGHYSERAAANLCRQMVTV  180

Query  560  LHYCHSMGVMHRDLKPENFLFLSS  631
            +HYCHSMGVMHRDLKPENFLF SS
Sbjct  181  VHYCHSMGVMHRDLKPENFLFSSS  204



>gb|KDO76376.1| hypothetical protein CISIN_1g010013mg [Citrus sinensis]
Length=520

 Score =   283 bits (725),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 160/204 (78%), Gaps = 6/204 (3%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  199
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  200  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  379
            PMEDV +TYIFG ELGRGQFGVTYLVTH+ T+++ ACKSI++RKL+++DDV+DVRREVQI
Sbjct  61   PMEDVRNTYIFGRELGRGQFGVTYLVTHKDTKQQFACKSISSRKLINRDDVEDVRREVQI  120

Query  380  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTV  559
            MHHLTGHRNIVELKG YEDR+ V+L+M+LCAGGELFDRIIAKGHYSERAAA LCRQMVTV
Sbjct  121  MHHLTGHRNIVELKGAYEDRHSVNLIMDLCAGGELFDRIIAKGHYSERAAANLCRQMVTV  180

Query  560  LHYCHSMGVMHRDLKPENFLFLSS  631
            +HYCHSMGVMHRDLKPENFLF SS
Sbjct  181  VHYCHSMGVMHRDLKPENFLFSSS  204



>ref|XP_006476469.1| PREDICTED: calcium-dependent protein kinase 3-like [Citrus sinensis]
Length=520

 Score =   283 bits (725),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 160/204 (78%), Gaps = 6/204 (3%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  199
            MG+CN +PSS     S   + D  P       K D    P           + VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPGPSSSATSATSASVGRVLGK  60

Query  200  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  379
            PMEDV +TYIFG ELGRGQFGVTYLVTH+ T+++ ACKSI++RKL+++DDV+DVRREVQI
Sbjct  61   PMEDVRNTYIFGRELGRGQFGVTYLVTHKDTKQQFACKSISSRKLINRDDVEDVRREVQI  120

Query  380  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTV  559
            MHHLTGHRNIVELKG YEDR+ V+L+M+LCAGGELFDRIIAKGHYSERAAA LCRQMVTV
Sbjct  121  MHHLTGHRNIVELKGAYEDRHSVNLIMDLCAGGELFDRIIAKGHYSERAAANLCRQMVTV  180

Query  560  LHYCHSMGVMHRDLKPENFLFLSS  631
            +HYCHSMGVMHRDLKPENFLF SS
Sbjct  181  VHYCHSMGVMHRDLKPENFLFSSS  204



>ref|XP_006439443.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
 gb|ESR52683.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
Length=520

 Score =   283 bits (723),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 160/204 (78%), Gaps = 6/204 (3%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPP------KNDITVLppsqpppprpFLSGVGRVLGR  199
            MG+CN +PSS     S   + D  P       K D    P           S VGRVLG+
Sbjct  1    MGNCNGLPSSQTQLHSTTADPDTGPGHHPNGLKIDPPGPPRPSSSATSATSSSVGRVLGK  60

Query  200  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  379
            PMEDV +TYIFG ELGRGQFG+TYLVTH+ T+++ ACKSI++RKL+++DDV+DVRREVQI
Sbjct  61   PMEDVRNTYIFGRELGRGQFGITYLVTHKYTKQQFACKSISSRKLINRDDVEDVRREVQI  120

Query  380  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTV  559
            MHHLTGHRNIVELKG YEDR+ V+L+M+LCAGGELFDRIIAKGHYSERAAA LCRQMVTV
Sbjct  121  MHHLTGHRNIVELKGAYEDRHSVNLIMDLCAGGELFDRIIAKGHYSERAAANLCRQMVTV  180

Query  560  LHYCHSMGVMHRDLKPENFLFLSS  631
            +HYCHSMGVMHRDLKPENFLF SS
Sbjct  181  VHYCHSMGVMHRDLKPENFLFSSS  204



>emb|CAN61364.1| hypothetical protein VITISV_032639 [Vitis vinifera]
Length=482

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  170  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  349
            L+G GRVLGRPMEDV  TYIFG ELGRGQFGVTYLVTH++T+E+ ACKSIATRKL+++DD
Sbjct  14   LAGNGRVLGRPMEDVRQTYIFGRELGRGQFGVTYLVTHKETKEQFACKSIATRKLVNRDD  73

Query  350  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  529
            ++DVRREVQIMHHLTGHRNIVELKG YEDR+ V+LVMELCAGGELFDRIIAKGHYSERAA
Sbjct  74   IEDVRREVQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCAGGELFDRIIAKGHYSERAA  133

Query  530  AGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
            A LCRQ+VTV+H CH+MGVMHRDLKPENFLFLS+
Sbjct  134  AALCRQIVTVVHNCHTMGVMHRDLKPENFLFLST  167



>ref|XP_006849377.1| PREDICTED: calcium-dependent protein kinase 3 [Amborella trichopoda]
 gb|ERN10958.1| hypothetical protein AMTR_s00158p00082100 [Amborella trichopoda]
Length=538

 Score =   281 bits (718),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  170  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  349
            ++G+GR+LGRPMED  STYIFG ELGRGQFGVTY+ THR+T+E LACKSIATRKL++KDD
Sbjct  60   IAGIGRILGRPMEDGRSTYIFGKELGRGQFGVTYMCTHRETKEVLACKSIATRKLITKDD  119

Query  350  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  529
            ++DVRREVQIMHHLTGHRNIVELKG YEDRN V+LVMELCAGGELFDRIIAKGHYSERAA
Sbjct  120  IEDVRREVQIMHHLTGHRNIVELKGAYEDRNSVNLVMELCAGGELFDRIIAKGHYSERAA  179

Query  530  AGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            A LCR++VTV+H CHSMGVMHRDLKPENFLFL+ D
Sbjct  180  ATLCREIVTVVHTCHSMGVMHRDLKPENFLFLNKD  214



>ref|XP_012086799.1| PREDICTED: calcium-dependent protein kinase 3 [Jatropha curcas]
 gb|KDP25359.1| hypothetical protein JCGZ_20515 [Jatropha curcas]
Length=525

 Score =   280 bits (717),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 171/213 (80%), Gaps = 17/213 (8%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppp--------------rpFLS  175
            MG+C+S+PS   + T++ G SD PPP N IT+ P +  PPP                   
Sbjct  1    MGNCSSLPS---SFTTSSGGSDNPPPSNGITIHPATASPPPRPPPPHSFQPSNRPSSTTP  57

Query  176  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  355
             VGRVLGRP+EDV +TYIFG ELGRGQFG+TYLVTH++T+E+ ACKSI TRKL+++DD++
Sbjct  58   AVGRVLGRPIEDVRNTYIFGRELGRGQFGITYLVTHKETKEQFACKSITTRKLINRDDIE  117

Query  356  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  535
            DVRREVQIMHHLTGHRNIVELKG YEDR+ ++LVMELCAGGELFDRIIAKGHYSERAAA 
Sbjct  118  DVRREVQIMHHLTGHRNIVELKGAYEDRHSINLVMELCAGGELFDRIIAKGHYSERAAAI  177

Query  536  LCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            LCRQ+VTV+H CHSMGV+HRDLKPENFLFLS D
Sbjct  178  LCRQIVTVVHDCHSMGVIHRDLKPENFLFLSKD  210



>gb|AGS15000.1| calcium-dependent protein kinase 3 [Vitis amurensis]
Length=528

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  170  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  349
            L+G GRVLGRPMEDV  TYIFG ELGRGQFGVTYLVTH++T+E+ ACKSIATRKL+++DD
Sbjct  60   LAGNGRVLGRPMEDVRQTYIFGRELGRGQFGVTYLVTHKETKEQFACKSIATRKLVNRDD  119

Query  350  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  529
            ++DVRREVQIMHHLTGHRNIVELKG YEDR+ V+LVMELCAGGELFDRIIAKGHYSERAA
Sbjct  120  IEDVRREVQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCAGGELFDRIIAKGHYSERAA  179

Query  530  AGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
            A LCRQ+VTV+H CH+MGVMHRDLKPENFLFLS+
Sbjct  180  AALCRQIVTVVHNCHTMGVMHRDLKPENFLFLST  213



>ref|XP_002272270.1| PREDICTED: calcium-dependent protein kinase 3 [Vitis vinifera]
 ref|XP_010658560.1| PREDICTED: calcium-dependent protein kinase 3 [Vitis vinifera]
Length=528

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  170  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  349
            L+G GRVLGRPMEDV  TYIFG ELGRGQFGVTYLVTH++T+E+ ACKSIATRKL+++DD
Sbjct  60   LAGNGRVLGRPMEDVRQTYIFGRELGRGQFGVTYLVTHKETKEQFACKSIATRKLVNRDD  119

Query  350  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  529
            ++DVRREVQIMHHLTGHRNIVELKG YEDR+ V+LVMELCAGGELFDRIIAKGHYSERAA
Sbjct  120  IEDVRREVQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCAGGELFDRIIAKGHYSERAA  179

Query  530  AGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
            A LCRQ+VTV+H CH+MGVMHRDLKPENFLFLS+
Sbjct  180  AALCRQIVTVVHNCHTMGVMHRDLKPENFLFLST  213



>ref|XP_010251583.1| PREDICTED: calcium-dependent protein kinase 3-like [Nelumbo nucifera]
Length=522

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 163/215 (76%), Gaps = 24/215 (11%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqppppr----------------pF  169
            MG+CN +PS+         +  PPPP N I+V P  +P  P                   
Sbjct  1    MGNCNGLPSN--------DDRHPPPPINVISVRPDDKPTTPTPPNQHQGPPQPPSAVHRP  52

Query  170  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  349
            LSG GRVLGRPMEDV +TY+FG E+GRGQFGVT L TH++T+E+ ACKSIATRKL+++DD
Sbjct  53   LSGTGRVLGRPMEDVRATYVFGREIGRGQFGVTCLATHKETKEQFACKSIATRKLVNRDD  112

Query  350  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  529
            +DDVRREVQIMHHLTGHRNIVELKG YED + V+LVMELC GGELFDRII KGHYSERAA
Sbjct  113  IDDVRREVQIMHHLTGHRNIVELKGAYEDHHSVNLVMELCEGGELFDRIILKGHYSERAA  172

Query  530  AGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            A LCRQ+VTV+HYCHSMGV+HRDLKPENFLFL  D
Sbjct  173  AALCRQIVTVVHYCHSMGVIHRDLKPENFLFLGKD  207



>gb|EYU40050.1| hypothetical protein MIMGU_mgv1a011511mg [Erythranthe guttata]
Length=279

 Score =   270 bits (691),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 146/180 (81%), Gaps = 15/180 (8%)
 Frame = +2

Query  95   ESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYL  274
            ++DPPP +               P  +G GR+LGRPM DVHS Y FG ELGRGQFGVT+L
Sbjct  46   DADPPPRR---------------PLPTGNGRILGRPMADVHSVYTFGRELGRGQFGVTHL  90

Query  275  VTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHL  454
            VT R TRE  ACKSIATRKL++ DDV DVRREVQIMHHLTGHRNIVELK  +EDRN+VHL
Sbjct  91   VTRRATREAFACKSIATRKLVTADDVADVRREVQIMHHLTGHRNIVELKEVFEDRNNVHL  150

Query  455  VMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            VMELCAGGELFDRIIAKGHYSERAAAGLCRQ+VTV+H CHSMGVMHRDLKPENFL LS D
Sbjct  151  VMELCAGGELFDRIIAKGHYSERAAAGLCRQIVTVVHACHSMGVMHRDLKPENFLLLSKD  210



>ref|XP_011073451.1| PREDICTED: calcium-dependent protein kinase 3-like [Sesamum indicum]
Length=517

 Score =   278 bits (711),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            +G GRVLGRPM DVHS YIFG ELGRGQFGVT+LVTHR TR+  ACKSIATRKL++ DDV
Sbjct  49   TGTGRVLGRPMSDVHSAYIFGRELGRGQFGVTHLVTHRATRQTFACKSIATRKLVTPDDV  108

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
             DVRREVQIMHHLTGHRNIVELK  +EDR++VHLVMELCAGGELFDRIIAKGHYSERAAA
Sbjct  109  ADVRREVQIMHHLTGHRNIVELKEVFEDRHNVHLVMELCAGGELFDRIIAKGHYSERAAA  168

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            GLCRQ+VTV+H CHSMGVMHRDLKPENFLFLS+D
Sbjct  169  GLCRQIVTVVHACHSMGVMHRDLKPENFLFLSTD  202



>ref|XP_002509886.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF51273.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=528

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            + VGRVLGRPMEDV S Y FG ELGRGQFGVTYLVTH++T+++ ACKSIATRKL+++DD+
Sbjct  60   AAVGRVLGRPMEDVRSIYAFGRELGRGQFGVTYLVTHKETKQQFACKSIATRKLINRDDI  119

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +DVRREVQIMHHLTGHRNIVELKG YEDR+ V+LVMELCAGGELFDRIIAKGHYSERAAA
Sbjct  120  EDVRREVQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCAGGELFDRIIAKGHYSERAAA  179

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             LCRQ+VTV+H CHSMGV+HRDLKPENFLFLS+D
Sbjct  180  NLCRQIVTVVHDCHSMGVIHRDLKPENFLFLSTD  213



>gb|KEH21166.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=516

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 163/201 (81%), Gaps = 4/201 (2%)
 Frame = +2

Query  41   GSCNSIPSSPFAATSAGGESDPPPPKNDITVLpps---qpppprpFLSGVGRVLGRPMED  211
            G+C++   +    T+    SDPPP KN  T+LP +    PP P    + +GR+L RPMED
Sbjct  3    GNCSTGAGAGINTTTTTPHSDPPP-KNAPTILPQNFTPSPPQPPLPTTTLGRILNRPMED  61

Query  212  VHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHL  391
            V S +IFG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRKL+++DD+DDVRREVQIMHHL
Sbjct  62   VRSIFIFGRELGRGQFGVTYLVTHKVTKEQFACKSIATRKLVNRDDIDDVRREVQIMHHL  121

Query  392  TGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYC  571
            TGHRNIVELKG YED++ V+LVMELCAGGELFDRII KGHYSERAAA LCRQ+VTV+H C
Sbjct  122  TGHRNIVELKGAYEDKHSVNLVMELCAGGELFDRIILKGHYSERAAANLCRQIVTVVHNC  181

Query  572  HSMGVMHRDLKPENFLFLSSD  634
            H+MGVMHRDLKPENFLFL  +
Sbjct  182  HTMGVMHRDLKPENFLFLGKE  202



>ref|XP_003517491.2| PREDICTED: calcium-dependent protein kinase 3-like [Glycine max]
Length=528

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 160/203 (79%), Gaps = 12/203 (6%)
 Frame = +2

Query  32   LQMGSCNSIPSSPFAATSAGGESDPPPPKND--ITVLppsqpppprpFLSGVGRVLGRPM  205
            + MG+CNS  SS    T    +  P P  N   ITVLPP+           VGRVLGRPM
Sbjct  22   VSMGNCNSEASS---QTQPHSDHHPQPRSNSNGITVLPPNSK-------PSVGRVLGRPM  71

Query  206  EDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMH  385
            EDV STY FG ELGRGQFGVTYLVTH+ T+++ ACKSIAT KL+ +DD++DVRREVQIMH
Sbjct  72   EDVRSTYTFGRELGRGQFGVTYLVTHKHTKQQFACKSIATPKLVHRDDLEDVRREVQIMH  131

Query  386  HLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLH  565
            HLTGHRNIVELKG YEDR+ V+L+MELC GGELFDRIIAKGHYSERAAA LCRQ+VTV+H
Sbjct  132  HLTGHRNIVELKGAYEDRHSVNLIMELCGGGELFDRIIAKGHYSERAAADLCRQIVTVVH  191

Query  566  YCHSMGVMHRDLKPENFLFLSSD  634
             CH+MGVMHRDLKPENFLFLS D
Sbjct  192  DCHTMGVMHRDLKPENFLFLSKD  214



>ref|XP_007160124.1| hypothetical protein PHAVU_002G294500g [Phaseolus vulgaris]
 gb|ESW32118.1| hypothetical protein PHAVU_002G294500g [Phaseolus vulgaris]
Length=519

 Score =   276 bits (705),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 163/206 (79%), Gaps = 11/206 (5%)
 Frame = +2

Query  38   MGSCNSI---PSSPFAATSAGGESDPPPPKNDITVLppsqppp----prpFLSGVGRVLG  196
            MG+C+S      +P  +T     SD  P +N ITVLPP+  P          S +GRVLG
Sbjct  1    MGNCSSSHGGGGTPATSTY----SDELPQRNGITVLPPNTNPSPPLPKPQASSSLGRVLG  56

Query  197  RPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQ  376
            RPMEDV S YIFG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRKL+++DD+DDVRREVQ
Sbjct  57   RPMEDVRSIYIFGRELGRGQFGVTYLVTHKVTKEQFACKSIATRKLVNRDDIDDVRREVQ  116

Query  377  IMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVT  556
            IMHHLTGHRNIVELKG YEDR+ V+L+MELCAGGELFDRII KGHYSERAAA  CRQ+VT
Sbjct  117  IMHHLTGHRNIVELKGAYEDRHSVNLIMELCAGGELFDRIITKGHYSERAAANSCRQIVT  176

Query  557  VLHYCHSMGVMHRDLKPENFLFLSSD  634
            V+H CHSMGVMHRDLKPENFL L+ D
Sbjct  177  VVHNCHSMGVMHRDLKPENFLLLNKD  202



>gb|KJB52213.1| hypothetical protein B456_008G251000 [Gossypium raimondii]
Length=534

 Score =   276 bits (705),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 162/219 (74%), Gaps = 20/219 (9%)
 Frame = +2

Query  38   MGSCNSIPS--SPF-AATSAGG------------ESDPPPPK-----NDITVLppsqppp  157
            MG+CNS PS  S F   T+ GG             S P PPK     N  +         
Sbjct  1    MGNCNSQPSADSQFRPETNTGGGPNHGINVLPADASAPRPPKPSTHHNLSSSSAAPNHHT  60

Query  158  prpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLL  337
                   +GRVLGRPMEDV STY+FG ELGRGQFGVTYLVTH++T ++ ACKSIATRKL+
Sbjct  61   APSATPPIGRVLGRPMEDVRSTYVFGRELGRGQFGVTYLVTHKETNQQFACKSIATRKLI  120

Query  338  SKDDVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYS  517
            ++DD++DVRREVQIM+HLTGHRNIVELKG YEDR+ V+L+MELCAGGELFDRIIAKGHYS
Sbjct  121  NRDDIEDVRREVQIMYHLTGHRNIVELKGAYEDRHSVNLIMELCAGGELFDRIIAKGHYS  180

Query  518  ERAAAGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            ER AA LCRQ+VTV+H CHSMGVMHRDLKPENFL LS D
Sbjct  181  EREAANLCRQIVTVVHNCHSMGVMHRDLKPENFLLLSKD  219



>gb|KHG11508.1| Calcium-dependent protein kinase 3 [Gossypium arboreum]
Length=534

 Score =   276 bits (705),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 163/219 (74%), Gaps = 20/219 (9%)
 Frame = +2

Query  38   MGSCNSIPS--SPF-AATSAGG------------ESDPPPPK-----NDITVLppsqppp  157
            MG+CNS PS  S F   T+ GG             S P PPK     N  +  P      
Sbjct  1    MGNCNSQPSADSQFRPETNTGGGPNHGINVLPADASAPRPPKPSTHHNLSSSSPAPNHHT  60

Query  158  prpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLL  337
                   +GRVLGRPMEDV STY+FG ELGRGQFGVTYLVTH++T ++ ACKSIATRKL+
Sbjct  61   APSTTPPIGRVLGRPMEDVRSTYVFGRELGRGQFGVTYLVTHKETNQQFACKSIATRKLI  120

Query  338  SKDDVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYS  517
            ++DD++DVRREVQIM+HLTGHRNIVELKG YEDR+ V+L+MELCAGGELFDRIIAKGHYS
Sbjct  121  NRDDIEDVRREVQIMYHLTGHRNIVELKGAYEDRHSVNLIMELCAGGELFDRIIAKGHYS  180

Query  518  ERAAAGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            ER AA LCRQ+VTV+H CHSMGVMHRDLKPENFL LS D
Sbjct  181  EREAANLCRQIVTVVHNCHSMGVMHRDLKPENFLLLSKD  219



>ref|XP_007040388.1| Calcium-dependent protein kinase 6 isoform 2 [Theobroma cacao]
 gb|EOY24889.1| Calcium-dependent protein kinase 6 isoform 2 [Theobroma cacao]
Length=476

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 158/216 (73%), Gaps = 17/216 (8%)
 Frame = +2

Query  38   MGSCNSIPSS-------------PFAATSAGGESDPPPPKNDITVLppsqpppprpFLSG  178
            MG+CN  PS+             P    +      PP P+   T    S         + 
Sbjct  1    MGNCNGHPSADNQFRPDSDSGGGPHNGINIKAGPSPPRPQQHSTTHHSSSAASNHRLATP  60

Query  179  ----VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKD  346
                +GRVLGRPMEDV S Y+FG ELGRGQFG+TYLVTH++T+++ ACKSIATRKL+++D
Sbjct  61   TTPPIGRVLGRPMEDVRSNYVFGRELGRGQFGITYLVTHKETKQQFACKSIATRKLINRD  120

Query  347  DVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERA  526
            D++DVRREVQIMHHLTGHRNIVELKG YEDR+ V+L+MELCAGGELFDRI+AKGHYSER 
Sbjct  121  DIEDVRREVQIMHHLTGHRNIVELKGAYEDRHSVNLIMELCAGGELFDRILAKGHYSERE  180

Query  527  AAGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            AA LCRQ+V V+H CHSMGVMHRDLKPENFLFLS D
Sbjct  181  AANLCRQIVMVVHNCHSMGVMHRDLKPENFLFLSKD  216



>ref|XP_004503656.1| PREDICTED: calcium-dependent protein kinase 3-like [Cicer arietinum]
Length=511

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  182  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  361
            GR+L RPMEDV ST+IFG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRKL+++DD+DDV
Sbjct  47   GRILNRPMEDVRSTFIFGRELGRGQFGVTYLVTHKVTKEQFACKSIATRKLINRDDIDDV  106

Query  362  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  541
            RREVQIMHHLTGHRNIVELKG YEDR+ V+LVMELCAGGELFDRII KGHYSERAAA LC
Sbjct  107  RREVQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCAGGELFDRIITKGHYSERAAANLC  166

Query  542  RQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            RQ+VTV+H CH+MGVMHRDLKPENFLFL +D
Sbjct  167  RQIVTVVHNCHTMGVMHRDLKPENFLFLGND  197



>ref|XP_009334485.1| PREDICTED: calcium-dependent protein kinase 3 [Pyrus x bretschneideri]
Length=525

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +GRVLGRPMEDV STY FG ELGRGQFGVTYLVT ++T++  ACKSIATRKL ++DDV+D
Sbjct  59   IGRVLGRPMEDVRSTYTFGRELGRGQFGVTYLVTDKQTKQLFACKSIATRKLSNQDDVED  118

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTGHRNIVELKG YEDR+ V+LVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  119  VRREVQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCAGGELFDRIIAKGHYSERAAANL  178

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            CRQ+VTV+HYCHSMGVMHRDLKPENFL LS D
Sbjct  179  CRQIVTVVHYCHSMGVMHRDLKPENFLLLSKD  210



>ref|XP_007209903.1| hypothetical protein PRUPE_ppa004162mg [Prunus persica]
 gb|EMJ11102.1| hypothetical protein PRUPE_ppa004162mg [Prunus persica]
Length=526

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+  +++ ACKSIATRKL++ DDV+D
Sbjct  60   IGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKHNKQQFACKSIATRKLINHDDVED  119

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTGHRNIVELKG YED++ V+LVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  120  VRREVQIMHHLTGHRNIVELKGAYEDKHSVNLVMELCAGGELFDRIIAKGHYSERAAANL  179

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            CRQ+VTV+HYCHSMGVMHRDLKPENFL LS D
Sbjct  180  CRQIVTVVHYCHSMGVMHRDLKPENFLLLSKD  211



>ref|XP_003538256.1| PREDICTED: calcium-dependent protein kinase 3-like isoform 1 
[Glycine max]
Length=505

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 158/199 (79%), Gaps = 8/199 (4%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVH  217
            MG+CNS PSS      +      P P N ITVLPP+           VGRVLGRPMED  
Sbjct  1    MGNCNSEPSSQ-TQPHSDHHHHHPQPSNGITVLPPNSK-------PSVGRVLGRPMEDAR  52

Query  218  STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTG  397
            STY FG ELGRGQFGVTY VTH+ T+++ ACKSIATRKL+ +DD++DVRREVQIMHHLTG
Sbjct  53   STYTFGRELGRGQFGVTYQVTHKHTKQQFACKSIATRKLVHRDDLEDVRREVQIMHHLTG  112

Query  398  HRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHS  577
            HRNIVELKG YEDR+ V+L+MELC GGELFDRIIAKGHYSERAAA LCRQ+VTV+H CH+
Sbjct  113  HRNIVELKGAYEDRHSVNLIMELCGGGELFDRIIAKGHYSERAAADLCRQIVTVVHDCHT  172

Query  578  MGVMHRDLKPENFLFLSSD  634
            MGVMHRDLKPENFLFLS D
Sbjct  173  MGVMHRDLKPENFLFLSKD  191



>ref|XP_010055801.1| PREDICTED: calcium-dependent protein kinase 3 [Eucalyptus grandis]
 gb|KCW72352.1| hypothetical protein EUGRSUZ_E00806 [Eucalyptus grandis]
Length=539

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            VGRVLGRPMEDV +TY+FG ELGRGQFGVTYLVTH++T+++ ACKSIA RKL++KDD++D
Sbjct  68   VGRVLGRPMEDVRATYVFGRELGRGQFGVTYLVTHKETKQQFACKSIAARKLVNKDDIED  127

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTGHRNIVELKG YED++ V+LVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  128  VRREVQIMHHLTGHRNIVELKGAYEDKHSVNLVMELCAGGELFDRIIAKGHYTERAAANL  187

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            CRQ+VTV+H CH+MGVMHRDLKPENFLFLS D
Sbjct  188  CRQIVTVVHNCHTMGVMHRDLKPENFLFLSPD  219



>ref|XP_007040387.1| Calcium-dependent protein kinase 6 isoform 1 [Theobroma cacao]
 gb|EOY24888.1| Calcium-dependent protein kinase 6 isoform 1 [Theobroma cacao]
Length=531

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 161/216 (75%), Gaps = 17/216 (8%)
 Frame = +2

Query  38   MGSCNSIPSSPFA----ATSAGGESD---------PPPPKNDITVLppsqpppprpFLSG  178
            MG+CN  PS+       + S GG  +         PP P+   T    S         + 
Sbjct  1    MGNCNGHPSADNQFRPDSDSGGGPHNGINIKAGPSPPRPQQHSTTHHSSSAASNHRLATP  60

Query  179  ----VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKD  346
                +GRVLGRPMEDV S Y+FG ELGRGQFG+TYLVTH++T+++ ACKSIATRKL+++D
Sbjct  61   TTPPIGRVLGRPMEDVRSNYVFGRELGRGQFGITYLVTHKETKQQFACKSIATRKLINRD  120

Query  347  DVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERA  526
            D++DVRREVQIMHHLTGHRNIVELKG YEDR+ V+L+MELCAGGELFDRI+AKGHYSER 
Sbjct  121  DIEDVRREVQIMHHLTGHRNIVELKGAYEDRHSVNLIMELCAGGELFDRILAKGHYSERE  180

Query  527  AAGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            AA LCRQ+V V+H CHSMGVMHRDLKPENFLFLS D
Sbjct  181  AANLCRQIVMVVHNCHSMGVMHRDLKPENFLFLSKD  216



>ref|XP_010106587.1| Calcium-dependent protein kinase 3 [Morus notabilis]
 gb|EXC10841.1| Calcium-dependent protein kinase 3 [Morus notabilis]
Length=639

 Score =   276 bits (705),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            VGRVLGRPMEDV STYIFG ELGRGQFGVTYLVTH++T+++ ACKSIATRKL+++DDV+D
Sbjct  60   VGRVLGRPMEDVRSTYIFGRELGRGQFGVTYLVTHKETKQQFACKSIATRKLVNRDDVED  119

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHH+TGHRNIVELKG YEDR+ V+LVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  120  VRREVQIMHHMTGHRNIVELKGAYEDRHSVNLVMELCAGGELFDRIIAKGHYSERAAANL  179

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            CRQ+V V+H CH+MGVMHRDLKPENFLFLS+D
Sbjct  180  CRQIVRVVHDCHAMGVMHRDLKPENFLFLSTD  211



>ref|XP_004511540.1| PREDICTED: calcium-dependent protein kinase 3-like [Cicer arietinum]
Length=509

 Score =   271 bits (694),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 161/202 (80%), Gaps = 10/202 (5%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDP---PPPKNDITVLppsqpppprpFLSGVGRVLGRPME  208
            MG+C S P S   + S    S+P   PPP      L P+QP P     S +GRVLGRPME
Sbjct  1    MGNCKSEPIS--NSESQPPHSNPISTPPPD-----LNPNQPTPTATPTSTMGRVLGRPME  53

Query  209  DVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHH  388
            D+ STY FG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRK++++ D+DD+RREVQIMHH
Sbjct  54   DIRSTYTFGRELGRGQFGVTYLVTHKITKEQFACKSIATRKIINRGDLDDIRREVQIMHH  113

Query  389  LTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHY  568
            LTGHRNIVELKG YED + V+L+MELCAGGELFDRIIAKGHYSERAAA LC QMVTV+H 
Sbjct  114  LTGHRNIVELKGAYEDHHSVNLIMELCAGGELFDRIIAKGHYSERAAAELCGQMVTVVHN  173

Query  569  CHSMGVMHRDLKPENFLFLSSD  634
            CHSMGVMHRDLKPENFLFLS +
Sbjct  174  CHSMGVMHRDLKPENFLFLSKE  195



>ref|XP_004298849.1| PREDICTED: calcium-dependent protein kinase 3 [Fragaria vesca 
subsp. vesca]
Length=519

 Score =   272 bits (695),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            S VGRVLG+PMEDV +TY FG ELGRGQFGVTYLVTH++++ + ACKSIATRKL++ DDV
Sbjct  51   SPVGRVLGKPMEDVRATYTFGRELGRGQFGVTYLVTHKESKLQFACKSIATRKLVNHDDV  110

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +DVRREVQIMHHLTGHRNIVELKG YEDR+ V+LVMELC GGELFDRIIAKGHYSERAAA
Sbjct  111  EDVRREVQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCGGGELFDRIIAKGHYSERAAA  170

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             LCRQMVTV+HYCHSMGV HRDLKPENFL LS D
Sbjct  171  NLCRQMVTVVHYCHSMGVFHRDLKPENFLLLSKD  204



>ref|XP_003525360.1| PREDICTED: calcium-dependent protein kinase 3-like isoform 1 
[Glycine max]
Length=518

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 160/207 (77%), Gaps = 14/207 (7%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqppp--------prpFLSGVGRVL  193
            MG+C+S   +P         SD  P  N ITVLPP+  P              S +GRVL
Sbjct  1    MGNCSSGAGAPTTY------SDDHPHHNGITVLPPNSNPSPQLPKPPPTSSSSSSLGRVL  54

Query  194  GRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREV  373
            GRPMEDV S YIFG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRKL+++DD+DD+RREV
Sbjct  55   GRPMEDVRSIYIFGRELGRGQFGVTYLVTHKATKEQFACKSIATRKLVNRDDIDDIRREV  114

Query  374  QIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMV  553
            QIMHHLTGHRNIVELKG YEDR+ V+LVMELCAGGELFDRII KGHYSERAAA  CRQ+V
Sbjct  115  QIMHHLTGHRNIVELKGAYEDRHSVNLVMELCAGGELFDRIITKGHYSERAAANSCRQIV  174

Query  554  TVLHYCHSMGVMHRDLKPENFLFLSSD  634
            TV+H CHSMGVMHRDLKPENFL L+ +
Sbjct  175  TVVHNCHSMGVMHRDLKPENFLLLNKN  201



>ref|XP_002298000.1| calcium-dependent protein kinase 1 [Populus trichocarpa]
 gb|EEE82805.1| calcium-dependent protein kinase 1 [Populus trichocarpa]
Length=515

 Score =   269 bits (688),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 165/203 (81%), Gaps = 8/203 (4%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqppp-prpFL----SGVGRVLGRP  202
            MG+CNS+ SS   +++     +PPP    I VLPP+  PP    FL    + VGRVLGRP
Sbjct  1    MGNCNSLASS---SSTTTNHRNPPPSNGGIKVLPPNASPPPRSQFLHHSSAAVGRVLGRP  57

Query  203  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  382
            MEDV +TY FG E+GRGQFGVTYLVTH++T++  ACKSIA RKL+++DD++DV REVQIM
Sbjct  58   MEDVRNTYTFGREVGRGQFGVTYLVTHKETKQHFACKSIAKRKLINRDDIEDVLREVQIM  117

Query  383  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVL  562
            HHLTGHRN+VELKG YEDR+ V+L+MELC GGELFDRII KGHYSERAAA LCRQ+VTV+
Sbjct  118  HHLTGHRNVVELKGAYEDRHSVNLIMELCEGGELFDRIITKGHYSERAAANLCRQIVTVV  177

Query  563  HYCHSMGVMHRDLKPENFLFLSS  631
            H CH+MGV+HRDLKPENFLFLS+
Sbjct  178  HNCHTMGVIHRDLKPENFLFLST  200



>ref|XP_002304529.2| hypothetical protein POPTR_0003s13380g [Populus trichocarpa]
 gb|EEE79508.2| hypothetical protein POPTR_0003s13380g [Populus trichocarpa]
Length=523

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 159/214 (74%), Gaps = 22/214 (10%)
 Frame = +2

Query  38   MGSCNSIP----------------SSPFAATSAGGESDPPPPKNDITVLppsqpppprpF  169
            MG+CNS+P                + P         +  PPP++       +        
Sbjct  1    MGNCNSLPSSSSTTTTSTTTDHHNTPPNGVIKVLPPTATPPPRSQHHHHSSASGS-----  55

Query  170  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  349
             + VGRVLGRP EDV +TYIFG ELGRGQFGVTYLVTH++T++  ACKSIA+RKL+++DD
Sbjct  56   -TAVGRVLGRPREDVRNTYIFGRELGRGQFGVTYLVTHKETKQHFACKSIASRKLINRDD  114

Query  350  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  529
            ++DVRREVQIMHHLTGHRNIVELKG YED++ V+L+MELC GGELFDRIIAKGHYSERAA
Sbjct  115  IEDVRREVQIMHHLTGHRNIVELKGAYEDQHSVNLIMELCEGGELFDRIIAKGHYSERAA  174

Query  530  AGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
            A LCRQ+VTV+H CH+MGV+HRDLKPENFLFLS+
Sbjct  175  ANLCRQIVTVVHNCHTMGVIHRDLKPENFLFLST  208



>ref|XP_010529626.1| PREDICTED: calcium-dependent protein kinase 3-like [Tarenaya 
hassleriana]
Length=513

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +GR+LGRPME+V STY FG ELGRGQFGVTYLVTH++TR++ ACKSI TR+L+ +DD++D
Sbjct  47   IGRILGRPMENVRSTYEFGHELGRGQFGVTYLVTHKETRKQFACKSIPTRRLVHRDDIED  106

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTGHRNIVELKG YEDR+ V+LVMELC GGELFDRIIAKGHY+ERAAA L
Sbjct  107  VRREVQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCEGGELFDRIIAKGHYTERAAADL  166

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            CRQMV VLH CHSMGVMHRDLKPENFLFLS D
Sbjct  167  CRQMVMVLHNCHSMGVMHRDLKPENFLFLSKD  198



>gb|AIU98505.1| calcium-dependent protein kinase [Musa acuminata AAA Group]
Length=517

 Score =   267 bits (683),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +2

Query  170  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  349
            LS VGRVLGRPME+V +TY FG ELGRGQFG+TYLVTHR+TRE+ ACKSIATRKL+ ++D
Sbjct  45   LSNVGRVLGRPMENVRATYSFGRELGRGQFGITYLVTHRETREQFACKSIATRKLVHEED  104

Query  350  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  529
            ++DVRRE+QIMHHLTGHRNIVELKG YEDR+ V+LVMELC GGELFDRII KGHYSERAA
Sbjct  105  LEDVRREIQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCEGGELFDRIITKGHYSERAA  164

Query  530  AGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
            A LCR++V V+H CHSMGVMHRDLKPENFLFL+ 
Sbjct  165  AALCREIVNVVHVCHSMGVMHRDLKPENFLFLNK  198



>ref|XP_009386326.1| PREDICTED: calcium-dependent protein kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=517

 Score =   267 bits (682),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +2

Query  170  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  349
            LS VGRVLGRPME+V +TY FG ELGRGQFG+TYLVTHR+TRE+ ACKSIATRKL+ ++D
Sbjct  45   LSNVGRVLGRPMENVRATYSFGRELGRGQFGITYLVTHRETREQFACKSIATRKLVHEED  104

Query  350  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  529
            ++DVRRE+QIMHHLTGHRNIVELKG YEDR+ V+LVMELC GGELFDRII KGHYSERAA
Sbjct  105  LEDVRREIQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCEGGELFDRIITKGHYSERAA  164

Query  530  AGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
            A LCR++V V+H CHSMGVMHRDLKPENFLFL+ 
Sbjct  165  AALCREIVNVVHVCHSMGVMHRDLKPENFLFLNK  198



>ref|XP_010541306.1| PREDICTED: calcium-dependent protein kinase 3 [Tarenaya hassleriana]
Length=521

 Score =   267 bits (682),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +GR+LGRPME+V +TY FG ELGRGQFGVTYLVTH++TR++ ACKSI TR+L+ +DD++D
Sbjct  53   IGRILGRPMENVRTTYEFGRELGRGQFGVTYLVTHKETRKQFACKSIPTRRLVHRDDIED  112

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTGHRNIVELKG YEDR+ V+LVMELC GGELFDRIIAKGHYSERAAA L
Sbjct  113  VRREVQIMHHLTGHRNIVELKGAYEDRHSVNLVMELCEGGELFDRIIAKGHYSERAAADL  172

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            CRQMV V+H CHSMGVMHRDLKPENFLFLS D
Sbjct  173  CRQMVMVVHNCHSMGVMHRDLKPENFLFLSKD  204



>ref|XP_009416404.1| PREDICTED: calcium-dependent protein kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=519

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            S VGRVLGRPMEDV +TY FG ELGRGQFGVTYLVTHR T ++ ACKSIATRKL+ +DD+
Sbjct  49   SDVGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHRGTTKQFACKSIATRKLVRQDDL  108

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            DDVRRE+QIMHHLTGHRNIVELKG YEDR+ V+LVME+C GGELFDRII+KGHYSERAAA
Sbjct  109  DDVRREIQIMHHLTGHRNIVELKGAYEDRHSVNLVMEICEGGELFDRIISKGHYSERAAA  168

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
             LCR++V V+H CHSMGVMHRDLKPENFLFL+ 
Sbjct  169  ALCREIVNVVHACHSMGVMHRDLKPENFLFLNK  201



>ref|XP_011022588.1| PREDICTED: calcium-dependent protein kinase 3-like [Populus euphratica]
 ref|XP_011022589.1| PREDICTED: calcium-dependent protein kinase 3-like [Populus euphratica]
 ref|XP_011022590.1| PREDICTED: calcium-dependent protein kinase 3-like [Populus euphratica]
Length=517

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            + VGRVLGRP EDV +TYIFG ELGRGQFGVTYLVTH++T++  ACKSIA+RKL+++DD+
Sbjct  50   TAVGRVLGRPREDVRNTYIFGRELGRGQFGVTYLVTHKETKQHFACKSIASRKLINRDDI  109

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +DVRREVQIMHHLTGHRNIVELKG YED++ V+L+MELC GGELFDRIIAKGHYSERAAA
Sbjct  110  EDVRREVQIMHHLTGHRNIVELKGAYEDQHSVNLIMELCEGGELFDRIIAKGHYSERAAA  169

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
             LCRQ+VTV+H CH+MGV+HRDLKPENFLFLS+
Sbjct  170  DLCRQIVTVVHNCHTMGVIHRDLKPENFLFLST  202



>ref|XP_008792394.1| PREDICTED: calcium-dependent protein kinase 3-like [Phoenix dactylifera]
Length=531

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 150/184 (82%), Gaps = 7/184 (4%)
 Frame = +2

Query  77   ATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQ  256
            A SAGG  D P P     V P      PRP    VGRVLGRPMEDV + Y FG ELGRGQ
Sbjct  38   AASAGG--DGPKP-----VWPRPASSIPRPLTPKVGRVLGRPMEDVRAFYTFGRELGRGQ  90

Query  257  FGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNIVELKGTYED  436
            FGVTYLVT ++T ERLACKSIATRKL+ +DD++DVRREVQIMHHLTGHRNIVELK  YED
Sbjct  91   FGVTYLVTRKETGERLACKSIATRKLIHRDDIEDVRREVQIMHHLTGHRNIVELKAAYED  150

Query  437  RNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHSMGVMHRDLKPENF  616
            R+ V+LVMELC GGELFDRIIAKGHYSERAAA LCR++VTV+H CHSMGVMHRDLKPENF
Sbjct  151  RHSVNLVMELCEGGELFDRIIAKGHYSERAAAALCREIVTVVHICHSMGVMHRDLKPENF  210

Query  617  LFLS  628
            LFL+
Sbjct  211  LFLN  214



>gb|AFW83320.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
Length=373

 Score =   261 bits (666),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = +2

Query  170  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  349
            +  VGRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH +T +R ACKSIATRKL+ +DD
Sbjct  60   VGAVGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHSETGQRFACKSIATRKLVHRDD  119

Query  350  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  529
            ++DVRREVQIMHHLTGHRNIVEL+G YEDR+ V+LVMELC GGELFDRIIAKGHY+ERAA
Sbjct  120  IEDVRREVQIMHHLTGHRNIVELRGAYEDRHSVNLVMELCEGGELFDRIIAKGHYTERAA  179

Query  530  AGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
            A LCR++V V+H CHSMGV HRDLKPENFLFL++
Sbjct  180  ASLCREIVAVVHSCHSMGVFHRDLKPENFLFLNN  213



>gb|KHG03431.1| Calcium-dependent protein kinase 3 [Gossypium arboreum]
Length=604

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +2

Query  176  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  355
             VGRVLGRPMEDV STY+F GELGRGQFG+TYLVTH+KT+++ ACKSI  RKL++++D++
Sbjct  52   AVGRVLGRPMEDVRSTYVFSGELGRGQFGITYLVTHKKTKQQFACKSIPKRKLINREDIE  111

Query  356  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  535
            DVRREVQIM+HLTGHRNIVELKG YED   V+L+MELCAGGELF+RIIAKGH+SER AA 
Sbjct  112  DVRREVQIMYHLTGHRNIVELKGAYEDHQSVNLIMELCAGGELFNRIIAKGHFSERKAAN  171

Query  536  LCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            LCRQ+V +LHYCHSMGVMHRDLKPENFLFL+ D
Sbjct  172  LCRQIVMMLHYCHSMGVMHRDLKPENFLFLNKD  204



>ref|XP_011080890.1| PREDICTED: calcium-dependent protein kinase 3 [Sesamum indicum]
Length=481

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 136/156 (87%), Gaps = 3/156 (2%)
 Frame = +2

Query  167  FLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKD  346
            F  G GRVLGRPM DVHS Y FG ELGRGQFGVT+LVTHR T +  ACKSIATRKL+   
Sbjct  18   FTGGTGRVLGRPMSDVHSAYTFGRELGRGQFGVTHLVTHRVTCQTFACKSIATRKLVI--  75

Query  347  DVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERA  526
             +DDVRREVQIMHHL GHRNIVELK  +EDRN+VHLVMELCAGGELFDRIIAKGHYSERA
Sbjct  76   -LDDVRREVQIMHHLAGHRNIVELKEVFEDRNYVHLVMELCAGGELFDRIIAKGHYSERA  134

Query  527  AAGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            AAGLCRQ+VT++H CHSMGVMHRDLKPENFLF S+D
Sbjct  135  AAGLCRQIVTLVHTCHSMGVMHRDLKPENFLFWSTD  170



>ref|XP_006655639.1| PREDICTED: calcium-dependent protein kinase 3-like, partial [Oryza 
brachyantha]
Length=470

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
             GVGRVLGRPMEDV +TY FG ELGRGQFGVTYL TH+ T  R ACKSIA RKL  KDDV
Sbjct  1    DGVGRVLGRPMEDVRATYTFGRELGRGQFGVTYLATHKPTGRRYACKSIAARKLARKDDV  60

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            DDVRREV IMHHLTGHRNIVEL+G YEDR+ V+L+MELC GGELFDRIIA+GHYSERAAA
Sbjct  61   DDVRREVHIMHHLTGHRNIVELRGAYEDRHSVNLIMELCEGGELFDRIIARGHYSERAAA  120

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLS  628
             LCR++V+V+H CHSMGVMHRDLKPENFLFL+
Sbjct  121  ALCREIVSVVHSCHSMGVMHRDLKPENFLFLN  152



>ref|XP_011026960.1| PREDICTED: calcium-dependent protein kinase 3 [Populus euphratica]
Length=515

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 164/203 (81%), Gaps = 8/203 (4%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqppp-prpFL----SGVGRVLGRP  202
            MG+CNS+ S   ++++     + PP    I VLPP+  PP    FL    + VGRVLGRP
Sbjct  1    MGNCNSLSS---SSSTTTNHRNSPPSNGGIKVLPPNASPPPRSQFLHHSSAAVGRVLGRP  57

Query  203  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  382
            MEDV +TY FG E+GRGQFGVTYLVTH++T++  ACKSIA RKL+++DD++DV REVQIM
Sbjct  58   MEDVRNTYTFGREVGRGQFGVTYLVTHKETKQHFACKSIAKRKLINRDDIEDVLREVQIM  117

Query  383  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVL  562
            HHLTGHRN+VELKG YEDR+ V+L+MELC GGELFDRII KGHYSERAAA LCRQ+VTV+
Sbjct  118  HHLTGHRNVVELKGAYEDRHSVNLIMELCEGGELFDRIITKGHYSERAAANLCRQIVTVV  177

Query  563  HYCHSMGVMHRDLKPENFLFLSS  631
            H CH+MGV+HRDLKPENFLFLS+
Sbjct  178  HNCHTMGVIHRDLKPENFLFLST  200



>gb|KFK28919.1| hypothetical protein AALP_AA7G065000 [Arabis alpina]
Length=529

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +GR+LGRPME+V +TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+ +DD++D
Sbjct  61   IGRILGRPMENVRATYEFGRELGRGQFGVTYLVTHKETKQIFACKSIPTRRLVHRDDIED  120

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHL+GHRNIV+LKG YEDR+ V+LVMELC GGELFDRIIAKGHYSERAAA L
Sbjct  121  VRREVQIMHHLSGHRNIVDLKGAYEDRHSVNLVMELCEGGELFDRIIAKGHYSERAAADL  180

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            CRQMV V+H CHSMGVMHRDLKPENFLFLS D
Sbjct  181  CRQMVMVVHSCHSMGVMHRDLKPENFLFLSKD  212



>ref|XP_010924783.1| PREDICTED: calcium-dependent protein kinase 3-like isoform X2 
[Elaeis guineensis]
Length=527

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 148/185 (80%), Gaps = 9/185 (5%)
 Frame = +2

Query  77   ATSAGGESDPPPPKNDITVLppsqpppprpFLS-GVGRVLGRPMEDVHSTYIFGGELGRG  253
            ATSAGG+     PK     L P         L+  VGRVLGRPMEDV + Y FG ELGRG
Sbjct  34   ATSAGGDG----PK----ALRPRPAAATPRLLTPSVGRVLGRPMEDVRAFYTFGRELGRG  85

Query  254  QFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNIVELKGTYE  433
            QFGVTYLVT ++T ER ACKSIATRKL  +DD++DVRREVQIMHHLTGHRNIVELK  YE
Sbjct  86   QFGVTYLVTSKQTGERFACKSIATRKLTHRDDIEDVRREVQIMHHLTGHRNIVELKAAYE  145

Query  434  DRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHSMGVMHRDLKPEN  613
            DR+ V+LVMELC GGELFDRIIAKGHYSERAAA LCR++VTV+H CHSMGVMHRDLKPEN
Sbjct  146  DRHSVNLVMELCEGGELFDRIIAKGHYSERAAAALCREIVTVVHICHSMGVMHRDLKPEN  205

Query  614  FLFLS  628
            FLFL+
Sbjct  206  FLFLN  210



>ref|XP_010924782.1| PREDICTED: calcium-dependent protein kinase 3-like isoform X1 
[Elaeis guineensis]
Length=531

 Score =   263 bits (671),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 148/185 (80%), Gaps = 9/185 (5%)
 Frame = +2

Query  77   ATSAGGESDPPPPKNDITVLppsqpppprpFLS-GVGRVLGRPMEDVHSTYIFGGELGRG  253
            ATSAGG+     PK     L P         L+  VGRVLGRPMEDV + Y FG ELGRG
Sbjct  34   ATSAGGDG----PK----ALRPRPAAATPRLLTPSVGRVLGRPMEDVRAFYTFGRELGRG  85

Query  254  QFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNIVELKGTYE  433
            QFGVTYLVT ++T ER ACKSIATRKL  +DD++DVRREVQIMHHLTGHRNIVELK  YE
Sbjct  86   QFGVTYLVTSKQTGERFACKSIATRKLTHRDDIEDVRREVQIMHHLTGHRNIVELKAAYE  145

Query  434  DRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHSMGVMHRDLKPEN  613
            DR+ V+LVMELC GGELFDRIIAKGHYSERAAA LCR++VTV+H CHSMGVMHRDLKPEN
Sbjct  146  DRHSVNLVMELCEGGELFDRIIAKGHYSERAAAALCREIVTVVHICHSMGVMHRDLKPEN  205

Query  614  FLFLS  628
            FLFL+
Sbjct  206  FLFLN  210



>ref|NP_001169721.1| uncharacterized LOC100383602 [Zea mays]
 gb|ACN34646.1| unknown [Zea mays]
 tpg|DAA58515.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=524

 Score =   262 bits (670),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  176  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  355
             VGRVLGRPMEDV +TY FG ELGRGQFGVTYLVTHR+T +R ACKSIATRKL+ +DD++
Sbjct  56   AVGRVLGRPMEDVKATYTFGRELGRGQFGVTYLVTHRETGQRFACKSIATRKLVHRDDIE  115

Query  356  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  535
            DVRREVQIMHHLTGHRNIVEL+G YEDR  V+L MELC GGELFDRIIA+GHY+ERAAA 
Sbjct  116  DVRREVQIMHHLTGHRNIVELRGAYEDRRSVNLAMELCEGGELFDRIIARGHYTERAAAA  175

Query  536  LCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
            LCR++V V+H CHSMGV HRDLKPENFLFL++
Sbjct  176  LCREIVAVVHSCHSMGVFHRDLKPENFLFLNN  207



>ref|NP_001152509.1| calcium-dependent protein kinase, isoform 2 [Zea mays]
 gb|ACG47976.1| calcium-dependent protein kinase, isoform 2 [Zea mays]
 gb|AFW83318.1| putative calcium-dependent protein kinase family protein isoform 
1 [Zea mays]
 gb|AFW83319.1| putative calcium-dependent protein kinase family protein isoform 
2 [Zea mays]
Length=530

 Score =   262 bits (670),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = +2

Query  170  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  349
            +  VGRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH +T +R ACKSIATRKL+ +DD
Sbjct  60   VGAVGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHSETGQRFACKSIATRKLVHRDD  119

Query  350  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  529
            ++DVRREVQIMHHLTGHRNIVEL+G YEDR+ V+LVMELC GGELFDRIIAKGHY+ERAA
Sbjct  120  IEDVRREVQIMHHLTGHRNIVELRGAYEDRHSVNLVMELCEGGELFDRIIAKGHYTERAA  179

Query  530  AGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
            A LCR++V V+H CHSMGV HRDLKPENFLFL++
Sbjct  180  ASLCREIVAVVHSCHSMGVFHRDLKPENFLFLNN  213



>ref|XP_006413532.1| hypothetical protein EUTSA_v10024899mg [Eutrema salsugineum]
 gb|ESQ54985.1| hypothetical protein EUTSA_v10024899mg [Eutrema salsugineum]
Length=527

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  182  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  361
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+ +DD++DV
Sbjct  60   GRILGRPMENVRGTYEFGRELGRGQFGVTYLVTHKETKKLFACKSIPTRRLVHRDDIEDV  119

Query  362  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  541
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+LVMELC GGELFDRIIAKGHYSERAAA LC
Sbjct  120  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLVMELCEGGELFDRIIAKGHYSERAAADLC  179

Query  542  RQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            RQMV V+H CHSMGVMHRDLKPENFLFLS D
Sbjct  180  RQMVMVVHSCHSMGVMHRDLKPENFLFLSQD  210



>ref|XP_003569386.1| PREDICTED: calcium-dependent protein kinase 3-like [Brachypodium 
distachyon]
Length=526

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  176  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  355
             +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL+ +DD++
Sbjct  58   AMGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGQRFACKSIATRKLVHRDDIE  117

Query  356  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  535
            DV+REVQIMHHLTGHRNIVEL+G YEDR+ V+LVMELC GGELFDRIIA+GHYSERAAA 
Sbjct  118  DVQREVQIMHHLTGHRNIVELRGAYEDRHSVNLVMELCEGGELFDRIIARGHYSERAAAV  177

Query  536  LCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
            LCR+MV+V+H CHSMGV HRDLKPENFLFL++
Sbjct  178  LCREMVSVVHSCHSMGVFHRDLKPENFLFLNN  209



>ref|XP_008451994.1| PREDICTED: calcium-dependent protein kinase 3 [Cucumis melo]
Length=527

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 155/212 (73%), Gaps = 13/212 (6%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPP--PPKNDITVLpps-----------qpppprpFLSG  178
            MG+C+ +P+   +     G SD    PP N +  + P            +          
Sbjct  1    MGNCSGLPTGQTSTAYPLGHSDADYRPPSNGVVKVLPPDSDPSLPPPLPKEISTSSAPPA  60

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            VGRVLGRP  DV S Y F GELGRGQFGVTYLVTH++T++  ACKSIATRKL+ +DDV+D
Sbjct  61   VGRVLGRPFSDVRSFYSFRGELGRGQFGVTYLVTHKETKQDFACKSIATRKLIDQDDVED  120

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTGH +IVELK  YEDR++V+L+MELCAGGELFDRIIAKGHYSE  AA L
Sbjct  121  VRREVQIMHHLTGHPHIVELKEVYEDRHYVNLIMELCAGGELFDRIIAKGHYSECTAASL  180

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            CRQ+VTV+H CHSMGVMHRDLKPENFLFLS+D
Sbjct  181  CRQIVTVVHNCHSMGVMHRDLKPENFLFLSAD  212



>ref|XP_004961071.1| PREDICTED: calcium-dependent protein kinase 3-like [Setaria italica]
Length=546

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  176  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  355
            GVGRVLGRPMEDV + Y FG ELGRGQFGVTYL TH+ T  R ACKSIA RKL  +DDVD
Sbjct  78   GVGRVLGRPMEDVRAAYTFGRELGRGQFGVTYLATHKPTGRRYACKSIAARKLAHRDDVD  137

Query  356  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  535
            DVRREVQIMHHLTGHRNIVEL+G YEDR+ V+LVMELC GGELFDRIIA+GHYSERAAA 
Sbjct  138  DVRREVQIMHHLTGHRNIVELRGAYEDRHSVNLVMELCEGGELFDRIIARGHYSERAAAA  197

Query  536  LCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
            LCR++V+V+H CHSMGVMHRDLKPENFLFL+ 
Sbjct  198  LCREIVSVVHSCHSMGVMHRDLKPENFLFLNK  229



>ref|XP_004969206.1| PREDICTED: calcium-dependent protein kinase 3-like [Setaria italica]
Length=522

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
             GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTHR+T +R ACKSIATRKL+ +DD++D
Sbjct  55   AGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHRETGQRFACKSIATRKLVHRDDIED  114

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTGHRNIVEL+G YEDR+ V+LVMELC GGELFDRIIA+GHY+ERAAA L
Sbjct  115  VRREVQIMHHLTGHRNIVELRGAYEDRHSVNLVMELCEGGELFDRIIARGHYTERAAAAL  174

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
            CR++V V+H CHSMGV HRDLKPENFLFL+ 
Sbjct  175  CREIVAVVHSCHSMGVFHRDLKPENFLFLND  205



>ref|XP_006283520.1| hypothetical protein CARUB_v10004572mg [Capsella rubella]
 gb|ACC91261.1| putative calcium-dependent protein kinase [Capsella rubella]
 gb|EOA16418.1| hypothetical protein CARUB_v10004572mg [Capsella rubella]
Length=529

 Score =   261 bits (666),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  182  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  361
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T+++ ACKSI TR+L+ KDD+DDV
Sbjct  63   GRILGRPMENVKGTYEFGRELGRGQFGVTYLVTHKETKQQFACKSIPTRRLVHKDDIDDV  122

Query  362  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  541
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRIIAKG YSERAAA LC
Sbjct  123  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIIAKGLYSERAAADLC  182

Query  542  RQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            RQMV V+H CHSMGVMHRDLKPENFLFLS D
Sbjct  183  RQMVMVVHSCHSMGVMHRDLKPENFLFLSKD  213



>gb|ABY59010.1| calcium-dependent protein kinase [Triticum aestivum]
Length=518

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  176  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  355
             +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL+ +DD++
Sbjct  50   AMGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGQRFACKSIATRKLVHRDDIE  109

Query  356  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  535
            DV+REVQIMHHLTGHRNIVEL+G YEDR+ V+L+MELC GGELFDRIIA+GHYSERAAA 
Sbjct  110  DVQREVQIMHHLTGHRNIVELRGAYEDRHSVNLIMELCEGGELFDRIIARGHYSERAAAL  169

Query  536  LCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
            LCR+MV+V+H CHSMGV HRDLKPENFLFL++
Sbjct  170  LCREMVSVVHSCHSMGVFHRDLKPENFLFLNN  201



>emb|CAF18446.1| putative calcium-dependent protein kinase [Triticum aestivum]
 emb|CDM83446.1| unnamed protein product [Triticum aestivum]
Length=518

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  176  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  355
             +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL+ +DD++
Sbjct  50   AMGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGQRFACKSIATRKLVHRDDIE  109

Query  356  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  535
            DV+REVQIMHHLTGHRNIVEL+G YEDR+ V+L+MELC GGELFDRIIA+GHYSERAAA 
Sbjct  110  DVQREVQIMHHLTGHRNIVELRGAYEDRHSVNLIMELCEGGELFDRIIARGHYSERAAAL  169

Query  536  LCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
            LCR+MV+V+H CHSMGV HRDLKPENFLFL++
Sbjct  170  LCREMVSVVHSCHSMGVFHRDLKPENFLFLNN  201



>gb|EAZ12734.1| hypothetical protein OsJ_02652 [Oryza sativa Japonica Group]
 dbj|BAH01699.1| unnamed protein product [Oryza sativa Japonica Group]
Length=518

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL  +DD++D
Sbjct  51   MGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGKRFACKSIATRKLAHRDDIED  110

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTGHRNIVEL+G YEDR+ V+L+MELC GGELFDRIIA+GHYSERAAA L
Sbjct  111  VRREVQIMHHLTGHRNIVELRGAYEDRHSVNLIMELCEGGELFDRIIARGHYSERAAAAL  170

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLS  628
            CR++V V+H CHSMGV HRDLKPENFLFLS
Sbjct  171  CREIVAVVHSCHSMGVFHRDLKPENFLFLS  200



>gb|EEC71113.1| hypothetical protein OsI_02910 [Oryza sativa Indica Group]
Length=520

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL  +DD++D
Sbjct  53   MGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGKRFACKSIATRKLAHRDDIED  112

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTGHRNIVEL+G YEDR+ V+L+MELC GGELFDRIIA+GHYSERAAA L
Sbjct  113  VRREVQIMHHLTGHRNIVELRGAYEDRHSVNLIMELCEGGELFDRIIARGHYSERAAAAL  172

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLS  628
            CR++V V+H CHSMGV HRDLKPENFLFLS
Sbjct  173  CREIVAVVHSCHSMGVFHRDLKPENFLFLS  202



>dbj|BAJ95679.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   260 bits (664),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  176  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  355
             +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL+ +DD++
Sbjct  52   AMGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGQRFACKSIATRKLVHRDDIE  111

Query  356  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  535
            DV+REVQIMHHLTGHRNIVEL+G YEDR+ V+L+MELC GGELFDRIIA+GHYSERAAA 
Sbjct  112  DVQREVQIMHHLTGHRNIVELRGAYEDRHSVNLIMELCEGGELFDRIIARGHYSERAAAL  171

Query  536  LCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
            LCR+MV+V+H CHSMGV HRDLKPENFLFL++
Sbjct  172  LCREMVSVVHSCHSMGVFHRDLKPENFLFLNN  203



>ref|XP_010509303.1| PREDICTED: calcium-dependent protein kinase 3 [Camelina sativa]
Length=529

 Score =   260 bits (664),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  182  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  361
            GR+LGRPME+V  +Y FG ELGRGQFGVTYLVTH++T+++ ACKSI TR+L+ KDD+DDV
Sbjct  64   GRILGRPMENVRGSYEFGPELGRGQFGVTYLVTHKETKQQFACKSIPTRRLVHKDDIDDV  123

Query  362  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  541
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRIIAKG YSERAAA LC
Sbjct  124  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIIAKGLYSERAAADLC  183

Query  542  RQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            RQMV V+H CHSMGVMHRDLKPENFLFLS D
Sbjct  184  RQMVMVVHSCHSMGVMHRDLKPENFLFLSKD  214



>gb|AIU98501.1| calcium-dependent protein kinase [Musa acuminata AAA Group]
Length=521

 Score =   259 bits (663),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            S VGRVLGRPMEDV +TY FG ELGRGQFGVTYLVTHR T ++ ACKSIATRKL+ +DD+
Sbjct  51   SDVGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHRGTTKQFACKSIATRKLVRQDDL  110

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            DDVRRE+QIMHHLTGHRNIVE KG YEDR+ V+LVME+C GGELFDRII+KGHYSERAAA
Sbjct  111  DDVRREIQIMHHLTGHRNIVEPKGAYEDRHSVNLVMEICEGGELFDRIISKGHYSERAAA  170

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
             LCR++V V+H CHSMGVMHRDLKPEN LFL+ 
Sbjct  171  ALCREIVNVVHACHSMGVMHRDLKPENCLFLNK  203



>ref|XP_009137374.1| PREDICTED: calcium-dependent protein kinase 3-like [Brassica 
rapa]
 ref|XP_009137377.1| PREDICTED: calcium-dependent protein kinase 3-like [Brassica 
rapa]
Length=532

 Score =   260 bits (664),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  182  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  361
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+ +DD++DV
Sbjct  65   GRILGRPMENVRGTYDFGKELGRGQFGVTYLVTHKETKKLFACKSIPTRRLVHRDDIEDV  124

Query  362  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  541
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRIIAKGHY+ERAAA LC
Sbjct  125  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIIAKGHYTERAAADLC  184

Query  542  RQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            RQMV V+H CHSMGVMHRDLKPENFLFLS D
Sbjct  185  RQMVMVVHSCHSMGVMHRDLKPENFLFLSKD  215



>ref|XP_010433881.1| PREDICTED: calcium-dependent protein kinase 3-like [Camelina 
sativa]
Length=528

 Score =   259 bits (663),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  182  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  361
            GR+LGRPME+V  +Y FG ELGRGQFGVTYLVTH++T+++ ACKSI TR+L+ KDD+DDV
Sbjct  62   GRILGRPMENVRGSYEFGPELGRGQFGVTYLVTHKETKQQFACKSIPTRRLVHKDDIDDV  121

Query  362  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  541
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRIIAKG YSERAAA LC
Sbjct  122  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIIAKGLYSERAAADLC  181

Query  542  RQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            RQMV V+H CHSMGVMHRDLKPENFLFLS D
Sbjct  182  RQMVMVVHSCHSMGVMHRDLKPENFLFLSKD  212



>ref|XP_010439150.1| PREDICTED: calcium-dependent protein kinase 3-like [Camelina 
sativa]
Length=528

 Score =   259 bits (663),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  182  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  361
            GR+LGRPME+V  +Y FG ELGRGQFGVTYLVTH++T+++ ACKSI TR+L+ KDD+DDV
Sbjct  62   GRILGRPMENVRGSYEFGPELGRGQFGVTYLVTHKETKQQFACKSIPTRRLVHKDDIDDV  121

Query  362  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  541
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRIIAKG YSERAAA LC
Sbjct  122  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIIAKGLYSERAAADLC  181

Query  542  RQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            RQMV V+H CHSMGVMHRDLKPENFLFLS D
Sbjct  182  RQMVMVVHSCHSMGVMHRDLKPENFLFLSKD  212



>gb|ACA63885.1| calcium-dependent protein kinase [Hordeum vulgare]
Length=520

 Score =   259 bits (662),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  176  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  355
             +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL+ +DD++
Sbjct  52   AMGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGQRFACKSIATRKLVHRDDIE  111

Query  356  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  535
            DV+REVQIMHHLTGHRNIVEL+G YEDR+ V+L+MELC GGELFDRIIA+GHYSERAAA 
Sbjct  112  DVQREVQIMHHLTGHRNIVELRGAYEDRHSVNLIMELCEGGELFDRIIARGHYSERAAAL  171

Query  536  LCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
            LCR+MV+V+H CHSMGV HRDLKPENFLFL++
Sbjct  172  LCREMVSVVHSCHSMGVFHRDLKPENFLFLNN  203



>ref|XP_010676387.1| PREDICTED: calcium-dependent protein kinase 3 [Beta vulgaris 
subsp. vulgaris]
Length=526

 Score =   259 bits (663),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            S +GRVLGRPMEDV  +YIFG ELGRGQFG+TYLVTH++T+   ACKSIATRKL+++DD+
Sbjct  58   SNIGRVLGRPMEDVRESYIFGRELGRGQFGITYLVTHKQTKLNFACKSIATRKLINQDDI  117

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            DDVRREVQIMHHLTG+ NIVELK  +EDR+ V+L+MELCAGGELFDRIIAKGHYSER AA
Sbjct  118  DDVRREVQIMHHLTGNSNIVELKSAFEDRHSVNLIMELCAGGELFDRIIAKGHYSERQAA  177

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
             L RQ+VTV++ CHSMGVMHRDLKPENFL LSS
Sbjct  178  KLFRQIVTVVYNCHSMGVMHRDLKPENFLLLSS  210



>gb|AFW81269.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
Length=478

 Score =   258 bits (659),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            VGRVLGRPMEDV ++Y FG ELGRGQFGVTYL TH+ T  R ACKSIATRKL   DDVDD
Sbjct  72   VGRVLGRPMEDVRASYTFGRELGRGQFGVTYLATHKPTGRRYACKSIATRKLAHSDDVDD  131

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTGHR+IVEL+G YEDR+ V+LVMELC GGELFDRIIA+GHYSERAAA L
Sbjct  132  VRREVQIMHHLTGHRSIVELRGAYEDRHSVNLVMELCEGGELFDRIIARGHYSERAAAAL  191

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLS  628
            CR++V+V+H CHSMGVMHRDLKPENFLFL+
Sbjct  192  CREIVSVVHSCHSMGVMHRDLKPENFLFLN  221



>ref|NP_001056455.1| Os05g0585500 [Oryza sativa Japonica Group]
 gb|AAT47064.1| putative calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF18369.1| Os05g0585500 [Oryza sativa Japonica Group]
Length=542

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  176  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  355
            GVGRVLGRPMEDV +TY FG ELGRGQFGVTYL TH+ T  R ACKSIA RKL   DD+D
Sbjct  74   GVGRVLGRPMEDVRATYTFGRELGRGQFGVTYLATHKPTGRRYACKSIAARKLARPDDLD  133

Query  356  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  535
            DVRREV IMHHLTGHRNIVEL+G YEDR+ V+LVMELC GGELFDRIIA+GHYSERAAA 
Sbjct  134  DVRREVHIMHHLTGHRNIVELRGAYEDRHSVNLVMELCEGGELFDRIIARGHYSERAAAA  193

Query  536  LCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
            LCR++V+V+H CHSMGVMHRDLKPENFLFL+ 
Sbjct  194  LCREIVSVVHSCHSMGVMHRDLKPENFLFLNK  225



>ref|XP_007158545.1| hypothetical protein PHAVU_002G161200g [Phaseolus vulgaris]
 gb|ESW30539.1| hypothetical protein PHAVU_002G161200g [Phaseolus vulgaris]
Length=502

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 153/201 (76%), Gaps = 13/201 (6%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGE--SDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMED  211
            MG+ NS     ++ T    E     P P N ++VLPP+  P        VGRVL RPMED
Sbjct  1    MGNSNS---QAYSQTQPHSEHHQHQPQPSNGVSVLPPNSKPT-------VGRVLDRPMED  50

Query  212  VHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHL  391
            V S YIFG ELGRGQFGVTY VTH+ T E LACKSIA RKL  +DD++DVRREVQIMHHL
Sbjct  51   VRSDYIFGRELGRGQFGVTYSVTHKHTNENLACKSIAKRKL-HRDDLEDVRREVQIMHHL  109

Query  392  TGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYC  571
            TGHRNIVELKG  EDR+ V+LVMELCAGGELFDRIIAKGHYSERAAA LCRQ+ TV+H C
Sbjct  110  TGHRNIVELKGACEDRHSVNLVMELCAGGELFDRIIAKGHYSERAAADLCRQIATVIHDC  169

Query  572  HSMGVMHRDLKPENFLFLSSD  634
            HSMGVMHRDLKPENFLFL  +
Sbjct  170  HSMGVMHRDLKPENFLFLGKE  190



>ref|XP_008656081.1| PREDICTED: calcium-dependent protein kinase 3-like [Zea mays]
 gb|AFW81270.1| putative calcium-dependent protein kinase family protein isoform 
1 [Zea mays]
 gb|AFW81271.1| putative calcium-dependent protein kinase family protein isoform 
2 [Zea mays]
Length=539

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            VGRVLGRPMEDV ++Y FG ELGRGQFGVTYL TH+ T  R ACKSIATRKL   DDVDD
Sbjct  72   VGRVLGRPMEDVRASYTFGRELGRGQFGVTYLATHKPTGRRYACKSIATRKLAHSDDVDD  131

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTGHR+IVEL+G YEDR+ V+LVMELC GGELFDRIIA+GHYSERAAA L
Sbjct  132  VRREVQIMHHLTGHRSIVELRGAYEDRHSVNLVMELCEGGELFDRIIARGHYSERAAAAL  191

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
            CR++V+V+H CHSMGVMHRDLKPENFLFL+ 
Sbjct  192  CREIVSVVHSCHSMGVMHRDLKPENFLFLNK  222



>gb|KHG14847.1| Calcium-dependent protein kinase 3 [Gossypium arboreum]
Length=530

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +GRV GRPMEDV STYI G ELGRGQFGVTYLVTH++T++  ACKSI+ RKLL++DD++D
Sbjct  64   IGRVFGRPMEDVRSTYIVGRELGRGQFGVTYLVTHKETKQHFACKSISRRKLLNRDDIED  123

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIM+HLTGHRNIVEL+   EDR  V+L+MELCAGGELFDRI+AKGHYSE+ AA L
Sbjct  124  VRREVQIMYHLTGHRNIVELEKACEDRRSVNLIMELCAGGELFDRILAKGHYSEKEAANL  183

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            CRQ+VTV+H CHSMGVMHRDLKPENFLFLS D
Sbjct  184  CRQIVTVVHNCHSMGVMHRDLKPENFLFLSKD  215



>gb|AHN16201.1| CPK3-2.1 [Brassica napus]
Length=527

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  182  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  361
            GR+LG+PMEDV +TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+  DD++DV
Sbjct  60   GRILGKPMEDVKATYDFGRELGRGQFGVTYLVTHKETKKVFACKSIPTRRLVQSDDIEDV  119

Query  362  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  541
            RREV IMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRIIAKGHY+ERAAA LC
Sbjct  120  RREVHIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIIAKGHYTERAAADLC  179

Query  542  RQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            RQMV V+H CHSMGVMHRDLKPENFLFLS D
Sbjct  180  RQMVMVVHSCHSMGVMHRDLKPENFLFLSKD  210



>ref|XP_002867697.1| calcium-dependent protein kinase 6 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43956.1| calcium-dependent protein kinase 6 [Arabidopsis lyrata subsp. 
lyrata]
Length=519

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  182  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  361
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+ KDD++DV
Sbjct  54   GRILGRPMENVRGTYEFGRELGRGQFGVTYLVTHKETKQLFACKSIPTRRLVHKDDIEDV  113

Query  362  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  541
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRIIAKG YSERAAA LC
Sbjct  114  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIIAKGLYSERAAADLC  173

Query  542  RQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            RQMV V+H CHSMGVMHRDLKPENFLFLS D
Sbjct  174  RQMVMVVHSCHSMGVMHRDLKPENFLFLSKD  204



>ref|NP_194096.1| calcium-dependent protein kinase 6 [Arabidopsis thaliana]
 sp|Q42479.1|CDPK3_ARATH RecName: Full=Calcium-dependent protein kinase 3; AltName: Full=Calcium-dependent 
protein kinase isoform CDPK6; Short=AtCDPK6 
[Arabidopsis thaliana]
 gb|AAK60302.1|AF385710_1 AT4g23650/F9D16_120 [Arabidopsis thaliana]
 gb|AAA67654.1| calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAA67656.1| calcium-dependent protein kinase [Arabidopsis thaliana]
 emb|CAA23031.1| calcium-dependent protein kinase (CDPK6) [Arabidopsis thaliana]
 emb|CAB79320.1| calcium-dependent protein kinase (CDPK6) [Arabidopsis thaliana]
 gb|AAL87385.1| AT4g23650/F9D16_120 [Arabidopsis thaliana]
 gb|AAM65176.1| calcium-dependent protein kinase CDPK6 [Arabidopsis thaliana]
 gb|AAN31878.1| putative calcium-dependent protein kinase (CDPK6) [Arabidopsis 
thaliana]
 gb|AEE84789.1| calcium-dependent protein kinase 6 [Arabidopsis thaliana]
Length=529

 Score =   258 bits (658),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  182  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  361
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T++++ACKSI TR+L+ KDD++DV
Sbjct  64   GRILGRPMEEVRRTYEFGRELGRGQFGVTYLVTHKETKQQVACKSIPTRRLVHKDDIEDV  123

Query  362  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  541
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRII+KG YSERAAA LC
Sbjct  124  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIISKGLYSERAAADLC  183

Query  542  RQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            RQMV V+H CHSMGVMHRDLKPENFLFLS D
Sbjct  184  RQMVMVVHSCHSMGVMHRDLKPENFLFLSKD  214



>gb|AAL38596.1|AF446863_1 AT4g23650/F9D16_120 [Arabidopsis thaliana]
 gb|AAK96512.1| AT4g23650/F9D16_120 [Arabidopsis thaliana]
Length=529

 Score =   258 bits (658),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  182  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  361
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T++++ACKSI TR+L+ KDD++DV
Sbjct  64   GRILGRPMEEVRRTYEFGRELGRGQFGVTYLVTHKETKQQVACKSIPTRRLVHKDDIEDV  123

Query  362  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  541
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRII+KG YSERAAA LC
Sbjct  124  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIISKGLYSERAAADLC  183

Query  542  RQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            RQMV V+H CHSMGVMHRDLKPENFLFLS D
Sbjct  184  RQMVMVVHSCHSMGVMHRDLKPENFLFLSKD  214



>emb|CDY54853.1| BnaC01g15460D [Brassica napus]
Length=525

 Score =   258 bits (658),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  182  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  361
            GR+LG+PMEDV +TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+  DD++DV
Sbjct  58   GRILGKPMEDVKATYDFGRELGRGQFGVTYLVTHKETKKVFACKSIPTRRLVQSDDIEDV  117

Query  362  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  541
            RREV IMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRIIAKGHY+ERAAA LC
Sbjct  118  RREVHIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIIAKGHYTERAAADLC  177

Query  542  RQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            RQMV V+H CHSMGVMHRDLKPENFLFLS D
Sbjct  178  RQMVMVVHSCHSMGVMHRDLKPENFLFLSKD  208



>emb|CDY62741.1| BnaC07g50270D [Brassica napus]
Length=615

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  182  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  361
            GR+LGRPME+V  TY FG ELGRGQFGVTYLVTH++T++  ACKSI TR+L+ +DD++DV
Sbjct  148  GRILGRPMENVRGTYDFGKELGRGQFGVTYLVTHKETKKLFACKSIPTRRLVHRDDIEDV  207

Query  362  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  541
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRIIAKGHY+ERAAA LC
Sbjct  208  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIIAKGHYTERAAADLC  267

Query  542  RQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            RQMV V+H CHSMGVMHRDLKPENFLFLS D
Sbjct  268  RQMVMVVHSCHSMGVMHRDLKPENFLFLSKD  298



>gb|KJB39672.1| hypothetical protein B456_007G025000 [Gossypium raimondii]
Length=431

 Score =   254 bits (650),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 153/218 (70%), Gaps = 22/218 (10%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDP-----------------PPPKNDI--TVLppsqpppp  160
            MG+CN     P  +     E DP                 PPPK     +    S+    
Sbjct  1    MGNCNR---PPIVSNRFRAEPDPGGTHHNDDNVKPVPGYSPPPKTHYYHSSTIASKNRLA  57

Query  161  rpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLS  340
             P    +GRV GRPMEDV STY+ G ELGRGQFGVTYLVTH++T++  ACKSI+ RKLL+
Sbjct  58   TPNTPPIGRVFGRPMEDVRSTYVVGRELGRGQFGVTYLVTHKETKQHFACKSISRRKLLT  117

Query  341  KDDVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSE  520
            +DD++DVRREVQIM+HLTGHRNIVEL+   EDR  V+L+MELCAGGEL DRI+AKGHYSE
Sbjct  118  RDDIEDVRREVQIMYHLTGHRNIVELETACEDRRSVNLIMELCAGGELLDRILAKGHYSE  177

Query  521  RAAAGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            + AA LCRQ+VTV+H CHSMGVMHRDLKPENFLFLS D
Sbjct  178  KEAANLCRQIVTVVHNCHSMGVMHRDLKPENFLFLSKD  215



>gb|KJB39669.1| hypothetical protein B456_007G025000 [Gossypium raimondii]
Length=438

 Score =   254 bits (650),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 153/218 (70%), Gaps = 22/218 (10%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDP-----------------PPPKNDI--TVLppsqpppp  160
            MG+CN     P  +     E DP                 PPPK     +    S+    
Sbjct  1    MGNCNR---PPIVSNRFRAEPDPGGTHHNDDNVKPVPGYSPPPKTHYYHSSTIASKNRLA  57

Query  161  rpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLS  340
             P    +GRV GRPMEDV STY+ G ELGRGQFGVTYLVTH++T++  ACKSI+ RKLL+
Sbjct  58   TPNTPPIGRVFGRPMEDVRSTYVVGRELGRGQFGVTYLVTHKETKQHFACKSISRRKLLT  117

Query  341  KDDVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSE  520
            +DD++DVRREVQIM+HLTGHRNIVEL+   EDR  V+L+MELCAGGEL DRI+AKGHYSE
Sbjct  118  RDDIEDVRREVQIMYHLTGHRNIVELETACEDRRSVNLIMELCAGGELLDRILAKGHYSE  177

Query  521  RAAAGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            + AA LCRQ+VTV+H CHSMGVMHRDLKPENFLFLS D
Sbjct  178  KEAANLCRQIVTVVHNCHSMGVMHRDLKPENFLFLSKD  215



>ref|XP_002455974.1| hypothetical protein SORBIDRAFT_03g028340 [Sorghum bicolor]
 gb|EES01094.1| hypothetical protein SORBIDRAFT_03g028340 [Sorghum bicolor]
Length=525

 Score =   257 bits (656),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +2

Query  191  LGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRRE  370
            LGRPMEDV +TY FG ELGRGQFGVTYLVTHR+T +R ACKSIATRKL+ +DD++DVRRE
Sbjct  62   LGRPMEDVRATYTFGRELGRGQFGVTYLVTHRETGQRFACKSIATRKLVHRDDIEDVRRE  121

Query  371  VQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  550
            VQIMHHLTGHRNIVEL+G YEDR+ V+LVMELC GGELFDRIIAKGHY+ERAAA LCR++
Sbjct  122  VQIMHHLTGHRNIVELRGAYEDRHSVNLVMELCEGGELFDRIIAKGHYTERAAAALCREI  181

Query  551  VTVLHYCHSMGVMHRDLKPENFLFLSS  631
            V V+H CHSMGV HRDLKPENFLFL++
Sbjct  182  VAVVHSCHSMGVFHRDLKPENFLFLNN  208



>ref|XP_002441592.1| hypothetical protein SORBIDRAFT_09g029950 [Sorghum bicolor]
 gb|EES20022.1| hypothetical protein SORBIDRAFT_09g029950 [Sorghum bicolor]
Length=541

 Score =   257 bits (656),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            + +GRVLGRPMEDV ++Y FG ELGRGQFGVTYL TH+ T  R ACKSIATRKL   DDV
Sbjct  72   TNIGRVLGRPMEDVRASYTFGRELGRGQFGVTYLATHKPTGRRYACKSIATRKLAHLDDV  131

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +DVRREVQIMHHLTGHR+IVEL+G YEDR+ V+LVMELC GGELFDRIIA+GHYSERAAA
Sbjct  132  EDVRREVQIMHHLTGHRSIVELRGAYEDRHSVNLVMELCEGGELFDRIIARGHYSERAAA  191

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLS  628
             LCR++V+V+H CHSMGVMHRDLKPENFLFLS
Sbjct  192  SLCREIVSVVHSCHSMGVMHRDLKPENFLFLS  223



>gb|KJB39670.1| hypothetical protein B456_007G025000 [Gossypium raimondii]
 gb|KJB39671.1| hypothetical protein B456_007G025000 [Gossypium raimondii]
Length=504

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 153/218 (70%), Gaps = 22/218 (10%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDP-----------------PPPKNDI--TVLppsqpppp  160
            MG+CN     P  +     E DP                 PPPK     +    S+    
Sbjct  1    MGNCNR---PPIVSNRFRAEPDPGGTHHNDDNVKPVPGYSPPPKTHYYHSSTIASKNRLA  57

Query  161  rpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLS  340
             P    +GRV GRPMEDV STY+ G ELGRGQFGVTYLVTH++T++  ACKSI+ RKLL+
Sbjct  58   TPNTPPIGRVFGRPMEDVRSTYVVGRELGRGQFGVTYLVTHKETKQHFACKSISRRKLLT  117

Query  341  KDDVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSE  520
            +DD++DVRREVQIM+HLTGHRNIVEL+   EDR  V+L+MELCAGGEL DRI+AKGHYSE
Sbjct  118  RDDIEDVRREVQIMYHLTGHRNIVELETACEDRRSVNLIMELCAGGELLDRILAKGHYSE  177

Query  521  RAAAGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            + AA LCRQ+VTV+H CHSMGVMHRDLKPENFLFLS D
Sbjct  178  KEAANLCRQIVTVVHNCHSMGVMHRDLKPENFLFLSKD  215



>dbj|BAD61167.1| putative calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
Length=713

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +GRVLGRPMEDV +TY FG ELGRGQFGVTYLVTH+ T +R ACKSIATRKL  +DD++D
Sbjct  246  MGRVLGRPMEDVRATYTFGRELGRGQFGVTYLVTHKATGKRFACKSIATRKLAHRDDIED  305

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTGHRNIVEL+G YEDR+ V+L+MELC GGELFDRIIA+GHYSERAAA L
Sbjct  306  VRREVQIMHHLTGHRNIVELRGAYEDRHSVNLIMELCEGGELFDRIIARGHYSERAAAAL  365

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLS  628
            CR++V V+H CHSMGV HRDLKPENFLFLS
Sbjct  366  CREIVAVVHSCHSMGVFHRDLKPENFLFLS  395



>gb|KJB39673.1| hypothetical protein B456_007G025000 [Gossypium raimondii]
Length=530

 Score =   255 bits (652),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 153/218 (70%), Gaps = 22/218 (10%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDP-----------------PPPKNDI--TVLppsqpppp  160
            MG+CN     P  +     E DP                 PPPK     +    S+    
Sbjct  1    MGNCNR---PPIVSNRFRAEPDPGGTHHNDDNVKPVPGYSPPPKTHYYHSSTIASKNRLA  57

Query  161  rpFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLS  340
             P    +GRV GRPMEDV STY+ G ELGRGQFGVTYLVTH++T++  ACKSI+ RKLL+
Sbjct  58   TPNTPPIGRVFGRPMEDVRSTYVVGRELGRGQFGVTYLVTHKETKQHFACKSISRRKLLT  117

Query  341  KDDVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSE  520
            +DD++DVRREVQIM+HLTGHRNIVEL+   EDR  V+L+MELCAGGEL DRI+AKGHYSE
Sbjct  118  RDDIEDVRREVQIMYHLTGHRNIVELETACEDRRSVNLIMELCAGGELLDRILAKGHYSE  177

Query  521  RAAAGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            + AA LCRQ+VTV+H CHSMGVMHRDLKPENFLFLS D
Sbjct  178  KEAANLCRQIVTVVHNCHSMGVMHRDLKPENFLFLSKD  215



>ref|NP_001267714.1| calcium-dependent protein kinase 3-like [Cucumis sativus]
 emb|CAC44471.1| calcium dependent calmodulin independent protein kinase [Cucumis 
sativus]
 gb|AAK26164.2| calcium-dependent calmodulin-independent protein kinase 5 [Cucumis 
sativus]
Length=514

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = +2

Query  176  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  355
             +GRVL RP  DV S Y F GELGRGQFGVTYLVTH++T++  ACKSIATRKL+ +DDV+
Sbjct  47   ALGRVLARPFSDVRSFYSFRGELGRGQFGVTYLVTHKETKQDFACKSIATRKLIDQDDVE  106

Query  356  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  535
            DVRREVQIMHHLTGH +IVELK  YEDR++V+L+MELCAGGELFDRIIAKGHYSE  AA 
Sbjct  107  DVRREVQIMHHLTGHPHIVELKEVYEDRHYVNLIMELCAGGELFDRIIAKGHYSECTAAS  166

Query  536  LCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            LCRQ+VTV+H CHSMGVMHRDLKPENFLFLS+D
Sbjct  167  LCRQIVTVVHNCHSMGVMHRDLKPENFLFLSAD  199



>gb|AGG35973.1| calcium-dependent protein kinase 3, partial [Brassica napus]
Length=525

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +2

Query  182  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  361
            GR+LG+PMEDV  TY  G ELGRGQFGVT+LVTH++T++  ACKSI TR+L+  DD++DV
Sbjct  58   GRILGKPMEDVKGTYDLGRELGRGQFGVTHLVTHKETKKVFACKSIPTRRLVQSDDIEDV  117

Query  362  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  541
            RREVQIMHHL+GHRNIV+LKG YEDR  V+L+MELC GGELFDRIIAKGHY+ERAAA LC
Sbjct  118  RREVQIMHHLSGHRNIVDLKGAYEDRQSVNLIMELCEGGELFDRIIAKGHYTERAAADLC  177

Query  542  RQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            RQMV V+H CHSMGVMHRDLKPENFLFLS D
Sbjct  178  RQMVMVVHSCHSMGVMHRDLKPENFLFLSKD  208



>emb|CDY44125.1| BnaA01g13330D [Brassica napus]
Length=525

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +2

Query  182  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  361
            GR+LG+PMEDV  TY  G ELGRGQFGVT+LVTH++T++  ACKSI TR+L+  DD++DV
Sbjct  58   GRILGKPMEDVKGTYDLGRELGRGQFGVTHLVTHKETKKVFACKSIPTRRLVQSDDIEDV  117

Query  362  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  541
            RREVQIMHHL+GHRNIV+LKG YEDR  V+L+MELC GGELFDRIIAKGHY+ERAAA LC
Sbjct  118  RREVQIMHHLSGHRNIVDLKGAYEDRQSVNLIMELCEGGELFDRIIAKGHYTERAAADLC  177

Query  542  RQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            RQMV V+H CHSMGVMHRDLKPENFLFLS D
Sbjct  178  RQMVMVVHSCHSMGVMHRDLKPENFLFLSKD  208



>ref|XP_009137281.1| PREDICTED: calcium-dependent protein kinase 3-like [Brassica 
rapa]
Length=525

 Score =   254 bits (650),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  182  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  361
            GR+LG+PMEDV  TY  G ELGRGQFGVT+LVTH++T++  ACKSI TR+L+  DD++DV
Sbjct  58   GRILGKPMEDVKGTYDLGRELGRGQFGVTHLVTHKETKKVFACKSIPTRRLVQSDDIEDV  117

Query  362  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  541
            RREVQIMHHL+GHRNIV+LKG YEDR+ V+L+MELC GGELFDRIIAKGHY+ERAAA LC
Sbjct  118  RREVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIIAKGHYTERAAADLC  177

Query  542  RQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            RQMV V+H CHSMGVMHRDLKPENFLFLS D
Sbjct  178  RQMVMVVHSCHSMGVMHRDLKPENFLFLSKD  208



>dbj|BAJ94561.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=527

 Score =   254 bits (649),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            VGRVLGRPMEDV +TY FG ELGRGQFGVTYL TH+ T  R ACKSIA RKL   DDV+D
Sbjct  60   VGRVLGRPMEDVRATYTFGRELGRGQFGVTYLATHKSTGARYACKSIAARKLARADDVED  119

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
             RREVQIMHHLTGHR+IVEL+G YEDR+ V+LVMELC GGELFDRIIA+GHYSERAAA L
Sbjct  120  ARREVQIMHHLTGHRSIVELRGAYEDRHSVNLVMELCEGGELFDRIIARGHYSERAAATL  179

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLS  628
            CR++V+V+H CHSMGVMHRDLKPENFLFL+
Sbjct  180  CREVVSVVHSCHSMGVMHRDLKPENFLFLN  209



>ref|XP_008802050.1| PREDICTED: calcium-dependent protein kinase 3-like [Phoenix dactylifera]
Length=525

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +2

Query  167  FLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKD  346
             +  VGRV  RPM+ V + Y FG E+GRGQFGVTYLVTH++T +  ACKSIATR+LL +D
Sbjct  51   IIPNVGRVFKRPMDHVRAFYTFGSEIGRGQFGVTYLVTHKETGKLFACKSIATRRLLHRD  110

Query  347  DVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERA  526
            D++DVRREVQIMHHLTGHRNIVEL+  YEDRN V+LVMELC GGELFDRIIAKGHYSERA
Sbjct  111  DIEDVRREVQIMHHLTGHRNIVELEEAYEDRNSVNLVMELCEGGELFDRIIAKGHYSERA  170

Query  527  AAGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSS  631
            AA LCR++VTV+H CHSMGVMHRDLKPENFLFL++
Sbjct  171  AAALCREIVTVVHVCHSMGVMHRDLKPENFLFLNT  205



>gb|KEH27423.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=433

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            S +GRVLG+PMEDV STY FG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRKL+ +DD+
Sbjct  50   SPLGRVLGKPMEDVRSTYTFGRELGRGQFGVTYLVTHKLTKEQFACKSIATRKLIRRDDL  109

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            DD+RREVQIMHHLTGHRNIVELKG YEDR+ V+L+MELCAGGELFDRII+KGHYSERAAA
Sbjct  110  DDIRREVQIMHHLTGHRNIVELKGAYEDRHSVNLIMELCAGGELFDRIISKGHYSERAAA  169

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLS  628
             LCRQ+VTV+H CH+MGVMHRDLKPENFLFLS
Sbjct  170  ELCRQIVTVVHNCHTMGVMHRDLKPENFLFLS  201



>gb|EYU23402.1| hypothetical protein MIMGU_mgv1a004683mg [Erythranthe guttata]
Length=515

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 149/201 (74%), Gaps = 6/201 (3%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGV--GRVLGRPMED  211
            MG+  SI + P A T+    + PP    D     P+ P  P      +  G +LGRP+ +
Sbjct  1    MGNAPSIDAPPHAPTA----TSPPNGGADSETSLPTPPESPPHPPGSLPTGAILGRPISN  56

Query  212  VHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHL  391
            VHS Y FG ELGRGQFGVT+LVTHR+TR   ACKSIA RKL + DD   VRREVQIMHHL
Sbjct  57   VHSAYNFGRELGRGQFGVTHLVTHRETRRAFACKSIAVRKLAAPDDAAAVRREVQIMHHL  116

Query  392  TGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYC  571
            TGHRNIVEL+  +EDR HVHLVM+LCAGGELF+RI++KGHYSER AAGLCRQ+VTV+H C
Sbjct  117  TGHRNIVELREVFEDRRHVHLVMDLCAGGELFERIVSKGHYSERGAAGLCRQIVTVVHAC  176

Query  572  HSMGVMHRDLKPENFLFLSSD  634
            HSMGVMHRDLKPENFLF  SD
Sbjct  177  HSMGVMHRDLKPENFLFFDSD  197



>gb|KGN53365.1| hypothetical protein Csa_4G050200 [Cucumis sativus]
Length=527

 Score =   252 bits (644),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = +2

Query  176  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  355
             +GRVL RP  DV S Y F GELGRGQFGVTYLVTH++T++  ACKSIATRKL+ +DDV+
Sbjct  60   ALGRVLARPFSDVRSFYSFRGELGRGQFGVTYLVTHKETKQDFACKSIATRKLIDQDDVE  119

Query  356  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  535
            DVRREVQIMHHLTGH +IVELK  +EDR++V+L+MELCAGGELFDRIIAKGHYSE  AA 
Sbjct  120  DVRREVQIMHHLTGHPHIVELKEVHEDRHYVNLIMELCAGGELFDRIIAKGHYSECTAAS  179

Query  536  LCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            LCRQ+VTV+H CHSMGVMHRDLKPENFLFLS+D
Sbjct  180  LCRQIVTVVHNCHSMGVMHRDLKPENFLFLSAD  212



>ref|XP_009406794.1| PREDICTED: calcium-dependent protein kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=461

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  203  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  382
            MEDV +TY FG ELGRGQFGVTYLV HR+T ++LACK+IATRKL+ +DD+DDVRRE+QIM
Sbjct  1    MEDVRATYSFGRELGRGQFGVTYLVVHRETGKQLACKAIATRKLVRQDDLDDVRREIQIM  60

Query  383  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVL  562
            HHLTGHRNIVELKG YEDR+ V+LVMELC GGELFDRIIAKGHYSERAAA LCR++V+V+
Sbjct  61   HHLTGHRNIVELKGAYEDRHSVNLVMELCEGGELFDRIIAKGHYSERAAAALCREIVSVV  120

Query  563  HYCHSMGVMHRDLKPENFLFLS  628
            H CHSMGVMHRDLKPENFLFL+
Sbjct  121  HACHSMGVMHRDLKPENFLFLN  142



>gb|EPS65220.1| hypothetical protein M569_09555, partial [Genlisea aurea]
Length=457

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +2

Query  176  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  355
            G GRVLG+PM DV S Y FG E+GRGQFGVTYLVTH  T E+ ACKSI+ RK++S  DV 
Sbjct  1    GKGRVLGKPMSDVRSKYGFGKEIGRGQFGVTYLVTHSVTGEKFACKSISKRKIISPADVA  60

Query  356  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  535
            DVRREVQIM+HLTGH N+VEL+  +E R HVHLVMELCAGGELFDRIIAKGHY+ERAAAG
Sbjct  61   DVRREVQIMYHLTGHPNVVELREVFEGRQHVHLVMELCAGGELFDRIIAKGHYTERAAAG  120

Query  536  LCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            LCRQ+VTV+H CHSMGV HRDLKPENFLF S+D
Sbjct  121  LCRQIVTVVHACHSMGVFHRDLKPENFLFSSTD  153



>ref|XP_003611046.1| Calcium dependent protein kinase [Medicago truncatula]
 gb|AES94004.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=517

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            S +GRVLG+PMEDV STY FG ELGRGQFGVTYLVTH+ T+E+ ACKSIATRKL+ +DD+
Sbjct  50   SPLGRVLGKPMEDVRSTYTFGRELGRGQFGVTYLVTHKLTKEQFACKSIATRKLIRRDDL  109

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            DD+RREVQIMHHLTGHRNIVELKG YEDR+ V+L+MELCAGGELFDRII+KGHYSERAAA
Sbjct  110  DDIRREVQIMHHLTGHRNIVELKGAYEDRHSVNLIMELCAGGELFDRIISKGHYSERAAA  169

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLS  628
             LCRQ+VTV+H CH+MGVMHRDLKPENFLFLS
Sbjct  170  ELCRQIVTVVHNCHTMGVMHRDLKPENFLFLS  201



>gb|EPS59027.1| hypothetical protein M569_15783, partial [Genlisea aurea]
Length=433

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S Y  G ELGRGQFGVT+L TH++T ++LACK+IA RKL SK+DVDD
Sbjct  70   IGPVLGRPMEDVRSIYTMGKELGRGQFGVTHLCTHKQTGQQLACKTIAKRKLGSKEDVDD  129

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  N+VELKGTYED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  130  VRREVQIMHHLTGQPNVVELKGTYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  189

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  190  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  221



>ref|XP_010673770.1| PREDICTED: calcium-dependent protein kinase 17-like [Beta vulgaris 
subsp. vulgaris]
Length=534

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 148/198 (75%), Gaps = 8/198 (4%)
 Frame = +2

Query  41   GSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHS  220
            G+ N+IP+       A   + P PP +  T    +            G VLGRPMEDV +
Sbjct  26   GNNNAIPNPSTQKPEAS--TKPTPPSSSGTTHNKNTKTAQN------GPVLGRPMEDVKT  77

Query  221  TYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGH  400
            TY FG ELGRGQFGVT+LVTHR+T E+ ACK+IA RKL++K+D++DVRREVQIMHHLTG 
Sbjct  78   TYSFGKELGRGQFGVTHLVTHRQTGEQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTGQ  137

Query  401  RNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHSM  580
             NIVELKG +ED++ VHL+MELCAGGELFDRIIAKGH++ERAAA L R +V ++H CHSM
Sbjct  138  PNIVELKGAFEDKHSVHLIMELCAGGELFDRIIAKGHFTERAAASLLRTIVQIVHTCHSM  197

Query  581  GVMHRDLKPENFLFLSSD  634
            GV+HRDLKPENFL L+ D
Sbjct  198  GVIHRDLKPENFLLLNKD  215



>tpg|DAA58514.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=460

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  203  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  382
            MEDV +TY FG ELGRGQFGVTYLVTHR+T +R ACKSIATRKL+ +DD++DVRREVQIM
Sbjct  1    MEDVKATYTFGRELGRGQFGVTYLVTHRETGQRFACKSIATRKLVHRDDIEDVRREVQIM  60

Query  383  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVL  562
            HHLTGHRNIVEL+G YEDR  V+L MELC GGELFDRIIA+GHY+ERAAA LCR++V V+
Sbjct  61   HHLTGHRNIVELRGAYEDRRSVNLAMELCEGGELFDRIIARGHYTERAAAALCREIVAVV  120

Query  563  HYCHSMGVMHRDLKPENFLFLSS  631
            H CHSMGV HRDLKPENFLFL++
Sbjct  121  HSCHSMGVFHRDLKPENFLFLNN  143



>ref|XP_009385897.1| PREDICTED: calcium-dependent protein kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=506

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +2

Query  191  LGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRRE  370
            L RPMEDVH+TY FG ELGRGQFGVT+L+T+R + E LACKSIATRKL ++DD++DVRRE
Sbjct  43   LRRPMEDVHATYSFGRELGRGQFGVTHLITNRASGEVLACKSIATRKLTNRDDLEDVRRE  102

Query  371  VQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQM  550
            VQIMHHLTGHRNIVEL+G +EDR  V+LVMELC GGELFDRII++GHYSERAAA LCR++
Sbjct  103  VQIMHHLTGHRNIVELRGAFEDRRSVNLVMELCEGGELFDRIISRGHYSERAAAALCREI  162

Query  551  VTVLHYCHSMGVMHRDLKPENFLFLS  628
            V V+H CHSMGVMHRDLKPENFLFL+
Sbjct  163  VNVVHCCHSMGVMHRDLKPENFLFLN  188



>ref|XP_008449648.1| PREDICTED: calcium-dependent protein kinase 34-like [Cucumis 
melo]
Length=535

 Score =   247 bits (630),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            S +G VLGRPMEDV STY  G ELGRGQFGVT+L TH+ + E+LACK+IA RKL++K+D+
Sbjct  64   SQIGTVLGRPMEDVRSTYSIGKELGRGQFGVTHLCTHKASGEQLACKTIAKRKLVNKEDI  123

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +DVRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  124  EDVRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAA  183

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             L R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  184  SLLRTIVQIVHTCHSMGVIHRDLKPENFLLLSKD  217



>ref|XP_009419685.1| PREDICTED: calcium-dependent protein kinase 34-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   246 bits (628),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 148/206 (72%), Gaps = 7/206 (3%)
 Frame = +2

Query  38   MGSC-NSIPSSPFAATSAG-GESDPPPPKNDITVLppsqpppprpFL-----SGVGRVLG  196
            MG+C    P++P  A   G   +DP P            P P   F      + +G VLG
Sbjct  1    MGNCFTKNPTNPAPAEGEGEAGADPVPSSAPDDAPVQKAPIPTAAFTPPPKPTAIGPVLG  60

Query  197  RPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQ  376
            RPMEDV +TY  G ELGRGQFGVT+L TH+ T E+LACK+IA RKL +K+D++DVRREVQ
Sbjct  61   RPMEDVRTTYSLGKELGRGQFGVTHLCTHKATGEKLACKTIAKRKLTNKEDIEDVRREVQ  120

Query  377  IMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVT  556
            IM+HL+G  NIVELKG YED+  VHLVMELCAGGELFDRIIA+GHY+ERAAA L R +V 
Sbjct  121  IMYHLSGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIARGHYTERAAASLLRTIVQ  180

Query  557  VLHYCHSMGVMHRDLKPENFLFLSSD  634
            ++H CHSMGVMHRDLKPENFL LS D
Sbjct  181  IVHTCHSMGVMHRDLKPENFLLLSKD  206



>gb|EPS70504.1| calcium dependent protein kinase 25 [Genlisea aurea]
Length=527

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV +TY  G ELGRGQFGVTYL TH++T E+ ACK+IA RKL +K+D++D
Sbjct  54   IGPVLGRPMEDVRATYTIGKELGRGQFGVTYLCTHKQTGEKFACKTIAKRKLANKEDIED  113

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHL+G +NIVELKG YED++ VHL+MELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  114  VRREVQIMHHLSGQQNIVELKGAYEDKHSVHLIMELCAGGELFDRIIAKGHYTERAAASL  173

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  174  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  205



>ref|XP_002526062.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF36339.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=536

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 150/217 (69%), Gaps = 18/217 (8%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGE------------------SDPPPPKNDITVLppsqppppr  163
            MG+C S   S  AA +  GE                  S  PPPK+     P     P  
Sbjct  1    MGNCCSRGDSGDAAENEKGEAVANNTNGSVANNANQENSTTPPPKSTAPTSPSPAASPKP  60

Query  164  pFLSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSK  343
               + +G VLGRPME+V S Y  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K
Sbjct  61   AKAAPIGPVLGRPMEEVKSVYTIGKELGRGQFGVTHLCTHKATGEQFACKTIAKRKLVNK  120

Query  344  DDVDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSER  523
            +DV+DV+REVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ER
Sbjct  121  EDVEDVKREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTER  180

Query  524  AAAGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            AAA L R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  181  AAASLLRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  217



>ref|XP_004140192.1| PREDICTED: calcium-dependent protein kinase 34 [Cucumis sativus]
 gb|KGN48093.1| hypothetical protein Csa_6G430690 [Cucumis sativus]
Length=535

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            S +G VLGRPMEDV STY  G ELGRGQFGVT+L TH+ + E LACK+IA RKL++K+D+
Sbjct  64   SQIGTVLGRPMEDVRSTYSIGKELGRGQFGVTHLCTHKASGEHLACKTIAKRKLVNKEDI  123

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +DVRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  124  EDVRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAA  183

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             L R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  184  SLLRTIVQIVHTCHSMGVIHRDLKPENFLLLSKD  217



>ref|XP_009402456.1| PREDICTED: calcium-dependent protein kinase 17-like [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 152/207 (73%), Gaps = 8/207 (4%)
 Frame = +2

Query  38   MGSC----NSIPSSPFAATSAGGESDPPPPKNDITV----LppsqpppprpFLSGVGRVL  193
            MG+C     + P++P  A +     DP P  +D  V    +P +   PP    + +G VL
Sbjct  1    MGNCFTKKPADPATPTDADTPAHAPDPSPAPDDAPVQTAPVPTAAFSPPPKPAAPIGPVL  60

Query  194  GRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREV  373
            GRPMEDV +TY  G ELGRGQFGVT+L TH+ T ++ ACK+IA RKL +K+D++DVRREV
Sbjct  61   GRPMEDVRTTYSLGKELGRGQFGVTHLCTHKATGDKYACKTIAKRKLANKEDIEDVRREV  120

Query  374  QIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMV  553
            QIM+HL+G  NIVELKG +ED+  VHLVMELCAGGELFDRIIA+GHY+ERAAA L R +V
Sbjct  121  QIMYHLSGQPNIVELKGAFEDKQSVHLVMELCAGGELFDRIIARGHYTERAAASLLRTIV  180

Query  554  TVLHYCHSMGVMHRDLKPENFLFLSSD  634
             ++H CHSMGVMHRDLKPENFL L+ D
Sbjct  181  QIVHTCHSMGVMHRDLKPENFLLLNKD  207



>ref|XP_006349794.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X1 
[Solanum tuberosum]
 ref|XP_006349795.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Solanum tuberosum]
 ref|XP_006349796.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X3 
[Solanum tuberosum]
 ref|XP_010314698.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Solanum lycopersicum]
 ref|XP_010314699.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Solanum lycopersicum]
Length=500

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMED+ +TY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL++K+D++D
Sbjct  28   IGPVLGRPMEDIKATYTLGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED  87

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLT   NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  88   VRREVQIMHHLTEQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  147

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  148  LRTIVQIVHTCHSMGVIHRDLKPENFLLLSKD  179



>gb|EYU46187.1| hypothetical protein MIMGU_mgv1a004352mg [Erythranthe guttata]
Length=531

 Score =   244 bits (623),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            VG VLGRPMEDV STY  G ELGRGQFGVT+L TH+++ E+ ACK+IA RKL +K+D++D
Sbjct  58   VGPVLGRPMEDVRSTYTMGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED  117

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  118  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  177

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  178  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  209



>ref|XP_009773532.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana 
sylvestris]
Length=542

 Score =   244 bits (623),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL++K+D++D
Sbjct  69   IGPVLGRPMEDVRTTYTIGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED  128

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  129  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  188

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  189  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  220



>ref|XP_006644382.1| PREDICTED: calcium-dependent protein kinase 3-like isoform X1 
[Oryza brachyantha]
 ref|XP_006644383.1| PREDICTED: calcium-dependent protein kinase 3-like isoform X2 
[Oryza brachyantha]
Length=460

 Score =   242 bits (618),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  203  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  382
            MEDV +TY FG ELGRGQFGVTYLVTH+ + +R ACKSIATRKL+ +DD++DVRREVQIM
Sbjct  1    MEDVRATYTFGRELGRGQFGVTYLVTHKASGKRFACKSIATRKLVHRDDIEDVRREVQIM  60

Query  383  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVL  562
            +HLTGHRNIVEL+G YEDR+ V+L+MELC GGELFDRIIA+GHY+ERAAA LCR++V V+
Sbjct  61   YHLTGHRNIVELRGAYEDRHSVNLIMELCEGGELFDRIIARGHYTERAAAALCREIVAVV  120

Query  563  HYCHSMGVMHRDLKPENFLFLS  628
            H CHSMGV HRDLKPENFLFLS
Sbjct  121  HSCHSMGVFHRDLKPENFLFLS  142



>ref|XP_004252886.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X1 
[Solanum lycopersicum]
Length=535

 Score =   244 bits (623),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMED+ +TY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL++K+D++D
Sbjct  63   IGPVLGRPMEDIKATYTLGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED  122

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLT   NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  123  VRREVQIMHHLTEQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  182

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  183  LRTIVQIVHTCHSMGVIHRDLKPENFLLLSKD  214



>ref|XP_009627412.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana 
tomentosiformis]
Length=541

 Score =   244 bits (623),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL++K+D++D
Sbjct  68   IGPVLGRPMEDVRTTYTIGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED  127

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  128  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  187

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  188  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  219



>ref|XP_009789543.1| PREDICTED: calcium-dependent protein kinase 34-like [Nicotiana 
sylvestris]
Length=532

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMED+ +TY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL++K+D++D
Sbjct  60   IGPVLGRPMEDIKATYTLGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED  119

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLT   NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  120  VRREVQIMHHLTEQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  179

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  180  LRTIVQIVHTCHSMGVIHRDLKPENFLLLSKD  211



>ref|XP_010536137.1| PREDICTED: calcium-dependent protein kinase 17 [Tarenaya hassleriana]
Length=521

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 142/192 (74%), Gaps = 13/192 (7%)
 Frame = +2

Query  59   PSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIFGG  238
            P++P   ++A  +  PP P   I                 +G VLGRPMED+ +++  G 
Sbjct  24   PTNPAETSAAASKHAPPSPPPAIK-------------QGPIGPVLGRPMEDIKASFSLGK  70

Query  239  ELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNIVEL  418
            ELGRGQFGVT+L TH+ T  + ACK+IA RKL++K+D++DVRREVQIMHHLTG  NIVEL
Sbjct  71   ELGRGQFGVTHLCTHKATGHQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTGQPNIVEL  130

Query  419  KGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHSMGVMHRD  598
            KG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L R +V ++H CHSMGV+HRD
Sbjct  131  KGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASLLRTIVQIVHTCHSMGVIHRD  190

Query  599  LKPENFLFLSSD  634
            LKPENFL L+ D
Sbjct  191  LKPENFLLLNKD  202



>ref|XP_009630031.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana 
tomentosiformis]
Length=536

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            S +G VLGRPMEDV  TY  G ELGRGQFGVT+L TH+++ E+ ACK+IA RKL++K+D+
Sbjct  62   SPIGPVLGRPMEDVRKTYSIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLVNKEDI  121

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +DV+REVQIMHHLTG +NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  122  EDVKREVQIMHHLTGQQNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAA  181

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             L R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  182  TLLRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  215



>gb|KDO36585.1| hypothetical protein CISIN_1g042977mg, partial [Citrus sinensis]
Length=471

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +2

Query  188  VLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRR  367
            VLGRPMEDV +TY FG ELGRGQFG+T+L TH+ T ++ ACK+IA RKL++K+D++DVRR
Sbjct  69   VLGRPMEDVKATYSFGKELGRGQFGITHLCTHKGTGQQFACKTIAKRKLVNKEDIEDVRR  128

Query  368  EVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQ  547
            EVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA L R 
Sbjct  129  EVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRT  188

Query  548  MVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  189  IVQIIHTCHSMGVIHRDLKPENFLLLNKD  217



>ref|XP_003567831.1| PREDICTED: calcium-dependent protein kinase 3-like [Brachypodium 
distachyon]
Length=548

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
             GRVLGRP+ DV +TY FG ELGRGQFGVTYL TH+ T  R ACKSI+ RKL   DD DD
Sbjct  81   TGRVLGRPLSDVRATYTFGRELGRGQFGVTYLATHKSTGARYACKSISARKLSRGDDADD  140

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTGHR+IVELKG +EDR+ V+LVMELC GGELFDRIIA+GHYSE AAA +
Sbjct  141  VRREVQIMHHLTGHRSIVELKGAHEDRHSVNLVMELCEGGELFDRIIARGHYSESAAAAV  200

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLS  628
            CR++V V+H CHSMGVMHRDLKPENFLFL+
Sbjct  201  CREVVNVVHCCHSMGVMHRDLKPENFLFLN  230



>ref|XP_004293141.1| PREDICTED: calcium-dependent protein kinase 34 [Fragaria vesca 
subsp. vesca]
Length=531

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV STY  G ELGRGQFGVT+L TH++T E  ACK+IA RKL++K+D++D
Sbjct  61   IGPVLGRPMEDVRSTYSIGKELGRGQFGVTHLCTHKQTGEHFACKTIAKRKLVNKEDIED  120

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRII+KGHY+ERAAA L
Sbjct  121  VRREVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIISKGHYTERAAAAL  180

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  181  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  212



>ref|XP_006361005.1| PREDICTED: calcium-dependent protein kinase 17-like [Solanum 
tuberosum]
Length=544

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L T ++T E+ ACK+IA RKL++K+D++D
Sbjct  71   IGLVLGRPMEDVRTTYTIGKELGRGQFGVTHLCTQKQTSEQFACKTIAKRKLVNKEDIED  130

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIV+LKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  131  VRREVQIMHHLTGQENIVQLKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  190

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  191  LRTIVQIVHTCHSMGVIHRDLKPENFLLLSKD  222



>ref|XP_009603797.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana 
tomentosiformis]
Length=536

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMED+ +TY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL++K+D++D
Sbjct  64   IGPVLGRPMEDIKATYTLGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED  123

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLT   NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  124  VRREVQIMHHLTEQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  183

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  184  LRTIVQIVHTCHSMGVIHRDLKPENFLLLSKD  215



>ref|XP_010519814.1| PREDICTED: calcium-dependent protein kinase 34 isoform X2 [Tarenaya 
hassleriana]
Length=526

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 143/198 (72%), Gaps = 11/198 (6%)
 Frame = +2

Query  41   GSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHS  220
            G+  +  S+P A TSA   S   PP                     +G VLGRPMEDV +
Sbjct  21   GNGATAQSNPAAETSAAPASKHAPPSPPPATKQ-----------GPIGPVLGRPMEDVKA  69

Query  221  TYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGH  400
            +Y  G ELGRGQFGVT+L TH+ T  + ACK+IA RKL++K+D++DVRREVQIMHHLTG 
Sbjct  70   SYSLGKELGRGQFGVTHLCTHKATGHQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTGQ  129

Query  401  RNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHSM  580
             NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L R +V ++H CHSM
Sbjct  130  PNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASLLRTIVQIVHTCHSM  189

Query  581  GVMHRDLKPENFLFLSSD  634
            GV+HRDLKPENFL L+ D
Sbjct  190  GVIHRDLKPENFLLLNKD  207



>ref|XP_009368734.1| PREDICTED: calcium-dependent protein kinase 17-like [Pyrus x 
bretschneideri]
Length=534

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K+D++D
Sbjct  65   IGPVLGRPMEDVRTTYSIGKELGRGQFGVTHLCTHKATGEQFACKTIAKRKLVNKEDIED  124

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG +NIVELKG YED+  VHLVMELCAGGELFDRII+KGHY+ERAAA L
Sbjct  125  VRREVQIMHHLTGQQNIVELKGAYEDKQSVHLVMELCAGGELFDRIISKGHYTERAAAAL  184

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CH+MGV+HRDLKPENFL L+ D
Sbjct  185  LRTIVQIVHTCHTMGVIHRDLKPENFLLLNKD  216



>ref|XP_008365176.1| PREDICTED: calcium-dependent protein kinase 17-like [Malus domestica]
Length=533

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDVH+TY  G ELGRGQFGVT+L TH+   E+ ACK+IA RKL++K+D++D
Sbjct  63   IGPVLGRPMEDVHTTYSIGKELGRGQFGVTHLCTHKAXGEQFACKTIAKRKLVNKEDIED  122

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRII+KGHY+ERAAA L
Sbjct  123  VRREVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIISKGHYTERAAAAL  182

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  183  LRTIVQIVHTCHSMGVIHRDLKPENFLMLNKD  214



>ref|XP_004980140.1| PREDICTED: calcium-dependent protein kinase 17-like [Setaria 
italica]
Length=538

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            VG VLGRPMEDV +TY  G ELGRGQFGVT+L THR T E+LACK+IA RKL SK+DVDD
Sbjct  66   VGPVLGRPMEDVRTTYSMGKELGRGQFGVTHLCTHRATGEKLACKTIAKRKLASKEDVDD  125

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHL+G  N+V L+G YED+++VHLVMELCAGGELFDRIIA+G Y+ERAAA L
Sbjct  126  VRREVQIMHHLSGQPNVVGLRGAYEDKHNVHLVMELCAGGELFDRIIARGQYTERAAASL  185

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGVMHRD+KPENFL LS D
Sbjct  186  LRTIVEIVHSCHSMGVMHRDIKPENFLLLSKD  217



>emb|CAG27840.1| calcium-dependent protein kinase 17 [Nicotiana plumbaginifolia]
Length=534

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            S +G VLGRPMEDV  TY  G ELGRGQFG+T+L TH+++ E+ ACK+IA RKL++K+D+
Sbjct  60   SPIGPVLGRPMEDVRKTYSIGKELGRGQFGITHLCTHKQSGEQFACKTIAKRKLVNKEDI  119

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +DV+REVQIMHHLTG +NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  120  EDVKREVQIMHHLTGQQNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAA  179

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             L R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  180  TLLRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  213



>emb|CDP20327.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            VG VLGRPMEDV S Y  G ELGRGQFGVT+L T+++T E+ ACK+IA RKL++K+D++D
Sbjct  58   VGPVLGRPMEDVRSLYTIGKELGRGQFGVTHLCTNKQTGEQFACKTIAKRKLVNKEDIED  117

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  118  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  177

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  178  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  209



>ref|XP_001771902.1| predicted protein [Physcomitrella patens]
 gb|EDQ63331.1| predicted protein [Physcomitrella patens]
Length=482

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = +2

Query  170  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  349
            +S VG VLG+P+ D+  TY  G ELGRGQFGVTYL TH++T E+LACKSIA RKL++K+D
Sbjct  9    VSNVG-VLGKPLVDIRQTYSLGKELGRGQFGVTYLCTHKETGEKLACKSIAKRKLIAKED  67

Query  350  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  529
            ++DV+REVQIMHHL+G  NIV+LKG YEDR+ VHLVMELCAGGELFDRIIAKGHYSERAA
Sbjct  68   IEDVKREVQIMHHLSGTPNIVDLKGVYEDRHSVHLVMELCAGGELFDRIIAKGHYSERAA  127

Query  530  AGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            A LCR +V V+H CHS+GV HRDLKPENFLF S D
Sbjct  128  ADLCRVIVNVVHRCHSLGVFHRDLKPENFLFASKD  162



>ref|XP_010519813.1| PREDICTED: calcium-dependent protein kinase 34 isoform X1 [Tarenaya 
hassleriana]
Length=562

 Score =   243 bits (620),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 143/198 (72%), Gaps = 11/198 (6%)
 Frame = +2

Query  41   GSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHS  220
            G+  +  S+P A TSA   S   PP                     +G VLGRPMEDV +
Sbjct  21   GNGATAQSNPAAETSAAPASKHAPPSPPPATKQ-----------GPIGPVLGRPMEDVKA  69

Query  221  TYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGH  400
            +Y  G ELGRGQFGVT+L TH+ T  + ACK+IA RKL++K+D++DVRREVQIMHHLTG 
Sbjct  70   SYSLGKELGRGQFGVTHLCTHKATGHQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTGQ  129

Query  401  RNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHSM  580
             NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L R +V ++H CHSM
Sbjct  130  PNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASLLRTIVQIVHTCHSM  189

Query  581  GVMHRDLKPENFLFLSSD  634
            GV+HRDLKPENFL L+ D
Sbjct  190  GVIHRDLKPENFLLLNKD  207



>emb|CDX97174.1| BnaC09g44510D [Brassica napus]
 emb|CDX69700.1| BnaA10g20490D [Brassica napus]
Length=522

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  52   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  111

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  112  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  171

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  172  LRTIVQIVHTCHSMGVIHRDLKPENFLLLSKD  203



>ref|XP_009796949.1| PREDICTED: calcium-dependent protein kinase 34-like [Nicotiana 
sylvestris]
Length=537

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV  TY  G ELGRGQFGVT+L TH+++ E+ ACK+IA RKL++K+D++D
Sbjct  65   IGPVLGRPMEDVRKTYSIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLVNKEDIED  124

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            V+REVQIMHHLTG +NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  125  VKREVQIMHHLTGQQNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAATL  184

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  185  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  216



>ref|XP_009121874.1| PREDICTED: calcium-dependent protein kinase 17 [Brassica rapa]
Length=522

 Score =   242 bits (617),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  52   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  111

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  112  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  171

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  172  LRTIVQIVHTCHSMGVIHRDLKPENFLLLSKD  203



>gb|EYU35947.1| hypothetical protein MIMGU_mgv1a004350mg [Erythranthe guttata]
Length=532

 Score =   242 bits (617),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMED+ +TY  G ELGRGQFGVT+L TH+++ E+ ACK+IA RKL +K+D++D
Sbjct  59   MGPVLGRPMEDIRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED  118

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  119  VRREVQIMHHLTGQANIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  178

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  179  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  210



>gb|KJB21813.1| hypothetical protein B456_004G015100 [Gossypium raimondii]
Length=538

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 138/192 (72%), Gaps = 18/192 (9%)
 Frame = +2

Query  59   PSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIFGG  238
            P+ P A+ S      P P  N I                  G VL RPMEDV +TY  G 
Sbjct  42   PTQPPASPSEEASPKPTPKPNPI------------------GTVLCRPMEDVRNTYTIGK  83

Query  239  ELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNIVEL  418
            ELGRGQFGVTYL TH+ T E+ ACK+IA RKL++K+D++DVRREVQIMHHLTG  N+VEL
Sbjct  84   ELGRGQFGVTYLCTHKVTGEQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTGQPNVVEL  143

Query  419  KGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHSMGVMHRD  598
            KG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L R +V ++H CHSMGV HRD
Sbjct  144  KGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASLLRIIVQIVHTCHSMGVFHRD  203

Query  599  LKPENFLFLSSD  634
            LKPENFL L+ +
Sbjct  204  LKPENFLLLNKE  215



>ref|XP_009125853.1| PREDICTED: calcium-dependent protein kinase 17-like [Brassica 
rapa]
Length=522

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  52   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  111

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHH+TG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  112  VRREVQIMHHMTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  171

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  172  LRTIVQIIHTCHSMGVIHRDLKPENFLLLSKD  203



>ref|XP_004228884.1| PREDICTED: calcium-dependent protein kinase 34-like [Solanum 
lycopersicum]
Length=541

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV STY  G ELGRGQFGVT+L T ++T E+ ACK+IA RKL+SK+D++D
Sbjct  68   IGLVLGRPMEDVRSTYTIGKELGRGQFGVTHLCTQKQTNEQYACKTIAKRKLVSKEDIED  127

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIV+LKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  128  VRREVQIMHHLTGQENIVQLKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  187

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++  CHSMGV+HRDLKPENFL LS D
Sbjct  188  LRTIVQIVDTCHSMGVIHRDLKPENFLLLSKD  219



>ref|XP_004978350.1| PREDICTED: calcium-dependent protein kinase 17-like [Setaria 
italica]
Length=541

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            VG VLGRPMEDV +TY  G ELGRGQFGVT+L THR T E+LACK+IA RKL SK+DVDD
Sbjct  69   VGPVLGRPMEDVRTTYSMGKELGRGQFGVTHLCTHRATGEKLACKTIAKRKLASKEDVDD  128

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHL+G  N+V L+G YED+++VHLVMELCAGGELFDRIIA+G Y+ERAAA L
Sbjct  129  VRREVQIMHHLSGQPNVVGLRGAYEDKHNVHLVMELCAGGELFDRIIARGQYTERAAASL  188

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGVMHRD+KPENFL LS D
Sbjct  189  LRTIVEIVHSCHSMGVMHRDIKPENFLLLSKD  220



>ref|XP_011080420.1| PREDICTED: calcium-dependent protein kinase 34-like [Sesamum 
indicum]
Length=532

 Score =   241 bits (616),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            VG VLGRPMEDV STY  G ELGRGQFGVT+L TH++T E+ ACK+IA RKL +K+D++D
Sbjct  59   VGPVLGRPMEDVRSTYTMGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLANKEDIED  118

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  N+VELKG +ED++ VHLVMELCAGGELFDRIIA+GHY+ERAAA L
Sbjct  119  VRREVQIMHHLTGQPNVVELKGAFEDKHSVHLVMELCAGGELFDRIIARGHYTERAAASL  178

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  179  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  210



>ref|XP_006470577.1| PREDICTED: calcium-dependent protein kinase 17-like [Citrus sinensis]
Length=534

 Score =   241 bits (616),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +2

Query  188  VLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRR  367
            VLGRPMEDV +TY FG ELGRGQFG+T+L TH+ T ++ ACK+IA RKL++K+D++DVRR
Sbjct  69   VLGRPMEDVKATYSFGKELGRGQFGITHLCTHKGTGQQFACKTIAKRKLVNKEDIEDVRR  128

Query  368  EVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQ  547
            EVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA L R 
Sbjct  129  EVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRT  188

Query  548  MVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  189  IVQIIHTCHSMGVIHRDLKPENFLLLNKD  217



>ref|XP_007015253.1| Calcium-dependent protein kinase 17 [Theobroma cacao]
 gb|EOY32872.1| Calcium-dependent protein kinase 17 [Theobroma cacao]
Length=535

 Score =   241 bits (616),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMED+ STY  G ELGRGQFGVT+L T++ T E+ ACK+IA RKL++K+D++D
Sbjct  66   IGPVLGRPMEDIKSTYTIGKELGRGQFGVTHLCTNKATGEQFACKTIAKRKLVNKEDIED  125

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  126  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  185

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  186  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  217



>ref|XP_009412989.1| PREDICTED: calcium-dependent protein kinase 17-like [Musa acuminata 
subsp. malaccensis]
Length=523

 Score =   241 bits (615),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            + +G VLGRPMEDV +TY  G ELGRGQFGVT+L TH+ T E+LACK+IA RKL +K+D+
Sbjct  52   AAIGPVLGRPMEDVGATYSLGKELGRGQFGVTHLCTHKATDEKLACKTIAKRKLANKEDI  111

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +DVRREVQIM+HL G  NIVELKG YED+  VHLVMELCAGGELFDR+IA+GHY+ERAAA
Sbjct  112  EDVRREVQIMYHLAGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRVIARGHYTERAAA  171

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             L R +V ++H CHSMGVMHRDLKPENFL L+ D
Sbjct  172  SLLRTIVEIVHTCHSMGVMHRDLKPENFLLLNKD  205



>ref|XP_006446309.1| hypothetical protein CICLE_v10014854mg [Citrus clementina]
 gb|ESR59549.1| hypothetical protein CICLE_v10014854mg [Citrus clementina]
Length=534

 Score =   241 bits (616),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +2

Query  188  VLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRR  367
            VLGRPMEDV +TY FG ELGRGQFG+T+L TH+ T ++ ACK+IA RKL++K+D++DVRR
Sbjct  69   VLGRPMEDVKATYSFGKELGRGQFGITHLCTHKGTGQQFACKTIAKRKLVNKEDIEDVRR  128

Query  368  EVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQ  547
            EVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA L R 
Sbjct  129  EVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRT  188

Query  548  MVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  189  IVQIIHTCHSMGVIHRDLKPENFLLLNKD  217



>gb|AFW82380.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
Length=220

 Score =   232 bits (591),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV +TY  G ELGRGQFGVT L TH+ T  R ACK+I+ RKL +K+DV+D
Sbjct  50   IGPVLGRPMEDVRATYAVGKELGRGQFGVTSLCTHKATGHRFACKTISKRKLSTKEDVED  109

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIM+HL+G   +VELKG YED+  VHLVMELCAGGELFDRIIA+GHY+ERAAA L
Sbjct  110  VRREVQIMYHLSGQPGVVELKGAYEDKGSVHLVMELCAGGELFDRIIARGHYTERAAASL  169

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  170  LRTIVEIVHTCHSMGVIHRDLKPENFLLLSKD  201



>gb|KJB09335.1| hypothetical protein B456_001G135000 [Gossypium raimondii]
Length=513

 Score =   241 bits (614),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 145/205 (71%), Gaps = 16/205 (8%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPP------PPKNDITVLppsqpppprpFLSGVGRVLGR  199
            MG+C S   SP A  +   + D P      PP    +                +G VLGR
Sbjct  1    MGNCCS-RGSPAAEDANDDKGDAPKQAEGSPPSGGAS---------SNSMSDSIGNVLGR  50

Query  200  PMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQI  379
            PMED+ +TY  G ELGRGQFGVT+L TH+ T E+ ACK+I  RKL +K+D++DV+R+VQI
Sbjct  51   PMEDIKATYTIGKELGRGQFGVTHLCTHKTTGEQFACKTITKRKLSTKEDIEDVKRDVQI  110

Query  380  MHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTV  559
            MHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L R +V +
Sbjct  111  MHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASLLRTIVQI  170

Query  560  LHYCHSMGVMHRDLKPENFLFLSSD  634
            +H CHSMGV+HRDLKPENFL L++D
Sbjct  171  VHTCHSMGVIHRDLKPENFLLLNND  195



>ref|XP_006356386.1| PREDICTED: calcium-dependent protein kinase 17-like [Solanum 
tuberosum]
Length=524

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            S +G VLGRPMEDV  TY  G ELGRGQFGVT+L TH++  E+ ACK+IA RKL++K+D+
Sbjct  50   SPIGLVLGRPMEDVRKTYSIGKELGRGQFGVTHLCTHKQNGEQFACKTIAKRKLVNKEDI  109

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +DV+REVQIMHHLTG +NIVELKG YED++ VHLVMELCAGGELFDRII KGHY+ERAAA
Sbjct  110  EDVKREVQIMHHLTGQQNIVELKGAYEDKHSVHLVMELCAGGELFDRIITKGHYTERAAA  169

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             L R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  170  TLLRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  203



>ref|XP_006289327.1| hypothetical protein CARUB_v10002812mg [Capsella rubella]
 gb|EOA22225.1| hypothetical protein CARUB_v10002812mg [Capsella rubella]
Length=530

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  60   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  119

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  120  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  179

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  180  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  211



>ref|XP_010106395.1| Calcium-dependent protein kinase 17 [Morus notabilis]
 gb|EXC10389.1| Calcium-dependent protein kinase 17 [Morus notabilis]
Length=538

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV STY  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K+D++D
Sbjct  68   IGTVLGRPMEDVRSTYNIGKELGRGQFGVTHLCTHKVTGEQFACKTIAKRKLVNKEDIED  127

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  128  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  187

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ +
Sbjct  188  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKN  219



>ref|XP_006845045.1| PREDICTED: calcium-dependent protein kinase 17 [Amborella trichopoda]
 gb|ERN06720.1| hypothetical protein AMTR_s00269p00011940 [Amborella trichopoda]
Length=517

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV +TYI G ELGRGQFG+T+L TH+ T +  ACK+IA RKL++K+D++D
Sbjct  49   IGPVLGRPMEDVRATYIMGKELGRGQFGITHLCTHKATGQPFACKTIAKRKLVNKEDIED  108

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIM+HLTG  NIVELKG +ED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  109  VRREVQIMYHLTGQPNIVELKGAFEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAAAL  168

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  169  MRTIVQIVHTCHSMGVVHRDLKPENFLLLSKD  200



>ref|XP_010247475.1| PREDICTED: calcium-dependent protein kinase 34 [Nelumbo nucifera]
Length=521

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            S +G VLGRPMED+ + Y  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K+D+
Sbjct  50   SQIGTVLGRPMEDIKTVYTIGKELGRGQFGVTHLCTHKVTGEQFACKTIAKRKLVNKEDI  109

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +DVRREVQIMHHL G  NIVELKG YED++ VHLVMELCAGGELFD+IIAKGHYSERAAA
Sbjct  110  EDVRREVQIMHHLAGQPNIVELKGAYEDKHSVHLVMELCAGGELFDKIIAKGHYSERAAA  169

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             L R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  170  SLLRTIVQIVHTCHSMGVVHRDLKPENFLLLSKD  203



>emb|CDX78468.1| BnaA03g03800D [Brassica napus]
Length=523

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV ++Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  53   IGPVLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  112

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHH+TG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  113  VRREVQIMHHMTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  172

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  173  LRTIVQIIHTCHSMGVIHRDLKPENFLLLSKD  204



>gb|AHG06449.1| calcium-dependent protein kinase 17 [Brassica napus]
Length=523

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV ++Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  53   IGPVLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  112

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHH+TG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  113  VRREVQIMHHMTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  172

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  173  LRTIVQIIHTCHSMGVIHRDLKPENFLLLSKD  204



>ref|NP_197437.1| calcium-dependent protein kinase 34 [Arabidopsis thaliana]
 sp|Q3E9C0.1|CDPKY_ARATH RecName: Full=Calcium-dependent protein kinase 34 [Arabidopsis 
thaliana]
 gb|ABE66169.1| calcium-dependent protein kinase/CDPK [Arabidopsis thaliana]
 gb|AED92691.1| calcium-dependent protein kinase 34 [Arabidopsis thaliana]
Length=523

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  53   IGPVLGRPMEDVKSSYTLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  112

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  113  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  172

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  173  LRTIVQIIHTCHSMGVIHRDLKPENFLLLSKD  204



>ref|XP_010099802.1| Calcium-dependent protein kinase 17 [Morus notabilis]
 gb|EXB80470.1| Calcium-dependent protein kinase 17 [Morus notabilis]
Length=538

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV STY  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K+D++D
Sbjct  68   IGTVLGRPMEDVRSTYNIGKELGRGQFGVTHLCTHKVTGEQFACKTIAKRKLVNKEDIED  127

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  128  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  187

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ +
Sbjct  188  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKN  219



>emb|CDX70450.1| BnaC03g05340D [Brassica napus]
Length=523

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  53   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  112

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHH+TG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  113  VRREVQIMHHMTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  172

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  173  LRTIVQIIHTCHSMGVIHRDLKPENFLLLNKD  204



>emb|CDY13993.1| BnaC09g38330D [Brassica napus]
Length=517

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVTYL T + T  + ACK+IA RKL++K+D++D
Sbjct  45   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTYLCTQKATGLQFACKTIAKRKLVNKEDIED  104

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED+++VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  105  VRREVQIMHHLTGQPNIVELKGAYEDKHNVHLVMELCAGGELFDRIIAKGHYSERAAASL  164

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ +
Sbjct  165  LRTIVQIIHTCHSMGVIHRDLKPENFLLLNKE  196



>ref|XP_012065867.1| PREDICTED: calcium-dependent protein kinase 34 [Jatropha curcas]
Length=538

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S Y  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K+DV+D
Sbjct  68   IGPVLGRPMEDVKSVYTIGKELGRGQFGVTHLCTHKITGEQFACKTIAKRKLVNKEDVED  127

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            V+REVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  128  VKREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  187

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ +
Sbjct  188  LRTIVQIIHTCHSMGVIHRDLKPENFLLLNKE  219



>gb|KDP43197.1| hypothetical protein JCGZ_22749 [Jatropha curcas]
Length=531

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S Y  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K+DV+D
Sbjct  68   IGPVLGRPMEDVKSVYTIGKELGRGQFGVTHLCTHKITGEQFACKTIAKRKLVNKEDVED  127

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            V+REVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  128  VKREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  187

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ +
Sbjct  188  LRTIVQIIHTCHSMGVIHRDLKPENFLLLNKE  219



>gb|ABV22575.1| calcium-dependent protein kinase [Physcomitrella patens]
 gb|ABV22576.1| calcium-dependent protein kinase [Physcomitrella patens]
Length=628

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = +2

Query  170  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  349
            +S VG VLG+P+ D+  TY  G ELGRGQFGVTYL TH++T E+LACKSIA RKL++K+D
Sbjct  155  VSNVG-VLGKPLVDIRQTYSLGKELGRGQFGVTYLCTHKETGEKLACKSIAKRKLIAKED  213

Query  350  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  529
            ++DV+REVQIMHHL+G  NIV+LKG YEDR+ VHLVMELCAGGELFDRIIAKGHYSERAA
Sbjct  214  IEDVKREVQIMHHLSGTPNIVDLKGVYEDRHSVHLVMELCAGGELFDRIIAKGHYSERAA  273

Query  530  AGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            A LCR +V V+H CHS+GV HRDLKPENFLF S D
Sbjct  274  ADLCRVIVNVVHRCHSLGVFHRDLKPENFLFASKD  308



>ref|XP_009120894.1| PREDICTED: calcium-dependent protein kinase 34 [Brassica rapa]
 emb|CDX92536.1| BnaA10g15750D [Brassica napus]
Length=517

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVTYL T + T  + ACK+IA RKL++K+D++D
Sbjct  45   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTYLCTQKATGLQFACKTIAKRKLVNKEDIED  104

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED+++VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  105  VRREVQIMHHLTGQPNIVELKGAYEDKHNVHLVMELCAGGELFDRIIAKGHYSERAAASL  164

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ +
Sbjct  165  LRTIVQIIHTCHSMGVIHRDLKPENFLLLNKE  196



>gb|AAZ76712.1| calcium-dependent protein kinase 1 [Petunia integrifolia subsp. 
inflata]
Length=532

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            S +G VLGRPMEDV  TY  G ELGRGQFGVT+L TH+++ E+ ACK+IA RKL++K+D+
Sbjct  57   SPIGPVLGRPMEDVRKTYSIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLVNKEDI  116

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +DV+REVQIMHHLTG +NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  117  EDVKREVQIMHHLTGQQNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAA  176

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             L R +V + H CHSMGV+HRDLKPENFL L+ D
Sbjct  177  TLLRTIVQIGHTCHSMGVIHRDLKPENFLLLNKD  210



>ref|XP_002441304.1| hypothetical protein SORBIDRAFT_09g024100 [Sorghum bicolor]
 gb|EES19734.1| hypothetical protein SORBIDRAFT_09g024100 [Sorghum bicolor]
Length=527

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 149/204 (73%), Gaps = 9/204 (4%)
 Frame = +2

Query  41   GSCNSIPSSPFAATSAGGESDP------PPPKNDITVLppsqpppprpFLSGVGRVLGRP  202
            GS ++ P+ P   +SAG  S P      PPP +  +    +      P  + +G VLGRP
Sbjct  8    GSSSAEPALP-PDSSAGSSSRPGGSATVPPPTSVSSSATTAPTQNKPP--AAIGPVLGRP  64

Query  203  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  382
            MEDV STY  G ELGRGQFGVT L TH+ T ++ ACK+I+ RKL +K+D++DVRREVQIM
Sbjct  65   MEDVKSTYTMGKELGRGQFGVTSLCTHKATGQKFACKTISKRKLSTKEDIEDVRREVQIM  124

Query  383  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVL  562
            +HL+G   +VELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L R +V ++
Sbjct  125  YHLSGQPGVVELKGAYEDKSSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTIVEIV  184

Query  563  HYCHSMGVMHRDLKPENFLFLSSD  634
            H CHSMGV+HRDLKPENFL LS D
Sbjct  185  HTCHSMGVIHRDLKPENFLLLSKD  208



>gb|AGG35954.1| calcium-dependent protein kinase 34 [Brassica napus]
Length=484

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMED+ S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  47   IGPVLGRPMEDIKSSYTLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  106

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  107  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  166

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  167  LRTIVQIIHTCHSMGVIHRDLKPENFLLLNKD  198



>ref|XP_008227265.1| PREDICTED: calcium-dependent protein kinase 34-like [Prunus mume]
Length=534

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S Y  G ELGRGQFGVT+L TH+ T E  ACK+IA RKL++K+D++D
Sbjct  64   IGPVLGRPMEDVRSMYSIGKELGRGQFGVTHLCTHKATGEHFACKTIAKRKLVNKEDIED  123

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRII+KGHY+ERAAA L
Sbjct  124  VRREVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIISKGHYTERAAAAL  183

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  184  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  215



>ref|XP_010031714.1| PREDICTED: calcium-dependent protein kinase 34-like [Eucalyptus 
grandis]
 gb|KCW51080.1| hypothetical protein EUGRSUZ_J00686 [Eucalyptus grandis]
Length=534

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            S +G VLGRPME+V S Y  G ELGRGQFGVT+L TH++T ++ ACK+IA RKL++K+D+
Sbjct  63   SPIGPVLGRPMEEVKSMYTIGKELGRGQFGVTHLCTHKQTGQQFACKTIAKRKLVNKEDI  122

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +DVRREVQIM+HLTG  NIVELKG YED++ VHLVMELCAGGELFDRII+KGHY+ERAAA
Sbjct  123  EDVRREVQIMYHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIISKGHYTERAAA  182

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             L R +V +LH CHSMGV+HRDLKPENFL L+ D
Sbjct  183  SLLRTIVQILHTCHSMGVIHRDLKPENFLLLNKD  216



>ref|XP_010419805.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X1 
[Camelina sativa]
 ref|XP_010491975.1| PREDICTED: calcium-dependent protein kinase 17-like [Camelina 
sativa]
Length=527

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  57   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  116

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSE+AAA L
Sbjct  117  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSEKAAASL  176

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  177  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  208



>ref|XP_003622837.1| Calcium dependent protein kinase [Medicago truncatula]
 gb|KEH17263.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=534

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            + VG VL RPMEDV +TY  G ELGRGQFGVT+L TH+ T+E+ ACK+IA RKL++K+D+
Sbjct  61   AAVGPVLQRPMEDVRATYSIGKELGRGQFGVTHLCTHKVTKEQFACKTIAKRKLVNKEDI  120

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +DVRREVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  121  EDVRREVQIMHHLTGQANIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAA  180

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             L R +V ++H  HSMGV+HRDLKPENFL L+ D
Sbjct  181  SLMRTIVQIIHTLHSMGVIHRDLKPENFLLLNKD  214



>gb|ADE76782.1| unknown [Picea sitchensis]
Length=256

 Score =   231 bits (590),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 124/151 (82%), Gaps = 0/151 (0%)
 Frame = +2

Query  182  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  361
            GR+LGRP+EDV S Y  G ELGRGQFGVTY+ THR+T ++ ACKSIA RKL   DD++ V
Sbjct  62   GRILGRPLEDVRSQYSIGKELGRGQFGVTYICTHRQTLQKYACKSIAIRKLKRNDDIEKV  121

Query  362  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  541
            R EV+IM HLTG  NIVE KG YEDR  V+LVMELCAGGELF+RIIAKGHYSERAAA L 
Sbjct  122  RMEVKIMQHLTGKPNIVEFKGAYEDRRSVNLVMELCAGGELFERIIAKGHYSERAAASLF  181

Query  542  RQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            R +V V+H CHSMGV+HRDLKPENFLF+S D
Sbjct  182  RTIVKVVHTCHSMGVLHRDLKPENFLFVSKD  212



>ref|XP_007213195.1| hypothetical protein PRUPE_ppa026653mg [Prunus persica]
 gb|EMJ14394.1| hypothetical protein PRUPE_ppa026653mg [Prunus persica]
Length=534

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S Y  G ELGRGQFGVT+L TH+ T E  ACK+IA RKL++K+D++D
Sbjct  64   IGPVLGRPMEDVRSMYSIGKELGRGQFGVTHLCTHKATGEHFACKTIAKRKLVNKEDIED  123

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRII+KGHY+ERAAA L
Sbjct  124  VRREVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIISKGHYTERAAAAL  183

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  184  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  215



>ref|XP_010453282.1| PREDICTED: calcium-dependent protein kinase 17 [Camelina sativa]
Length=530

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  60   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  119

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSE+AAA L
Sbjct  120  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSEKAAASL  179

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  180  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  211



>gb|KFK26202.1| hypothetical protein AALP_AA8G215800 [Arabis alpina]
Length=523

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  53   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  112

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED+++VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  113  VRREVQIMHHLTGQPNIVELKGAYEDKHNVHLVMELCAGGELFDRIIAKGHYSERAAASL  172

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  173  LRTIVQIIHTCHSMGVIHRDLKPENFLLLNKD  204



>ref|XP_003617233.1| Calcium dependent protein kinase [Medicago truncatula]
 gb|AET00192.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=523

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            S +G VLGRPMEDV +TY  G ELGRGQFGVT+L TH+ T ++ ACK+IA RKL +K+D+
Sbjct  51   SAIGPVLGRPMEDVKATYSMGKELGRGQFGVTHLCTHKTTGKQYACKTIAKRKLANKEDI  110

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +DVRREVQIMHHLTG  NIVEL G +ED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  111  EDVRREVQIMHHLTGQPNIVELIGAFEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAA  170

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             L R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  171  SLLRTIVQIVHTCHSMGVIHRDLKPENFLLLSKD  204



>gb|KJB55472.1| hypothetical protein B456_009G078000 [Gossypium raimondii]
Length=532

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMED+ +TY  G ELGRGQFGVT+L T++ T E+ ACK+IA RKL +K+D++D
Sbjct  60   IGPVLGRPMEDIKTTYNIGKELGRGQFGVTHLCTNKSTGEQFACKTIAKRKLANKEDIED  119

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG +ED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  120  VRREVQIMHHLTGQSNIVELKGAFEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  179

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  180  LRTVVQIVHTCHSMGVIHRDLKPENFLLLNKD  211



>emb|CDY63783.1| BnaCnng42690D [Brassica napus]
Length=517

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMED+ S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  47   IGPVLGRPMEDIKSSYTLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  106

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  107  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  166

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  167  LRTIVQIIHTCHSMGVIHRDLKPENFLLLNKD  198



>ref|XP_002873943.1| calcium-dependent protein kinase 34 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50202.1| calcium-dependent protein kinase 34 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   239 bits (610),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  55   IGPVLGRPMEDVKSSYTLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  114

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  115  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  174

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  175  LRTIVQIIHTCHSMGVIHRDLKPENFLLLNKD  206



>ref|XP_006399734.1| hypothetical protein EUTSA_v10013236mg [Eutrema salsugineum]
 gb|ESQ41187.1| hypothetical protein EUTSA_v10013236mg [Eutrema salsugineum]
Length=528

 Score =   239 bits (610),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV ++Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  58   IGPVLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  117

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  118  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  177

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  178  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  209



>ref|XP_004250895.1| PREDICTED: calcium-dependent protein kinase 17-like [Solanum 
lycopersicum]
Length=529

 Score =   239 bits (610),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV  TY  G ELGRGQFGVT+L TH++  E+ ACK+IA RKL++K+D++D
Sbjct  57   IGPVLGRPMEDVKKTYSIGKELGRGQFGVTHLCTHKQNGEQFACKTIAKRKLVNKEDIED  116

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            V+REVQIMHHLTG +NIVELKG YED++ VHLVMELCAGGELFDRII KGHY+ERAAA L
Sbjct  117  VKREVQIMHHLTGQQNIVELKGAYEDKHSVHLVMELCAGGELFDRIITKGHYTERAAATL  176

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  177  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  208



>ref|XP_002871516.1| calcium-dependent protein kinase 17 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47775.1| calcium-dependent protein kinase 17 [Arabidopsis lyrata subsp. 
lyrata]
Length=530

 Score =   239 bits (610),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  60   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGHQFACKTIAKRKLVNKEDIED  119

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  120  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  179

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  180  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  211



>ref|XP_009126355.1| PREDICTED: calcium-dependent protein kinase 34 [Brassica rapa]
Length=517

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  47   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  106

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  107  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  166

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  167  LRTIVQIIHTCHSMGVIHRDLKPENFLLLNKD  198



>gb|EMT22025.1| Calcium-dependent protein kinase 3 [Aegilops tauschii]
Length=481

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  203  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  382
            MEDV +TY FG ELGRGQFGVTYL TH+ T  R ACKSIA RKL   DDV+D RREVQIM
Sbjct  1    MEDVRATYTFGRELGRGQFGVTYLATHKSTGSRYACKSIAARKLARADDVEDARREVQIM  60

Query  383  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVL  562
            HHLTGHR+IVEL+G YEDR+ V+LVMELC GGELFDRIIA+GHYSERAAA LCR++V+V+
Sbjct  61   HHLTGHRSIVELRGAYEDRHSVNLVMELCEGGELFDRIIARGHYSERAAATLCREVVSVV  120

Query  563  HYCHSMGVMHRDLKPENFLFLS  628
            H CHSMGVMHRDLKPENFLFL+
Sbjct  121  HSCHSMGVMHRDLKPENFLFLN  142



>ref|XP_010419806.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Camelina sativa]
Length=528

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  58   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  117

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSE+AAA L
Sbjct  118  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSEKAAASL  177

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  178  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  209



>ref|XP_006289743.1| hypothetical protein CARUB_v10003311mg [Capsella rubella]
 gb|EOA22641.1| hypothetical protein CARUB_v10003311mg [Capsella rubella]
Length=524

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  54   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  113

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  114  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  173

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  174  LRTIVQIIHTCHSMGVIHRDLKPENFLLLNKD  205



>ref|XP_004513232.1| PREDICTED: calcium-dependent protein kinase 17-like [Cicer arietinum]
Length=540

 Score =   239 bits (610),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            + +G VL RPMEDV +TY  G ELGRGQFGVT+L TH+ T+E+ ACK+IA RKL++K+D+
Sbjct  67   AAMGPVLQRPMEDVRATYTIGKELGRGQFGVTHLCTHKVTKEQFACKTIAKRKLVNKEDI  126

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +DVRREVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  127  EDVRREVQIMHHLTGQANIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAA  186

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             L R +V ++H  HSMGV+HRDLKPENFL L+ D
Sbjct  187  SLLRTIVQIVHTLHSMGVIHRDLKPENFLLLNKD  220



>ref|XP_010454209.1| PREDICTED: calcium-dependent protein kinase 34 [Camelina sativa]
Length=523

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  53   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  112

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  113  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  172

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  173  LRTIVQIIHTCHSMGVIHRDLKPENFLLLNKD  204



>ref|XP_010492994.1| PREDICTED: calcium-dependent protein kinase 34-like [Camelina 
sativa]
Length=525

 Score =   239 bits (609),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  55   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  114

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  115  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  174

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  175  LRTIVQIIHTCHSMGVIHRDLKPENFLLLNKD  206



>ref|XP_010420737.1| PREDICTED: calcium-dependent protein kinase 34-like [Camelina 
sativa]
Length=523

 Score =   238 bits (608),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  53   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  112

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  113  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  172

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  173  LRTIVQIIHTCHSMGVIHRDLKPENFLLLNKD  204



>gb|AAL59948.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
Length=528

 Score =   238 bits (608),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV ++Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  58   IGPVLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKSTGHQFACKTIAKRKLVNKEDIED  117

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  118  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  177

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  178  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  209



>ref|NP_196779.1| calcium-dependent protein kinase 17 [Arabidopsis thaliana]
 sp|Q9FMP5.1|CDPKH_ARATH RecName: Full=Calcium-dependent protein kinase 17 [Arabidopsis 
thaliana]
 dbj|BAB10036.1| calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAU95457.1| At5g12180 [Arabidopsis thaliana]
 gb|AED91771.1| calcium-dependent protein kinase 17 [Arabidopsis thaliana]
Length=528

 Score =   238 bits (608),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV ++Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  58   IGPVLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKATGHQFACKTIAKRKLVNKEDIED  117

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  118  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  177

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  178  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  209



>ref|XP_010904692.1| PREDICTED: calcium-dependent protein kinase 34-like [Elaeis guineensis]
Length=516

 Score =   238 bits (607),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S Y  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL++K+D++D
Sbjct  47   IGPVLGRPMEDVKSAYTMGKELGRGQFGVTHLCTHKLTGEQFACKTIAKRKLVNKEDIED  106

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIM+HL+G  NIVELKG +ED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  107  VRREVQIMYHLSGQPNIVELKGAFEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  166

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  167  LRTIVQIVHTCHSMGVIHRDLKPENFLLLSKD  198



>gb|EAY76207.1| hypothetical protein OsI_04143 [Oryza sativa Indica Group]
 gb|EAZ13887.1| hypothetical protein OsJ_03814 [Oryza sativa Japonica Group]
Length=501

 Score =   238 bits (606),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 138/195 (71%), Gaps = 25/195 (13%)
 Frame = +2

Query  62   SSPFAA----TSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYI  229
            SS F A    +SA  ++ PP P                     +G VLGRPMEDV S Y 
Sbjct  24   SSSFKAGASPSSAPAQNKPPAP---------------------IGPVLGRPMEDVRSIYT  62

Query  230  FGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNI  409
             G ELGRGQFGVT L TH+ T ++ ACK+IA RKL +K+DV+DVRREVQIM+HL G  N+
Sbjct  63   IGKELGRGQFGVTSLCTHKATGQKFACKTIAKRKLSTKEDVEDVRREVQIMYHLAGQPNV  122

Query  410  VELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHSMGVM  589
            VELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA L R +V ++H CHS+GV+
Sbjct  123  VELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTIVEIIHTCHSLGVI  182

Query  590  HRDLKPENFLFLSSD  634
            HRDLKPENFL LS D
Sbjct  183  HRDLKPENFLLLSKD  197



>ref|XP_006644875.1| PREDICTED: calcium-dependent protein kinase 34-like [Oryza brachyantha]
Length=518

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 141/201 (70%), Gaps = 24/201 (12%)
 Frame = +2

Query  32   LQMGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMED  211
            L+ G+     +SP   +SA  ++ PP P                     +G VLGRPMED
Sbjct  24   LRTGASMKAGASP---SSAPAQNKPPAP---------------------IGPVLGRPMED  59

Query  212  VHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHL  391
            V S Y  G ELGRGQFGVT L TH+ T ++ ACK+IA RKL +K+DV+DVRREVQIM+HL
Sbjct  60   VRSIYTVGKELGRGQFGVTSLCTHKATGQKFACKTIAKRKLSTKEDVEDVRREVQIMYHL  119

Query  392  TGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYC  571
             G  NIVELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA L R +V ++H C
Sbjct  120  AGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTIVEIIHTC  179

Query  572  HSMGVMHRDLKPENFLFLSSD  634
            HS+GV+HRDLKPENFL LS D
Sbjct  180  HSLGVIHRDLKPENFLLLSKD  200



>ref|XP_006400491.1| hypothetical protein EUTSA_v10013240mg [Eutrema salsugineum]
 gb|ESQ41944.1| hypothetical protein EUTSA_v10013240mg [Eutrema salsugineum]
Length=527

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  57   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  116

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  117  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  176

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  177  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  208



>tpg|DAA57188.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=510

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S Y  G ELGRGQFGVT L TH+ T ER ACK+IA RKL +K+DV+D
Sbjct  51   IGPVLGRPMEDVRSIYTVGKELGRGQFGVTSLCTHKATGERFACKTIAKRKLSTKEDVED  110

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIM+HL G  NIVELKG YED+  VHLVMELCAGGELFDRIIAKG Y+ERAAA L
Sbjct  111  VRREVQIMYHLAGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGKYTERAAASL  170

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  171  LRTIVEIVHTCHSMGVIHRDLKPENFLLLSKD  202



>gb|KFK25494.1| hypothetical protein AALP_AA8G122000 [Arabis alpina]
Length=528

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV ++Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  58   IGPVLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKATGHQFACKTIAKRKLVNKEDIED  117

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  118  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  177

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  178  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  209



>gb|AGT17455.1| hypothetical protein SHCRBa_258_F08_F_40 [Saccharum hybrid cultivar 
R570]
Length=519

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 150/204 (74%), Gaps = 10/204 (5%)
 Frame = +2

Query  41   GSCNSIPSSPFAATSAGGESDP------PPPKNDITVLppsqpppprpFLSGVGRVLGRP  202
            GS ++ P+ P    S+ G S P      PPP +  +    +  P   P  + +G VLGRP
Sbjct  8    GSSSAEPALP--PDSSAGSSRPVGSATVPPPTSVSSSATTAPTPNKPP--APIGPVLGRP  63

Query  203  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  382
            MEDV STY  G ELGRGQFGVT L TH+ T ++ ACK+I+ RKL +K+D++DVRREVQIM
Sbjct  64   MEDVKSTYTVGKELGRGQFGVTSLCTHKATGQKFACKTISKRKLSTKEDIEDVRREVQIM  123

Query  383  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVL  562
            +HL+G   +VELKG YED+++VHLVMELCAGGELFDRIIAKGHY+ERAAA L R +V ++
Sbjct  124  YHLSGQPGVVELKGAYEDKSNVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTIVEIV  183

Query  563  HYCHSMGVMHRDLKPENFLFLSSD  634
            H CHSMGV+HRDLKPENFL LS D
Sbjct  184  HTCHSMGVIHRDLKPENFLLLSKD  207



>gb|AGT15898.1| calcium-dependent protein kinase [Saccharum hybrid cultivar R570]
 gb|AGT16288.1| Protein kinase-like domain [Saccharum hybrid cultivar R570]
Length=526

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 150/204 (74%), Gaps = 10/204 (5%)
 Frame = +2

Query  41   GSCNSIPSSPFAATSAGGESDP------PPPKNDITVLppsqpppprpFLSGVGRVLGRP  202
            GS ++ P+ P    S+ G S P      PPP +  +    +  P   P  + +G VLGRP
Sbjct  8    GSSSAEPALP--PDSSAGSSRPVGSATVPPPTSVSSSATTAPTPNKPP--APIGPVLGRP  63

Query  203  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  382
            MEDV STY  G ELGRGQFGVT L TH+ T ++ ACK+I+ RKL +K+D++DVRREVQIM
Sbjct  64   MEDVKSTYTVGKELGRGQFGVTSLCTHKATGQKFACKTISKRKLSTKEDIEDVRREVQIM  123

Query  383  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVL  562
            +HL+G   +VELKG YED+++VHLVMELCAGGELFDRIIAKGHY+ERAAA L R +V ++
Sbjct  124  YHLSGQPGVVELKGAYEDKSNVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTIVEIV  183

Query  563  HYCHSMGVMHRDLKPENFLFLSSD  634
            H CHSMGV+HRDLKPENFL LS D
Sbjct  184  HTCHSMGVIHRDLKPENFLLLSKD  207



>ref|NP_001044575.1| Os01g0808400 [Oryza sativa Japonica Group]
 dbj|BAD68074.1| putative calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAD68220.1| putative calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF06489.1| Os01g0808400 [Oryza sativa Japonica Group]
Length=515

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 138/195 (71%), Gaps = 25/195 (13%)
 Frame = +2

Query  62   SSPFAA----TSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYI  229
            SS F A    +SA  ++ PP P                     +G VLGRPMEDV S Y 
Sbjct  24   SSSFKAGASPSSAPAQNKPPAP---------------------IGPVLGRPMEDVRSIYT  62

Query  230  FGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNI  409
             G ELGRGQFGVT L TH+ T ++ ACK+IA RKL +K+DV+DVRREVQIM+HL G  N+
Sbjct  63   IGKELGRGQFGVTSLCTHKATGQKFACKTIAKRKLSTKEDVEDVRREVQIMYHLAGQPNV  122

Query  410  VELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHSMGVM  589
            VELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA L R +V ++H CHS+GV+
Sbjct  123  VELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTIVEIIHTCHSLGVI  182

Query  590  HRDLKPENFLFLSSD  634
            HRDLKPENFL LS D
Sbjct  183  HRDLKPENFLLLSKD  197



>ref|XP_002299975.2| hypothetical protein POPTR_0001s28150g [Populus trichocarpa]
 gb|EEE84780.2| hypothetical protein POPTR_0001s28150g [Populus trichocarpa]
Length=505

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 145/197 (74%), Gaps = 14/197 (7%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVH  217
            MG+C S   +  A+T+    ++   PK                 ++ +G VLGRPMEDV 
Sbjct  1    MGNCCSRGGAQDASTNKEENTEGASPK--------------PAKVAPIGPVLGRPMEDVK  46

Query  218  STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTG  397
            S Y  G ELGRGQFG+T+L T++ T E+ ACK+IA RKL++K+DV+DVRREVQIMHHLTG
Sbjct  47   SIYSIGKELGRGQFGITHLCTNKVTGEQFACKTIAKRKLVNKEDVEDVRREVQIMHHLTG  106

Query  398  HRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHS  577
              NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L R +V ++H CHS
Sbjct  107  QPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTIVQIIHTCHS  166

Query  578  MGVMHRDLKPENFLFLS  628
            MGV+HRDLKPENFL L+
Sbjct  167  MGVIHRDLKPENFLLLN  183



>dbj|BAA81749.1| calcium-dependent protein kinase [Marchantia polymorpha]
 dbj|BAA81751.1| calcium-dependent protein kinase [Marchantia polymorpha]
Length=548

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
             G VLGRP+EDV S Y  G ELGRGQFGVT+L TH+ T E LACKSIA RKL +KDDV+D
Sbjct  66   TGNVLGRPLEDVRSIYTLGRELGRGQFGVTHLCTHKVTGELLACKSIAKRKLTNKDDVED  125

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHL G +NIVELKG YED+++VHLVMELCAGGELFDRII +GHYSERAAA L
Sbjct  126  VRREVQIMHHLEGQKNIVELKGAYEDKHNVHLVMELCAGGELFDRIIQRGHYSERAAAAL  185

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLF  622
            CR +V V+  CHS+GVMHRDLKPENFL 
Sbjct  186  CRTIVQVVQTCHSLGVMHRDLKPENFLL  213



>ref|XP_008674922.1| PREDICTED: calcium-dependent protein kinase 34 [Zea mays]
Length=520

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S Y  G ELGRGQFGVT L TH+ T ER ACK+IA RKL +K+DV+D
Sbjct  51   IGPVLGRPMEDVRSIYTVGKELGRGQFGVTSLCTHKATGERFACKTIAKRKLSTKEDVED  110

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIM+HL G  NIVELKG YED+  VHLVMELCAGGELFDRIIAKG Y+ERAAA L
Sbjct  111  VRREVQIMYHLAGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGKYTERAAASL  170

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  171  LRTIVEIVHTCHSMGVIHRDLKPENFLLLSKD  202



>dbj|BAA81748.1| calcium-dependent protein kinase [Marchantia polymorpha]
 dbj|BAA81750.1| calcium-dependent protein kinase [Marchantia polymorpha]
Length=548

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
             G VLGRP+EDV S Y  G ELGRGQFGVT+L TH+ T E LACKSIA RKL +KDDV+D
Sbjct  66   TGNVLGRPLEDVRSIYTLGRELGRGQFGVTHLCTHKVTGELLACKSIAKRKLTNKDDVED  125

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHL G +NIVELKG YED+++VHLVMELCAGGELFDRII +GHYSERAAA L
Sbjct  126  VRREVQIMHHLEGQKNIVELKGAYEDKHNVHLVMELCAGGELFDRIIQRGHYSERAAAAL  185

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLF  622
            CR +V V+  CHS+GVMHRDLKPENFL 
Sbjct  186  CRTIVQVVQTCHSLGVMHRDLKPENFLL  213



>gb|AGT17376.1| calcium-dependent protein kinase [Saccharum hybrid cultivar R570]
Length=540

 Score =   238 bits (606),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 150/204 (74%), Gaps = 10/204 (5%)
 Frame = +2

Query  41   GSCNSIPSSPFAATSAGGESDP------PPPKNDITVLppsqpppprpFLSGVGRVLGRP  202
            GS ++ P+ P    S+ G S P      PPP +  +    +  P   P  + +G VLGRP
Sbjct  8    GSSSAEPALP--PDSSAGSSRPVGSATVPPPTSVSSSATTAPTPNKPP--APIGPVLGRP  63

Query  203  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  382
            MEDV STY  G ELGRGQFGVT L TH+ T ++ ACK+I+ RKL +K+D++DVRREVQIM
Sbjct  64   MEDVKSTYTVGKELGRGQFGVTSLCTHKATGQKFACKTISKRKLSTKEDIEDVRREVQIM  123

Query  383  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVL  562
            +HL+G   +VELKG YED+++VHLVMELCAGGELFDRIIAKGHY+ERAAA L R +V ++
Sbjct  124  YHLSGQPGVVELKGAYEDKSNVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTIVEIV  183

Query  563  HYCHSMGVMHRDLKPENFLFLSSD  634
            H CHSMGV+HRDLKPENFL LS D
Sbjct  184  HTCHSMGVIHRDLKPENFLLLSKD  207



>emb|CDY44912.1| BnaA02g04170D [Brassica napus]
Length=517

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S+Y  G ELGRGQFGVT+L T + T  + ACK+IA RKL++K+D++D
Sbjct  47   IGPVLGRPMEDVKSSYSLGKELGRGQFGVTHLCTQKATGLQFACKTIAKRKLVNKEDIED  106

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHYSERAAA L
Sbjct  107  VRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASL  166

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLS  628
             R +V ++H CHSMGV+HRDLKPENFL L+
Sbjct  167  LRTIVQIIHTCHSMGVIHRDLKPENFLLLN  196



>ref|XP_011024983.1| PREDICTED: calcium-dependent protein kinase 17 [Populus euphratica]
Length=530

 Score =   237 bits (604),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +2

Query  170  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  349
            ++ +G VLGRPMEDV S Y  G ELGRGQFG+T+L T++ T E+ ACK+IA RKL++K+D
Sbjct  57   VAPIGPVLGRPMEDVKSIYSIGKELGRGQFGITHLCTNKVTGEQFACKTIAKRKLVNKED  116

Query  350  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  529
            V+DVRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAA
Sbjct  117  VEDVRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAA  176

Query  530  AGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLS  628
            A L R +V ++H CHSMGV+HRDLKPENFL L+
Sbjct  177  ASLLRTIVQIIHTCHSMGVIHRDLKPENFLLLN  209



>ref|XP_004491231.1| PREDICTED: calcium-dependent protein kinase 17-like [Cicer arietinum]
Length=520

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            + +G VL RPMEDV +TY  G ELGRGQFGVTYL TH+ T ++ ACK+IA RKL++K+D+
Sbjct  48   AAIGPVLERPMEDVKATYSIGKELGRGQFGVTYLCTHKTTGKQYACKTIAKRKLVNKEDI  107

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +D RREVQIMHHLTG  N+VEL G YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  108  EDARREVQIMHHLTGQPNVVELVGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAA  167

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             L R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  168  SLLRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  201



>ref|XP_008786936.1| PREDICTED: calcium-dependent protein kinase 34-like [Phoenix 
dactylifera]
Length=514

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 147/199 (74%), Gaps = 3/199 (2%)
 Frame = +2

Query  38   MGSCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVH  217
            MG+C S   SP     A G +    P       PP +P PP      +G VLGRPMEDV 
Sbjct  1    MGNCFSNDKSP---RPAAGNAAADRPNLSPHAAPPPKPSPPPSKPVPIGPVLGRPMEDVK  57

Query  218  STYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTG  397
            +TY  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL +K+D++DVRREV+IM+HL+G
Sbjct  58   ATYSMGKELGRGQFGVTHLCTHKLTGEQFACKTIAKRKLANKEDIEDVRREVRIMYHLSG  117

Query  398  HRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHS  577
              NIVELKG +ED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L R +V ++H CHS
Sbjct  118  QPNIVELKGAFEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTIVQIVHTCHS  177

Query  578  MGVMHRDLKPENFLFLSSD  634
            MGV+HRDLKPENFL LS D
Sbjct  178  MGVIHRDLKPENFLLLSKD  196



>ref|XP_008671573.1| PREDICTED: calcium-dependent protein kinase 17-like [Zea mays]
 tpg|DAA39257.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=552

 Score =   237 bits (604),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            + VG VLGRPMEDV +TY  G ELGRGQFGVT+L THR + E+LACK+IA RKL +++DV
Sbjct  78   AAVGTVLGRPMEDVRATYSMGKELGRGQFGVTHLCTHRTSGEKLACKTIAKRKLAAREDV  137

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            DDVRREVQIMHHL+G  N+V L+G YED+  VHLVMELCAGGELFDRIIA+G Y+ER AA
Sbjct  138  DDVRREVQIMHHLSGQPNVVGLRGAYEDKQSVHLVMELCAGGELFDRIIARGQYTERGAA  197

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             L R +V ++H CHSMGVMHRD+KPENFL LS D
Sbjct  198  ELLRAIVQIVHTCHSMGVMHRDIKPENFLLLSKD  231



>gb|AFW84809.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
Length=464

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S Y  G ELGRGQFGVT L TH+ T ER ACK+IA RKL +K+DV+D
Sbjct  51   IGPVLGRPMEDVRSIYTVGKELGRGQFGVTSLCTHKATGERFACKTIAKRKLSTKEDVED  110

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIM+HL G  NIVELKG YED+  VHLVMELCAGGELFDRIIAKG Y+ERAAA L
Sbjct  111  VRREVQIMYHLAGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGKYTERAAASL  170

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHS+GV+HRDLKPENFL L+ D
Sbjct  171  LRTIVEIVHTCHSLGVIHRDLKPENFLLLNKD  202



>ref|XP_001781985.1| predicted protein [Physcomitrella patens]
 gb|EDQ53209.1| predicted protein [Physcomitrella patens]
Length=479

 Score =   234 bits (598),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = +2

Query  176  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  355
              G VLG+P+ DV S Y  G ELGRGQFGVTY  T+ KT E LACKSIA RKL+SK+D++
Sbjct  10   AAGTVLGKPLSDVRSVYTLGKELGRGQFGVTYACTNIKTGEHLACKSIAKRKLISKEDIE  69

Query  356  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  535
            DVRREVQIMHHL+G  N+VELKG +ED++HVH+VMELCAGGELFDRIIAKGHYSERAAA 
Sbjct  70   DVRREVQIMHHLSGTPNVVELKGVFEDKHHVHIVMELCAGGELFDRIIAKGHYSERAAAA  129

Query  536  LCRQMVTVLHYCHSMGVMHRDLKPENFLF  622
            LCR +V+V+H CHS+ V HRDLKPENFL 
Sbjct  130  LCRTIVSVVHRCHSLNVFHRDLKPENFLL  158



>ref|XP_004961659.1| PREDICTED: calcium-dependent protein kinase 34-like [Setaria 
italica]
Length=573

 Score =   237 bits (604),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            VG VLGRPMEDV STY  G ELGRGQFGVT L TH+ T ++ ACK+I+ RKL +K+D++D
Sbjct  101  VGPVLGRPMEDVKSTYTVGKELGRGQFGVTSLCTHKATGQKFACKTISKRKLSTKEDIED  160

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIM+HL+G   +VELKG YED+N VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  161  VRREVQIMYHLSGQPGVVELKGAYEDKNSVHLVMELCAGGELFDRIIAKGHYTERAAASL  220

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CH+MGV+HRDLKPENFL LS D
Sbjct  221  LRTIVEIVHTCHTMGVIHRDLKPENFLLLSKD  252



>ref|XP_009414363.1| PREDICTED: calcium-dependent protein kinase 17 [Musa acuminata 
subsp. malaccensis]
Length=523

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPM+DVH+TY  G ELGRGQFGVT+L TH+ T E+ ACK+IA RKL SK+DV+D
Sbjct  54   IGLVLGRPMQDVHATYTIGKELGRGQFGVTHLCTHKTTAEQFACKTIAKRKLTSKEDVED  113

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREV+IM+HL G  N+VELKG YED++ VHLVMELCAGGELFDRI+A+GH++E AAA L
Sbjct  114  VRREVEIMYHLAGQANVVELKGAYEDKHSVHLVMELCAGGELFDRIVAQGHFTEFAAASL  173

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGVMHRDLKPENFL L+ +
Sbjct  174  LRTIVQIVHTCHSMGVMHRDLKPENFLLLNKE  205



>ref|XP_011009111.1| PREDICTED: calcium-dependent protein kinase 34-like [Populus 
euphratica]
Length=525

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +2

Query  170  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  349
            ++ +G VLGRPMED  S Y  G ELGRGQFG+T+L T++ T E+ ACK+IA RKL++K+D
Sbjct  52   VTPIGPVLGRPMEDAKSIYTIGKELGRGQFGITHLCTNKVTGEQFACKTIAKRKLVNKED  111

Query  350  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  529
            V+DVRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAA
Sbjct  112  VEDVRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAA  171

Query  530  AGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLS  628
            A L R +V ++H CHSMGV+HRDLKPENFL L+
Sbjct  172  ASLLRTIVQIVHTCHSMGVIHRDLKPENFLLLN  204



>ref|XP_011014420.1| PREDICTED: calcium-dependent protein kinase 34-like [Populus 
euphratica]
Length=525

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +2

Query  170  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  349
            ++ +G VLGRPMED  S Y  G ELGRGQFG+T+L T++ T E+ ACK+IA RKL++K+D
Sbjct  52   VTPIGPVLGRPMEDAKSIYTIGKELGRGQFGITHLCTNKVTGEQFACKTIAKRKLVNKED  111

Query  350  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  529
            V+DVRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAA
Sbjct  112  VEDVRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAA  171

Query  530  AGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLS  628
            A L R +V ++H CHSMGV+HRDLKPENFL L+
Sbjct  172  ASLLRTIVQIVHTCHSMGVIHRDLKPENFLLLN  204



>ref|XP_002313265.1| calcium-dependent protein kinase [Populus trichocarpa]
 gb|EEE87220.1| calcium-dependent protein kinase [Populus trichocarpa]
Length=525

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +2

Query  170  LSGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDD  349
            ++ +G VLGRPMED  S Y  G ELGRGQFG+T+L T++ T E+ ACK+IA RKL++K+D
Sbjct  52   VTPIGPVLGRPMEDAKSIYTIGKELGRGQFGITHLCTNKVTGEQFACKTIAKRKLVNKED  111

Query  350  VDDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAA  529
            V+DVRREVQIMHHLTG  NIVELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAA
Sbjct  112  VEDVRREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTERAA  171

Query  530  AGLCRQMVTVLHYCHSMGVMHRDLKPENFLFLS  628
            A L R +V ++H CHSMGV+HRDLKPENFL L+
Sbjct  172  ASLLRTIVQIVHTCHSMGVIHRDLKPENFLLLN  204



>ref|XP_008788593.1| PREDICTED: calcium-dependent protein kinase 17-like [Phoenix 
dactylifera]
Length=515

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  182  GRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDV  361
            G VLGRPMEDV +TY  G ELGRGQFGVT+L THR T E+ ACK+IA RKL+SK+D++DV
Sbjct  47   GPVLGRPMEDVKATYTMGKELGRGQFGVTHLCTHRLTGEQFACKTIAKRKLVSKEDIEDV  106

Query  362  RREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLC  541
            RREVQIM+HL+G  NIVELKG +ED++ VHLVMELCAGGELFDRIIA+GHY+ERAAA L 
Sbjct  107  RREVQIMYHLSGQPNIVELKGAFEDKHSVHLVMELCAGGELFDRIIARGHYTERAAASLL  166

Query  542  RQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            R +V ++H CHSMGV+HRDLKPENFL  S +
Sbjct  167  RTIVQIVHTCHSMGVIHRDLKPENFLLSSKN  197



>ref|XP_002276630.2| PREDICTED: calcium-dependent protein kinase 34-like [Vitis vinifera]
Length=534

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV + Y  G ELGRGQFGVT+L T + T E+ ACK+IA RKL++K+D++D
Sbjct  65   IGPVLGRPMEDVRTLYTIGKELGRGQFGVTHLCTSKATGEQFACKTIAKRKLVNKEDIED  124

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRII+KGHY+ER AA L
Sbjct  125  VRREVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIISKGHYTERGAASL  184

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  185  LRTIVQIVHTCHSMGVVHRDLKPENFLLLNKD  216



>ref|XP_008657141.1| PREDICTED: calcium-dependent protein kinase 34-like [Zea mays]
Length=520

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S Y  G ELGRGQFGVT L TH+ T ER ACK+IA RKL +K+DV+D
Sbjct  51   IGPVLGRPMEDVRSIYTVGKELGRGQFGVTSLCTHKATGERFACKTIAKRKLSTKEDVED  110

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIM+HL G  NIVELKG YED+  VHLVMELCAGGELFDRIIAKG Y+ERAAA L
Sbjct  111  VRREVQIMYHLAGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGKYTERAAASL  170

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHS+GV+HRDLKPENFL L+ D
Sbjct  171  LRTIVEIVHTCHSLGVIHRDLKPENFLLLNKD  202



>ref|XP_010922091.1| PREDICTED: calcium-dependent protein kinase 17-like [Elaeis guineensis]
Length=515

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L THR + E+ ACK+IA RKL++K+D++D
Sbjct  46   IGPVLGRPMEDVKATYTMGKELGRGQFGVTHLCTHRISGEQFACKTIAKRKLVNKEDIED  105

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIM+HL+G  NIVELKG +ED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  106  VRREVQIMYHLSGQPNIVELKGAFEDKHSVHLVMELCAGGELFDRIIAKGHYTERAAASL  165

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL  S +
Sbjct  166  LRTIVQIVHTCHSMGVIHRDLKPENFLLSSKN  197



>ref|XP_003576346.1| PREDICTED: calcium-dependent protein kinase 17-like [Brachypodium 
distachyon]
Length=532

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 141/188 (75%), Gaps = 16/188 (9%)
 Frame = +2

Query  62   SSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIFGGE  241
            +S  +A++ GG S   PP +                 + VG VLGRPMEDV +TY  G E
Sbjct  37   ASSSSASNRGGASKAAPPSSS----------------APVGEVLGRPMEDVRATYSIGKE  80

Query  242  LGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNIVELK  421
            LGRGQFGVT+L THR + E+LACK+IA RKL +++D++DVRREVQIM+HL+G  NIV+L+
Sbjct  81   LGRGQFGVTHLCTHRTSGEKLACKTIAKRKLSTREDLEDVRREVQIMYHLSGQPNIVDLR  140

Query  422  GTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHSMGVMHRDL  601
            G YED++ VHLVMELCAGGELFDRIIA+GHY+ERAAA L R +V ++H CH MGVMHRDL
Sbjct  141  GAYEDKHSVHLVMELCAGGELFDRIIARGHYTERAAASLLRAIVGIVHTCHCMGVMHRDL  200

Query  602  KPENFLFL  625
            KPENFL L
Sbjct  201  KPENFLLL  208



>emb|CAN62888.1| hypothetical protein VITISV_025544 [Vitis vinifera]
Length=540

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV + Y  G ELGRGQFGVT+L T + T E+ ACK+IA RKL++K+D++D
Sbjct  65   IGPVLGRPMEDVRTLYTIGKELGRGQFGVTHLCTSKATGEQFACKTIAKRKLVNKEDIED  124

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED+  VHLVMELCAGGELFDRII+KGHY+ER AA L
Sbjct  125  VRREVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIISKGHYTERGAASL  184

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  185  LRTIVQIVHTCHSMGVVHRDLKPENFLLLNKD  216



>gb|KHN23929.1| Calcium-dependent protein kinase 17 [Glycine soja]
Length=474

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L T++ T ++ ACK+IA RKL++K+D++D
Sbjct  1    MGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTNKATGQQFACKTIAKRKLVNKEDIED  60

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHL+G  NIVELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  61   VRREVQIMHHLSGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASL  120

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R ++ ++H  HSMGV+HRDLKPENFL L+ D
Sbjct  121  LRTIMQIIHTFHSMGVIHRDLKPENFLMLNKD  152



>gb|KDO62718.1| hypothetical protein CISIN_1g0096582mg, partial [Citrus sinensis]
 gb|KDO62719.1| hypothetical protein CISIN_1g0096582mg, partial [Citrus sinensis]
 gb|KDO62720.1| hypothetical protein CISIN_1g0096582mg, partial [Citrus sinensis]
Length=235

 Score =   225 bits (574),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = +2

Query  188  VLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRR  367
            +LG+P EDV   Y FG ELGRGQFGVTYL T   T  + ACKSI+ RKL++K+D DD++R
Sbjct  69   ILGKPYEDVKLHYSFGKELGRGQFGVTYLCTENSTGRQFACKSISKRKLVTKNDKDDIKR  128

Query  368  EVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQ  547
            E+QIM HL+G  NIVE KG YED+  VH+VMELCAGGELFDRIIAKGHYSERAAA +CR 
Sbjct  129  EIQIMQHLSGQPNIVEFKGAYEDKQSVHVVMELCAGGELFDRIIAKGHYSERAAASICRS  188

Query  548  MVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
            +V V+H CH MGVMHRDLKPENFL  S D
Sbjct  189  IVNVVHICHFMGVMHRDLKPENFLLSSKD  217



>gb|AGT16545.1| calcium-dependent protein kinase 34 [Saccharum hybrid cultivar 
R570]
Length=519

 Score =   234 bits (596),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 149/204 (73%), Gaps = 10/204 (5%)
 Frame = +2

Query  41   GSCNSIPSSPFAATSAGGESDP------PPPKNDITVLppsqpppprpFLSGVGRVLGRP  202
            GS ++ P+ P    S+ G S P      PPP +  +    +  P   P  + +G VLGRP
Sbjct  8    GSSSAEPALP--PDSSAGSSRPVGSATVPPPTSVSSSATTAPTPNKPP--APIGPVLGRP  63

Query  203  MEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIM  382
            MEDV STY  G ELGRGQFGVT L TH+ T ++ ACK+I+ RKL +K+D++DVRREVQIM
Sbjct  64   MEDVKSTYTVGKELGRGQFGVTSLCTHKATGQKFACKTISKRKLSTKEDIEDVRREVQIM  123

Query  383  HHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVL  562
            +HL+G   +VELKG YED+++VHLVMELCAGGEL DRIIAKGHY+ERAAA L R +V ++
Sbjct  124  YHLSGQPGVVELKGAYEDKSNVHLVMELCAGGELCDRIIAKGHYTERAAASLLRTIVEIV  183

Query  563  HYCHSMGVMHRDLKPENFLFLSSD  634
            H CHSMGV+HRDLKPENFL LS D
Sbjct  184  HTCHSMGVIHRDLKPENFLLLSKD  207



>gb|KJB83565.1| hypothetical protein B456_013G253100 [Gossypium raimondii]
Length=527

 Score =   234 bits (596),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 140/197 (71%), Gaps = 23/197 (12%)
 Frame = +2

Query  44   SCNSIPSSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHST  223
            S  + PSS  A+T  G +S P P                      +G VLGRPMEDV +T
Sbjct  36   SYRTAPSSQGAST-VGKQSKPAP----------------------MGPVLGRPMEDVKAT  72

Query  224  YIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHR  403
            Y  G ELGRGQFG+T+L TH+ T E+ ACK+IA RKL SK+DV+DVRREVQIMHHLTG  
Sbjct  73   YTIGKELGRGQFGITHLCTHKTTGEQFACKTIAKRKLSSKEDVEDVRREVQIMHHLTGQP  132

Query  404  NIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHSMG  583
            NIVELKG YED++ VHLVMELC GGELFDRIIAKGHY+ERAAA L R ++ ++H  HSMG
Sbjct  133  NIVELKGAYEDKHAVHLVMELCGGGELFDRIIAKGHYTERAAASLLRTIMQIVHTFHSMG  192

Query  584  VMHRDLKPENFLFLSSD  634
            V+HRDLKPENFL L  +
Sbjct  193  VIHRDLKPENFLLLGKE  209



>ref|XP_002448943.1| hypothetical protein SORBIDRAFT_05g002110 [Sorghum bicolor]
 gb|EES07931.1| hypothetical protein SORBIDRAFT_05g002110 [Sorghum bicolor]
Length=538

 Score =   234 bits (597),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            + VG VLGRPMEDV  T+  G ELGRGQFGVT+L THR + E+LACK+IA RKL +K+DV
Sbjct  65   AAVGPVLGRPMEDVRDTHSMGKELGRGQFGVTHLCTHRASGEKLACKTIAKRKLATKEDV  124

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            DDVRREVQIMHHL+G  N+V L+G YED+  VHLVMELCAGGELFDRIIA+G Y+ER AA
Sbjct  125  DDVRREVQIMHHLSGQPNVVALRGAYEDKQSVHLVMELCAGGELFDRIIARGQYTERGAA  184

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             L R +V ++H CH+MGVMHRD+KPENFL LS D
Sbjct  185  ALLRTIVRIVHTCHAMGVMHRDIKPENFLLLSKD  218



>gb|KJB35709.1| hypothetical protein B456_006G124800 [Gossypium raimondii]
Length=524

 Score =   234 bits (596),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGR MED+ +TY  G ELGRGQFGVT+L T ++T E+ ACK+IA RKL +KDD++D
Sbjct  57   IGPVLGRQMEDIKATYNIGKELGRGQFGVTHLCTCKQTGEQFACKTIAKRKLANKDDIED  116

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHLTG  NIVELKG YED + ++LVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  117  VRREVQIMHHLTGQANIVELKGAYEDNHSIYLVMELCAGGELFDRIIAKGHYTERAAASL  176

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  177  LRTIVQIVHTCHSMGVIHRDLKPENFLLLNQD  208



>ref|XP_003556786.1| PREDICTED: calcium-dependent protein kinase 17-like [Glycine 
max]
Length=546

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            + +G VLGRPMEDV +TY  G ELGRGQFGVT+L T++ T ++ ACK+IA RKL++K+D+
Sbjct  71   AAMGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTNKATGQQFACKTIAKRKLVNKEDI  130

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +DVRREVQIMHHL+G  NIVELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  131  EDVRREVQIMHHLSGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAA  190

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             L R ++ ++H  HSMGV+HRDLKPENFL L+ D
Sbjct  191  SLLRTIMQIIHTFHSMGVIHRDLKPENFLMLNKD  224



>ref|XP_009131258.1| PREDICTED: calcium-dependent protein kinase 17-like [Brassica 
rapa]
Length=523

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV ++Y  G ELGRGQFGVT+L T + T ++ ACK+IA RKL++K+D++D
Sbjct  53   IGPVLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIED  112

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHH+TG  NIVELKG YED + VHLVME CA GELFDR IAKGHYSERAAA L
Sbjct  113  VRREVQIMHHMTGQPNIVELKGAYEDTHSVHLVMEFCASGELFDRTIAKGHYSERAAASL  172

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  173  LRTIVQIIHTCHSMGVIHRDLKPENFLLLSKD  204



>ref|XP_008798404.1| PREDICTED: calcium-dependent protein kinase 17-like [Phoenix 
dactylifera]
Length=525

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 139/191 (73%), Gaps = 4/191 (2%)
 Frame = +2

Query  62   SSPFAATSAGGESDPPPPKNDITVLppsqpppprpFLSGVGRVLGRPMEDVHSTYIFGGE  241
            ++PF A  A      P P N       +    P    + +G VLGRPMEDV  TY  G E
Sbjct  21   AAPFDAVRAS----KPSPHNASPAAAAAATSRPPAKPARIGPVLGRPMEDVRFTYSMGKE  76

Query  242  LGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDDVRREVQIMHHLTGHRNIVELK  421
            LGRGQFGVT+  TH+ T E+ ACK+IA RKL++K+D+ DVRREVQIM+HL+G  NIVELK
Sbjct  77   LGRGQFGVTHRCTHKATGEQFACKTIAKRKLVNKEDIQDVRREVQIMYHLSGQPNIVELK  136

Query  422  GTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVLHYCHSMGVMHRDL  601
            G YED+  VHLVMELCAGGELFDRIIA+GHY+ERAAA L R +V ++H CHSMGV+HRDL
Sbjct  137  GAYEDQQSVHLVMELCAGGELFDRIIARGHYTERAAASLLRIIVQIVHTCHSMGVIHRDL  196

Query  602  KPENFLFLSSD  634
            KPENFL L+ D
Sbjct  197  KPENFLLLNKD  207



>ref|XP_006655439.1| PREDICTED: calcium-dependent protein kinase 34-like, partial 
[Oryza brachyantha]
Length=479

 Score =   232 bits (592),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV S Y  G ELGRGQFGVT L TH+ T +R ACK+I+ RKL +K+DV+D
Sbjct  10   IGPVLGRPMEDVKSIYTVGKELGRGQFGVTSLCTHKATGQRFACKTISKRKLSTKEDVED  69

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIM+HL G   +VELKG YED++ VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  70   VRREVQIMYHLAGQPGVVELKGAYEDKHAVHLVMELCAGGELFDRIIAKGHYTERAAASL  129

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  130  LRTIVEIIHTCHSMGVIHRDLKPENFLLLSKD  161



>gb|ABV22565.1| calcium-dependent protein kinase [Physcomitrella patens]
 gb|ABV22571.1| calcium-dependent protein kinase [Physcomitrella patens]
Length=545

 Score =   234 bits (596),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = +2

Query  176  GVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVD  355
              G VLG+P+ DV S Y  G ELGRGQFGVTY  T+ KT E LACKSIA RKL+SK+D++
Sbjct  76   AAGTVLGKPLSDVRSVYTLGKELGRGQFGVTYACTNIKTGEHLACKSIAKRKLISKEDIE  135

Query  356  DVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAG  535
            DVRREVQIMHHL+G  N+VELKG +ED++HVH+VMELCAGGELFDRIIAKGHYSERAAA 
Sbjct  136  DVRREVQIMHHLSGTPNVVELKGVFEDKHHVHIVMELCAGGELFDRIIAKGHYSERAAAA  195

Query  536  LCRQMVTVLHYCHSMGVMHRDLKPENFLF  622
            LCR +V+V+H CHS+ V HRDLKPENFL 
Sbjct  196  LCRTIVSVVHRCHSLNVFHRDLKPENFLL  224



>gb|KHN28162.1| Calcium-dependent protein kinase 17 [Glycine soja]
Length=472

 Score =   232 bits (591),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VLGRPMEDV +TY  G ELGRGQFGVT+L T++ T ++ ACK+IA RKL++K+D++D
Sbjct  1    MGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTNKTTGQQFACKTIAKRKLVNKEDIED  60

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIM+HL+G  NIVELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  61   VRREVQIMNHLSGQSNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASL  120

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R ++ ++H  HSMGV+HRDLKPENFL L+ D
Sbjct  121  LRTIMQIIHTFHSMGVIHRDLKPENFLMLNKD  152



>ref|XP_010269424.1| PREDICTED: calcium-dependent protein kinase 34-like isoform X1 
[Nelumbo nucifera]
Length=534

 Score =   233 bits (595),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VL RPMEDV S Y  G ELGRGQFGVT+L TH+ T E+ ACK IA RKL +K+D++D
Sbjct  61   MGTVLNRPMEDVRSVYTIGKELGRGQFGVTHLCTHKVTGEQFACKMIAKRKLANKEDIED  120

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHL G  NIVELKG YED+  VHLVMELCAGGELFDRIIAKG+YSER AA L
Sbjct  121  VRREVQIMHHLAGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGYYSEREAASL  180

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  181  LRTIVQIVHTCHSMGVVHRDLKPENFLLLSKD  212



>dbj|BAK06838.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=542

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            VG VLGRP+EDV +TY  G ELGRGQFGVTYL TH +T E+LACK+IA RKL   +DV+D
Sbjct  69   VGEVLGRPIEDVRATYTIGEELGRGQFGVTYLCTHTETGEKLACKTIAKRKLSGAEDVED  128

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREV+IMHHL+G  NIV+L+G YED+++VHLVMELCAGGELFDRIIAKGHY+ERAAA L
Sbjct  129  VRREVEIMHHLSGQPNIVDLRGAYEDKHNVHLVMELCAGGELFDRIIAKGHYTERAAASL  188

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V  +H  HSMGVMHRDLKPENFL L+ D
Sbjct  189  LRSVVGTVHTFHSMGVMHRDLKPENFLMLNRD  220



>gb|KHN38392.1| Calcium-dependent protein kinase 17 [Glycine soja]
Length=511

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            + +G VLGR MEDV STY  G ELGRGQFGVT+L TH+ T ++ ACK+IA RKL++K+D+
Sbjct  55   AAIGPVLGRAMEDVKSTYSMGKELGRGQFGVTHLCTHKSTGKQYACKTIAKRKLVNKEDI  114

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +DV+REVQIMHHL+G  NIVEL   YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  115  EDVKREVQIMHHLSGQANIVELVNVYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAA  174

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             L R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  175  SLLRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  208



>ref|XP_007141507.1| hypothetical protein PHAVU_008G201900g [Phaseolus vulgaris]
 gb|ESW13501.1| hypothetical protein PHAVU_008G201900g [Phaseolus vulgaris]
Length=521

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            + +G VLG+PMEDV STY  G ELGRGQFGVT+L TH+ T ++ ACK+IA RKL++K+D+
Sbjct  49   AAIGPVLGKPMEDVRSTYSMGKELGRGQFGVTHLCTHKSTGKQYACKTIAKRKLVNKEDI  108

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +DV+REVQIMHHL+G  NIVEL   +ED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  109  EDVKREVQIMHHLSGQPNIVELVNVFEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAA  168

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             L R +V ++H CHSMGV+HRDLKPENFL L+ D
Sbjct  169  SLLRTIVQIVHTCHSMGVIHRDLKPENFLLLNKD  202



>ref|XP_010269425.1| PREDICTED: calcium-dependent protein kinase 34-like isoform X2 
[Nelumbo nucifera]
Length=530

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            +G VL RPMEDV S Y  G ELGRGQFGVT+L TH+ T E+ ACK IA RKL +K+D++D
Sbjct  61   MGTVLNRPMEDVRSVYTIGKELGRGQFGVTHLCTHKVTGEQFACKMIAKRKLANKEDIED  120

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHL G  NIVELKG YED+  VHLVMELCAGGELFDRIIAKG+YSER AA L
Sbjct  121  VRREVQIMHHLAGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGYYSEREAASL  180

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V ++H CHSMGV+HRDLKPENFL LS D
Sbjct  181  LRTIVQIVHTCHSMGVVHRDLKPENFLLLSKD  212



>ref|NP_001266856.1| calcium-dependent protein kinase [Zea mays]
 gb|AFP36377.1| calcium-dependent protein kinase [Zea mays]
Length=549

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +2

Query  179  VGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDVDD  358
            VG VLGRPMEDV +TY  G ELGRGQFGVT+L THR + E+LACK+IA RKL  K+DV+D
Sbjct  77   VGTVLGRPMEDVRATYTMGKELGRGQFGVTHLCTHRASGEKLACKTIAKRKLAGKEDVED  136

Query  359  VRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAAGL  538
            VRREVQIMHHL+G   +V L+G YEDR+ VHLVMELCAGGELFDRIIA+GHY+ER AA L
Sbjct  137  VRREVQIMHHLSGQPGVVCLRGAYEDRHGVHLVMELCAGGELFDRIIARGHYTERGAAAL  196

Query  539  CRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             R +V  +H CHSMGVMHRD+KPENFL LS D
Sbjct  197  LRAIVQTVHTCHSMGVMHRDIKPENFLLLSRD  228



>ref|XP_003528592.1| PREDICTED: calcium-dependent protein kinase 17-like [Glycine 
max]
Length=541

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  173  SGVGRVLGRPMEDVHSTYIFGGELGRGQFGVTYLVTHRKTRERLACKSIATRKLLSKDDV  352
            + +G VLGRPMEDV +TY  G ELGRGQFGVT+L T++ T ++ ACK+IA RKL++K+D+
Sbjct  68   AAMGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTNKTTGQQFACKTIAKRKLVNKEDI  127

Query  353  DDVRREVQIMHHLTGHRNIVELKGTYEDRNHVHLVMELCAGGELFDRIIAKGHYSERAAA  532
            +DVRREVQIM+HL+G  NIVELKG YED+  VHLVMELCAGGELFDRIIAKGHY+ERAAA
Sbjct  128  EDVRREVQIMNHLSGQSNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAA  187

Query  533  GLCRQMVTVLHYCHSMGVMHRDLKPENFLFLSSD  634
             L R ++ ++H  HSMGV+HRDLKPENFL L+ D
Sbjct  188  SLLRTIMQIIHTFHSMGVIHRDLKPENFLMLNKD  221



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 955946848384