BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7453

Length=592
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006343987.1|  PREDICTED: glutamate--cysteine ligase, chlor...    240   9e-73   Solanum tuberosum [potatoes]
ref|XP_010325297.1|  PREDICTED: glutamate--cysteine ligase, chlor...    236   5e-71   
ref|NP_001234010.1|  glutamate--cysteine ligase, chloroplastic          236   6e-71   
ref|XP_009617977.1|  PREDICTED: glutamate--cysteine ligase, chlor...    233   5e-70   Nicotiana tomentosiformis
gb|AFP93564.1|  GCS                                                     229   1e-68   Cestrum nocturnum [night jessamine]
emb|CDP09740.1|  unnamed protein product                                227   7e-67   Coffea canephora [robusta coffee]
ref|XP_009766955.1|  PREDICTED: glutamate--cysteine ligase, chlor...    224   1e-66   Nicotiana sylvestris
ref|XP_011080960.1|  PREDICTED: glutamate--cysteine ligase, chlor...    221   3e-65   Sesamum indicum [beniseed]
gb|EYU23478.1|  hypothetical protein MIMGU_mgv1a004459mg                217   8e-64   Erythranthe guttata [common monkey flower]
gb|ADE06226.1|  gamma-glutamylcysteine synthetase                       216   2e-63   Hevea brasiliensis [jebe]
ref|XP_009350439.1|  PREDICTED: glutamate--cysteine ligase, chlor...    212   1e-62   
ref|XP_009350438.1|  PREDICTED: glutamate--cysteine ligase, chlor...    212   1e-62   
gb|KJB37541.1|  hypothetical protein B456_006G209400                    212   5e-62   Gossypium raimondii
ref|XP_009350437.1|  PREDICTED: glutamate--cysteine ligase, chlor...    212   5e-62   Pyrus x bretschneideri [bai li]
gb|KJB37540.1|  hypothetical protein B456_006G209400                    212   5e-62   Gossypium raimondii
gb|AGI36546.1|  gamma-glutamylcysteine synthetase                       202   7e-62   Brassica oleracea var. botrytis [cauliflower]
ref|XP_008341055.1|  PREDICTED: glutamate--cysteine ligase, chlor...    212   7e-62   Malus domestica [apple tree]
ref|XP_009350436.1|  PREDICTED: glutamate--cysteine ligase, chlor...    212   7e-62   Pyrus x bretschneideri [bai li]
ref|XP_008341054.1|  PREDICTED: glutamate--cysteine ligase, chlor...    212   7e-62   Malus domestica [apple tree]
ref|XP_008341053.1|  PREDICTED: glutamate--cysteine ligase, chlor...    212   7e-62   Malus domestica [apple tree]
ref|XP_002509800.1|  Glutamate--cysteine ligase, chloroplast prec...    211   9e-62   Ricinus communis
ref|XP_007209899.1|  hypothetical protein PRUPE_ppa004151mg             211   1e-61   Prunus persica
ref|XP_002273626.1|  PREDICTED: glutamate--cysteine ligase, chlor...    211   1e-61   Vitis vinifera
dbj|BAP47506.1|  gamma-glutamylcysteine synthetase                      211   1e-61   Gentiana triflora
ref|XP_011022699.1|  PREDICTED: glutamate--cysteine ligase, chlor...    211   2e-61   Populus euphratica
ref|XP_008238836.1|  PREDICTED: glutamate--cysteine ligase, chlor...    210   3e-61   Prunus mume [ume]
ref|XP_011072645.1|  PREDICTED: glutamate--cysteine ligase, chlor...    210   3e-61   Sesamum indicum [beniseed]
ref|XP_012086908.1|  PREDICTED: glutamate--cysteine ligase, chlor...    209   5e-61   
gb|AHJ60103.1|  gamma-glutamylcysteine synthetase                       209   6e-61   Pyrus betulifolia
ref|XP_007040225.1|  Glutamate-cysteine ligase isoform 1                209   8e-61   
ref|XP_009364899.1|  PREDICTED: glutamate--cysteine ligase, chlor...    209   1e-60   Pyrus x bretschneideri [bai li]
ref|XP_009364919.1|  PREDICTED: glutamate--cysteine ligase, chlor...    208   1e-60   Pyrus x bretschneideri [bai li]
ref|XP_009364953.1|  PREDICTED: glutamate--cysteine ligase, chlor...    208   2e-60   Pyrus x bretschneideri [bai li]
ref|XP_011029270.1|  PREDICTED: glutamate--cysteine ligase, chlor...    207   3e-60   Populus euphratica
gb|AFF18844.2|  gamma-glutamylcysteine synthetase                       207   3e-60   Dimocarpus longan [longan]
ref|XP_011463882.1|  PREDICTED: glutamate--cysteine ligase, chlor...    206   6e-60   Fragaria vesca subsp. vesca
ref|XP_002304493.2|  hypothetical protein POPTR_0003s12700g             205   1e-59   
dbj|BAD27390.1|  gamma-glutamylcysteine synthetase                      206   2e-59   Zinnia elegans [garden zinnia]
ref|NP_001292626.1|  glutamate--cysteine ligase, chloroplastic          205   2e-59   Cucumis sativus [cucumbers]
gb|ABK96626.1|  unknown                                                 205   2e-59   Populus trichocarpa x Populus deltoides
ref|XP_008360718.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--c...    203   2e-59   
gb|ACJ83305.1|  unknown                                                 195   2e-59   Medicago truncatula
ref|XP_010053262.1|  PREDICTED: glutamate--cysteine ligase, chlor...    205   3e-59   Eucalyptus grandis [rose gum]
ref|XP_010053261.1|  PREDICTED: glutamate--cysteine ligase, chlor...    205   4e-59   Eucalyptus grandis [rose gum]
ref|XP_010089108.1|  Glutamate--cysteine ligase                         206   5e-59   
ref|XP_002298035.2|  hypothetical protein POPTR_0001s09340g             204   6e-59   Populus trichocarpa [western balsam poplar]
ref|XP_006439555.1|  hypothetical protein CICLE_v10019696mg             202   2e-58   
ref|XP_011654747.1|  PREDICTED: glutamate--cysteine ligase, chlor...    202   2e-58   Cucumis sativus [cucumbers]
ref|XP_006439556.1|  hypothetical protein CICLE_v10019696mg             202   2e-58   
emb|CAK24967.1|  gamma-glutamylcysteine synthetase                      201   8e-58   Brassica napus [oilseed rape]
ref|XP_006439553.1|  hypothetical protein CICLE_v10019696mg             201   8e-58   Citrus clementina [clementine]
ref|NP_001031701.1|  glutamate-cysteine ligase                          199   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008437270.1|  PREDICTED: glutamate--cysteine ligase, chlor...    200   2e-57   Cucumis melo [Oriental melon]
ref|XP_008792987.1|  PREDICTED: glutamate--cysteine ligase, chlor...    199   4e-57   Phoenix dactylifera
emb|CAA71075.1|  gamma-glutamylcysteine synthetase                      199   4e-57   Arabidopsis thaliana [mouse-ear cress]
gb|AAL16161.1|AF428393_1  AT4g23100/F7H19_290                           199   5e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010920822.1|  PREDICTED: glutamate--cysteine ligase, chlor...    199   5e-57   Elaeis guineensis
gb|ABJ98542.1|  gamma-glutamylcysteine synthetase                       199   5e-57   Arabidopsis thaliana [mouse-ear cress]
gb|AAL08228.1|  AT4g23100/F7H19_290                                     199   5e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194041.1|  glutamate-cysteine ligase                             199   5e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CAA82626.1|  gamma-glutamylcysteine synthetase                      199   8e-57   Arabidopsis thaliana [mouse-ear cress]
sp|O23736.1|GSH1_BRAJU  RecName: Full=Glutamate--cysteine ligase,...    198   1e-56   Brassica juncea [brown mustard]
gb|AHC02699.1|  gamma-glutamylcysteine synthetase                       197   1e-56   Pyrus calleryana [Bradford pear]
ref|XP_009136711.1|  PREDICTED: glutamate--cysteine ligase, chlor...    197   1e-56   Brassica rapa
emb|CDY41249.1|  BnaA01g12900D                                          197   1e-56   Brassica napus [oilseed rape]
ref|XP_008792975.1|  PREDICTED: glutamate--cysteine ligase, chlor...    199   2e-56   
ref|XP_008792981.1|  PREDICTED: glutamate--cysteine ligase, chlor...    199   2e-56   
gb|ACX70134.1|  gamma-glutamylcysteine synthetase                       197   2e-56   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_010540840.1|  PREDICTED: glutamate--cysteine ligase, chlor...    196   4e-56   Tarenaya hassleriana [spider flower]
ref|XP_006476577.1|  PREDICTED: glutamate--cysteine ligase, chlor...    196   5e-56   
ref|XP_010540831.1|  PREDICTED: glutamate--cysteine ligase, chlor...    196   6e-56   Tarenaya hassleriana [spider flower]
gb|AAG13459.1|AF128453_1  gamma-glutamylcysteine synthetase precu...    191   6e-56   Glycine max [soybeans]
gb|AAF22136.1|AF128454_1  gamma-glutamylcysteine synthetase precu...    195   1e-55   Phaseolus vulgaris [French bean]
ref|XP_007160058.1|  hypothetical protein PHAVU_002G289200g             195   1e-55   Phaseolus vulgaris [French bean]
ref|XP_010255398.1|  PREDICTED: glutamate--cysteine ligase, chlor...    195   1e-55   Nelumbo nucifera [Indian lotus]
gb|AAO45821.1|  gamma-glutamylcysteine synthetase                       194   1e-55   Lotus japonicus
gb|KDP25439.1|  hypothetical protein JCGZ_20595                         194   1e-55   Jatropha curcas
ref|XP_010695138.1|  PREDICTED: glutamate--cysteine ligase, chlor...    192   2e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002867730.1|  hypothetical protein ARALYDRAFT_492552             194   3e-55   
ref|XP_010448772.1|  PREDICTED: glutamate--cysteine ligase, chlor...    194   3e-55   Camelina sativa [gold-of-pleasure]
gb|AEA77156.1|  chloroplast gamma glutamyl cysteine synthetase          194   3e-55   Vigna radiata [mung bean]
gb|KDO76213.1|  hypothetical protein CISIN_1g010751mg                   191   4e-55   Citrus sinensis [apfelsine]
ref|XP_006413578.1|  hypothetical protein EUTSA_v10024916mg             194   5e-55   
ref|XP_010439228.1|  PREDICTED: glutamate--cysteine ligase, chlor...    193   6e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010433943.1|  PREDICTED: glutamate--cysteine ligase, chlor...    193   7e-55   Camelina sativa [gold-of-pleasure]
gb|KDO76211.1|  hypothetical protein CISIN_1g010751mg                   191   8e-55   Citrus sinensis [apfelsine]
gb|KGN50100.1|  hypothetical protein Csa_5G153150                       192   9e-55   Cucumis sativus [cucumbers]
ref|XP_010695135.1|  PREDICTED: glutamate--cysteine ligase, chlor...    192   1e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009137315.1|  PREDICTED: glutamate--cysteine ligase, chlor...    192   1e-54   Brassica rapa
ref|XP_003630512.1|  Glutamate-cysteine ligase                          192   1e-54   Medicago truncatula
emb|CAD91714.1|  glutamate-cysteine ligase                              192   1e-54   Brassica juncea [brown mustard]
ref|XP_006283533.1|  hypothetical protein CARUB_v10004582mg             192   3e-54   Capsella rubella
gb|KDO76206.1|  hypothetical protein CISIN_1g010751mg                   191   3e-54   Citrus sinensis [apfelsine]
ref|XP_006586325.1|  PREDICTED: glutamate--cysteine ligase, chlor...    191   3e-54   
gb|KHN16824.1|  Glutamate--cysteine ligase, chloroplastic               191   4e-54   Glycine soja [wild soybean]
ref|XP_004503722.1|  PREDICTED: glutamate--cysteine ligase, chlor...    190   6e-54   Cicer arietinum [garbanzo]
ref|XP_010529570.1|  PREDICTED: glutamate--cysteine ligase, chlor...    191   6e-54   Tarenaya hassleriana [spider flower]
ref|XP_009402382.1|  PREDICTED: glutamate--cysteine ligase A, chl...    190   7e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003525397.1|  PREDICTED: glutamate--cysteine ligase, chlor...    190   1e-53   Glycine max [soybeans]
ref|XP_010937863.1|  PREDICTED: glutamate--cysteine ligase A, chl...    189   2e-53   Elaeis guineensis
ref|XP_008789126.1|  PREDICTED: glutamate--cysteine ligase A, chl...    189   3e-53   Phoenix dactylifera
gb|AAF22137.1|AF128455_1  gamma-glutamylcysteine synthetase precu...    187   7e-53   Pisum sativum [garden pea]
ref|XP_008351685.1|  PREDICTED: glutamate--cysteine ligase, chlor...    177   2e-52   
gb|EPS61788.1|  gamma-glutamylcysteine synthetase                       185   2e-52   Genlisea aurea
pdb|2GWD|A  Chain A, Crystal Structure Of Plant Glutamate Cystein...    185   3e-52   Brassica juncea [brown mustard]
emb|CDY10914.1|  BnaA03g45730D                                          186   4e-52   Brassica napus [oilseed rape]
gb|AAL61610.1|AF401621_1  gamma-glutamylcysteine synthetase             185   6e-52   Allium cepa
emb|CAR82640.1|  putative glutamyl cysteine ligase                      185   6e-52   Brassica napus [oilseed rape]
ref|XP_006851855.2|  PREDICTED: glutamate--cysteine ligase, chlor...    186   6e-52   Amborella trichopoda
ref|XP_009380693.1|  PREDICTED: glutamate--cysteine ligase A, chl...    184   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB37542.1|  hypothetical protein B456_006G209400                    184   2e-51   Gossypium raimondii
gb|ABM46854.1|  gamma-glutamylcysteine synthetase                       183   5e-51   Chorispora bungeana
ref|XP_007210716.1|  hypothetical protein PRUPE_ppa022884mg             180   2e-50   
pdb|2GWC|A  Chain A, Crystal Structure Of Plant Glutamate Cystein...    179   3e-50   Brassica juncea [brown mustard]
ref|XP_002439220.1|  hypothetical protein SORBIDRAFT_09g002470          181   3e-50   Sorghum bicolor [broomcorn]
ref|NP_001054541.1|  Os05g0129000                                       178   2e-49   
emb|CAD48599.3|  gamma-glutamylcysteine synthetase                      178   3e-49   Oryza sativa Japonica Group [Japonica rice]
sp|Q8GU95.2|GSH1A_ORYSI  RecName: Full=Glutamate--cysteine ligase...    178   3e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_008655177.1|  PREDICTED: uncharacterized protein LOC100381...    177   6e-49   
gb|EEE62203.1|  hypothetical protein OsJ_16990                          179   6e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009380691.1|  PREDICTED: glutamate--cysteine ligase A, chl...    174   9e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003611087.1|  Glutamate-cysteine ligase                          169   6e-47   
emb|CDY41369.1|  BnaC03g65140D                                          170   1e-46   Brassica napus [oilseed rape]
ref|XP_008648285.1|  PREDICTED: gamma-glutamylcysteine synthetase...    170   2e-46   Zea mays [maize]
gb|EEC81979.1|  hypothetical protein OsI_25896                          171   5e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_003569058.1|  PREDICTED: glutamate--cysteine ligase B, chl...    168   2e-45   Brachypodium distachyon [annual false brome]
ref|XP_003611086.1|  Glutamate-cysteine ligase                          167   2e-45   
sp|A2YL07.2|GSH1B_ORYSI  RecName: Full=Glutamate--cysteine ligase...    167   2e-45   Oryza sativa Indica Group [Indian rice]
sp|Q6Z3A3.1|GSH1B_ORYSJ  RecName: Full=Glutamate--cysteine ligase...    167   3e-45   Oryza sativa Japonica Group [Japonica rice]
emb|CAA06613.1|  gamma-glutamylcysteine synthetase                      165   7e-45   Brassica juncea [brown mustard]
ref|XP_004960382.1|  PREDICTED: glutamate--cysteine ligase B, chl...    166   1e-44   Setaria italica
ref|XP_004511574.1|  PREDICTED: glutamate--cysteine ligase, chlor...    166   1e-44   Cicer arietinum [garbanzo]
gb|EEE67118.1|  hypothetical protein OsJ_24143                          166   1e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010241948.1|  PREDICTED: glutamate--cysteine ligase, chlor...    156   5e-44   Nelumbo nucifera [Indian lotus]
ref|XP_003611083.1|  Glutamate-cysteine ligase                          155   1e-43   
gb|KDO76209.1|  hypothetical protein CISIN_1g010751mg                   163   1e-43   Citrus sinensis [apfelsine]
ref|XP_002965328.1|  hypothetical protein SELMODRAFT_83292              162   2e-43   
ref|XP_008375304.1|  PREDICTED: glutamate--cysteine ligase, chlor...    161   4e-43   
gb|ERM95077.1|  hypothetical protein AMTR_s00009p00252400               159   5e-43   Amborella trichopoda
ref|XP_008375303.1|  PREDICTED: glutamate--cysteine ligase, chlor...    160   6e-43   
ref|XP_011626090.1|  PREDICTED: glutamate--cysteine ligase, chlor...    159   1e-42   
ref|NP_001105142.1|  gamma-glutamylcysteine synthetase1                 157   4e-42   Zea mays [maize]
ref|XP_010241950.1|  PREDICTED: glutamate--cysteine ligase, chlor...    150   1e-41   
gb|ADY17635.1|  gamma-glutamylcysteine synthetase                       153   1e-41   Salix sachalinensis
emb|CAD48598.1|  gamma-glutamylcysteine synthetase                      156   2e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654002.1|  PREDICTED: glutamate--cysteine ligase B, chl...    155   3e-41   
gb|KFK30813.1|  hypothetical protein AALP_AA6G029500                    154   1e-40   Arabis alpina [alpine rockcress]
ref|XP_003516702.1|  PREDICTED: glutamate--cysteine ligase, chlor...    153   3e-40   Glycine max [soybeans]
ref|XP_002867731.1|  hypothetical protein ARALYDRAFT_914292             152   7e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_002875199.1|  predicted protein                                  151   1e-39   Arabidopsis lyrata subsp. lyrata
ref|XP_006283598.1|  hypothetical protein CARUB_v10004654mg             151   2e-39   Capsella rubella
ref|XP_010448777.1|  PREDICTED: glutamate--cysteine ligase, chlor...    150   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010448775.1|  PREDICTED: glutamate--cysteine ligase, chlor...    149   5e-39   Camelina sativa [gold-of-pleasure]
dbj|BAJ21771.1|  putative gamma-glutamylcysteine synthetase             149   7e-39   Pteris vittata
ref|XP_010439235.1|  PREDICTED: glutamate--cysteine ligase, chlor...    149   8e-39   
dbj|BAJ21770.1|  putative gamma-glutamylcysteine synthetase             149   1e-38   Pteris vittata
ref|XP_001785532.1|  predicted protein                                  147   3e-38   
ref|XP_010439234.1|  PREDICTED: glutamate--cysteine ligase, chlor...    147   5e-38   
ref|XP_010439231.1|  PREDICTED: glutamate--cysteine ligase, chlor...    147   5e-38   Camelina sativa [gold-of-pleasure]
ref|XP_008346998.1|  PREDICTED: glutamate--cysteine ligase, chlor...    138   7e-38   
ref|XP_010440635.1|  PREDICTED: glutamate--cysteine ligase, chlor...    146   7e-38   Camelina sativa [gold-of-pleasure]
emb|CDX94156.1|  BnaC07g37900D                                          147   8e-38   
ref|XP_010435330.1|  PREDICTED: glutamate--cysteine ligase, chlor...    146   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010439229.1|  PREDICTED: glutamate--cysteine ligase, chlor...    145   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010440632.1|  PREDICTED: glutamate--cysteine ligase, chlor...    145   2e-37   
ref|XP_002974231.1|  hypothetical protein SELMODRAFT_101407             145   2e-37   
ref|XP_010433942.1|  PREDICTED: glutamate--cysteine ligase, chlor...    145   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002977172.1|  hypothetical protein SELMODRAFT_232900             145   2e-37   
emb|CDY63259.1|  BnaA03g58670D                                          145   3e-37   Brassica napus [oilseed rape]
ref|XP_010448773.1|  PREDICTED: glutamate--cysteine ligase, chlor...    145   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_004971557.1|  PREDICTED: glutamate--cysteine ligase B, chl...    144   7e-37   
ref|XP_007158499.1|  hypothetical protein PHAVU_002G157600g             144   9e-37   Phaseolus vulgaris [French bean]
ref|XP_002985600.1|  hypothetical protein SELMODRAFT_122883             143   1e-36   
ref|XP_009137312.1|  PREDICTED: glutamate--cysteine ligase, chlor...    143   1e-36   Brassica rapa
ref|XP_001757520.1|  predicted protein                                  142   3e-36   
gb|AES94042.2|  gamma glutamyl cysteine synthetase                      131   7e-34   Medicago truncatula
gb|ADX30738.2|  truncated gamma-glutamyl-cysteine synthetase            129   6e-32   Populus x canadensis [Canadian poplar]
gb|ERN13322.1|  hypothetical protein AMTR_s00041p00090940               120   1e-28   Amborella trichopoda
ref|XP_004971558.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--c...    120   2e-28   
ref|XP_005844806.1|  hypothetical protein CHLNCDRAFT_26566              117   2e-27   Chlorella variabilis
ref|XP_001778732.1|  predicted protein                                  117   4e-27   
ref|XP_003062187.1|  predicted protein                                  112   2e-25   Micromonas pusilla CCMP1545
ref|XP_005646648.1|  plant glutamate cysteine ligase in complex w...    111   3e-25   Coccomyxa subellipsoidea C-169
ref|XP_002507857.1|  predicted protein                                  108   3e-24   Micromonas commoda
gb|KIY94325.1|  glutamate--cysteine ligase                              107   5e-24   Monoraphidium neglectum
ref|WP_035612545.1|  glutamate--cysteine ligase                         107   1e-23   Hyphomonas johnsonii
ref|XP_001701647.1|  gamma-glutamylcysteine synthetase                  106   2e-23   Chlamydomonas reinhardtii
gb|KCZ62975.1|  glutamate--cysteine ligase                              104   8e-23   Hyphomonas sp. L-53-1-40
ref|WP_012568753.1|  glutamate--cysteine ligase                         103   2e-22   Rhodospirillum centenum
gb|AFC88288.1|  gamma-glutamylcysteine synthetase                       103   2e-22   Chlamydomonas sp. ICE-L
ref|WP_035537514.1|  glutamate--cysteine ligase                         102   3e-22   Hyphomonas oceanitis
ref|WP_027840020.1|  glutamate--cysteine ligase                         102   3e-22   
gb|KDA02929.1|  glutamate--cysteine ligase                              102   4e-22   Hyphomonas oceanitis SCH89
ref|WP_035583514.1|  glutamate--cysteine ligase                         102   6e-22   Hyphomonas jannaschiana
ref|WP_045654749.1|  glutamate--cysteine ligase                         102   7e-22   
gb|KCZ97952.1|  glutamate--cysteine ligase                              102   7e-22   Hyphomonas polymorpha PS728
ref|WP_034815788.1|  glutamate--cysteine ligase                         101   1e-21   
emb|CEG00964.1|  Glutamate--cysteine ligase, plant                      101   1e-21   Ostreococcus tauri
gb|KCZ49144.1|  glutamate--cysteine ligase                              100   1e-21   Hyphomonas sp. CY54-11-8
ref|WP_018998172.1|  glutamate--cysteine ligase                         100   2e-21   Hirschia maritima
ref|WP_015826863.1|  glutamate--cysteine ligase                         100   3e-21   Hirschia baltica
ref|WP_007256884.1|  glutamate--cysteine ligase                         100   3e-21   Oceanicola granulosus
ref|WP_020085081.1|  glutamate--cysteine ligase                       99.8    4e-21   Hyphomicrobium zavarzinii
ref|WP_038036730.1|  glutamate--cysteine ligase                       99.4    5e-21   
ref|WP_025311017.1|  glutamate--cysteine ligase                       99.4    6e-21   Roseibacterium elongatum
ref|WP_043871177.1|  glutamate--cysteine ligase                       99.4    6e-21   Celeribacter indicus
ref|WP_034763127.1|  glutamate--cysteine ligase                       99.0    7e-21   
ref|WP_036701928.1|  glutamate--cysteine ligase                       99.0    7e-21   Paracoccus sanguinis
ref|WP_013383393.1|  glutamate--cysteine ligase                       99.0    8e-21   Ketogulonicigenium vulgare
ref|WP_014537450.1|  glutamate--cysteine ligase                       99.0    8e-21   Ketogulonicigenium vulgare
ref|WP_036707793.1|  glutamate--cysteine ligase                       99.0    9e-21   Paracoccus sanguinis
ref|WP_011457023.1|  glutamate--cysteine ligase                       99.0    9e-21   Jannaschia sp. CCS1
ref|WP_022694894.1|  glutamate--cysteine ligase                       99.0    9e-21   Ponticaulis koreensis
ref|WP_034744831.1|  glutamate--cysteine ligase                       99.0    9e-21   Hyphomonas chukchiensis
ref|WP_043131585.1|  glutamate--cysteine ligase                       99.0    9e-21   Paracoccus sanguinis
ref|WP_035571182.1|  glutamate--cysteine ligase                       98.6    1e-20   Hyphomonas adhaerens
ref|WP_039718559.1|  glutamate--cysteine ligase                       98.6    1e-20   
gb|KCZ53527.1|  glutamate--cysteine ligase                            98.6    1e-20   Hyphomonas chukchiensis
ref|WP_043831764.1|  glutamate--cysteine ligase                       98.2    1e-20   Roseomonas aerilata
ref|WP_045696674.1|  glutamate--cysteine ligase                       98.2    1e-20   
ref|WP_031555060.1|  glutamate--cysteine ligase                       98.2    1e-20   
ref|WP_007427205.1|  glutamate--cysteine ligase                       98.2    1e-20   Oceaniovalibus guishaninsula
ref|WP_036733683.1|  glutamate--cysteine ligase                       98.2    2e-20   Paracoccus sanguinis
ref|WP_035599559.1|  glutamate--cysteine ligase                       97.8    2e-20   
gb|ABI75913.1|  glutamate--cysteine ligase                            97.8    2e-20   Hyphomonas neptunium ATCC 15444
ref|WP_015921392.1|  glutamate--cysteine ligase                       97.4    3e-20   Rhodobacter sphaeroides
ref|WP_011570131.1|  glutamate--cysteine ligase                       97.1    3e-20   Roseobacter denitrificans
ref|WP_009572338.1|  glutamate--cysteine ligase                       97.1    4e-20   Celeribacter baekdonensis
ref|WP_018147083.1|  glutamate--cysteine ligase                       97.1    5e-20   Henriciella marina
ref|WP_008944552.1|  glutamate--cysteine ligase                       96.7    5e-20   Oceanibaculum indicum
ref|WP_037944812.1|  glutamate--cysteine ligase                       96.7    6e-20   Sulfitobacter
ref|WP_037966014.1|  glutamate--cysteine ligase                       96.7    6e-20   Sulfitobacter pontiacus
ref|WP_005849673.1|  glutamate--cysteine ligase                       96.3    6e-20   Sulfitobacter sp. EE-36
ref|WP_024088897.1|  glutamate--cysteine ligase                       96.3    8e-20   Leisingera methylohalidivorans
ref|WP_012654088.1|  glutamate--cysteine ligase                       95.5    1e-19   Agrobacterium vitis
dbj|BAQ68193.1|  glutamate-cysteine ligase                            95.5    1e-19   Rhodovulum sulfidophilum
ref|WP_042463612.1|  glutamate--cysteine ligase                       95.5    1e-19   Rhodovulum sulfidophilum
ref|WP_036716534.1|  glutamate--cysteine ligase                       95.5    2e-19   Paracoccus sphaerophysae
ref|WP_043136175.1|  glutamate--cysteine ligase                       95.5    2e-19   Mameliella alba
ref|WP_002721323.1|  glutamate--cysteine ligase                       95.5    2e-19   Rhodobacter sphaeroides
ref|WP_009563049.1|  Glutamate--cysteine ligase                       95.1    2e-19   Rhodobacter sp. AKP1
ref|WP_018304101.1|  glutamate--cysteine ligase                       95.1    2e-19   Wenxinia marina
ref|WP_028098740.1|  glutamate--cysteine ligase                       95.1    2e-19   Dongia sp. URHE0060
ref|WP_011338651.1|  glutamate--cysteine ligase                       95.1    2e-19   Rhodobacter sphaeroides
ref|WP_027256476.1|  glutamate--cysteine ligase                       94.7    2e-19   Leisingera aquimarina
ref|WP_013960367.1|  glutamate--cysteine ligase                       94.7    3e-19   Roseobacter litoralis
ref|WP_027298647.1|  glutamate--cysteine ligase                       94.7    3e-19   Rhodospirillales bacterium URHD0088
ref|WP_031448324.1|  glutamate--cysteine ligase                       94.4    3e-19   Caulobacteraceae bacterium PMMR1
ref|WP_037909876.1|  glutamate--cysteine ligase                       94.4    4e-19   Sulfitobacter mediterraneus
ref|WP_020057893.1|  glutamate--cysteine ligase                       94.4    4e-19   
ref|WP_025047965.1|  glutamate--cysteine ligase                       94.4    4e-19   Sulfitobacter
ref|WP_008035160.1|  glutamate--cysteine ligase                       94.4    4e-19   Rhodobacterales bacterium HTCC2255
ref|WP_035590604.1|  MULTISPECIES: glutamate--cysteine ligase         94.0    4e-19   
ref|WP_007118944.1|  glutamate--cysteine ligase                       94.0    5e-19   Sulfitobacter indolifex
ref|WP_018631656.1|  hypothetical protein                             94.0    5e-19   Neomegalonema perideroedes
ref|WP_008227367.1|  glutamate--cysteine ligase                       94.0    5e-19   Roseobacter sp. GAI101
ref|WP_039159936.1|  glutamate--cysteine ligase                       94.0    5e-19   Leisingera sp. ANG-M1
dbj|GAD55534.1|  LOW QUALITY PROTEIN: glutamate--cysteine ligase      93.6    6e-19   Limimaricola cinnabarinus LL-001
ref|WP_009825249.1|  glutamate--cysteine ligase                       93.6    7e-19   Sulfitobacter
ref|WP_039181640.1|  glutamate--cysteine ligase                       93.6    7e-19   Leisingera sp. ANG-M7
ref|WP_038005861.1|  MULTISPECIES: glutamate--cysteine ligase         93.6    8e-19   Thalassobacter
ref|WP_046021998.1|  glutamate--cysteine ligase                       93.2    8e-19   Magnetospira sp. QH-2
gb|KDO76210.1|  hypothetical protein CISIN_1g010751mg                 92.4    9e-19   Citrus sinensis [apfelsine]
ref|WP_025045830.1|  glutamate--cysteine ligase                       93.2    9e-19   Sulfitobacter geojensis
ref|WP_011841809.1|  glutamate--cysteine ligase                       93.2    9e-19   Rhodobacter sphaeroides
ref|WP_034794187.1|  glutamate--cysteine ligase                       93.2    1e-18   Hyphomonas beringensis
ref|WP_007668376.1|  glutamate--cysteine ligase                       93.2    1e-18   Caulobacter sp. AP07
ref|WP_041643346.1|  glutamate--cysteine ligase                       93.2    1e-18   
ref|WP_008280351.1|  glutamate--cysteine ligase                       93.2    1e-18   Roseovarius
ref|XP_009138281.1|  PREDICTED: glutamate--cysteine ligase, chlor...  87.4    1e-18   Brassica rapa
ref|XP_009138279.1|  PREDICTED: glutamate--cysteine ligase, chlor...  87.4    1e-18   Brassica rapa
ref|WP_045829033.1|  glutamate--cysteine ligase                       93.2    1e-18   Luteibacter yeojuensis
gb|ABK46164.1|  glutamate--cysteine ligase                            92.8    1e-18   Magnetococcus marinus MC-1
ref|WP_039191673.1|  glutamate--cysteine ligase                       92.8    1e-18   Leisingera sp. ANG-M6
ref|WP_039149394.1|  glutamate--cysteine ligase                       92.8    1e-18   Leisingera sp. ANG-DT
ref|WP_019297147.1|  MULTISPECIES: glutamate--cysteine ligase         92.8    1e-18   Leisingera
ref|WP_039173812.1|  glutamate--cysteine ligase                       92.8    1e-18   Leisingera sp. ANG-S5
ref|WP_036637388.1|  glutamate--cysteine ligase                       92.4    2e-18   Paenirhodobacter enshiensis
ref|WP_043917987.1|  glutamate--cysteine ligase                       92.8    2e-18   Jannaschia aquimarina
ref|WP_009809702.1|  glutamate--cysteine ligase                       92.4    2e-18   
gb|KCW77522.1|  hypothetical protein EUGRSUZ_D01848                   91.7    2e-18   
ref|WP_025050606.1|  glutamate--cysteine ligase                       92.4    2e-18   
ref|WP_028030001.1|  glutamate--cysteine ligase                       92.4    2e-18   
ref|WP_025054601.1|  glutamate--cysteine ligase                       92.4    2e-18   
ref|WP_035262427.1|  glutamate--cysteine ligase                       92.4    2e-18   
ref|WP_037244759.1|  glutamate--cysteine ligase                       92.4    2e-18   
ref|WP_039688281.1|  glutamate--cysteine ligase                       92.4    2e-18   
ref|WP_027241581.1|  glutamate--cysteine ligase                       92.4    2e-18   
ref|WP_017931593.1|  hypothetical protein                             92.0    3e-18   
ref|WP_012284466.1|  glutamate--cysteine ligase                       92.0    3e-18   
ref|WP_044559775.1|  glutamate--cysteine ligase                       92.0    3e-18   
ref|WP_008331213.1|  glutamate--cysteine ligase                       92.0    3e-18   
ref|WP_020038423.1|  glutamate--cysteine ligase                       92.0    3e-18   
ref|WP_008554755.1|  glutamate--cysteine ligase                       91.7    3e-18   
ref|WP_009819233.1|  glutamate--cysteine ligase                       91.7    3e-18   
ref|WP_040990658.1|  glutamate--cysteine ligase                       91.7    3e-18   
ref|WP_041004352.1|  glutamate--cysteine ligase                       91.7    3e-18   
ref|WP_019953566.1|  glutamate--cysteine ligase                       91.7    4e-18   
ref|WP_011049305.1|  glutamate--cysteine ligase                       91.7    4e-18   
ref|WP_029911457.1|  glutamate--cysteine ligase                       91.7    4e-18   
ref|XP_001418312.1|  gamma-glutamate cysteine synthase                91.7    4e-18   
ref|WP_041010010.1|  glutamate--cysteine ligase                       91.7    4e-18   
ref|WP_045683558.1|  glutamate--cysteine ligase                       91.7    4e-18   
ref|WP_010141018.1|  glutamate--cysteine ligase                       91.3    4e-18   
ref|WP_039131405.1|  glutamate--cysteine ligase                       91.3    4e-18   
ref|WP_012179758.1|  glutamate--cysteine ligase                       91.3    4e-18   
ref|WP_008561563.1|  glutamate--cysteine ligase                       91.3    5e-18   
ref|WP_008891547.1|  glutamate--cysteine ligase                       91.3    5e-18   
ref|WP_040849077.1|  glutamate--cysteine ligase                       91.3    5e-18   
ref|WP_035076274.1|  glutamate--cysteine ligase                       91.3    5e-18   
ref|WP_027673864.1|  glutamate--cysteine ligase                       91.3    5e-18   
ref|WP_027244640.1|  glutamate--cysteine ligase                       91.3    5e-18   
ref|WP_008208925.1|  glutamate--cysteine ligase                       91.3    5e-18   
gb|ADM10280.1|  glutamate--cysteine ligase                            90.9    6e-18   
ref|WP_035047089.1|  glutamate--cysteine ligase                       90.9    6e-18   
ref|WP_044826967.1|  glutamate--cysteine ligase                       90.9    6e-18   
ref|WP_028092401.1|  glutamate--cysteine ligase                       90.9    6e-18   
ref|XP_005981417.1|  PREDICTED: glutamate--cysteine ligase, chlor...  90.9    6e-18   
ref|WP_025063362.1|  glutamate--cysteine ligase                       90.9    6e-18   
gb|KCZ59182.1|  glutamate--cysteine ligase                            90.9    6e-18   
emb|CDY45302.1|  BnaA03g52750D                                        88.2    6e-18   
ref|WP_039615750.1|  glutamate--cysteine ligase                       90.9    6e-18   
ref|WP_011907279.1|  glutamate--cysteine ligase                       90.9    7e-18   
ref|WP_026940724.1|  glutamate--cysteine ligase                       90.5    7e-18   
ref|WP_022571217.1|  glutamate--cysteine ligase, plant type           90.9    7e-18   
ref|WP_017929555.1|  glutamate--cysteine ligase                       90.9    7e-18   
ref|WP_041003537.1|  glutamate--cysteine ligase                       90.5    8e-18   
ref|WP_037211212.1|  glutamate--cysteine ligase                       90.5    8e-18   
dbj|GAN00159.1|  glutamate--cysteine ligase                           90.5    9e-18   
ref|WP_028038147.1|  glutamate--cysteine ligase                       90.5    9e-18   
ref|WP_040973710.1|  glutamate--cysteine ligase                       90.5    1e-17   
ref|WP_018289050.1|  hypothetical protein                             90.1    1e-17   
ref|WP_036179038.1|  glutamate--cysteine ligase                       90.5    1e-17   
emb|CCF18117.1|  Glutamate--cysteine ligase, chloroplastic            90.1    1e-17   
ref|XP_009138280.1|  PREDICTED: glutamate--cysteine ligase, chlor...  84.7    1e-17   
ref|WP_008593913.1|  glutamate--cysteine ligase                       90.1    1e-17   
ref|WP_035029482.1|  MULTISPECIES: glutamate--cysteine ligase         90.1    1e-17   
ref|WP_007196210.1|  glutamate--cysteine ligase                       90.1    1e-17   
ref|WP_039018738.1|  glutamate--cysteine ligase                       90.1    1e-17   
gb|ESQ76538.1|  glutamate--cysteine ligase                            90.1    1e-17   
ref|WP_007206794.1|  glutamate--cysteine ligase                       89.7    2e-17   
ref|WP_029011247.1|  glutamate--cysteine ligase                       89.7    2e-17   
ref|WP_037269048.1|  glutamate--cysteine ligase                       89.7    2e-17   
ref|WP_045392021.1|  glutamate--cysteine ligase                       89.7    2e-17   
ref|WP_028287925.1|  glutamate--cysteine ligase                       89.7    2e-17   
ref|WP_045647268.1|  glutamate--cysteine ligase                       89.7    2e-17   
ref|WP_024098545.1|  glutamate--cysteine ligase, plant type           89.7    2e-17   
ref|WP_011536696.1|  glutamate--cysteine ligase                       89.4    2e-17   
ref|WP_040171354.1|  glutamate--cysteine ligase                       89.4    2e-17   
ref|WP_037991147.1|  glutamate--cysteine ligase                       89.4    2e-17   
ref|WP_014873403.1|  MULTISPECIES: glutamate--cysteine ligase         89.4    2e-17   
gb|KCZ51869.1|  glutamate--cysteine ligase                            89.4    2e-17   
ref|WP_042640977.1|  glutamate--cysteine ligase                       89.4    2e-17   
ref|WP_040180655.1|  glutamate--cysteine ligase                       89.4    2e-17   
ref|WP_007812764.1|  glutamate--cysteine ligase                       89.4    2e-17   
ref|WP_028033997.1|  glutamate--cysteine ligase                       89.4    2e-17   
ref|WP_011628951.1|  glutamate--cysteine ligase                       89.4    2e-17   
ref|WP_012973384.1|  glutamate--cysteine ligase                       89.4    2e-17   
ref|WP_010394011.1|  glutamate--cysteine ligase                       89.4    2e-17   
ref|WP_033069251.1|  glutamate--cysteine ligase                       89.4    2e-17   
ref|WP_037279315.1|  glutamate--cysteine ligase                       89.4    3e-17   
ref|WP_028770479.1|  glutamate--cysteine ligase                       89.4    3e-17   
ref|WP_027235179.1|  glutamate--cysteine ligase                       89.4    3e-17   
ref|WP_035528788.1|  glutamate--cysteine ligase                       89.0    3e-17   
ref|WP_008755986.1|  glutamate--cysteine ligase                       89.0    3e-17   
ref|WP_022707282.1|  glutamate--cysteine ligase                       89.0    3e-17   
ref|WP_045581954.1|  glutamate--cysteine ligase                       89.0    3e-17   
ref|WP_005640786.1|  glutamate--cysteine ligase                       89.0    3e-17   
ref|WP_042248429.1|  glutamate--cysteine ligase                       89.0    4e-17   
ref|WP_009175638.1|  glutamate--cysteine ligase                       89.0    4e-17   
ref|WP_020949400.1|  glutamate-cysteine ligase                        88.6    4e-17   
ref|WP_024843638.1|  glutamate--cysteine ligase                       88.6    4e-17   
ref|WP_020694464.1|  hypothetical protein                             88.6    4e-17   
ref|WP_045981076.1|  glutamate--cysteine ligase                       88.6    4e-17   
ref|WP_007091204.1|  glutamate--cysteine ligase                       88.6    4e-17   
ref|WP_046000002.1|  glutamate--cysteine ligase                       88.6    4e-17   
ref|WP_035554031.1|  glutamate--cysteine ligase                       88.6    4e-17   
ref|WP_017463721.1|  glutamate--cysteine ligase                       88.6    4e-17   
ref|WP_043948471.1|  glutamate--cysteine ligase                       88.6    5e-17   
ref|WP_027164308.1|  glutamate--cysteine ligase                       88.6    5e-17   
ref|WP_009805745.1|  glutamate--cysteine ligase                       88.2    5e-17   
ref|WP_035707859.1|  glutamate--cysteine ligase                       88.2    5e-17   
ref|WP_045681366.1|  glutamate--cysteine ligase                       88.2    5e-17   
ref|WP_013077468.1|  glutamate--cysteine ligase                       88.2    5e-17   
gb|ADI20112.1|  gamma-glutamylcysteine synthetase                     88.2    6e-17   
ref|WP_025898136.1|  glutamate--cysteine ligase                       88.2    6e-17   
ref|WP_028958648.1|  glutamate--cysteine ligase                       88.2    6e-17   
ref|WP_022710514.1|  glutamate--cysteine ligase                       88.2    6e-17   
ref|WP_036482412.1|  glutamate--cysteine ligase                       88.2    6e-17   
ref|WP_008030431.1|  glutamate--cysteine ligase                       88.2    6e-17   
ref|WP_035745514.1|  glutamate--cysteine ligase                       87.8    7e-17   
ref|WP_005859104.1|  glutamate--cysteine ligase                       87.8    7e-17   
ref|WP_023788514.1|  glutamate--cysteine ligase                       87.8    7e-17   
ref|WP_018116164.1|  hypothetical protein                             84.7    7e-17   
ref|WP_010921243.1|  glutamate--cysteine ligase                       87.8    8e-17   
ref|WP_037924320.1|  glutamate--cysteine ligase                       87.8    8e-17   
ref|WP_036756177.1|  glutamate--cysteine ligase                       87.8    8e-17   
ref|WP_028717858.1|  glutamate--cysteine ligase                       87.8    8e-17   
ref|WP_011749120.1|  glutamate--cysteine ligase                       87.8    8e-17   
ref|WP_022704956.1|  glutamate--cysteine ligase                       87.8    8e-17   
ref|WP_042696029.1|  glutamate--cysteine ligase                       87.8    9e-17   
ref|WP_036740280.1|  glutamate--cysteine ligase                       87.8    9e-17   
ref|WP_020044267.1|  hypothetical protein                             87.8    9e-17   
ref|WP_046118514.1|  glutamate--cysteine ligase                       87.8    9e-17   
ref|WP_026613047.1|  glutamate--cysteine ligase                       87.8    9e-17   
ref|WP_023919107.1|  glutamate--cysteine ligase                       87.4    1e-16   
ref|WP_007797378.1|  glutamate--cysteine ligase                       87.4    1e-16   
ref|WP_005979126.1|  glutamate--cysteine ligase                       87.4    1e-16   
ref|WP_008438534.1|  glutamate--cysteine ligase                       87.4    1e-16   
ref|WP_025059631.1|  glutamate--cysteine ligase                       87.4    1e-16   
ref|WP_026633958.1|  glutamate--cysteine ligase                       87.4    1e-16   
ref|WP_019959805.1|  glutamate--cysteine ligase                       87.4    1e-16   
ref|WP_013066129.1|  glutamate--cysteine ligase                       87.4    1e-16   
ref|WP_023922999.1|  glutamate--cysteine ligase                       87.4    1e-16   
ref|WP_023912218.1|  glutamate--cysteine ligase                       87.4    1e-16   
ref|WP_027494082.1|  glutamate--cysteine ligase                       87.4    1e-16   
ref|WP_029014876.1|  glutamate--cysteine ligase                       87.4    1e-16   
ref|WP_043696285.1|  glutamate--cysteine ligase                       87.4    1e-16   
ref|WP_036109768.1|  MULTISPECIES: glutamate--cysteine ligase         87.4    1e-16   
ref|WP_019401656.1|  hypothetical protein                             87.4    1e-16   
ref|WP_004623350.1|  glutamate--cysteine ligase, plant type           87.4    1e-16   
ref|WP_011579720.1|  glutamate--cysteine ligase                       87.4    1e-16   
ref|WP_019463764.1|  glutamate--cysteine ligase                       87.4    1e-16   
ref|WP_035442344.1|  glutamate--cysteine ligase                       87.0    1e-16   
ref|WP_014416028.1|  glutamate--cysteine ligase                       87.0    1e-16   
ref|WP_041535609.1|  glutamate--cysteine ligase                       87.0    1e-16   
ref|WP_034825230.1|  glutamate--cysteine ligase                       87.0    1e-16   
ref|WP_027840761.1|  glutamate--cysteine ligase                       87.0    2e-16   
ref|WP_018426605.1|  glutamate--cysteine ligase                       87.0    2e-16   
ref|WP_029418256.1|  glutamate--cysteine ligase                       87.0    2e-16   
ref|WP_038621702.1|  glutamate--cysteine ligase                       87.0    2e-16   
ref|WP_028467521.1|  glutamate--cysteine ligase                       86.7    2e-16   
ref|WP_008187808.1|  glutamate--cysteine ligase                       86.7    2e-16   
ref|WP_008040667.1|  glutamate--cysteine ligase                       86.7    2e-16   
ref|WP_018688648.1|  MULTISPECIES: hypothetical protein               86.7    2e-16   
ref|WP_024588372.1|  glutamate--cysteine ligase                       86.7    2e-16   
ref|WP_012521098.1|  glutamate--cysteine ligase                       86.7    2e-16   
ref|WP_029041764.1|  glutamate--cysteine ligase                       86.7    2e-16   
ref|WP_022727621.1|  glutamate--cysteine ligase                       86.7    2e-16   
ref|WP_017998317.1|  glutamate--cysteine ligase                       86.7    2e-16   
ref|WP_041300348.1|  glutamate--cysteine ligase                       86.7    2e-16   
emb|CCB67029.1|  gamma-glutamylcysteine synthetase                    87.0    2e-16   
ref|WP_036515476.1|  glutamate--cysteine ligase                       86.7    2e-16   
ref|WP_034458644.1|  glutamate--cysteine ligase                       86.7    2e-16   
ref|WP_020055049.1|  hypothetical protein                             86.7    2e-16   
ref|WP_018065518.1|  glutamate--cysteine ligase                       86.7    2e-16   
ref|WP_025030022.1|  glutamate--cysteine ligase                       86.3    2e-16   
ref|WP_023432400.1|  Glutamate--cysteine ligase                       86.3    3e-16   
ref|WP_023450390.1|  glutamate--cysteine ligase                       86.3    3e-16   
ref|WP_043750433.1|  glutamate--cysteine ligase                       86.3    3e-16   
ref|WP_006726555.1|  glutamate--cysteine ligase                       86.3    3e-16   
ref|WP_022701642.1|  glutamate--cysteine ligase                       86.3    3e-16   
ref|XP_005977097.1|  PREDICTED: glutamate--cysteine ligase, chlor...  86.3    3e-16   
ref|WP_010443590.1|  glutamate--cysteine ligase                       86.3    3e-16   
ref|WP_028712189.1|  MULTISPECIES: glutamate--cysteine ligase         86.3    3e-16   
ref|WP_002725375.1|  glutamate--cysteine ligase                       86.3    3e-16   
ref|WP_036138872.1|  glutamate--cysteine ligase                       84.3    3e-16   
ref|WP_014241129.1|  glutamate--cysteine ligase                       85.9    3e-16   
ref|WP_026618399.1|  glutamate--cysteine ligase                       85.9    3e-16   
ref|WP_035675217.1|  glutamate--cysteine ligase                       85.9    4e-16   
ref|WP_004864473.1|  glutamate--cysteine ligase                       85.9    4e-16   
ref|WP_009870063.1|  Gamma-glutamylcysteine synthetase                85.9    4e-16   
ref|WP_019183743.1|  glutamate--cysteine ligase                       85.9    4e-16   
ref|WP_009364261.1|  glutamate--cysteine ligase                       85.9    4e-16   
ref|WP_022969328.1|  glutamate--cysteine ligase                       85.9    4e-16   
ref|WP_015398814.1|  glutamate-cysteine ligase                        85.9    4e-16   
ref|WP_010704819.1|  glutamate-cysteine ligase                        85.9    4e-16   
ref|WP_026030461.1|  glutamate--cysteine ligase                       85.9    4e-16   
ref|WP_025592557.1|  glutamate--cysteine ligase                       85.9    4e-16   
ref|WP_038144312.1|  glutamate--cysteine ligase                       85.9    4e-16   
ref|WP_013635532.1|  glutamate--cysteine ligase                       85.9    4e-16   
ref|WP_027999595.1|  glutamate--cysteine ligase                       85.9    4e-16   
ref|WP_019564258.1|  glutamate--cysteine ligase                       85.9    4e-16   
ref|WP_027285334.1|  glutamate--cysteine ligase                       85.5    4e-16   
ref|WP_038489924.1|  glutamate--cysteine ligase                       85.5    4e-16   
ref|WP_011995572.1|  glutamate--cysteine ligase                       85.5    5e-16   
ref|WP_028010423.1|  glutamate--cysteine ligase                       85.5    5e-16   
ref|WP_007799281.1|  glutamate--cysteine ligase                       85.5    5e-16   
ref|WP_010968802.1|  glutamate--cysteine ligase                       85.5    5e-16   
ref|WP_003494015.1|  glutamate--cysteine ligase                       85.5    5e-16   
emb|CCM66472.1|  glutamate--cysteine ligase precursor protein         85.9    5e-16   
ref|WP_003515206.1|  glutamate--cysteine ligase                       85.5    5e-16   
ref|WP_027990498.1|  glutamate--cysteine ligase                       85.5    5e-16   
gb|AEG03327.1|  glutamate/cysteine ligase                             85.9    5e-16   
ref|WP_003527223.1|  glutamate--cysteine ligase                       85.5    5e-16   
ref|WP_009803181.1|  glutamate--cysteine ligase                       85.5    5e-16   
ref|WP_027081073.1|  glutamate--cysteine ligase                       85.5    5e-16   
ref|WP_039001774.1|  glutamate--cysteine ligase                       85.5    5e-16   
ref|WP_004854162.1|  glutamate--cysteine ligase                       85.5    5e-16   
ref|WP_027262077.1|  glutamate--cysteine ligase                       85.5    5e-16   
ref|WP_045445239.1|  glutamate--cysteine ligase                       85.5    6e-16   
ref|WP_039540655.1|  glutamate--cysteine ligase                       85.5    6e-16   
ref|WP_007009691.1|  glutamate--cysteine ligase                       85.5    6e-16   
ref|WP_039522877.1|  glutamate--cysteine ligase                       85.1    6e-16   
ref|WP_021588178.1|  glutamate--cysteine ligase                       85.1    6e-16   
ref|WP_037316513.1|  glutamate--cysteine ligase                       85.1    6e-16   
ref|WP_016552865.1|  glutamate-cysteine ligase                        85.1    6e-16   
ref|WP_006589172.1|  glutamate--cysteine ligase                       85.1    6e-16   
ref|WP_023512633.1|  glutamate--cysteine ligase                       85.1    7e-16   
ref|WP_037139419.1|  glutamate--cysteine ligase                       85.1    7e-16   



>ref|XP_006343987.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Solanum 
tuberosum]
Length=523

 Score =   240 bits (613),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 148/177 (84%), Gaps = 12/177 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKG----VVNSMEMFKRNEIGFGFssssrsssKGMQGLRLE  259
            MALMSQ+G S+ ++SE ++C G    ++N+MEMFK  EI FG   SSR++S+ +QG  L 
Sbjct  1    MALMSQAGSSHCIYSEKIRCIGGHSNIMNNMEMFKMREICFGVDISSRNASRRVQGNHLN  60

Query  260  -----SRRGHGGLT-VAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKF  421
                 SRRG  GLT VAASPPTED V AAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKF
Sbjct  61   LIGVGSRRG--GLTIVAASPPTEDAVVAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKF  118

Query  422  GFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            GFEF TLRPMKY+QIA+LLNGI+ERFDW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  119  GFEFGTLRPMKYDQIADLLNGIAERFDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  175



>ref|XP_010325297.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Solanum lycopersicum]
 gb|ACQ91100.1| GSH1 [Solanum lycopersicum]
Length=523

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 146/176 (83%), Gaps = 10/176 (6%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKC----KGVVNSMEMFKRNEIGFGFssssrsssKGMQGLRLE  259
            MALMSQ+G S+ ++SE V+C    + ++N+M+MF+  EI FG   SSR++S+ +QG  L 
Sbjct  1    MALMSQAGSSHCIYSEKVRCISGHRSIINNMDMFRMREICFGVDISSRNASRRVQGNYLN  60

Query  260  -----SRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFG  424
                 SRRG   + VAASPPTED V AAEPLTKEDLVGYLASGCK+KEKWRIGTEHEKFG
Sbjct  61   HIGVGSRRGDLTI-VAASPPTEDAVVAAEPLTKEDLVGYLASGCKSKEKWRIGTEHEKFG  119

Query  425  FEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FEF TLRPMKY+QIA+LLNGI+ERFDW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  120  FEFGTLRPMKYDQIADLLNGIAERFDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  175



>ref|NP_001234010.1| glutamate--cysteine ligase, chloroplastic [Solanum lycopersicum]
 sp|O22493.1|GSH1_SOLLC RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: 
Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine 
synthetase; Flags: Precursor [Solanum lycopersicum]
 gb|AAB71230.1| gamma-glutamylcysteine synthetase [Solanum lycopersicum]
Length=523

 Score =   236 bits (601),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 146/176 (83%), Gaps = 10/176 (6%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKC----KGVVNSMEMFKRNEIGFGFssssrsssKGMQGLRLE  259
            MALMSQ+G S+ ++SE V+C    + ++N+M+MF+  EI FG   SSR++S+ +QG  L 
Sbjct  1    MALMSQAGSSHCIYSEKVRCISGHRSIINNMDMFRMREICFGVDISSRNASRRVQGNYLN  60

Query  260  -----SRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFG  424
                 SRRG   + VAASPPTED V AAEPLTKEDLVGYLASGCK+KEKWRIGTEHEKFG
Sbjct  61   HIGVGSRRGDLTI-VAASPPTEDAVVAAEPLTKEDLVGYLASGCKSKEKWRIGTEHEKFG  119

Query  425  FEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FEF TLRPMKY+QIA+LLNGI+ERFDW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  120  FEFGTLRPMKYDQIADLLNGIAERFDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  175



>ref|XP_009617977.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Nicotiana 
tomentosiformis]
Length=522

 Score =   233 bits (595),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 144/176 (82%), Gaps = 11/176 (6%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKC----KGVVNSMEMFKRNEIGFGFssssrsssKGMQGLRL-  256
            MALMSQ+G S+ ++SE +KC      + N+MEM K  EI FG + SSR+SSK MQG+ L 
Sbjct  1    MALMSQAGSSHCIYSEKMKCISGHNSITNNMEMLKMKEICFG-NISSRNSSKRMQGIYLD  59

Query  257  ----ESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFG  424
                E RRG   + VAASPPTED V AAEPLTKEDLV YLASGCK+KEKWRIGTEHEKFG
Sbjct  60   RVVMERRRGRLAI-VAASPPTEDAVVAAEPLTKEDLVAYLASGCKSKEKWRIGTEHEKFG  118

Query  425  FEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FEF +LRPMKYEQIAELLNGI+ERFDW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  119  FEFGSLRPMKYEQIAELLNGIAERFDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  174



>gb|AFP93564.1| GCS [Cestrum nocturnum]
Length=518

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 138/172 (80%), Gaps = 7/172 (4%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKGVVNSMEMFKRNEIGFGFssssrsssKGMQGLRL-----  256
            MALMSQ+G S+ +H E ++CKG  N ME+FK  EI FG   S R+SS   QG+ L     
Sbjct  1    MALMSQAGSSHCIHPEKIRCKGGHN-MEIFKLKEICFGVHISPRNSSNAKQGICLRRVGA  59

Query  257  ESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFE  436
            E RRG   + VAASPPT+D V AAEPLTKEDLV YLASGCK+KEKWRIGTEHEKFGFEF 
Sbjct  60   ERRRGRLSI-VAASPPTDDAVVAAEPLTKEDLVAYLASGCKSKEKWRIGTEHEKFGFEFG  118

Query  437  TLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            TLRPM YEQIAELL G+SERFDW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  119  TLRPMNYEQIAELLYGVSERFDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  170



>emb|CDP09740.1| unnamed protein product [Coffea canephora]
Length=611

 Score =   227 bits (578),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 137/175 (78%), Gaps = 9/175 (5%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK---GVV----NSMEMFKRNEIGFGFssssrsssKGMQGL  250
            MALMSQ+GPSY +  E+V+CK   GVV     SME  K  ++ F F  SS + SK  +  
Sbjct  90   MALMSQAGPSYCVQPEIVRCKAGHGVVYSLTGSMEGSKVKDVCFDFRFSSSNLSKQRRSY  149

Query  251  RL-ESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGF  427
               ES+R H  + VAASPPTED V AAEPLTKEDLVGYLASGCK KEKWRIGTEHEKFGF
Sbjct  150  GPGESKRRHQ-VIVAASPPTEDAVVAAEPLTKEDLVGYLASGCKPKEKWRIGTEHEKFGF  208

Query  428  EFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            EF TLRPMKYEQIAELLN ISERFDWDKIMEG+ IIGLKQGKQSISLEPGGQFEL
Sbjct  209  EFGTLRPMKYEQIAELLNSISERFDWDKIMEGENIIGLKQGKQSISLEPGGQFEL  263



>ref|XP_009766955.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Nicotiana 
sylvestris]
 sp|Q1W2L8.2|GSH1_TOBAC RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: 
Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine 
synthetase; Flags: Precursor [Nicotiana tabacum]
 gb|ABD98695.2| chloroplast gamma-glutamylcysteine synthetase [Nicotiana tabacum]
Length=522

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 139/175 (79%), Gaps = 9/175 (5%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKC----KGVVNSMEMFKRNEIGFGFssssrsssKGMQGLRLE  259
            MALMSQ+G S+ ++SE +KC      + ++MEM K  +I FG + SSR+SSK MQG+ L+
Sbjct  1    MALMSQAGSSHCIYSEKMKCISGHSSITSNMEMLKMKDICFG-NISSRNSSKPMQGIYLD  59

Query  260  SRRGHGGL----TVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGF  427
                         VAASPPTED V AAEPLTKEDLV YLASGCK+KEKWRIGTEHEKFGF
Sbjct  60   RVGVERRRGRLAIVAASPPTEDAVVAAEPLTKEDLVAYLASGCKSKEKWRIGTEHEKFGF  119

Query  428  EFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            EF TLRPMKYEQIAELLNGI+ERFDW+K+MEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  120  EFGTLRPMKYEQIAELLNGIAERFDWEKVMEGDNIIGLKQGKQSISLEPGGQFEL  174



>ref|XP_011080960.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Sesamum 
indicum]
Length=526

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 134/179 (75%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKGVVN-------SMEMFKRNEIGFGFssssrsssKGMQGL  250
            MALMS SG S+ +HSE  +CK   N        ME  K   I FGF  +S SS K  +G 
Sbjct  1    MALMSHSGSSHCIHSETTQCKSRYNGVNSFADKMEAAKAKGIIFGFHPASWSSLKATKGW  60

Query  251  RLE-----SRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             L+      RRGH  +TVAASPPTED V A+EPLTKE+LVGYLASGCK KEKWRIGTEHE
Sbjct  61   SLDGSEVGQRRGHC-VTVAASPPTEDAVIASEPLTKEELVGYLASGCKPKEKWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE  TL+PMKYEQI ELLNG+SERFDWDKIMEG+ IIGL+QGKQSISLEPGGQFEL
Sbjct  120  KFGFEIGTLKPMKYEQIEELLNGLSERFDWDKIMEGENIIGLQQGKQSISLEPGGQFEL  178



>gb|EYU23478.1| hypothetical protein MIMGU_mgv1a004459mg [Erythranthe guttata]
 gb|EYU23479.1| hypothetical protein MIMGU_mgv1a004459mg [Erythranthe guttata]
Length=526

 Score =   217 bits (552),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 132/179 (74%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKG-------VVNSMEMFKRNEIGFGFssssrsssKGMQGL  250
            MALMS  G S  +H+E V+CK          ++ME  K  EI FG  S S SS K  Q  
Sbjct  1    MALMSHPGASPCIHTEAVQCKARNYGVNSFTSTMESAKTKEIFFGLRSPSWSSLKVAQKW  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
              +S     RRGH  +TVAASPPTED V A EPLTK+DLV YLASGCK K+KWRIGTEHE
Sbjct  61   SSDSTEVGQRRGHR-VTVAASPPTEDAVIATEPLTKQDLVDYLASGCKPKDKWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE ETLRPM YEQI++LLNGISERFDWDKIMEG+ IIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFEIETLRPMTYEQISDLLNGISERFDWDKIMEGEYIIGLKQGKQSISLEPGGQFEL  178



>gb|ADE06226.1| gamma-glutamylcysteine synthetase [Hevea brasiliensis]
Length=523

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 133/174 (76%), Gaps = 8/174 (5%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-----GVVNSMEMFKRNEIGFGFssssrsssK--GMQGL  250
            M L+SQ+ PSY + +E+ K       GV N +E  K+ E  F FSS   +S K  G+   
Sbjct  1    MKLVSQAHPSYCVPTEISKTSQNVVFGVTNRIEASKQKEKCFRFSSLLCNSIKTPGVPRE  60

Query  251  RLESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFE  430
             L  RRG+  L VAASPPTED V AAEPLTKEDLVGYLASGCK KEKWRIGTEHEKFGFE
Sbjct  61   CLRIRRGNQ-LVVAASPPTEDTVIAAEPLTKEDLVGYLASGCKPKEKWRIGTEHEKFGFE  119

Query  431  FETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
              TLRPMKYEQIA+LLNGI+ERFDW+KIMEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  120  LGTLRPMKYEQIADLLNGIAERFDWEKIMEGDNIIGLKQGKQSISLEPGGQFEL  173



>ref|XP_009350439.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X4 [Pyrus x bretschneideri]
Length=447

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 138/179 (77%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK---GVV----NSMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L+SQ+G SY + +E+ + K    VV    N++E  K  E   GFSS S SSS+  Q L
Sbjct  1    MVLLSQTGSSYCIRTELFRYKSGQNVVFSRANNIEASKLKENSIGFSSVSYSSSRKTQIL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             +++     +RGH  + VAASPPTED V A EPLTKEDLV YLASGCK+KEKWRIGTEHE
Sbjct  61   HIDNAGVGQKRGHS-VIVAASPPTEDAVIATEPLTKEDLVAYLASGCKSKEKWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE +TLRP+KYEQIAELLN ISERFDW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFELKTLRPIKYEQIAELLNVISERFDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  178



>ref|XP_009350438.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Pyrus x bretschneideri]
Length=455

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 138/179 (77%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK---GVV----NSMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L+SQ+G SY + +E+ + K    VV    N++E  K  E   GFSS S SSS+  Q L
Sbjct  1    MVLLSQTGSSYCIRTELFRYKSGQNVVFSRANNIEASKLKENSIGFSSVSYSSSRKTQIL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             +++     +RGH  + VAASPPTED V A EPLTKEDLV YLASGCK+KEKWRIGTEHE
Sbjct  61   HIDNAGVGQKRGHS-VIVAASPPTEDAVIATEPLTKEDLVAYLASGCKSKEKWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE +TLRP+KYEQIAELLN ISERFDW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFELKTLRPIKYEQIAELLNVISERFDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  178



>gb|KJB37541.1| hypothetical protein B456_006G209400 [Gossypium raimondii]
Length=527

 Score =   212 bits (540),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 135/178 (76%), Gaps = 11/178 (6%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGMQGL  250
            MAL+S++G SY + S++ + +       GVVN++E     E     SS S  +++  Q  
Sbjct  1    MALVSKAGSSYCIRSDITRGRTGQNVAFGVVNNVEAPIMKEKSIKISSLSCKNARVAQFF  60

Query  251  RLES----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEK  418
             LE+     +G   + VAASPPTED + A EPLTK+DLVGYLASGCK+KEKWRIGTEHEK
Sbjct  61   PLETVGFRSKGRNSVIVAASPPTEDALIAIEPLTKQDLVGYLASGCKSKEKWRIGTEHEK  120

Query  419  FGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FGFE +TLRPMKYEQIAELLNGISERFDW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  121  FGFEIKTLRPMKYEQIAELLNGISERFDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  178



>ref|XP_009350437.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Pyrus x bretschneideri]
Length=503

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 138/179 (77%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK---GVV----NSMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L+SQ+G SY + +E+ + K    VV    N++E  K  E   GFSS S SSS+  Q L
Sbjct  1    MVLLSQTGSSYCIRTELFRYKSGQNVVFSRANNIEASKLKENSIGFSSVSYSSSRKTQIL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             +++     +RGH  + VAASPPTED V A EPLTKEDLV YLASGCK+KEKWRIGTEHE
Sbjct  61   HIDNAGVGQKRGHS-VIVAASPPTEDAVIATEPLTKEDLVAYLASGCKSKEKWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE +TLRP+KYEQIAELLN ISERFDW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFELKTLRPIKYEQIAELLNVISERFDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  178



>gb|KJB37540.1| hypothetical protein B456_006G209400 [Gossypium raimondii]
 gb|KJB37543.1| hypothetical protein B456_006G209400 [Gossypium raimondii]
 gb|KJB37544.1| hypothetical protein B456_006G209400 [Gossypium raimondii]
Length=526

 Score =   212 bits (540),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 135/178 (76%), Gaps = 11/178 (6%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGMQGL  250
            MAL+S++G SY + S++ + +       GVVN++E     E     SS S  +++  Q  
Sbjct  1    MALVSKAGSSYCIRSDITRGRTGQNVAFGVVNNVEAPIMKEKSIKISSLSCKNARVAQFF  60

Query  251  RLES----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEK  418
             LE+     +G   + VAASPPTED + A EPLTK+DLVGYLASGCK+KEKWRIGTEHEK
Sbjct  61   PLETVGFRSKGRNSVIVAASPPTEDALIAIEPLTKQDLVGYLASGCKSKEKWRIGTEHEK  120

Query  419  FGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FGFE +TLRPMKYEQIAELLNGISERFDW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  121  FGFEIKTLRPMKYEQIAELLNGISERFDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  178



>gb|AGI36546.1| gamma-glutamylcysteine synthetase, partial [Brassica oleracea 
var. botrytis]
Length=199

 Score =   202 bits (515),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 127/168 (76%), Gaps = 3/168 (2%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKGVVNSMEMFKRN-EIGFGFssssrsssKGMQGLRLESRR  268
            MAL+SQ+G +Y + S  V  K    S+    RN  +  GF SS   +      L+  S+R
Sbjct  1    MALLSQAGGAYTVPSGHVSPKIRTTSVSGCVRNLRMKEGFVSSYPRTLYTNSVLK-SSKR  59

Query  269  GHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRP  448
            GH  L VAASPPTE+ V A EPLT+EDL+ YLASGCKTK+KWRIGTEHEKFGFE  TLRP
Sbjct  60   GHQ-LIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKWRIGTEHEKFGFEVNTLRP  118

Query  449  MKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            MKY+QIAELLN I+ERF+W+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  119  MKYDQIAELLNSIAERFEWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  166



>ref|XP_008341055.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Malus domestica]
Length=526

 Score =   212 bits (539),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 138/179 (77%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK---GVV----NSMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L+SQ+G SY + +E+ + K    VV    N++E  K  E   GFSS S SSS+  Q L
Sbjct  1    MVLISQTGSSYCIRTELFRYKSGQNVVFSRANNIEASKLKENSIGFSSVSYSSSRKTQIL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             +++     +RGH  + VAASPPTED V A EPLTKEDLV YLASGCK+KEKWRIGTEHE
Sbjct  61   HIDNARVGQKRGHS-VIVAASPPTEDAVIATEPLTKEDLVAYLASGCKSKEKWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE +TLRP+KYEQIAELLN ISERFDW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFELKTLRPIKYEQIAELLNVISERFDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  178



>ref|XP_009350436.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Pyrus x bretschneideri]
Length=526

 Score =   212 bits (539),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 138/179 (77%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK---GVV----NSMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L+SQ+G SY + +E+ + K    VV    N++E  K  E   GFSS S SSS+  Q L
Sbjct  1    MVLLSQTGSSYCIRTELFRYKSGQNVVFSRANNIEASKLKENSIGFSSVSYSSSRKTQIL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             +++     +RGH  + VAASPPTED V A EPLTKEDLV YLASGCK+KEKWRIGTEHE
Sbjct  61   HIDNAGVGQKRGHS-VIVAASPPTEDAVIATEPLTKEDLVAYLASGCKSKEKWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE +TLRP+KYEQIAELLN ISERFDW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFELKTLRPIKYEQIAELLNVISERFDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  178



>ref|XP_008341054.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Malus domestica]
Length=547

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 138/179 (77%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK---GVV----NSMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L+SQ+G SY + +E+ + K    VV    N++E  K  E   GFSS S SSS+  Q L
Sbjct  1    MVLISQTGSSYCIRTELFRYKSGQNVVFSRANNIEASKLKENSIGFSSVSYSSSRKTQIL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             +++     +RGH  + VAASPPTED V A EPLTKEDLV YLASGCK+KEKWRIGTEHE
Sbjct  61   HIDNARVGQKRGHS-VIVAASPPTEDAVIATEPLTKEDLVAYLASGCKSKEKWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE +TLRP+KYEQIAELLN ISERFDW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFELKTLRPIKYEQIAELLNVISERFDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  178



>ref|XP_008341053.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Malus domestica]
Length=550

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 138/179 (77%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK---GVV----NSMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L+SQ+G SY + +E+ + K    VV    N++E  K  E   GFSS S SSS+  Q L
Sbjct  1    MVLISQTGSSYCIRTELFRYKSGQNVVFSRANNIEASKLKENSIGFSSVSYSSSRKTQIL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             +++     +RGH  + VAASPPTED V A EPLTKEDLV YLASGCK+KEKWRIGTEHE
Sbjct  61   HIDNARVGQKRGHS-VIVAASPPTEDAVIATEPLTKEDLVAYLASGCKSKEKWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE +TLRP+KYEQIAELLN ISERFDW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFELKTLRPIKYEQIAELLNVISERFDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  178



>ref|XP_002509800.1| Glutamate--cysteine ligase, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF51187.1| Glutamate--cysteine ligase, chloroplast precursor, putative [Ricinus 
communis]
Length=526

 Score =   211 bits (538),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 134/179 (75%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGMQ--  244
            M ++SQ+GPS  + +++ +CK       GV NS+E  K  E    FSS S +S+K  Q  
Sbjct  1    MPVISQAGPSCYVPTDITRCKTGQNAVLGVFNSIETSKLKETCVRFSSLSCNSTKIPQLP  60

Query  245  ---GLRLESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
                  + SRRG+  + VAASPP ED V A EPLTKEDLVGYLASGCK KEKWRIGTEHE
Sbjct  61   SSENSWVRSRRGNQ-MIVAASPPIEDAVIATEPLTKEDLVGYLASGCKPKEKWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE  TLRPMKYEQIAELLNGI+ERFDW+K+MEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFELGTLRPMKYEQIAELLNGIAERFDWEKVMEGDYIIGLKQGKQSISLEPGGQFEL  178



>ref|XP_007209899.1| hypothetical protein PRUPE_ppa004151mg [Prunus persica]
 gb|EMJ11098.1| hypothetical protein PRUPE_ppa004151mg [Prunus persica]
Length=526

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 133/179 (74%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVV--KCKGVV-----NSMEMFKRNEIGFGFssssrsssKGMQGL  250
            MAL+ Q G SY + +E+   KC   V     N++E  K  E   GFSS S  SS+  Q L
Sbjct  1    MALLLQMGSSYCIRTEIFRHKCGQNVGLSRANNIEAAKLKENCIGFSSVSCFSSRKTQIL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             ++      +RGH  + VAASPPTED V   EPLTKEDLVGYLASGCK KE WRIGTEHE
Sbjct  61   HVDDAVLGHKRGHS-VIVAASPPTEDAVIVTEPLTKEDLVGYLASGCKPKENWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE +TLRPMKYEQIAELLNGISERFDW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFELKTLRPMKYEQIAELLNGISERFDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  178



>ref|XP_002273626.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Vitis vinifera]
 ref|XP_010660724.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Vitis vinifera]
 ref|XP_010660727.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Vitis vinifera]
 emb|CBI34672.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 130/178 (73%), Gaps = 11/178 (6%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGMQGL  250
            MAL+ Q+GPSY M SEVV CK        + N+ME  K  E     SS SRS +K    L
Sbjct  1    MALVPQTGPSYCMRSEVVHCKTGQSAVVNMTNNMEASKIKETRTWLSSLSRSRTKTKHIL  60

Query  251  RLESR----RGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEK  418
              +S     +    + VAASPPTED V A EPLT+EDL+GYLASGCK KEKWRIGTEHEK
Sbjct  61   SPDSVGVGCKQRHQVIVAASPPTEDAVVATEPLTREDLIGYLASGCKPKEKWRIGTEHEK  120

Query  419  FGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FGFEF TLRPM+YEQI+ELL G+SERF WDKIMEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  121  FGFEFRTLRPMRYEQISELLYGVSERFGWDKIMEGDNIIGLKQGKQSISLEPGGQFEL  178



>dbj|BAP47506.1| gamma-glutamylcysteine synthetase [Gentiana triflora]
Length=526

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 133/178 (75%), Gaps = 11/178 (6%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGMQGL  250
            MALMSQ+G SY + SEV++ K       G++  +E  K  E+ FG  SSS  S K +Q L
Sbjct  1    MALMSQAGSSYCIQSEVLRGKAGQNTVSGLLCHVEGSKAKEVLFGLHSSSLVSPKAIQSL  60

Query  251  RLESRRG----HGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEK  418
             LES R        + VAASPPTED V AAEPLTK+DLV YL SGCK KE+WRIGTEHEK
Sbjct  61   NLESPRKLLRHRHQVIVAASPPTEDAVVAAEPLTKDDLVEYLKSGCKPKEQWRIGTEHEK  120

Query  419  FGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FGFEF TLRPMKY+QI+ELL  ISERFDW+K+MEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  121  FGFEFGTLRPMKYQQISELLYSISERFDWEKVMEGDYIIGLKQGKQSISLEPGGQFEL  178



>ref|XP_011022699.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Populus 
euphratica]
Length=526

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 134/179 (75%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L+SQ+GPSY + +++++CK       G+ ++M+  K  E    FSS S +SSK  + L
Sbjct  1    MTLVSQAGPSYCIPADIIRCKTAQNVVIGMASNMDASKLKETPARFSSLSCNSSKTPKIL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
              ES     +RGH    V ASPPTED V A EPLTKEDL+ YLASGCK KE WRIGTEHE
Sbjct  61   SSESLSVGMKRGHQ-FVVNASPPTEDAVIATEPLTKEDLIRYLASGCKPKENWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE  TLRPMKYEQIAELL+GI+ERFDWDKIMEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFEMGTLRPMKYEQIAELLHGIAERFDWDKIMEGDAIIGLKQGKQSISLEPGGQFEL  178



>ref|XP_008238836.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Prunus 
mume]
 ref|XP_008238837.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Prunus 
mume]
 ref|XP_008238838.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Prunus 
mume]
 ref|XP_008238840.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Prunus 
mume]
Length=526

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 131/179 (73%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKG-------VVNSMEMFKRNEIGFGFssssrsssKGMQGL  250
            MAL+ Q G SY + +E+ + K          N++E  K  E   GFSS S  S +  Q  
Sbjct  1    MALLLQMGSSYCIRTEIFRHKSGQNVGLSRANNIEAAKLKENCIGFSSVSCYSPRKTQIF  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             +++     +RGH  + VAASPPTED V   EPLTKEDLVGYLASGCK KE WRIGTEHE
Sbjct  61   HVDNAVLGHKRGHS-VIVAASPPTEDAVIVTEPLTKEDLVGYLASGCKPKENWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE +TLRPMKYEQIAELLNGISERFDW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFELKTLRPMKYEQIAELLNGISERFDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  178



>ref|XP_011072645.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Sesamum 
indicum]
 ref|XP_011072650.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Sesamum 
indicum]
Length=526

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 126/179 (70%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKGVVN-------SMEMFKRNEIGFGFssssrsssKGMQGL  250
            MALMS     + + +E ++ K   N       +M   K  EI FGF  +S+S  K  Q  
Sbjct  1    MALMSHPSSLHCVCTETIQPKARYNGVNNISSTMGTAKSKEICFGFRPASQSFLKAAQSW  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             ++      +RGH  LTVAASPPTED V A EPLTKEDLVGYLASGCK K  WRIGTEHE
Sbjct  61   SMDDTEVQRKRGHW-LTVAASPPTEDAVIATEPLTKEDLVGYLASGCKPKANWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE  TLRPM Y QIAELLNGISERFDWDKIMEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFEIATLRPMNYAQIAELLNGISERFDWDKIMEGDNIIGLKQGKQSISLEPGGQFEL  178



>ref|XP_012086908.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Jatropha 
curcas]
Length=526

 Score =   209 bits (533),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 135/179 (75%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssK-----  235
            M L+SQ+G SY + +E+ + K       GVVNS+E  K  E+   FSS S +S K     
Sbjct  1    MTLVSQAGISYYIPTEIPRSKTSQNVVFGVVNSIEASKPKEMYTRFSSLSYNSIKMSRIS  60

Query  236  GMQGLRLESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
              +   L S+RG+  + VAASPP ED V A EPLTKEDLVGYLASGCK+KE+WRIGTEHE
Sbjct  61   TSENSWLRSKRGNQ-VIVAASPPIEDAVIATEPLTKEDLVGYLASGCKSKEQWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE  TLRPMKYEQIAELLNGI+ERFDW+K+MEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFELGTLRPMKYEQIAELLNGIAERFDWEKVMEGDYIIGLKQGKQSISLEPGGQFEL  178



>gb|AHJ60103.1| gamma-glutamylcysteine synthetase [Pyrus betulifolia]
Length=526

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 137/179 (77%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK---GVV----NSMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L+SQ+G SY + +E+ + K    VV    N++E  K  E   GFSS S SSS+  Q L
Sbjct  1    MVLISQTGSSYCIRTELFRYKSGQNVVFSRANNIEASKLKENSIGFSSVSYSSSRKTQIL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             +++     +RGH  + VAASPPTED V A EPLTKEDLV YL SGCK+KEKWRIGTEHE
Sbjct  61   HIDNAGVGQKRGHT-VIVAASPPTEDAVIATEPLTKEDLVAYLVSGCKSKEKWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE +TLRP+KYEQIAELLN ISERFDW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFELKTLRPIKYEQIAELLNVISERFDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  178



>ref|XP_007040225.1| Glutamate-cysteine ligase isoform 1 [Theobroma cacao]
 ref|XP_007040226.1| Glutamate-cysteine ligase isoform 1 [Theobroma cacao]
 gb|EOY24726.1| Glutamate-cysteine ligase isoform 1 [Theobroma cacao]
 gb|EOY24727.1| Glutamate-cysteine ligase isoform 1 [Theobroma cacao]
Length=525

 Score =   209 bits (532),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 129/175 (74%), Gaps = 11/175 (6%)
 Frame = +2

Query  101  MSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGMQGLRLE  259
            +S++G SY + S++   +       GVVN++E     E    FSS   + +K  +   LE
Sbjct  3    LSKAGSSYCIPSDITWGRTGQNVAFGVVNNLEAPIMKEKSVSFSSLLCNKAKIARIFPLE  62

Query  260  S----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGF  427
            +    R+    + VAASPPTED V A EPLTKEDLV YLASGCK KEKWRIGTEHEKFGF
Sbjct  63   TVGFGRKRRNSMIVAASPPTEDAVIATEPLTKEDLVAYLASGCKPKEKWRIGTEHEKFGF  122

Query  428  EFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            EF+TLRPMKYEQIAELLNGISERFDWDK+MEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  123  EFKTLRPMKYEQIAELLNGISERFDWDKVMEGDNIIGLKQGKQSISLEPGGQFEL  177



>ref|XP_009364899.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364900.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364901.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364902.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364956.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Pyrus x bretschneideri]
Length=526

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 135/179 (75%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK---GVV----NSMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L SQ+G SY + +E+ + K    VV    NS++  K  E   GFSS   SSS   Q L
Sbjct  1    MVLFSQTGSSYCIRTELFRYKSGKNVVFSRANSIDASKLKENSIGFSSLLYSSSSKAQIL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             + +     +RGH  + VAASPPTED V A EPLTKEDLV YLASGCK+K+KWRIGTEHE
Sbjct  61   HIANAGVGQKRGHS-VIVAASPPTEDAVIATEPLTKEDLVAYLASGCKSKDKWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE +TLRP+KYEQIAELLNGISER+DW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFERKTLRPIKYEQIAELLNGISERYDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  178



>ref|XP_009364919.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364920.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364921.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364922.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=526

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 135/179 (75%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK---GVV----NSMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L SQ+G SY + +E+ + K    VV    NS++  K  E   GFSS   SSS   Q L
Sbjct  1    MVLFSQTGSSYCIRTELFRYKSGKNVVFSRANSIDASKLKENSIGFSSLLYSSSSKAQIL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             + +     +RGH  + VAASPPTED V A EPLTKEDLV YLASGCK+K+KWRIGTEHE
Sbjct  61   HIANAGVGQKRGHS-VIVAASPPTEDAVIATEPLTKEDLVAYLASGCKSKDKWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE +TLRP+KYEQIAELLNGISER+DW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFERKTLRPIKYEQIAELLNGISERYDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  178



>ref|XP_009364953.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009364954.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009364955.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Pyrus x bretschneideri]
Length=537

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 135/179 (75%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK---GVV----NSMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L SQ+G SY + +E+ + K    VV    NS++  K  E   GFSS   SSS   Q L
Sbjct  1    MVLFSQTGSSYCIRTELFRYKSGKNVVFSRANSIDASKLKENSIGFSSLLYSSSSKAQIL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             + +     +RGH  + VAASPPTED V A EPLTKEDLV YLASGCK+K+KWRIGTEHE
Sbjct  61   HIANAGVGQKRGHS-VIVAASPPTEDAVIATEPLTKEDLVAYLASGCKSKDKWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE +TLRP+KYEQIAELLNGISER+DW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFERKTLRPIKYEQIAELLNGISERYDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  178



>ref|XP_011029270.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Populus 
euphratica]
 ref|XP_011029271.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Populus 
euphratica]
 ref|XP_011029272.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Populus 
euphratica]
Length=526

 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 132/179 (74%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKGVVN-------SMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L++Q+GPS  + +E+ +CK   N       S + +K  E    FSS S +SSK  Q L
Sbjct  1    MTLVAQAGPSSSILTEISRCKAAQNVVIAMARSTDAYKLKETPPRFSSLSCNSSKTPQIL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
              ES     +RG   + VAASPPTED V A EPLTKEDL+GYLASGCK KE WRIGTEHE
Sbjct  61   SSESLSVGMKRGRR-VVVAASPPTEDAVIATEPLTKEDLIGYLASGCKPKENWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE  TLRPMKYEQIAELL+GI+ERFDWD+IMEGD IIGL+QGKQSISLEPGGQFEL
Sbjct  120  KFGFEIGTLRPMKYEQIAELLHGIAERFDWDRIMEGDNIIGLQQGKQSISLEPGGQFEL  178



>gb|AFF18844.2| gamma-glutamylcysteine synthetase [Dimocarpus longan]
Length=511

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 130/171 (76%), Gaps = 12/171 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVK----CKGVVNSMEMFKRNEIGFGFssssrsssKGMQGLRLE  259
            MAL+SQ G +Y + SE+        G+VN++E  +  E    FSS S  S+KG       
Sbjct  1    MALVSQGGATYRVRSEITPGHRGVFGLVNNVEASRVKESCVSFSSLSCYSTKG-------  53

Query  260  SRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFET  439
            SRRG+  + VAASPPT+D V AAEPLTKEDLVGYLASGCK +EKWRIGTEHEKFGFE  T
Sbjct  54   SRRGYRAI-VAASPPTDDAVIAAEPLTKEDLVGYLASGCKPREKWRIGTEHEKFGFEIGT  112

Query  440  LRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            LRPMKYEQIAELLN I+ERFDW+KIME + IIGLKQGKQSISLEPGGQFEL
Sbjct  113  LRPMKYEQIAELLNSIAERFDWEKIMEDNNIIGLKQGKQSISLEPGGQFEL  163



>ref|XP_011463882.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=516

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 132/171 (77%), Gaps = 7/171 (4%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKGVVNSMEMFKRNEIGFGFssssrsssKGMQGLRLESR--  265
            MAL+SQ+G SY + +EV    G V + ++ K N +GF   S S +S++  Q L +++   
Sbjct  1    MALISQTGSSYCIRTEVFSRAGNVEASKL-KDNCVGFS--SFSCNSARKTQILHMDNAGV  57

Query  266  --RGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFET  439
              +  G + VAASPPTED V A EPLTKEDLV YLASGCK KE WRIGTEHEKFGFE +T
Sbjct  58   GLKRCGSVVVAASPPTEDAVIATEPLTKEDLVAYLASGCKPKEAWRIGTEHEKFGFELKT  117

Query  440  LRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            LRPMKYEQI+ELLNGI+ERFDW+K+MEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  118  LRPMKYEQISELLNGIAERFDWEKVMEGDYIIGLKQGKQSISLEPGGQFEL  168



>ref|XP_002304493.2| hypothetical protein POPTR_0003s12700g [Populus trichocarpa]
 gb|EEE79472.2| hypothetical protein POPTR_0003s12700g [Populus trichocarpa]
Length=491

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 132/179 (74%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L+SQ+GPSY + +++ +CK       G+ ++++  K  E    FSS S +SSK  + L
Sbjct  1    MTLVSQAGPSYCIPTDISRCKTAQNVVIGMASNIDASKLKETPARFSSLSCNSSKTPKIL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
              E      +RGH    VAASPPTED V A EPLTKEDL+ YLASGCK KE WRIGTEHE
Sbjct  61   SSECLSVGMKRGHQ-FVVAASPPTEDAVVATEPLTKEDLIRYLASGCKPKENWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE  TLRPMKYEQIAELL+GI+ERFDWDKIMEGD IIGLKQ KQSISLEPGGQFEL
Sbjct  120  KFGFEIGTLRPMKYEQIAELLHGIAERFDWDKIMEGDTIIGLKQEKQSISLEPGGQFEL  178



>dbj|BAD27390.1| gamma-glutamylcysteine synthetase [Zinnia elegans]
Length=523

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 130/176 (74%), Gaps = 10/176 (6%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKGVVNSMEMFKRNEIGFGFssssrsssKGM----QGLRLE  259
            M LMSQ+ PS+G+H+E+++ K   +S+     N   F   +S  + S+      Q + ++
Sbjct  1    MVLMSQASPSHGIHAEILQSKSGYSSLLNGASNTNAFRHQTSKVAFSRNYLKYTQAMHVD  60

Query  260  S-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFG  424
            +     +RG+  + VAASPPTED V A EPLTKEDLVGYLASGCK KE WRIGTEHEKFG
Sbjct  61   AVGGNFKRGNK-VIVAASPPTEDAVVATEPLTKEDLVGYLASGCKPKENWRIGTEHEKFG  119

Query  425  FEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            F+ +TLRPM YEQIA LLN ISERFDW+K+MEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  120  FDLKTLRPMTYEQIAHLLNAISERFDWEKVMEGDNIIGLKQGKQSISLEPGGQFEL  175



>ref|NP_001292626.1| glutamate--cysteine ligase, chloroplastic [Cucumis sativus]
 gb|ADK77882.1| gamma-glutamylcysteine synthetase [Cucumis sativus]
Length=525

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 130/178 (73%), Gaps = 12/178 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKG------VVNSMEMFKRNEIGFGFssssrsssKGMQGL-  250
            MAL S +G ++ + +E ++C+G           E  K  EI  G SS S SS   M GL 
Sbjct  1    MALASHTGSAHRIGAETLRCRGGNMAFNFSTHAESLKMKEILLGSSSLSCSSGNIMHGLH  60

Query  251  ----RLESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEK  418
                R+ S+RG G + VAASPPTED   AAEPLTKEDLV YLASGCK KEKWRIGTEHEK
Sbjct  61   IDSARMASKRG-GRVIVAASPPTEDATVAAEPLTKEDLVAYLASGCKPKEKWRIGTEHEK  119

Query  419  FGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FGF  ETLRPMKYEQIA LLNGI+ERFDW+KIMEGD IIGL+QGKQSISLEPGGQFEL
Sbjct  120  FGFNIETLRPMKYEQIAGLLNGIAERFDWEKIMEGDNIIGLQQGKQSISLEPGGQFEL  177



>gb|ABK96626.1| unknown [Populus trichocarpa x Populus deltoides]
Length=526

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 132/179 (74%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L+SQ+GPSY + +++ +CK       G+ ++++  K  E    FSS S +SSK  + L
Sbjct  1    MTLVSQAGPSYCIPTDISRCKTAQNVVIGMASNIDASKLKETPARFSSLSCNSSKTPKIL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
              E      +RGH    VAASPPTED V A EPLTKEDL+ YLASGCK KE WRIGTEHE
Sbjct  61   SSECLSVGMKRGHQ-FVVAASPPTEDAVVATEPLTKEDLIRYLASGCKPKENWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE  TLRPMKYEQIAELL+GI+ERFDWDKIMEGD IIGLKQ KQSISLEPGGQFEL
Sbjct  120  KFGFEIGTLRPMKYEQIAELLHGIAERFDWDKIMEGDTIIGLKQEKQSISLEPGGQFEL  178



>ref|XP_008360718.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--cysteine ligase, chloroplastic-like 
[Malus domestica]
Length=430

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 132/179 (74%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK---GVV----NSMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L  Q G SY + +E+ + K    VV    NS++  K  E   GFSS   SS+   Q L
Sbjct  1    MGLFLQMGSSYCIRTELFRYKSGKNVVFSRXNSIDASKLKENSIGFSSLLYSSTSKAQIL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             + +     +RGH  + V ASPPTED V A EPLTKEDLV YLASGCK+K+KWRIGTEHE
Sbjct  61   HIANAGVGQKRGHS-VIVTASPPTEDAVIATEPLTKEDLVAYLASGCKSKDKWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGF+ +TLRP+KYEQIAELLNGISER+DW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFDRKTLRPIKYEQIAELLNGISERYDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  178



>gb|ACJ83305.1| unknown [Medicago truncatula]
 gb|AFK47474.1| unknown [Medicago truncatula]
Length=172

 Score =   195 bits (495),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 115/169 (68%), Gaps = 19/169 (11%)
 Frame = +2

Query  98   LMSQSGPSYGM----HSEVVKCKGVVNSMEMFKRNEIGFGFssssrsssKGMQGLRLESR  265
            L S S PS       H+  ++   V N+     +N + F                R+ + 
Sbjct  7    LASSSSPSLRHDATPHNFHIRKTSVSNTFSFSSKNSLSFK---------------RILTS  51

Query  266  RGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLR  445
             G     VAASPPTED V A EPLTK+DL+ YLASGCKTK+KWRIGTEHEKFGFE  +LR
Sbjct  52   GGSRRFIVAASPPTEDAVVATEPLTKQDLIDYLASGCKTKDKWRIGTEHEKFGFELGSLR  111

Query  446  PMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            PMKYEQI+ELLNGI+ERFDWDK+MEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  112  PMKYEQISELLNGIAERFDWDKVMEGDNIIGLKQGKQSISLEPGGQFEL  160



>ref|XP_010053262.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X2 [Eucalyptus grandis]
 gb|KCW77521.1| hypothetical protein EUGRSUZ_D01848 [Eucalyptus grandis]
Length=526

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 133/178 (75%), Gaps = 11/178 (6%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGMQGL  250
            MAL+S +GPS  + +E+++ +       G +N++E  +   +   F SSSR SSK    L
Sbjct  1    MALISNAGPSCKLGNEIMRSRSGYDLVFGPINNVETARTKMMCLNFPSSSRCSSKIAHAL  60

Query  251  RLES-RRG---HGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEK  418
            R++   RG      + VAASPPTEDV  A EPLTKEDL+ YLASGCK KEKWRIGTEHEK
Sbjct  61   RIDDVSRGCKRRRQVIVAASPPTEDVAVATEPLTKEDLIAYLASGCKPKEKWRIGTEHEK  120

Query  419  FGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FGFE +TLRPMKYEQI+ELL GISERFDW+KIMEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  121  FGFEIQTLRPMKYEQISELLYGISERFDWEKIMEGDYIIGLKQGKQSISLEPGGQFEL  178



>ref|XP_010053261.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Eucalyptus grandis]
Length=556

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 133/178 (75%), Gaps = 11/178 (6%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGMQGL  250
            MAL+S +GPS  + +E+++ +       G +N++E  +   +   F SSSR SSK    L
Sbjct  1    MALISNAGPSCKLGNEIMRSRSGYDLVFGPINNVETARTKMMCLNFPSSSRCSSKIAHAL  60

Query  251  RLES-RRG---HGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEK  418
            R++   RG      + VAASPPTEDV  A EPLTKEDL+ YLASGCK KEKWRIGTEHEK
Sbjct  61   RIDDVSRGCKRRRQVIVAASPPTEDVAVATEPLTKEDLIAYLASGCKPKEKWRIGTEHEK  120

Query  419  FGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FGFE +TLRPMKYEQI+ELL GISERFDW+KIMEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  121  FGFEIQTLRPMKYEQISELLYGISERFDWEKIMEGDYIIGLKQGKQSISLEPGGQFEL  178



>ref|XP_010089108.1| Glutamate--cysteine ligase [Morus notabilis]
 gb|EXB37355.1| Glutamate--cysteine ligase [Morus notabilis]
Length=582

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 132/180 (73%), Gaps = 15/180 (8%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKGVVNSM---------EMFKRNEIGFGFssssrsssKG--  238
            MAL+SQ+G SY + SEV++ K   N++            K N +G    S + ++ K   
Sbjct  1    MALISQAGSSYCVQSEVIRSKSGHNAIFNIGSNLEASRVKDNFVGASSLSCTFAAKKTNI  60

Query  239  --MQGLRLESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEH  412
              +   RL  +RGH  + VAASPPTED V AAEPLTKEDL+ YLASGCK KEKWRIGTEH
Sbjct  61   LHLDCARLGRKRGHH-VIVAASPPTEDAV-AAEPLTKEDLIAYLASGCKPKEKWRIGTEH  118

Query  413  EKFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            EKFGFEF TLRPM+YEQI+ELLNGI+ERFDWDK+MEGD IIGL QGKQSISLEPGGQFEL
Sbjct  119  EKFGFEFGTLRPMRYEQISELLNGIAERFDWDKVMEGDYIIGLIQGKQSISLEPGGQFEL  178



>ref|XP_002298035.2| hypothetical protein POPTR_0001s09340g [Populus trichocarpa]
 gb|EEE82840.2| hypothetical protein POPTR_0001s09340g [Populus trichocarpa]
Length=526

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 130/179 (73%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKGVVN-------SMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L++Q+GPS  +  E+ +CK   N       S +  K  E    FSS S +SSK  Q L
Sbjct  1    MTLVAQAGPSSSILKEISRCKAAQNVVIAMARSTDASKLKETPPRFSSLSCNSSKTPQIL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
              ES     +RGH  + VAASPPTED V A EPLTKEDL+GYLASGCK KE WRIGTEHE
Sbjct  61   SSESLSVGMKRGHR-VVVAASPPTEDAVIATEPLTKEDLIGYLASGCKPKENWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE  TLRPMKYEQIA LL+GI+ERFDWD+IMEGD IIGL+QGKQSISLEPGGQFEL
Sbjct  120  KFGFEIGTLRPMKYEQIAGLLHGIAERFDWDRIMEGDNIIGLQQGKQSISLEPGGQFEL  178



>ref|XP_006439555.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
 gb|ESR52795.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
Length=465

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 132/179 (74%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L+S++ PS  + ++V +C        G+  + E  +  E    FSSSSR S+K  Q L
Sbjct  1    MTLISRASPSCRVLTDVTRCTIRRSGVCGLAKNAEASRMKETCVSFSSSSRYSAKISQVL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             L++     RRG   + VAASPPTED V   EPLTKEDLVGYLASGCK KEKWRIGTEHE
Sbjct  61   HLDNAGIGIRRGRRSI-VAASPPTEDAVVVTEPLTKEDLVGYLASGCKPKEKWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFEF TLRPMKYEQIAELLN I+ERFDW+K+MEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFEFGTLRPMKYEQIAELLNSIAERFDWEKVMEGDYIIGLKQGKQSISLEPGGQFEL  178



>ref|XP_011654747.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Cucumis 
sativus]
Length=525

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 129/178 (72%), Gaps = 12/178 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKG------VVNSMEMFKRNEIGFGFssssrsssKGMQGL-  250
            MAL S +G ++ + +E ++C+G           E  K  EI  G SS S SS   M GL 
Sbjct  1    MALASHTGSAHRIGAETLRCRGGNMAFNFSTHAESLKMKEILLGSSSLSCSSGNIMHGLH  60

Query  251  ----RLESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEK  418
                R+ S+RG G + VAASPPTED   AAEPLTKEDLV YLASGCK KEKWRIGTEHEK
Sbjct  61   IDSARMASKRG-GRVIVAASPPTEDATVAAEPLTKEDLVAYLASGCKPKEKWRIGTEHEK  119

Query  419  FGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FGF  ETLRPM Y+QIA LLNGI+ERFDW+KIMEGD IIGL+QGKQSISLEPGGQFEL
Sbjct  120  FGFNIETLRPMTYDQIAGLLNGIAERFDWEKIMEGDNIIGLQQGKQSISLEPGGQFEL  177



>ref|XP_006439556.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
 gb|ESR52796.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
Length=487

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 132/179 (74%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L+S++ PS  + ++V +C        G+  + E  +  E    FSSSSR S+K  Q L
Sbjct  1    MTLISRASPSCRVLTDVTRCTIRRSGVCGLAKNAEASRMKETCVSFSSSSRYSAKISQVL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             L++     RRG   + VAASPPTED V   EPLTKEDLVGYLASGCK KEKWRIGTEHE
Sbjct  61   HLDNAGIGIRRGRRSI-VAASPPTEDAVVVTEPLTKEDLVGYLASGCKPKEKWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFEF TLRPMKYEQIAELLN I+ERFDW+K+MEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFEFGTLRPMKYEQIAELLNSIAERFDWEKVMEGDYIIGLKQGKQSISLEPGGQFEL  178



>emb|CAK24967.1| gamma-glutamylcysteine synthetase [Brassica napus]
 emb|CDY53137.1| BnaC01g41470D [Brassica napus]
Length=514

 Score =   201 bits (511),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 127/168 (76%), Gaps = 3/168 (2%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKGVVNSMEMFKRN-EIGFGFssssrsssKGMQGLRLESRR  268
            MAL+SQ+G +Y + S  V  K    S+    RN  +  GF SS   +      L+  S+R
Sbjct  1    MALLSQAGGAYTVPSGHVSSKIRTTSVSGCVRNLRMKEGFVSSYSRTLYTNSVLK-SSKR  59

Query  269  GHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRP  448
            GH  L VAASPPTE+ V A EPLT+EDL+ YLASGCKTK+KWRIGTEHEKFGFE  TLRP
Sbjct  60   GHQ-LIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKWRIGTEHEKFGFEVNTLRP  118

Query  449  MKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            MKY+QIAELLN I+ERF+W+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  119  MKYDQIAELLNSIAERFEWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  166



>ref|XP_006439553.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
 ref|XP_006439554.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
 gb|ESR52793.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
 gb|ESR52794.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
Length=526

 Score =   201 bits (511),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 132/179 (74%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L+S++ PS  + ++V +C        G+  + E  +  E    FSSSSR S+K  Q L
Sbjct  1    MTLISRASPSCRVLTDVTRCTIRRSGVCGLAKNAEASRMKETCVSFSSSSRYSAKISQVL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             L++     RRG   + VAASPPTED V   EPLTKEDLVGYLASGCK KEKWRIGTEHE
Sbjct  61   HLDNAGIGIRRGRRSI-VAASPPTEDAVVVTEPLTKEDLVGYLASGCKPKEKWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFEF TLRPMKYEQIAELLN I+ERFDW+K+MEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFEFGTLRPMKYEQIAELLNSIAERFDWEKVMEGDYIIGLKQGKQSISLEPGGQFEL  178



>ref|NP_001031701.1| glutamate-cysteine ligase [Arabidopsis thaliana]
 gb|AEE84707.1| glutamate-cysteine ligase [Arabidopsis thaliana]
Length=477

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 133/176 (76%), Gaps = 11/176 (6%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK--------GVVNSMEMFKRNEIGFGFssssrsssKGMQG  247
            MAL+SQ+G SY +    V  K        G V ++++ +  E  FG S S   S+K M  
Sbjct  1    MALLSQAGGSYTVVPSGVCSKAGTKAVVSGGVRNLDVLRMKE-AFGSSYSRSLSTKSMLL  59

Query  248  LRLE-SRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFG  424
              ++ S+RGH  L VAASPPTE+ V A EPLT+EDL+ YLASGCKTK+K+RIGTEHEKFG
Sbjct  60   HSVKRSKRGHQ-LIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHEKFG  118

Query  425  FEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FE  TLRPMKY+QIAELLNGI+ERF+W+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  119  FEVNTLRPMKYDQIAELLNGIAERFEWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  174



>ref|XP_008437270.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Cucumis 
melo]
 ref|XP_008437271.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Cucumis 
melo]
 ref|XP_008437272.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Cucumis 
melo]
Length=525

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 126/178 (71%), Gaps = 12/178 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKG------VVNSMEMFKRNEIGFGFssssrsssKGMQGL-  250
            MAL S +G ++ + +E ++C+G           E  K  EI  G SS S SS   M GL 
Sbjct  1    MALASHTGSAHRIGAETLRCRGGNMAFNFSTHAESLKMKEISIGSSSLSCSSRNIMHGLH  60

Query  251  ----RLESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEK  418
                R  SRRG   + VAASPPTED   A EPLTKEDLV YLASGCK KEKWRIGTEHEK
Sbjct  61   IDSARTASRRGDR-VIVAASPPTEDATVATEPLTKEDLVAYLASGCKPKEKWRIGTEHEK  119

Query  419  FGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FGF  ETLRPM YEQIA LLNGI+ERFDW+KIMEGD IIGL+QGKQSISLEPGGQFEL
Sbjct  120  FGFNIETLRPMTYEQIAGLLNGIAERFDWEKIMEGDNIIGLQQGKQSISLEPGGQFEL  177



>ref|XP_008792987.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
 ref|XP_008792991.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
 ref|XP_008792999.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
 ref|XP_008793008.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
Length=522

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 117/153 (76%), Gaps = 5/153 (3%)
 Frame = +2

Query  143  VKCKGVVNSMEMFKRNEIGFGFssssrsssKGMQGLRLE---SRRGHGGLTVAASPPTED  313
            V+C  +    ++  R  +  GF + +R+  +  QGLR +   SRRG   + VAASPPTED
Sbjct  24   VECDVISKDRQLRVRRNV-MGFRNMARNVERRSQGLRFDVVGSRRGQR-MVVAASPPTED  81

Query  314  VVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISE  493
             V   EPLTKEDLV YLASGCK KEKWRIGTEHEKFGFE  TLRP+ YEQIA+LLNGISE
Sbjct  82   AVVTTEPLTKEDLVRYLASGCKPKEKWRIGTEHEKFGFEVATLRPINYEQIADLLNGISE  141

Query  494  RFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            RFDWDK+MEGD +IGLKQGKQSISLEPGGQFEL
Sbjct  142  RFDWDKVMEGDYVIGLKQGKQSISLEPGGQFEL  174



>emb|CAA71075.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
Length=522

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 134/176 (76%), Gaps = 11/176 (6%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK--------GVVNSMEMFKRNEIGFGFssssrsssKGMQG  247
            MAL+SQ+G SY +    V  K        G V ++++ +  E  FG S+S   S+K M  
Sbjct  1    MALLSQAGGSYTVVPSGVCSKTGTKAVVSGGVRNLDVLRMKE-AFGSSNSRSLSTKSMLL  59

Query  248  LRLE-SRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFG  424
              ++ S+RGH  L VAASPPTE+ V A EPLT+EDL+ YLASGCKTK+K+RIGTEHEKFG
Sbjct  60   HSVKRSKRGHQ-LIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHEKFG  118

Query  425  FEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FE  TLRPMKY+QIAELLNGI+ERF+W+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  119  FEVNTLRPMKYDQIAELLNGIAERFEWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  174



>gb|AAL16161.1|AF428393_1 AT4g23100/F7H19_290 [Arabidopsis thaliana]
Length=522

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 133/176 (76%), Gaps = 11/176 (6%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK--------GVVNSMEMFKRNEIGFGFssssrsssKGMQG  247
            MAL+SQ+G SY +    V  K        G V ++++ +  E  FG S S   S+K M  
Sbjct  1    MALLSQAGGSYTVVPSGVCSKAGTKAVVSGGVRNLDVLRMKE-AFGSSYSRSLSTKSMLL  59

Query  248  LRLE-SRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFG  424
              ++ S+RGH  L VAASPPTE+ V A EPLT+EDL+ YLASGCKTK+K+RIGTEHEKFG
Sbjct  60   HSVKRSKRGHQ-LIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHEKFG  118

Query  425  FEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FE  TLRPMKY+QIAELLNGI+ERF+W+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  119  FEVNTLRPMKYDQIAELLNGIAERFEWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  174



>ref|XP_010920822.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Elaeis 
guineensis]
 ref|XP_010920823.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Elaeis 
guineensis]
Length=523

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 120/153 (78%), Gaps = 5/153 (3%)
 Frame = +2

Query  143  VKCKGVVNSMEMFKRNEIGFGFssssrsssKGMQGLRLE---SRRGHGGLTVAASPPTED  313
            V+C  ++   ++  R  +  G S+ +R+  + +QGLR +   SRRG   + VAASPPTED
Sbjct  25   VECNAMLKERQLRVRGSVA-GSSNVARNVERRLQGLRFDAVASRRGQR-MVVAASPPTED  82

Query  314  VVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISE  493
             +   EPLTKEDLV YLASGCK KEKWRIGTEHEKFGFE  TLRPMKYEQIA+LLNG++E
Sbjct  83   ALVMTEPLTKEDLVWYLASGCKPKEKWRIGTEHEKFGFEVATLRPMKYEQIADLLNGVAE  142

Query  494  RFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            RFDWDKIMEGD +IGLKQGKQSISLEPGGQFEL
Sbjct  143  RFDWDKIMEGDYVIGLKQGKQSISLEPGGQFEL  175



>gb|ABJ98542.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
Length=522

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 133/176 (76%), Gaps = 11/176 (6%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK--------GVVNSMEMFKRNEIGFGFssssrsssKGMQG  247
            MAL+SQ+G SY +    V  K        G V ++++ +  E  FG S S   S+K M  
Sbjct  1    MALLSQAGGSYTVVPSGVCSKTGTKAVVSGGVRNLDVLRMKE-AFGSSYSRSLSTKSMLL  59

Query  248  LRLE-SRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFG  424
              ++ S+RGH  L VAASPPTE+ V A EPLT+EDL+ YLASGCKTK+K+RIGTEHEKFG
Sbjct  60   HSVKRSKRGHQ-LIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHEKFG  118

Query  425  FEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FE  TLRPMKY+QIAELLNGI+ERF+W+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  119  FEVNTLRPMKYDQIAELLNGIAERFEWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  174



>gb|AAL08228.1| AT4g23100/F7H19_290 [Arabidopsis thaliana]
Length=522

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 133/176 (76%), Gaps = 11/176 (6%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK--------GVVNSMEMFKRNEIGFGFssssrsssKGMQG  247
            MAL+SQ+G SY +    V  K        G V ++++ +  E  FG S S   S+K M  
Sbjct  1    MALLSQAGGSYTVVPSGVCSKAGTKAVVSGGVRNLDVLRMKE-AFGSSYSRSLSTKSMLL  59

Query  248  LRLE-SRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFG  424
              ++ S+RGH  L VAASPPTE+ V A EPLT+EDL+ YLASGCKTK+K+RIGTEHEKFG
Sbjct  60   HSVKRSKRGHQ-LIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHEKFG  118

Query  425  FEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FE  TLRPMKY+QIAELLNGI+ERF+W+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  119  FEVNTLRPMKYDQIAELLNGIAERFEWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  174



>ref|NP_194041.1| glutamate-cysteine ligase [Arabidopsis thaliana]
 ref|NP_001190808.1| glutamate-cysteine ligase [Arabidopsis thaliana]
 sp|P46309.2|GSH1_ARATH RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: 
Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine 
synthetase; AltName: Full=Protein ROOT MERISTEMLESS 
1; Short=AtGCL; AltName: Full=Protein cadmium-sensitive 2; 
AltName: Full=Protein phytoalexin-deficient 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL31908.1|AF419576_1 AT4g23100/F7H19_290 [Arabidopsis thaliana]
 emb|CAA19826.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
 gb|AAD14544.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
 emb|CAB79265.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
 gb|AAN28909.1| At4g23100/F7H19_290 [Arabidopsis thaliana]
 gb|AEE84706.1| glutamate-cysteine ligase [Arabidopsis thaliana]
 gb|AEE84708.1| glutamate-cysteine ligase [Arabidopsis thaliana]
Length=522

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 133/176 (76%), Gaps = 11/176 (6%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK--------GVVNSMEMFKRNEIGFGFssssrsssKGMQG  247
            MAL+SQ+G SY +    V  K        G V ++++ +  E  FG S S   S+K M  
Sbjct  1    MALLSQAGGSYTVVPSGVCSKAGTKAVVSGGVRNLDVLRMKE-AFGSSYSRSLSTKSMLL  59

Query  248  LRLE-SRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFG  424
              ++ S+RGH  L VAASPPTE+ V A EPLT+EDL+ YLASGCKTK+K+RIGTEHEKFG
Sbjct  60   HSVKRSKRGHQ-LIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHEKFG  118

Query  425  FEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FE  TLRPMKY+QIAELLNGI+ERF+W+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  119  FEVNTLRPMKYDQIAELLNGIAERFEWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  174



>emb|CAA82626.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
Length=533

 Score =   199 bits (505),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 133/176 (76%), Gaps = 11/176 (6%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK--------GVVNSMEMFKRNEIGFGFssssrsssKGMQG  247
            MAL+SQ+G SY +    V  K        G V ++++ +  E  FG S S   S+K M  
Sbjct  1    MALLSQAGGSYTVVPSGVCSKAGTKAVVSGGVRNLDVLRMKE-AFGSSYSRSLSTKSMLL  59

Query  248  LRLE-SRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFG  424
              ++ S+RGH  L VAASPPTE+ V A EPLT+EDL+ YLASGCKTK+K+RIGTEHEKFG
Sbjct  60   HSVKRSKRGHQ-LIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHEKFG  118

Query  425  FEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FE  TLRPMKY+QIAELLNGI+ERF+W+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  119  FEVNTLRPMKYDQIAELLNGIAERFEWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  174



>sp|O23736.1|GSH1_BRAJU RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: 
Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine 
synthetase; Flags: Precursor [Brassica juncea]
 emb|CAA71801.1| gamma-glutamylcysteine synthetase [Brassica juncea]
 emb|CAD91712.1| glutamate-cysteine ligase [Brassica juncea]
Length=514

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 128/174 (74%), Gaps = 15/174 (9%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGMQGL  250
            MAL+SQ+G +Y + S  V  +       G VN + M +     +  + S++S  K     
Sbjct  1    MALLSQAGGAYTVPSGHVSSRTGTKTVSGCVNVLRMKETYVSSYSRTLSTKSMLK-----  55

Query  251  RLESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFE  430
               S+RGH  L VAASPPTE+ V A EPLT+EDL+ YLASGCK+KEKWRIGTEHEKFGFE
Sbjct  56   --RSKRGHQ-LIVAASPPTEEAVVATEPLTREDLIAYLASGCKSKEKWRIGTEHEKFGFE  112

Query  431  FETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
              TLRPMKY+QIAELLN I+ERF+W+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  113  VNTLRPMKYDQIAELLNSIAERFEWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  166



>gb|AHC02699.1| gamma-glutamylcysteine synthetase [Pyrus calleryana]
 gb|AHC02700.1| gamma-glutamylcysteine synthetase [Pyrus calleryana]
Length=490

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 119/167 (71%), Gaps = 25/167 (15%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKGVVNSMEMFKRNEIGFGFssssrsssKGMQGLRLESRRG  271
            M L+SQ+G SY + +E+ +        ++   +  G G                   +RG
Sbjct  1    MVLISQTGSSYCIRTELFR------KTQILHIDNAGVG------------------QKRG  36

Query  272  HGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPM  451
            H  + VAASPPTED V A EPLTKEDLV YL SGCK+KEKWRIGTEHEKFGFE +TLRP+
Sbjct  37   HT-VIVAASPPTEDAVIATEPLTKEDLVAYLVSGCKSKEKWRIGTEHEKFGFELKTLRPI  95

Query  452  KYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KYEQIAELLN ISERFDW+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  96   KYEQIAELLNVISERFDWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  142



>ref|XP_009136711.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Brassica 
rapa]
 ref|XP_009136719.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Brassica 
rapa]
 ref|XP_009136726.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Brassica 
rapa]
 emb|CAD91713.1| glutamate-cysteine ligase [Brassica juncea]
Length=511

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 124/167 (74%), Gaps = 4/167 (2%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKGVVNSMEMFKRNEIGFGFssssrsssKGMQGLRLESRRG  271
            MAL+SQ+G +Y + S  V  K    S+    RN      S +  SS       +  S+RG
Sbjct  1    MALLSQAGGAYTVPSGHVSSKIRTTSVSGCVRN---LRMSEAYVSSYSRTLSTKSRSKRG  57

Query  272  HGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPM  451
            H  L VAASPPTE+ V A EPLT+EDL+ YLASGCK+K+KWRIGTEHEKFGFE  TLRPM
Sbjct  58   HQ-LIVAASPPTEEAVVATEPLTREDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLRPM  116

Query  452  KYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KYEQIAELLN I+ERF+W+K++EGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  117  KYEQIAELLNSIAERFEWEKVLEGDKIIGLKQGKQSISLEPGGQFEL  163



>emb|CDY41249.1| BnaA01g12900D [Brassica napus]
Length=511

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 124/167 (74%), Gaps = 4/167 (2%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKGVVNSMEMFKRNEIGFGFssssrsssKGMQGLRLESRRG  271
            MAL+SQ+G +Y + S  V  K    S+    RN      S +  SS       +  S+RG
Sbjct  1    MALLSQAGGAYTVPSGHVSSKIRTTSVSGCVRN---LRMSEAYVSSYSRTLSTKSRSKRG  57

Query  272  HGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPM  451
            H  L VAASPPTE+ V A EPLT+EDL+ YLASGCK+K+KWRIGTEHEKFGFE  TLRPM
Sbjct  58   HQ-LIVAASPPTEEAVVATEPLTREDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLRPM  116

Query  452  KYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KYEQIAELLN I+ERF+W+K++EGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  117  KYEQIAELLNSIAERFEWEKVLEGDKIIGLKQGKQSISLEPGGQFEL  163



>ref|XP_008792975.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=582

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 117/153 (76%), Gaps = 5/153 (3%)
 Frame = +2

Query  143  VKCKGVVNSMEMFKRNEIGFGFssssrsssKGMQGLRLE---SRRGHGGLTVAASPPTED  313
            V+C  +    ++  R  +  GF + +R+  +  QGLR +   SRRG   + VAASPPTED
Sbjct  84   VECDVISKDRQLRVRRNV-MGFRNMARNVERRSQGLRFDVVGSRRGQR-MVVAASPPTED  141

Query  314  VVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISE  493
             V   EPLTKEDLV YLASGCK KEKWRIGTEHEKFGFE  TLRP+ YEQIA+LLNGISE
Sbjct  142  AVVTTEPLTKEDLVRYLASGCKPKEKWRIGTEHEKFGFEVATLRPINYEQIADLLNGISE  201

Query  494  RFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            RFDWDK+MEGD +IGLKQGKQSISLEPGGQFEL
Sbjct  202  RFDWDKVMEGDYVIGLKQGKQSISLEPGGQFEL  234



>ref|XP_008792981.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=575

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 117/153 (76%), Gaps = 5/153 (3%)
 Frame = +2

Query  143  VKCKGVVNSMEMFKRNEIGFGFssssrsssKGMQGLRLE---SRRGHGGLTVAASPPTED  313
            V+C  +    ++  R  +  GF + +R+  +  QGLR +   SRRG   + VAASPPTED
Sbjct  84   VECDVISKDRQLRVRRNV-MGFRNMARNVERRSQGLRFDVVGSRRGQR-MVVAASPPTED  141

Query  314  VVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISE  493
             V   EPLTKEDLV YLASGCK KEKWRIGTEHEKFGFE  TLRP+ YEQIA+LLNGISE
Sbjct  142  AVVTTEPLTKEDLVRYLASGCKPKEKWRIGTEHEKFGFEVATLRPINYEQIADLLNGISE  201

Query  494  RFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            RFDWDK+MEGD +IGLKQGKQSISLEPGGQFEL
Sbjct  202  RFDWDKVMEGDYVIGLKQGKQSISLEPGGQFEL  234



>gb|ACX70134.1| gamma-glutamylcysteine synthetase [Brassica rapa subsp. chinensis]
Length=511

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 123/167 (74%), Gaps = 4/167 (2%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKGVVNSMEMFKRNEIGFGFssssrsssKGMQGLRLESRRG  271
            MAL+SQ+G +Y + S  V  K    S+    RN      S +  SS          S+RG
Sbjct  1    MALLSQAGGAYTVPSGHVSSKIRTTSVSGCVRN---LRMSEAYVSSYSRTLSTNSRSKRG  57

Query  272  HGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPM  451
            H  L VAASPPTE+ V A EPLT+EDL+ YLASGCK+K+KWRIGTEHEKFGFE  TLRPM
Sbjct  58   HQ-LIVAASPPTEEAVVATEPLTREDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLRPM  116

Query  452  KYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KYEQIAELLN I+ERF+W+K++EGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  117  KYEQIAELLNSIAERFEWEKVLEGDKIIGLKQGKQSISLEPGGQFEL  163



>ref|XP_010540840.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=508

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 125/176 (71%), Gaps = 9/176 (5%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGMQGL  250
            MAL+SQ+G +  + S  V  K       G V ++EM K  E    F S S+SS K +   
Sbjct  1    MALVSQAGGTCSVPSGAVCSKTGNKAGPGSVRNLEMSKMKETYVSFCSRSKSSEKMLLRS  60

Query  251  RLESRRGHGG--LTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFG  424
                +R   G  + VA S PTED   A EPLTKEDL+GYLASGCK KEKWRIGTEHEKFG
Sbjct  61   NDNGKRSKRGRQVIVATSAPTEDAAVATEPLTKEDLIGYLASGCKPKEKWRIGTEHEKFG  120

Query  425  FEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FE  TLRPMKYEQIAELLNGI+ERFDW+K++E DKIIGLKQGKQSISLEPGGQFEL
Sbjct  121  FEVNTLRPMKYEQIAELLNGIAERFDWEKVLENDKIIGLKQGKQSISLEPGGQFEL  176



>ref|XP_006476577.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006476578.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Citrus sinensis]
Length=526

 Score =   196 bits (499),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 130/179 (73%), Gaps = 13/179 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L+ ++ PS  + ++V +C        G+  + E  +  E    FSSSSR S+K  Q L
Sbjct  1    MTLILRASPSCRVLTDVTRCTIRRSGVCGLAKNAEASRMKETCVSFSSSSRYSAKISQVL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             L++     RRG   + VAASPPTED V   EPLTKEDLVGYLASGCK KEKWRIGTEHE
Sbjct  61   HLDNAGIGIRRGRRSI-VAASPPTEDAVVVTEPLTKEDLVGYLASGCKPKEKWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFEF TL PMKYEQIAELLN I+ERFDW+K+MEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  120  KFGFEFGTLHPMKYEQIAELLNSIAERFDWEKVMEGDYIIGLKQGKQSISLEPGGQFEL  178



>ref|XP_010540831.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=524

 Score =   196 bits (498),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 125/176 (71%), Gaps = 9/176 (5%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGMQGL  250
            MAL+SQ+G +  + S  V  K       G V ++EM K  E    F S S+SS K +   
Sbjct  1    MALVSQAGGTCSVPSGAVCSKTGNKAGPGSVRNLEMSKMKETYVSFCSRSKSSEKMLLRS  60

Query  251  RLESRRGHGG--LTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFG  424
                +R   G  + VA S PTED   A EPLTKEDL+GYLASGCK KEKWRIGTEHEKFG
Sbjct  61   NDNGKRSKRGRQVIVATSAPTEDAAVATEPLTKEDLIGYLASGCKPKEKWRIGTEHEKFG  120

Query  425  FEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FE  TLRPMKYEQIAELLNGI+ERFDW+K++E DKIIGLKQGKQSISLEPGGQFEL
Sbjct  121  FEVNTLRPMKYEQIAELLNGIAERFDWEKVLENDKIIGLKQGKQSISLEPGGQFEL  176



>gb|AAG13459.1|AF128453_1 gamma-glutamylcysteine synthetase precursor [Glycine max]
Length=308

 Score =   191 bits (484),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +2

Query  281  LTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE  460
            + VAASPPTED V A +PLTK+DLV YLASGCK K+KWRIGTEHEKFGFE  +LRPMKY+
Sbjct  53   VIVAASPPTEDAVVATDPLTKQDLVDYLASGCKPKDKWRIGTEHEKFGFEIGSLRPMKYD  112

Query  461  QIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            QIAELLNGI+ERFDWDK+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  113  QIAELLNGIAERFDWDKVMEGDKIIGLKQGKQSISLEPGGQFEL  156



>gb|AAF22136.1|AF128454_1 gamma-glutamylcysteine synthetase precursor [Phaseolus vulgaris]
Length=508

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +2

Query  275  GGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMK  454
            G + VAASPPTED V A +PLTK+DLV YLASGCK +EKWRIGTEHEKFGFEF +LRPMK
Sbjct  55   GRVIVAASPPTEDAVVATDPLTKQDLVDYLASGCKPREKWRIGTEHEKFGFEFGSLRPMK  114

Query  455  YEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            YEQIAELLNGI+ERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  115  YEQIAELLNGIAERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  160



>ref|XP_007160058.1| hypothetical protein PHAVU_002G289200g [Phaseolus vulgaris]
 gb|ESW32052.1| hypothetical protein PHAVU_002G289200g [Phaseolus vulgaris]
Length=508

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +2

Query  275  GGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMK  454
            G + VAASPPTED V A +PLTK+DLV YLASGCK +EKWRIGTEHEKFGFEF +LRPMK
Sbjct  55   GRVIVAASPPTEDAVVATDPLTKQDLVDYLASGCKPREKWRIGTEHEKFGFEFGSLRPMK  114

Query  455  YEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            YEQIAELLNGI+ERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  115  YEQIAELLNGIAERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  160



>ref|XP_010255398.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Nelumbo 
nucifera]
Length=526

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 121/178 (68%), Gaps = 12/178 (7%)
 Frame = +2

Query  92   MALMSQSGPS-YGMHSEVVKCKGVVNSMEMFKRNEIGFGFssssrsssKGMQGLR-----  253
            MAL+SQ+ PS Y    + V      N  +M       F       SSS    G +     
Sbjct  2    MALISQTNPSSYIRSDQNVALNAASNVGDMIVSRNKAFKIKEGMTSSSSLSWGAKKMPRI  61

Query  254  -----LESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEK  418
                 L  +R H  + VAASPPTED V AAEPLTKEDLVGYLASGCK K+KWRIGTEHEK
Sbjct  62   SNFDGLRCKRDHR-MIVAASPPTEDAVIAAEPLTKEDLVGYLASGCKPKDKWRIGTEHEK  120

Query  419  FGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FGFE  TLRP+KYEQI  LLNG++ERFDW+KIMEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  121  FGFEIGTLRPIKYEQIKHLLNGLAERFDWEKIMEGDKIIGLKQGKQSISLEPGGQFEL  178



>gb|AAO45821.1| gamma-glutamylcysteine synthetase [Lotus japonicus]
 gb|AAO27827.1| gamma-glutamylcysteine synthetase [Lotus japonicus]
Length=495

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 99/111 (89%), Gaps = 1/111 (1%)
 Frame = +2

Query  260  SRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFET  439
            SRRG   L VAASPPTED V A EPLTK+DLV YLASGCK K+ WRIGTEHEKFGFE  +
Sbjct  38   SRRGRR-LIVAASPPTEDAVVATEPLTKQDLVDYLASGCKPKQNWRIGTEHEKFGFELGS  96

Query  440  LRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            LRPMKYEQIAELLNGI+ERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  97   LRPMKYEQIAELLNGIAERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  147



>gb|KDP25439.1| hypothetical protein JCGZ_20595 [Jatropha curcas]
Length=471

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 102/113 (90%), Gaps = 1/113 (1%)
 Frame = +2

Query  254  LESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEF  433
            L S+RG+  + VAASPP ED V A EPLTKEDLVGYLASGCK+KE+WRIGTEHEKFGFE 
Sbjct  12   LRSKRGNQ-VIVAASPPIEDAVIATEPLTKEDLVGYLASGCKSKEQWRIGTEHEKFGFEL  70

Query  434  ETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             TLRPMKYEQIAELLNGI+ERFDW+K+MEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  71   GTLRPMKYEQIAELLNGIAERFDWEKVMEGDYIIGLKQGKQSISLEPGGQFEL  123



>ref|XP_010695138.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=423

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 103/124 (83%), Gaps = 4/124 (3%)
 Frame = +2

Query  233  KGMQGLRLESRRGHGGL----TVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRI  400
            KG   L L+  RG+        VAASPPTED V AA+PLTKEDLV YLASGCK K+KWRI
Sbjct  23   KGTNYLCLDISRGNRSRGFRSIVAASPPTEDPVVAADPLTKEDLVNYLASGCKPKQKWRI  82

Query  401  GTEHEKFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGG  580
            GTEHEKFGFE +TLRPMKYEQIAELLNGI+ERFDWDK+MEGD IIGLKQG Q+ISLEPGG
Sbjct  83   GTEHEKFGFEIDTLRPMKYEQIAELLNGIAERFDWDKVMEGDYIIGLKQGNQNISLEPGG  142

Query  581  QFEL  592
            QFEL
Sbjct  143  QFEL  146



>ref|XP_002867730.1| hypothetical protein ARALYDRAFT_492552 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43989.1| hypothetical protein ARALYDRAFT_492552 [Arabidopsis lyrata subsp. 
lyrata]
Length=520

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 127/173 (73%), Gaps = 7/173 (4%)
 Frame = +2

Query  92   MALMSQSGPSYGM------HSEVVKCKGVVNSMEMFKRNEIGFGFssssrsssKGMQGLR  253
            MAL+SQ+G SY +       +      G V ++++ +  E  F  S S   S+K M    
Sbjct  1    MALLSQAGGSYTVVPLGCSKTGTKSVSGGVRNLDVLRMKE-AFVSSYSRSLSTKSMLLRS  59

Query  254  LESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEF  433
            ++  +    L VAASPPTE+ V A EPLT+EDL+ YLASGCKTK+K+RIGTEHEKFGFE 
Sbjct  60   VKRSKREHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHEKFGFEV  119

Query  434  ETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             TLRPMKYEQIAELLNGI+ERF+W+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  120  NTLRPMKYEQIAELLNGIAERFEWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  172



>ref|XP_010448772.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=528

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 132/181 (73%), Gaps = 15/181 (8%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK--------GVVNSMEMFKRNEIGFG-FssssrsssKGMQ  244
            MAL+SQ G SY + S  V  K        G V ++++ +  E  FG ++ +   S+    
Sbjct  1    MALLSQGGGSYTVPSGPVYSKNGTRAVSSGGVRNLDVLRMKEGFFGSYTGTRSLSTTKSM  60

Query  245  GLRLE-----SRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTE  409
             LR +     S+RGH  L VAASPPTE+ V A EPLT+EDL+ YLASGCKTK+K+RIGTE
Sbjct  61   LLRSDRSVKRSKRGHQ-LIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTE  119

Query  410  HEKFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFE  589
            HEKFGFE  TLRPMKY+QIAELLNGI+ERF+W+K+ME DKIIGLKQGKQSISLEPGGQFE
Sbjct  120  HEKFGFEVNTLRPMKYDQIAELLNGIAERFEWEKVMEEDKIIGLKQGKQSISLEPGGQFE  179

Query  590  L  592
            L
Sbjct  180  L  180



>gb|AEA77156.1| chloroplast gamma glutamyl cysteine synthetase [Vigna radiata]
Length=508

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +2

Query  275  GGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMK  454
            G + VAASPPTED V   +PLTK+DLV YLASGCK +EKWRIGTEHEKFGFEF +LRPMK
Sbjct  55   GRVIVAASPPTEDAVVVTDPLTKQDLVDYLASGCKPREKWRIGTEHEKFGFEFGSLRPMK  114

Query  455  YEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            YEQIAELLNGI+ERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  115  YEQIAELLNGIAERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  160



>gb|KDO76213.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
Length=397

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 97/110 (88%), Gaps = 1/110 (1%)
 Frame = +2

Query  263  RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETL  442
            RRG   + VAASPPTED V   EPLTKEDLVGYLASGCK KEKWRIGTEHEKFGFEF TL
Sbjct  32   RRGRRSI-VAASPPTEDAVVVTEPLTKEDLVGYLASGCKPKEKWRIGTEHEKFGFEFGTL  90

Query  443  RPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             PMKYEQIAELLN I+ERFDW+K+MEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  91   HPMKYEQIAELLNSIAERFDWEKVMEGDYIIGLKQGKQSISLEPGGQFEL  140



>ref|XP_006413578.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
 ref|XP_006413579.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
 ref|XP_006413580.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
 dbj|BAJ34068.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55031.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
 gb|ESQ55032.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
 gb|ESQ55033.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
Length=524

 Score =   194 bits (492),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 130/178 (73%), Gaps = 13/178 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGM---  241
            MAL+SQ+G SY + S  V  K       G V ++++ +  E     +S S  +   +   
Sbjct  1    MALLSQAGGSYTVPSGPVCSKIGTKAVSGSVRNLDVLRMKEAYVSSNSRSLPTKSVLLHS  60

Query  242  -QGLRLESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEK  418
             Q ++  S+RGH  L VAASPPTE+ V A EPLT+EDL+ YLASGCK+K+KWRIGTEHEK
Sbjct  61   SQSVK-RSKRGHQ-LIVAASPPTEEAVVATEPLTREDLIAYLASGCKSKDKWRIGTEHEK  118

Query  419  FGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FGFE  TLRPMKY+QIAELLN I+ERF+W+K+ME DKIIGLKQGKQSISLEPGGQFEL
Sbjct  119  FGFEVNTLRPMKYDQIAELLNSIAERFEWEKVMEDDKIIGLKQGKQSISLEPGGQFEL  176



>ref|XP_010439228.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Camelina 
sativa]
Length=528

 Score =   193 bits (491),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 132/181 (73%), Gaps = 15/181 (8%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK--------GVVNSMEMFKRNEIGFG-FssssrsssKGMQ  244
            MAL+SQ G SY + S  V  K        G V ++++ +  E  FG +S +   ++    
Sbjct  1    MALLSQGGGSYTVPSGPVCSKNGAKAVYGGGVRNLDVLRMKEGFFGSYSGTRSLATTKSM  60

Query  245  GLRLE-----SRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTE  409
             LR +     S+RGH  L VAASPPTE+ V A EPLT+EDL+ YLASGCKTK+K+RIGTE
Sbjct  61   LLRSDRSVKRSKRGHQ-LIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTE  119

Query  410  HEKFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFE  589
            HEKFGFE  TLRPMKY+QIAELLNGI+ERF+W+K+ME DKIIGLKQGKQSISLEPGGQFE
Sbjct  120  HEKFGFEVNTLRPMKYDQIAELLNGIAERFEWEKVMEEDKIIGLKQGKQSISLEPGGQFE  179

Query  590  L  592
            L
Sbjct  180  L  180



>ref|XP_010433943.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=529

 Score =   193 bits (491),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 132/182 (73%), Gaps = 16/182 (9%)
 Frame = +2

Query  92   MALMSQSGPSYGMHS---------EVVKCKGVVNSMEMFKRNEIGFG-FssssrsssKGM  241
            MAL+SQ G SY + +         + V   G V ++++ +  E  FG ++ +   ++   
Sbjct  1    MALLSQGGGSYTVPTGPLYSKNGTKAVYGGGTVRNLDVLRMKEGFFGSYTGTRSLTTTKS  60

Query  242  QGLRLE-----SRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGT  406
              LR +     S+RGH  L VAASPPTE+ V A EPLT+EDL+ YLASGCKTK+K+RIGT
Sbjct  61   MLLRSDLSVKRSKRGHQ-LIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGT  119

Query  407  EHEKFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQF  586
            EHEKFGFE  TLRPMKY+QIAELLNGI+ERF+W+K+ME DKIIGLKQGKQSISLEPGGQF
Sbjct  120  EHEKFGFEVNTLRPMKYDQIAELLNGIAERFEWEKVMEEDKIIGLKQGKQSISLEPGGQF  179

Query  587  EL  592
            EL
Sbjct  180  EL  181



>gb|KDO76211.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
 gb|KDO76212.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
Length=427

 Score =   191 bits (485),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 97/110 (88%), Gaps = 1/110 (1%)
 Frame = +2

Query  263  RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETL  442
            RRG   + VAASPPTED V   EPLTKEDLVGYLASGCK KEKWRIGTEHEKFGFEF TL
Sbjct  32   RRGRRSI-VAASPPTEDAVVVTEPLTKEDLVGYLASGCKPKEKWRIGTEHEKFGFEFGTL  90

Query  443  RPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             PMKYEQIAELLN I+ERFDW+K+MEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  91   HPMKYEQIAELLNSIAERFDWEKVMEGDYIIGLKQGKQSISLEPGGQFEL  140



>gb|KGN50100.1| hypothetical protein Csa_5G153150 [Cucumis sativus]
Length=501

 Score =   192 bits (489),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = +2

Query  251  RLESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFE  430
            R+ S+RG G + VAASPPTED   AAEPLTKEDLV YLASGCK KEKWRIGTEHEKFGF 
Sbjct  41   RMASKRG-GRVIVAASPPTEDATVAAEPLTKEDLVAYLASGCKPKEKWRIGTEHEKFGFN  99

Query  431  FETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             ETLRPM Y+QIA LLNGI+ERFDW+KIMEGD IIGL+QGKQSISLEPGGQFEL
Sbjct  100  IETLRPMTYDQIAGLLNGIAERFDWEKIMEGDNIIGLQQGKQSISLEPGGQFEL  153



>ref|XP_010695135.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010695136.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010695137.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=494

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 103/124 (83%), Gaps = 4/124 (3%)
 Frame = +2

Query  233  KGMQGLRLESRRGHGGL----TVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRI  400
            KG   L L+  RG+        VAASPPTED V AA+PLTKEDLV YLASGCK K+KWRI
Sbjct  23   KGTNYLCLDISRGNRSRGFRSIVAASPPTEDPVVAADPLTKEDLVNYLASGCKPKQKWRI  82

Query  401  GTEHEKFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGG  580
            GTEHEKFGFE +TLRPMKYEQIAELLNGI+ERFDWDK+MEGD IIGLKQG Q+ISLEPGG
Sbjct  83   GTEHEKFGFEIDTLRPMKYEQIAELLNGIAERFDWDKVMEGDYIIGLKQGNQNISLEPGG  142

Query  581  QFEL  592
            QFEL
Sbjct  143  QFEL  146



>ref|XP_009137315.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Brassica 
rapa]
Length=515

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 125/173 (72%), Gaps = 12/173 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVV----KCKGVVNSMEMFKRNEIGFGFssssrsssKGMQGLRLE  259
            MAL+SQ G +Y + S  +    + K V   + + +  +  F        S K M  L   
Sbjct  1    MALLSQGGGAYTVPSGTLCSKTRAKAVSGCVNVLRMKDCSFS----RSLSPKSM--LVER  54

Query  260  SRRGHGGLTVAASPPTEDV--VTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEF  433
            S+RG   L VAASPPT++     AAEPLT+EDL+ YLASGCK+K+KWRIGTEHEKFGFE 
Sbjct  55   SKRGQHQLIVAASPPTDEASAAVAAEPLTREDLIAYLASGCKSKDKWRIGTEHEKFGFEV  114

Query  434  ETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            +TLRPMKY+QIAELLN I+ERF+W+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  115  KTLRPMKYDQIAELLNSIAERFEWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  167



>ref|XP_003630512.1| Glutamate-cysteine ligase [Medicago truncatula]
 sp|Q9ZNX6.1|GSH1_MEDTR RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: 
Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine 
synthetase; Flags: Precursor [Medicago truncatula]
 gb|AAC82334.1| gamma-glutamylcysteine synthetase [Medicago truncatula]
 gb|AET04988.1| glutamate-cysteine ligase B [Medicago truncatula]
Length=508

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 115/169 (68%), Gaps = 19/169 (11%)
 Frame = +2

Query  98   LMSQSGPSYGM----HSEVVKCKGVVNSMEMFKRNEIGFGFssssrsssKGMQGLRLESR  265
            L S S PS       H+  ++   + N+     +N + F                R+ + 
Sbjct  7    LASSSSPSLRHDATPHNFHIRKTSISNTFSFSSKNSLSFK---------------RILTS  51

Query  266  RGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLR  445
             G     VAASPPTED V A EPLTK+DL+ YLASGCKTK+KWRIGTEHEKFGFE  +LR
Sbjct  52   GGSRRFIVAASPPTEDAVVATEPLTKQDLIDYLASGCKTKDKWRIGTEHEKFGFELGSLR  111

Query  446  PMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            PMKYEQI+ELLNGI+ERFDWDK+MEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  112  PMKYEQISELLNGIAERFDWDKVMEGDNIIGLKQGKQSISLEPGGQFEL  160



>emb|CAD91714.1| glutamate-cysteine ligase [Brassica juncea]
Length=515

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 125/173 (72%), Gaps = 12/173 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVV----KCKGVVNSMEMFKRNEIGFGFssssrsssKGMQGLRLE  259
            MAL+SQ G +Y + S  +    + K V   + + +  +  F        S K M  L   
Sbjct  1    MALLSQGGGAYTVPSGTLCSKTRAKAVSGCVNVLRMKDCSFS----RSLSPKSM--LVER  54

Query  260  SRRGHGGLTVAASPPTEDV--VTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEF  433
            S+RG   L VAASPPT++     AAEPLT+EDL+ YLASGCK+K+KWRIGTEHEKFGFE 
Sbjct  55   SKRGQHQLIVAASPPTDEASAAVAAEPLTREDLIAYLASGCKSKDKWRIGTEHEKFGFEV  114

Query  434  ETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            +TLRPMKY+QIAELLN I+ERF+W+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  115  KTLRPMKYDQIAELLNSIAERFEWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  167



>ref|XP_006283533.1| hypothetical protein CARUB_v10004582mg [Capsella rubella]
 gb|EOA16431.1| hypothetical protein CARUB_v10004582mg [Capsella rubella]
Length=525

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 102/111 (92%), Gaps = 1/111 (1%)
 Frame = +2

Query  260  SRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFET  439
            S+RGH  L VAASPPTE+ V A EPLT+EDL+ YLASGCKTK+K+RIGTEHEKFGFE  T
Sbjct  68   SKRGHQ-LIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHEKFGFEVNT  126

Query  440  LRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            LRPMKY+QIAELLNGI+ERF+W+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  127  LRPMKYDQIAELLNGIAERFEWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  177



>gb|KDO76206.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
 gb|KDO76207.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
 gb|KDO76208.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
Length=488

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 97/110 (88%), Gaps = 1/110 (1%)
 Frame = +2

Query  263  RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETL  442
            RRG   + VAASPPTED V   EPLTKEDLVGYLASGCK KEKWRIGTEHEKFGFEF TL
Sbjct  32   RRGRRSI-VAASPPTEDAVVVTEPLTKEDLVGYLASGCKPKEKWRIGTEHEKFGFEFGTL  90

Query  443  RPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             PMKYEQIAELLN I+ERFDW+K+MEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  91   HPMKYEQIAELLNSIAERFDWEKVMEGDYIIGLKQGKQSISLEPGGQFEL  140



>ref|XP_006586325.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Glycine 
max]
Length=507

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +2

Query  281  LTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE  460
            + +AASPPTED + A +PLTK+DLV YLASGCK K+KWRIGTEHEKFGFEF TLRPMKY+
Sbjct  59   VILAASPPTEDALVATDPLTKQDLVDYLASGCKPKDKWRIGTEHEKFGFEFGTLRPMKYD  118

Query  461  QIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            QIAELLNGI+ERFDWDK+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  119  QIAELLNGIAERFDWDKVMEGDKIIGLKQGKQSISLEPGGQFEL  162



>gb|KHN16824.1| Glutamate--cysteine ligase, chloroplastic [Glycine soja]
Length=510

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +2

Query  281  LTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE  460
            + +AASPPTED + A +PLTK+DLV YLASGCK K+KWRIGTEHEKFGFEF TLRPMKY+
Sbjct  59   VILAASPPTEDALVATDPLTKQDLVDYLASGCKPKDKWRIGTEHEKFGFEFGTLRPMKYD  118

Query  461  QIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            QIAELLNGI+ERFDWDK+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  119  QIAELLNGIAERFDWDKVMEGDKIIGLKQGKQSISLEPGGQFEL  162



>ref|XP_004503722.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Cicer 
arietinum]
Length=504

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +2

Query  281  LTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE  460
            + VAASPPTED V A  PLTK+DL+ YLASGCKTK+KWRIGTEHEKFGFE  +LRPMKYE
Sbjct  53   VIVAASPPTEDAVVATHPLTKQDLIDYLASGCKTKDKWRIGTEHEKFGFELGSLRPMKYE  112

Query  461  QIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            QI++LLNGI+ERFDWDK+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  113  QISDLLNGIAERFDWDKVMEGDKIIGLKQGKQSISLEPGGQFEL  156



>ref|XP_010529570.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Tarenaya 
hassleriana]
Length=524

 Score =   191 bits (484),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 126/179 (70%), Gaps = 15/179 (8%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKG-------VVNSMEMFKRNEIGFGFssssrsssKGM---  241
            MAL+SQ+G +  + S  V  K         V +  M K  E    F  S++S+ K +   
Sbjct  1    MALVSQAGGTCSVPSGAVCSKTGNKAGFWAVKNQAMSKMKETYVSFCPSNKSAKKMLIHS  60

Query  242  --QGLRLESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
               G R  S+RGH  + VAAS PTE+ V A EPLTKEDL+GYLASGCK KE WRIGTEHE
Sbjct  61   HNNGKR--SQRGHQ-VIVAASAPTEEAVVATEPLTKEDLIGYLASGCKPKENWRIGTEHE  117

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE  T RPMKYEQIAELLNGI+ERFDW+K++E DKIIGLKQGKQSISLEPGGQFEL
Sbjct  118  KFGFEVNTFRPMKYEQIAELLNGIAERFDWEKVLENDKIIGLKQGKQSISLEPGGQFEL  176



>ref|XP_009402382.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=517

 Score =   190 bits (483),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 110/141 (78%), Gaps = 4/141 (3%)
 Frame = +2

Query  179  FKRNEIGFGFssssrsssKGMQGLRLESRRGHG---GLTVAASPPTEDVVTAAEPLTKED  349
             KR  +  GF S  R   +  QGLR  +R G+G   G+ VAASPPT+D V   EPLTKED
Sbjct  30   LKRRGVFVGFDSLVRHGERRSQGLRWVAR-GYGRTSGMVVAASPPTDDAVVITEPLTKED  88

Query  350  LVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDK  529
            LVGYLASGCK KE WRIGTEHEKFGFE  TL PMKYEQIA+LLN I+ERFDWDKI+EGD 
Sbjct  89   LVGYLASGCKPKEMWRIGTEHEKFGFEVGTLCPMKYEQIADLLNAIAERFDWDKIVEGDY  148

Query  530  IIGLKQGKQSISLEPGGQFEL  592
            +IGLKQGKQ+ISLEPGGQFEL
Sbjct  149  VIGLKQGKQNISLEPGGQFEL  169



>ref|XP_003525397.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Glycine max]
 ref|XP_006580590.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X2 [Glycine max]
 gb|KHN23647.1| Glutamate--cysteine ligase, chloroplastic [Glycine soja]
Length=504

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +2

Query  281  LTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE  460
            + VAASPPTED V A +PLTK+DLV YLASGCK K+KWRIGTEHEKFGFE  +LRPMKY+
Sbjct  53   VIVAASPPTEDAVVATDPLTKQDLVDYLASGCKPKDKWRIGTEHEKFGFEIGSLRPMKYD  112

Query  461  QIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            QIAELLNGI+ERFDWDK+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  113  QIAELLNGIAERFDWDKVMEGDKIIGLKQGKQSISLEPGGQFEL  156



>ref|XP_010937863.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like [Elaeis 
guineensis]
 ref|XP_010937864.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like [Elaeis 
guineensis]
Length=522

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 117/156 (75%), Gaps = 3/156 (2%)
 Frame = +2

Query  131  HSEVVKCKGVVNSMEMFKR-NEIGFG-FssssrsssKGMQGLRLESRRGHGGLTVAASPP  304
            +S  V+C  ++   ++  R N +G G    ++   SK +    +  RRG   + VAASPP
Sbjct  20   YSSGVECNAILKERQLKVRGNLLGLGDLVRNAERRSKRLHFNVVGPRRGQR-MVVAASPP  78

Query  305  TEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNG  484
            TED V   EPLTKEDLV YLASGCK KE+WRIGTEHEKFGFE  TLRP+KYEQIA+LLNG
Sbjct  79   TEDAVVMTEPLTKEDLVQYLASGCKPKEQWRIGTEHEKFGFEVATLRPIKYEQIADLLNG  138

Query  485  ISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            ++ERFDWDKIMEGD +IGLKQGKQSISLEPGGQFEL
Sbjct  139  LAERFDWDKIMEGDYVIGLKQGKQSISLEPGGQFEL  174



>ref|XP_008789126.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like [Phoenix 
dactylifera]
Length=522

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 122/176 (69%), Gaps = 11/176 (6%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEV------VKCKGVVNSMEMFKRNEIGFGFssssrsssKGMQGLR  253
            MA+ S+  P     SE+      V+C  ++    +  R  +  GFS   R+  +  + L 
Sbjct  1    MAIASRLPPDQIRWSEMLNYPSGVECNAILKERRLKVRGNL-VGFSDLKRNVERRSERLH  59

Query  254  LE---SRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFG  424
                 SRRG   + VAASPPTED V   EPLTKEDLV YLASGCK KE+WRIGTEHEKFG
Sbjct  60   FNVVGSRRGQR-MVVAASPPTEDAVVMTEPLTKEDLVQYLASGCKPKEEWRIGTEHEKFG  118

Query  425  FEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FE  TLRP+KYEQIA+LLNG++ERFDWDKIMEGD +IGLKQ KQSISLEPGGQFEL
Sbjct  119  FEVATLRPIKYEQIADLLNGLAERFDWDKIMEGDYVIGLKQAKQSISLEPGGQFEL  174



>gb|AAF22137.1|AF128455_1 gamma-glutamylcysteine synthetase precursor [Pisum sativum]
Length=499

 Score =   187 bits (476),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +2

Query  281  LTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE  460
            L VAASPPTED V A EPLTK+DL+ YLASGCK K+KWRIGTEHEKFGFE  +LRP+KYE
Sbjct  48   LIVAASPPTEDAVVATEPLTKQDLIDYLASGCKPKDKWRIGTEHEKFGFELGSLRPVKYE  107

Query  461  QIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            QIAELLN I+ERFDW+KIMEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  108  QIAELLNAIAERFDWEKIMEGDKIIGLKQGKQSISLEPGGQFEL  151



>ref|XP_008351685.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Malus 
domestica]
Length=165

 Score =   177 bits (449),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 117/164 (71%), Gaps = 13/164 (8%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK---GVV----NSMEMFKRNEIGFGFssssrsssKGMQGL  250
            M L  Q G SY + +E+ + K    VV    NS++  K  E   GFSS   SS+   Q L
Sbjct  1    MGLFLQMGSSYCIRTELFRYKSGKNVVFSRANSIDASKLKENSIGFSSLLYSSTSKAQIL  60

Query  251  RLES-----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
             + +     +RGH  + V ASPPTED V A EPLTKEDLV YLASGCK+K+KWRIGTEHE
Sbjct  61   HIANAGVGQKRGHS-VIVTASPPTEDAVIATEPLTKEDLVAYLASGCKSKDKWRIGTEHE  119

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQ  547
            KFGF+ +TLRP+KYEQIAELLNGISER+DW+K+MEGDKIIGLKQ
Sbjct  120  KFGFDRKTLRPIKYEQIAELLNGISERYDWEKVMEGDKIIGLKQ  163



>gb|EPS61788.1| gamma-glutamylcysteine synthetase, partial [Genlisea aurea]
Length=454

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +2

Query  281  LTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE  460
            L VAASPPTED V + EPLTK+DLV YLASGCK KEKWRIGTEHEKFGFEF+TLRPMKY 
Sbjct  3    LIVAASPPTEDTVVSTEPLTKKDLVDYLASGCKPKEKWRIGTEHEKFGFEFKTLRPMKYG  62

Query  461  QIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            QI+ELL+ ISERFDWDKI+EG+ IIGLKQGKQSISLEPGGQFEL
Sbjct  63   QISELLHSISERFDWDKILEGENIIGLKQGKQSISLEPGGQFEL  106



>pdb|2GWD|A Chain A, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With Mg2+ And L-glutamate
Length=449

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  290  AASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIA  469
            AASPPTE+ V A EPLT+EDL+ YLASGCK+KEKWRIGTEHEKFGFE  TLRPMKY+QIA
Sbjct  1    AASPPTEEAVVATEPLTREDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPMKYDQIA  60

Query  470  ELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            ELLN I+ERF+W+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  61   ELLNSIAERFEWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  101



>emb|CDY10914.1| BnaA03g45730D [Brassica napus]
Length=517

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 125/175 (71%), Gaps = 14/175 (8%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKGVVNSM-----EMFKRNEIGFGFssssrsssKGMQGLRL  256
            MAL+SQ G +Y + S  +  K    ++      + +  +  F        S K M  L  
Sbjct  1    MALLSQGGGAYTVPSGTLCSKTRAKAVSGCGGNVLRMKDCSFS----RSLSPKSM--LVE  54

Query  257  ESRRGHG-GLTVAASPPTEDV--VTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGF  427
             S+RGH   L VAASPPT++     AAEPLT+EDL+ YLASGCK+K+KWRIGTEHEKFGF
Sbjct  55   RSKRGHHHQLIVAASPPTDEASAAVAAEPLTREDLIAYLASGCKSKDKWRIGTEHEKFGF  114

Query  428  EFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            E +TLRPMKY+QIAELLN I+ERF+W+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  115  EVKTLRPMKYDQIAELLNSIAERFEWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  169



>gb|AAL61610.1|AF401621_1 gamma-glutamylcysteine synthetase [Allium cepa]
Length=496

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +2

Query  272  HGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPM  451
             G   V+ASPPTED V   EPLTK+DLV YLASGCKTK+KWRIGTEHEKFGF+  TLRPM
Sbjct  42   RGKFVVSASPPTEDAVVMTEPLTKDDLVAYLASGCKTKDKWRIGTEHEKFGFQINTLRPM  101

Query  452  KYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             YEQIA LLNGI+ERFDW+K+MEGD +IGLKQGKQSISLEPGGQFEL
Sbjct  102  TYEQIAYLLNGIAERFDWEKVMEGDYVIGLKQGKQSISLEPGGQFEL  148



>emb|CAR82640.1| putative glutamyl cysteine ligase [Brassica napus]
 emb|CDX94161.1| BnaC07g37950D [Brassica napus]
Length=503

 Score =   185 bits (470),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 101/112 (90%), Gaps = 1/112 (1%)
 Frame = +2

Query  260  SRRGHGGLTVAASPPTEDV-VTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFE  436
            S+R +  L VAASPPT++  V AAEPLT++DL+ YLASGCK+K+KWRIGTEHEKFGFE  
Sbjct  44   SKRRNHQLIVAASPPTDEAAVVAAEPLTRDDLIAYLASGCKSKDKWRIGTEHEKFGFEVN  103

Query  437  TLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            TLRPMKY+QIAELLN I+ERF+W+K+MEGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  104  TLRPMKYDQIAELLNSIAERFEWEKVMEGDKIIGLKQGKQSISLEPGGQFEL  155



>ref|XP_006851855.2| PREDICTED: glutamate--cysteine ligase, chloroplastic [Amborella 
trichopoda]
 ref|XP_011626059.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Amborella 
trichopoda]
Length=533

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 124/184 (67%), Gaps = 17/184 (9%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKGVVN-SMEMFKRNEIGFGFssssrsssKGMQG-------  247
            MA++S++  SY +HSE+   +   N ++ +   +E G      S    K ++G       
Sbjct  2    MAVISRASLSYNIHSELFSYRSQKNATVNLGCSSETGSSNLGQSTCFVKNVRGPSSLSWN  61

Query  248  ---LRLESR------RGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRI  400
                R  SR      R  G   VAASPPT+D + A +PLTKEDLV YLASGCK KE WRI
Sbjct  62   SLRARWLSRSQTTGWRRAGCYIVAASPPTDDALVATDPLTKEDLVSYLASGCKPKEAWRI  121

Query  401  GTEHEKFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGG  580
            GTEHEKFGFEF +LRP++Y+QIA+LL G++ERFDWDK+MEGD IIGL QGKQSISLEPGG
Sbjct  122  GTEHEKFGFEFGSLRPLRYDQIADLLTGLAERFDWDKVMEGDHIIGLVQGKQSISLEPGG  181

Query  581  QFEL  592
            QFEL
Sbjct  182  QFEL  185



>ref|XP_009380693.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=524

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 114/164 (70%), Gaps = 7/164 (4%)
 Frame = +2

Query  116  PSYGMHSEVVKCKGVVNSMEMFKR---NEIGFGFssssrsssKGMQGLRLESR--RGHGG  280
            P     + V +C G     E+  R   N  G GF   + +  +  +GL   +R  R    
Sbjct  15   PGSPCANSVTECSGARRKREVRFRALGNSEGLGFLVQNGA--RKSRGLCWNARGSRRAKR  72

Query  281  LTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE  460
            + VAASPPT+D V   EPL KEDLVGYL SGCK KE WRIGTEHEKFGFE  +LRPMKYE
Sbjct  73   MVVAASPPTDDGVVVTEPLMKEDLVGYLNSGCKPKEMWRIGTEHEKFGFEVGSLRPMKYE  132

Query  461  QIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            QIA+LLNG++ERFDWDKIMEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  133  QIADLLNGLAERFDWDKIMEGDYIIGLKQGKQSISLEPGGQFEL  176



>gb|KJB37542.1| hypothetical protein B456_006G209400 [Gossypium raimondii]
Length=490

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 121/165 (73%), Gaps = 11/165 (7%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGMQGL  250
            MAL+S++G SY + S++ + +       GVVN++E     E     SS S  +++  Q  
Sbjct  1    MALVSKAGSSYCIRSDITRGRTGQNVAFGVVNNVEAPIMKEKSIKISSLSCKNARVAQFF  60

Query  251  RLES----RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEK  418
             LE+     +G   + VAASPPTED + A EPLTK+DLVGYLASGCK+KEKWRIGTEHEK
Sbjct  61   PLETVGFRSKGRNSVIVAASPPTEDALIAIEPLTKQDLVGYLASGCKSKEKWRIGTEHEK  120

Query  419  FGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGK  553
            FGFE +TLRPMKYEQIAELLNGISERFDW+K+MEGDKIIGLKQ K
Sbjct  121  FGFEIKTLRPMKYEQIAELLNGISERFDWEKVMEGDKIIGLKQVK  165



>gb|ABM46854.1| gamma-glutamylcysteine synthetase [Chorispora bungeana]
Length=524

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 129/179 (72%), Gaps = 15/179 (8%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCK-------GVVNSMEMFKRNEIGFGFssssrsssKGM---  241
            MAL+SQ+G SY + S  +  K       G + ++++ +  E  +    S   S+K M   
Sbjct  1    MALLSQAGGSYTVPSGPLSSKTGTKAVSGGLRNLDVLRIKE-AYVSPYSRSLSTKSMLLH  59

Query  242  --QGLRLESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHE  415
                ++  S+RGH  L VAASPPTE+ V A EPLT+EDL+ YLASGCK+K+K+RIGTEHE
Sbjct  60   SNHSVK-RSKRGHQ-LIVAASPPTEEAVVATEPLTREDLIAYLASGCKSKDKYRIGTEHE  117

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGF+  TLRPMKY+QIAELLN I+ERF+W+K+ME DKIIGLKQGKQSISL PGGQFEL
Sbjct  118  KFGFDVNTLRPMKYDQIAELLNSIAERFEWEKVMEDDKIIGLKQGKQSISLGPGGQFEL  176



>ref|XP_007210716.1| hypothetical protein PRUPE_ppa022884mg, partial [Prunus persica]
 gb|EMJ11915.1| hypothetical protein PRUPE_ppa022884mg, partial [Prunus persica]
Length=463

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +2

Query  263  RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETL  442
            +R      VAASPPTE  V AAEPLTKEDL+GYLASGCK KE WRIGTE E+FGF+ +TL
Sbjct  6    QRRRRSAIVAASPPTEAAVIAAEPLTKEDLIGYLASGCKPKENWRIGTEQERFGFDLKTL  65

Query  443  RPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFE  589
            RPMKYE IAELLNGI++RFDWDKIMEG+ II LKQGKQSI+LEPGGQFE
Sbjct  66   RPMKYEHIAELLNGIADRFDWDKIMEGNNIIALKQGKQSITLEPGGQFE  114



>pdb|2GWC|A Chain A, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|B Chain B, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|C Chain C, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|D Chain D, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|E Chain E, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|F Chain F, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|G Chain G, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|H Chain H, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
Length=449

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  290  AASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIA  469
            AASPPTE+ V A EPLT+EDL+ YLASGCK+KEKWRIGTEHEKFGFE  TLRP KY+QIA
Sbjct  1    AASPPTEEAVVATEPLTREDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPXKYDQIA  60

Query  470  ELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            ELLN I+ERF+W+K+ EGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  61   ELLNSIAERFEWEKVXEGDKIIGLKQGKQSISLEPGGQFEL  101



>ref|XP_002439220.1| hypothetical protein SORBIDRAFT_09g002470 [Sorghum bicolor]
 gb|EES17650.1| hypothetical protein SORBIDRAFT_09g002470 [Sorghum bicolor]
Length=501

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +2

Query  266  RGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLR  445
            R   G  VAASPPTE+ V   EPLTK+DLV YL SGCK KE WRIGTEHEKFGFE +TLR
Sbjct  45   RTRRGGAVAASPPTEEAVQMTEPLTKDDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLR  104

Query  446  PMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            P+KY+QI ++LNG++ERFDWDKIMEGD +IGLKQGKQSISLEPGGQFEL
Sbjct  105  PIKYDQIRDILNGLAERFDWDKIMEGDNVIGLKQGKQSISLEPGGQFEL  153



>ref|NP_001054541.1| Os05g0129000 [Oryza sativa Japonica Group]
 sp|Q688Q9.1|GSH1A_ORYSJ RecName: Full=Glutamate--cysteine ligase A, chloroplastic; AltName: 
Full=Gamma-ECS A; Short=GCS A; AltName: Full=Gamma-glutamylcysteine 
synthetase A; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|AAU10747.1| putative gamma-glutamylcysteine synthetase [Oryza sativa Japonica 
Group]
 dbj|BAF16455.1| Os05g0129000 [Oryza sativa Japonica Group]
 dbj|BAG96011.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = +2

Query  266  RGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLR  445
            RG GG  VAASPPTE+ V   EPLTKEDLV YL SGCK KE WRIGTEHEKFGFE +TLR
Sbjct  37   RGRGG-AVAASPPTEEAVQMTEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLR  95

Query  446  PMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            P+KY+QI ++LNG++ERFDWDKI+E + +IGLKQGKQSISLEPGGQFEL
Sbjct  96   PIKYDQIRDILNGLAERFDWDKIVEENNVIGLKQGKQSISLEPGGQFEL  144



>emb|CAD48599.3| gamma-glutamylcysteine synthetase [Oryza sativa Japonica Group]
Length=492

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = +2

Query  266  RGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLR  445
            RG GG  VAASPPTE+ V   EPLTKEDLV YL SGCK KE WRIGTEHEKFGFE +TLR
Sbjct  37   RGRGG-AVAASPPTEEAVQMTEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLR  95

Query  446  PMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            P+KY+QI ++LNG++ERFDWDKI+E + +IGLKQGKQSISLEPGGQFEL
Sbjct  96   PIKYDQIRDILNGLAERFDWDKIVEENNVIGLKQGKQSISLEPGGQFEL  144



>sp|Q8GU95.2|GSH1A_ORYSI RecName: Full=Glutamate--cysteine ligase A, chloroplastic; AltName: 
Full=Gamma-ECS A; Short=GCS A; AltName: Full=Gamma-glutamylcysteine 
synthetase A; Flags: Precursor [Oryza sativa 
Indica Group]
 gb|EEC78447.1| hypothetical protein OsI_18304 [Oryza sativa Indica Group]
Length=492

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = +2

Query  266  RGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLR  445
            RG GG  VAASPPTE+ V   EPLTKEDLV YL SGCK KE WRIGTEHEKFGFE +TLR
Sbjct  37   RGRGG-AVAASPPTEEAVQMTEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLR  95

Query  446  PMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            P+KY+QI ++LNG++ERFDWDKI+E + +IGLKQGKQSISLEPGGQFEL
Sbjct  96   PIKYDQIRDILNGLAERFDWDKIVEENNVIGLKQGKQSISLEPGGQFEL  144



>ref|XP_008655177.1| PREDICTED: uncharacterized protein LOC100381846 isoform X1 [Zea 
mays]
 gb|AFW82737.1| hypothetical protein ZEAMMB73_015174 [Zea mays]
Length=500

 Score =   177 bits (449),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  284  TVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQ  463
             VAASPPTE+VV   EPLTKEDLV YL SGCK KE WRIGTEHEKFGFE +TLRP+KY+Q
Sbjct  50   AVAASPPTEEVVQMTEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQ  109

Query  464  IAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            I ++LNG++ERFDW+KIMEG+ +IGLKQGKQSISLEPGGQFEL
Sbjct  110  IRDILNGLAERFDWEKIMEGNIVIGLKQGKQSISLEPGGQFEL  152



>gb|EEE62203.1| hypothetical protein OsJ_16990 [Oryza sativa Japonica Group]
Length=1281

 Score =   179 bits (454),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = +2

Query  266  RGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLR  445
            RG GG  VAASPPTE+ V   EPLTKEDLV YL SGCK KE WRIGTEHEKFGFE +TLR
Sbjct  826  RGRGG-AVAASPPTEEAVQMTEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLR  884

Query  446  PMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            P+KY+QI ++LNG++ERFDWDKI+E + +IGLKQGKQSISLEPGGQFEL
Sbjct  885  PIKYDQIRDILNGLAERFDWDKIVEENNVIGLKQGKQSISLEPGGQFEL  933



>ref|XP_009380691.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009380692.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=539

 Score =   174 bits (442),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 114/179 (64%), Gaps = 22/179 (12%)
 Frame = +2

Query  116  PSYGMHSEVVKCKGVVNSMEMFKR---NEIGFGFssssrsssKGMQGLRLESR--RGHGG  280
            P     + V +C G     E+  R   N  G GF   + +  +  +GL   +R  R    
Sbjct  15   PGSPCANSVTECSGARRKREVRFRALGNSEGLGFLVQNGA--RKSRGLCWNARGSRRAKR  72

Query  281  LTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKW---------------RIGTEHE  415
            + VAASPPT+D V   EPL KEDLVGYL SGCK KE W               RIGTEHE
Sbjct  73   MVVAASPPTDDGVVVTEPLMKEDLVGYLNSGCKPKEMWSSWELLLTEEHFCCNRIGTEHE  132

Query  416  KFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            KFGFE  +LRPMKYEQIA+LLNG++ERFDWDKIMEGD IIGLKQGKQSISLEPGGQFEL
Sbjct  133  KFGFEVGSLRPMKYEQIADLLNGLAERFDWDKIMEGDYIIGLKQGKQSISLEPGGQFEL  191



>ref|XP_003611087.1| Glutamate-cysteine ligase [Medicago truncatula]
Length=372

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +2

Query  278  GLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKY  457
             + VA  P  E  V A EPLTK+DL+ Y+ SGCK KEKWRIGTEHEKFGFEF+TLRP+KY
Sbjct  60   NVIVATGPAIEAPVIATEPLTKDDLIDYMVSGCKPKEKWRIGTEHEKFGFEFDTLRPIKY  119

Query  458  EQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            +QI+ LLNGI+ERF WDKIMEGD +IGLK GKQSISLEPGGQ EL
Sbjct  120  KQISPLLNGIAERFHWDKIMEGDNVIGLKTGKQSISLEPGGQIEL  164



>emb|CDY41369.1| BnaC03g65140D [Brassica napus]
Length=460

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 95/111 (86%), Gaps = 3/111 (3%)
 Frame = +2

Query  260  SRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFET  439
            ++RGH  L VAASPPTE+ V A EPL +EDL+ YLASGCK+K+KWRIGTEHEKFGFE  T
Sbjct  18   TKRGHQ-LIVAASPPTEEPVIANEPLRREDLIAYLASGCKSKDKWRIGTEHEKFGFEVNT  76

Query  440  LRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            LRPMKY+QIAELLN I+ERF+W+K+MEGDKIIGLKQ     SLEPGGQFEL
Sbjct  77   LRPMKYDQIAELLNSIAERFEWEKVMEGDKIIGLKQTLH--SLEPGGQFEL  125



>ref|XP_008648285.1| PREDICTED: gamma-glutamylcysteine synthetase1 isoform X1 [Zea 
mays]
 gb|AFW74704.1| putative gamma-glutamylcysteine synthetase [Zea mays]
Length=503

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  296  SPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAEL  475
            SPPTE+ V   EPLTKEDLV YL SGCK KE WRIGTEHEKFGFE +TLRP+KY+QI ++
Sbjct  57   SPPTEEAVQMTEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQIRDI  116

Query  476  LNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            LNG++ERFDWDKIME + +IGLKQGKQSISLEPGGQFEL
Sbjct  117  LNGLAERFDWDKIMEENNVIGLKQGKQSISLEPGGQFEL  155



>gb|EEC81979.1| hypothetical protein OsI_25896 [Oryza sativa Indica Group]
Length=670

 Score =   171 bits (432),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 75/99 (76%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  296  SPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAEL  475
            SPPTE+ V   EPLTKEDL+ YL SGCK KE WRIGTEHEKFGFE +TLRP+KY+QI ++
Sbjct  224  SPPTEEAVQMTEPLTKEDLMAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQIRDI  283

Query  476  LNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            LNG++ERFDWDKI+E + +IGLKQGKQSISLEPGGQFEL
Sbjct  284  LNGLAERFDWDKIVEENNVIGLKQGKQSISLEPGGQFEL  322



>ref|XP_003569058.1| PREDICTED: glutamate--cysteine ligase B, chloroplastic [Brachypodium 
distachyon]
Length=497

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 92/111 (83%), Gaps = 3/111 (3%)
 Frame = +2

Query  260  SRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFET  439
            S+RG     VAASPPTE+     EPLTK+DLV YL SGCK KE WRIGTEHEKFGF+ ET
Sbjct  42   SKRGGA---VAASPPTEEAAQMTEPLTKDDLVAYLVSGCKPKENWRIGTEHEKFGFDIET  98

Query  440  LRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            LRP+ Y+QI+ +LNG+SERF+WDKIME + +IGLKQGKQ+ISLEPGGQFEL
Sbjct  99   LRPITYDQISGILNGLSERFEWDKIMEENHVIGLKQGKQNISLEPGGQFEL  149



>ref|XP_003611086.1| Glutamate-cysteine ligase [Medicago truncatula]
 gb|AES94044.1| glutamate-cysteine ligase B [Medicago truncatula]
Length=512

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +2

Query  278  GLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKY  457
             + VA  P  E  V A EPLTK+DL+ Y+ SGCK KEKWRIGTEHEKFGFEF+TLRP+KY
Sbjct  60   NVIVATGPAIEAPVIATEPLTKDDLIDYMVSGCKPKEKWRIGTEHEKFGFEFDTLRPIKY  119

Query  458  EQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            +QI+ LLNGI+ERF WDKIMEGD +IGLK GKQSISLEPGGQ EL
Sbjct  120  KQISPLLNGIAERFHWDKIMEGDNVIGLKTGKQSISLEPGGQIEL  164



>sp|A2YL07.2|GSH1B_ORYSI RecName: Full=Glutamate--cysteine ligase B, chloroplastic; AltName: 
Full=Gamma-ECS B; Short=GCS B; AltName: Full=Gamma-glutamylcysteine 
synthetase B; Flags: Precursor [Oryza sativa 
Indica Group]
Length=496

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  296  SPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAEL  475
            SPPTE+ V   EPLTKEDL+ YL SGCK KE WRIGTEHEKFGFE +TLRP+KY+QI ++
Sbjct  50   SPPTEEAVQMTEPLTKEDLMAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQIRDI  109

Query  476  LNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            LNG++ERFDWDKI+E + +IGLKQGKQSISLEPGGQFEL
Sbjct  110  LNGLAERFDWDKIVEENNVIGLKQGKQSISLEPGGQFEL  148



>sp|Q6Z3A3.1|GSH1B_ORYSJ RecName: Full=Glutamate--cysteine ligase B, chloroplastic; AltName: 
Full=Gamma-ECS B; Short=GCS B; AltName: Full=Gamma-glutamylcysteine 
synthetase B; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAC84166.1| gamma-glutamylcysteine synthetase [Oryza sativa Japonica Group]
Length=496

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  296  SPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAEL  475
            SPPTE+ V   EPLTKEDL+ YL SGCK KE WRIGTEHEKFGFE +TLRP+KY+QI ++
Sbjct  50   SPPTEEAVQMTEPLTKEDLMAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQIRDI  109

Query  476  LNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            LNG++ERFDWDKI+E + +IGLKQGKQSISLEPGGQFEL
Sbjct  110  LNGLAERFDWDKIVEENNVIGLKQGKQSISLEPGGQFEL  148



>emb|CAA06613.1| gamma-glutamylcysteine synthetase [Brassica juncea]
Length=436

 Score =   165 bits (417),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +2

Query  329  EPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDWD  508
            EPLT+EDL+ YLASGCK+K+KWRIGTEHEKFGFE  TLRPMKYEQIAELLN I+ERF+W+
Sbjct  1    EPLTREDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLRPMKYEQIAELLNSIAERFEWE  60

Query  509  KIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            K++EGDKIIGLKQGKQSISLEPGGQFEL
Sbjct  61   KVLEGDKIIGLKQGKQSISLEPGGQFEL  88



>ref|XP_004960382.1| PREDICTED: glutamate--cysteine ligase B, chloroplastic-like [Setaria 
italica]
Length=498

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  296  SPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAEL  475
            SPPTE+ V   EPLTK+DLV YLASGCK KE WRIGTEHEKFGFE +TLRP+ Y QI ++
Sbjct  52   SPPTEEAVQMTEPLTKDDLVAYLASGCKPKENWRIGTEHEKFGFEVDTLRPINYNQIRDI  111

Query  476  LNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            LNG++ERF WDKIME + +IGLKQGKQSISLEPGGQFEL
Sbjct  112  LNGLAERFSWDKIMEENNVIGLKQGKQSISLEPGGQFEL  150



>ref|XP_004511574.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Cicer 
arietinum]
Length=511

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +2

Query  263  RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETL  442
            RRG   + VA  P TE    A EPLTK+DL+ Y+ SGCK KEKWRIGTEHEKFGFEF++L
Sbjct  55   RRGRS-VIVATGPATEAHAIATEPLTKDDLIDYMLSGCKPKEKWRIGTEHEKFGFEFDSL  113

Query  443  RPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            RP+KY QI+ LLN I+ RFDWDKIMEGD IIGLK G QSISLEPGGQ EL
Sbjct  114  RPIKYNQISALLNSIAARFDWDKIMEGDNIIGLKTGNQSISLEPGGQIEL  163



>gb|EEE67118.1| hypothetical protein OsJ_24143 [Oryza sativa Japonica Group]
Length=579

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  296  SPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAEL  475
            SPPTE+ V   EP TKEDL+ YL SGCK KE WRIGTEHEKFGFE +TLRP+KY+QI ++
Sbjct  133  SPPTEEAVQMTEPFTKEDLMAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQIRDI  192

Query  476  LNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            LNG++ERFDWDKI+E + +IGLKQGKQSISLEPGGQFEL
Sbjct  193  LNGLAERFDWDKIVEENNVIGLKQGKQSISLEPGGQFEL  231



>ref|XP_010241948.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Nelumbo 
nucifera]
Length=199

 Score =   156 bits (395),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 105/164 (64%), Gaps = 14/164 (9%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKGVVNSME--------MFKRNEIGFGFssssrsssKGMQG  247
            MAL+SQ  PS  + SE      V  +ME         +K  E   G SS   S+ K  + 
Sbjct  2    MALISQPSPSSYIRSE----HNVAGNMEDRIVSRGKAYKMKEGWTGSSSLLWSAEKVPRI  57

Query  248  LRLESRRGHGGL--TVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKF  421
              L+  RG       VAASPPT+D V   EPLTK+DLVGYLASGCK KE WRIGTEHEKF
Sbjct  58   SHLDGLRGKRRYRTIVAASPPTDDAVIVTEPLTKKDLVGYLASGCKAKENWRIGTEHEKF  117

Query  422  GFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGK  553
            GFE  TL P+KYEQI +LLNG++ERFDWDKIMEGD IIGL Q K
Sbjct  118  GFEIGTLHPIKYEQIKDLLNGLAERFDWDKIMEGDNIIGLNQVK  161



>ref|XP_003611083.1| Glutamate-cysteine ligase [Medicago truncatula]
Length=172

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  314  VVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISE  493
            V+ A EPLTK+DL+ Y+  GCK KEKWRIGTEHEKFGFEF+TLRP+ Y+QI+ LLNGI+ 
Sbjct  59   VIVATEPLTKDDLIDYMVHGCKPKEKWRIGTEHEKFGFEFDTLRPINYQQISALLNGIAA  118

Query  494  RFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            RFDWDKIMEGD I+GLK G QSISLE GGQ EL
Sbjct  119  RFDWDKIMEGDNIMGLKTGNQSISLEYGGQIEL  151



>gb|KDO76209.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
Length=502

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 84/100 (84%), Gaps = 1/100 (1%)
 Frame = +2

Query  263  RRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETL  442
            RRG   + VAASPPTED V   EPLTKEDLVGYLASGCK KEKWRIGTEHEKFGFEF TL
Sbjct  32   RRGRRSI-VAASPPTEDAVVVTEPLTKEDLVGYLASGCKPKEKWRIGTEHEKFGFEFGTL  90

Query  443  RPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSI  562
             PMKYEQIAELLN I+ERFDW+K+MEGD IIGLKQ   ++
Sbjct  91   HPMKYEQIAELLNSIAERFDWEKVMEGDYIIGLKQKASTL  130



>ref|XP_002965328.1| hypothetical protein SELMODRAFT_83292 [Selaginella moellendorffii]
 gb|EFJ34166.1| hypothetical protein SELMODRAFT_83292 [Selaginella moellendorffii]
Length=464

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 89/114 (78%), Gaps = 2/114 (2%)
 Frame = +2

Query  251  RLESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFE  430
            R+  RR  G   VAASPP E+    AEPLTK DLV YLASGCK K KWRIGTEHEKFGF 
Sbjct  5    RVRERRKLG--IVAASPPAEETALRAEPLTKLDLVDYLASGCKPKSKWRIGTEHEKFGFR  62

Query  431  FETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
              +L P+ YEQIA+LL G++ERF+W ++MEGDKIIGLKQ  QSISLEPGGQFEL
Sbjct  63   MSSLEPIDYEQIAQLLEGLAERFNWQRVMEGDKIIGLKQDGQSISLEPGGQFEL  116



>ref|XP_008375304.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Malus domestica]
Length=465

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +2

Query  287  VAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQI  466
            V A PP+E    + +PLTKEDL+GY ASGCK KE WRIG EHE+FGF+ +TLRPMKYEQI
Sbjct  38   VNARPPSEAAAVSTDPLTKEDLIGYFASGCKPKENWRIGIEHERFGFDLKTLRPMKYEQI  97

Query  467  AELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFE  589
            AE LNGI+ERF WDKI EG  +I LKQG QSI+LEPGGQFE
Sbjct  98   AEXLNGIAERFGWDKIFEGXNVIALKQGNQSIALEPGGQFE  138



>gb|ERM95077.1| hypothetical protein AMTR_s00009p00252400 [Amborella trichopoda]
Length=396

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 98/143 (69%), Gaps = 1/143 (1%)
 Frame = +2

Query  164  NSMEMFKRNEIGFGFssssrsssKGMQGLRLESRRGHGGLTVAASPPTEDVVTAAEPLTK  343
            +++  FK++++GF   S      +        ++RG+G + VA + PTED V   EPLTK
Sbjct  30   DNLPNFKKHQVGFSSLSCVERIKRASNLNITGAKRGYG-VIVAGNAPTEDAVVTTEPLTK  88

Query  344  EDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEG  523
             DLV YL SGCK KE+WRIGTEHE FGFEF TL+  KYEQI ELL   S RF WDK+MEG
Sbjct  89   ADLVSYLESGCKPKEQWRIGTEHENFGFEFGTLKSPKYEQIRELLERFSARFGWDKVMEG  148

Query  524  DKIIGLKQGKQSISLEPGGQFEL  592
            D I GLKQGKQSI+ EPGGQ EL
Sbjct  149  DIITGLKQGKQSITYEPGGQLEL  171



>ref|XP_008375303.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Malus domestica]
Length=488

 Score =   160 bits (406),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +2

Query  287  VAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQI  466
            V A PP+E    + +PLTKEDL+GY ASGCK KE WRIG EHE+FGF+ +TLRPMKYEQI
Sbjct  38   VNARPPSEAAAVSTDPLTKEDLIGYFASGCKPKENWRIGIEHERFGFDLKTLRPMKYEQI  97

Query  467  AELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFE  589
            AE LNGI+ERF WDKI EG  +I LKQG QSI+LEPGGQFE
Sbjct  98   AEXLNGIAERFGWDKIFEGXNVIALKQGNQSIALEPGGQFE  138



>ref|XP_011626090.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Amborella 
trichopoda]
Length=455

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 98/143 (69%), Gaps = 1/143 (1%)
 Frame = +2

Query  164  NSMEMFKRNEIGFGFssssrsssKGMQGLRLESRRGHGGLTVAASPPTEDVVTAAEPLTK  343
            +++  FK++++GF   S      +        ++RG+G + VA + PTED V   EPLTK
Sbjct  30   DNLPNFKKHQVGFSSLSCVERIKRASNLNITGAKRGYG-VIVAGNAPTEDAVVTTEPLTK  88

Query  344  EDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEG  523
             DLV YL SGCK KE+WRIGTEHE FGFEF TL+  KYEQI ELL   S RF WDK+MEG
Sbjct  89   ADLVSYLESGCKPKEQWRIGTEHENFGFEFGTLKSPKYEQIRELLERFSARFGWDKVMEG  148

Query  524  DKIIGLKQGKQSISLEPGGQFEL  592
            D I GLKQGKQSI+ EPGGQ EL
Sbjct  149  DIITGLKQGKQSITYEPGGQLEL  171



>ref|NP_001105142.1| gamma-glutamylcysteine synthetase1 [Zea mays]
 emb|CAC83005.1| putative gamma-glutamylcysteine synthetase [Zea mays]
Length=438

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  326  AEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDW  505
             EPLTKEDLV YL SGCK KE WRIGTEHEKFGFE +TLRP+KY+QI ++LNG++ERFDW
Sbjct  2    TEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPLKYDQIRDILNGLAERFDW  61

Query  506  DKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            DKIME + +IGLKQGKQSISLEPGGQFEL
Sbjct  62   DKIMEKNNVIGLKQGKQSISLEPGGQFEL  90



>ref|XP_010241950.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like, partial 
[Nelumbo nucifera]
Length=187

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 104/167 (62%), Gaps = 14/167 (8%)
 Frame = +2

Query  92   MALMSQSGPSYGMHSEVVKCKGVVNSME--------MFKRNEIGFGFssssrsssKGMQG  247
            M L+SQ  PS  + SE      V  +ME         +K  E   G SS   S+ K  + 
Sbjct  2    MTLISQPSPSSYIRSE----HNVAGNMEDRIVSRGKAYKMKEGWTGSSSLLWSAEKVPRI  57

Query  248  LRLESRRGHGGL--TVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKF  421
              L+  RG       VAASPPT+  V   EPLTK+DLVGYLASGCK KE WRIGTE E F
Sbjct  58   SHLDGLRGKRRYRTIVAASPPTDVAVIVTEPLTKKDLVGYLASGCKAKENWRIGTEQENF  117

Query  422  GFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSI  562
            GFE  TL P+KYEQI +LLNG++ERFDWDKIMEGD IIGLKQG+  I
Sbjct  118  GFEIGTLHPIKYEQIKDLLNGLAERFDWDKIMEGDNIIGLKQGRYEI  164



>gb|ADY17635.1| gamma-glutamylcysteine synthetase [Salix sachalinensis]
Length=301

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +2

Query  344  EDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEG  523
            +DL+ YLASGCK KE WRIGTEHEKFGFE  TLRPMKYEQIAELL+GI+ERFDWDKIMEG
Sbjct  1    DDLIAYLASGCKPKENWRIGTEHEKFGFENGTLRPMKYEQIAELLHGIAERFDWDKIMEG  60

Query  524  DKIIGLKQGKQSISLEPGGQFEL  592
            D IIGLKQG QSISLEPGGQFEL
Sbjct  61   DTIIGLKQGMQSISLEPGGQFEL  83



>emb|CAD48598.1| gamma-glutamylcysteine synthetase [Oryza sativa Japonica Group]
Length=438

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  326  AEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDW  505
             EPLTKEDLV YL SGCK KE WRIGTEHEKFGFE +TLRP+KY+QI ++LNG++ERFDW
Sbjct  2    TEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQIRDILNGLAERFDW  61

Query  506  DKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            DKI+E + +IGLKQGKQSISLEPGGQFEL
Sbjct  62   DKIVEENNVIGLKQGKQSISLEPGGQFEL  90



>ref|XP_006654002.1| PREDICTED: glutamate--cysteine ligase B, chloroplastic-like [Oryza 
brachyantha]
Length=438

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  326  AEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDW  505
             EPLTKEDL+ YL SGCK KE WRIGTEHEKFGFE +TLRP+KY+QI ++LNG++ERFDW
Sbjct  2    TEPLTKEDLIAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQIRDILNGLAERFDW  61

Query  506  DKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            DKI+E + +IGLKQGKQSISLEPGGQFEL
Sbjct  62   DKIVEENNVIGLKQGKQSISLEPGGQFEL  90



>gb|KFK30813.1| hypothetical protein AALP_AA6G029500 [Arabis alpina]
Length=479

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +2

Query  290  AASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIA  469
            + +  ++  + A EPLTKEDL+ Y ASGCK KE WRIGTEHEKFGFE  TLRPMK+ QI 
Sbjct  32   SKATASDSAIVATEPLTKEDLIAYFASGCKPKEMWRIGTEHEKFGFELRTLRPMKFGQIT  91

Query  470  ELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             LLNG++E+FDWDK+ME  ++IGLKQG+QSISLEPGGQ EL
Sbjct  92   SLLNGMAEKFDWDKVMENGRVIGLKQGRQSISLEPGGQLEL  132



>ref|XP_003516702.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Glycine max]
 ref|XP_006573776.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Glycine max]
 gb|KHN25701.1| Glutamate--cysteine ligase, chloroplastic [Glycine soja]
Length=506

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  287  VAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQI  466
            VA  P  +     A+PLTK+DL+ Y  SGCK K  WRIGTEHEKFGFE +TLRP+ Y+QI
Sbjct  57   VATGPAIDHAPVIAKPLTKDDLIDYFVSGCKPKHNWRIGTEHEKFGFELKTLRPINYKQI  116

Query  467  AELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            + LLN I+ RFDW+KIMEGD IIGLK GKQSISLEPGGQFEL
Sbjct  117  SALLNRIATRFDWEKIMEGDNIIGLKNGKQSISLEPGGQFEL  158



>ref|XP_002867731.1| hypothetical protein ARALYDRAFT_914292 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43990.1| hypothetical protein ARALYDRAFT_914292 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = +2

Query  242  QGLRLESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKF  421
            Q L  +  +   G  V     +   V A +PLTKEDL+ Y ASGCK KE WRIGTEHEKF
Sbjct  26   QSLTCKRSKVVAGNQVNMPTSSASSVVATKPLTKEDLIAYFASGCKPKEMWRIGTEHEKF  85

Query  422  GFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            GFE +TLRP+KYEQI  LLNGI+ER+ WDK+ME ++IIGLKQG +SISLEPGGQ EL
Sbjct  86   GFEVKTLRPIKYEQITALLNGIAERYGWDKVMEKERIIGLKQGMRSISLEPGGQLEL  142



>ref|XP_002875199.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51458.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=448

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  296  SPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAEL  475
            +P +   V   +PLTKEDL+ Y ASGCK KE WRIGTEHEKF FE +TLRP+K+EQI  L
Sbjct  2    APASASSVVVTKPLTKEDLIAYFASGCKPKEMWRIGTEHEKFCFEVKTLRPIKFEQITAL  61

Query  476  LNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            LNGI+ER+DWDK+ME ++IIGLKQG +SISLEPGGQ EL
Sbjct  62   LNGIAERYDWDKVMEKERIIGLKQGSKSISLEPGGQLEL  100



>ref|XP_006283598.1| hypothetical protein CARUB_v10004654mg [Capsella rubella]
 gb|EOA16496.1| hypothetical protein CARUB_v10004654mg [Capsella rubella]
Length=495

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +2

Query  332  PLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDWDK  511
            PLTKEDL+ + ASGCK KE WRIGTE+EK GFE +TLRPMKYEQIA LLNGI+ERFDWDK
Sbjct  61   PLTKEDLIAFFASGCKPKEMWRIGTENEKLGFEVKTLRPMKYEQIASLLNGIAERFDWDK  120

Query  512  IMEGDKIIGLKQGKQSISLEPGGQFEL  592
            +ME ++IIGLKQG QSI+LEPGGQ EL
Sbjct  121  VMENERIIGLKQGMQSITLEPGGQLEL  147



>ref|XP_010448777.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=448

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +2

Query  305  TEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNG  484
            T   V   +PLTKEDL+ Y ASGCK KE WRIGTEHEKFGFE +TLRP+K+EQI  LLNG
Sbjct  5    TASSVVTTKPLTKEDLIAYFASGCKPKEMWRIGTEHEKFGFEVKTLRPLKFEQITALLNG  64

Query  485  ISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            I+ERFDWDK+ME ++ IGL QG +SISLEPGGQ EL
Sbjct  65   IAERFDWDKVMENERTIGLTQGMKSISLEPGGQLEL  100



>ref|XP_010448775.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=448

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  305  TEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNG  484
            T   V A +PLTKEDL+ Y ASGCK KE WRIGTEHEKFGFE +TLRP+++EQI  LLNG
Sbjct  5    TASCVVATKPLTKEDLIAYFASGCKPKEMWRIGTEHEKFGFEIKTLRPIEFEQITALLNG  64

Query  485  ISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            I+ER+DWDK+ME ++IIGLKQG +SISLE GGQ EL
Sbjct  65   IAERYDWDKVMENERIIGLKQGIKSISLEYGGQLEL  100



>dbj|BAJ21771.1| putative gamma-glutamylcysteine synthetase [Pteris vittata]
Length=439

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +2

Query  257  ESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFE  436
            ++ R    L V AS P E++V A EPLTK+DLV +++SGCK K KWRIGTEHEKFGFE +
Sbjct  43   DASRRRCLLPVRASAPAEELVAATEPLTKKDLVEFISSGCKPKHKWRIGTEHEKFGFELK  102

Query  437  TLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            TL+PM Y QIAELL GI+ERF+W +++E   IIGL Q  QS+SLEPGGQFEL
Sbjct  103  TLKPMSYLQIAELLEGIAERFNWKRLIESGLIIGLTQDGQSVSLEPGGQFEL  154



>ref|XP_010439235.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Camelina sativa]
Length=448

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  305  TEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNG  484
            T   V A +PLTKEDL+ Y ASGCK KE WRIGTEHEKFGFE +TLRP+++EQI  LLNG
Sbjct  5    TASCVVATKPLTKEDLIAYFASGCKPKEMWRIGTEHEKFGFEIKTLRPIEFEQITALLNG  64

Query  485  ISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            I+ER+DWDK+ME ++IIGLKQG +SISLE GGQ EL
Sbjct  65   IAERYDWDKVMENERIIGLKQGIKSISLEYGGQLEL  100



>dbj|BAJ21770.1| putative gamma-glutamylcysteine synthetase [Pteris vittata]
Length=502

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +2

Query  257  ESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFE  436
            ++ R    L V AS P E++V A EPLTK+DLV +++SGCK K KWRIGTEHEKFGFE +
Sbjct  43   DASRRRCLLPVRASAPAEELVAATEPLTKKDLVEFISSGCKPKHKWRIGTEHEKFGFELK  102

Query  437  TLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            TL+PM Y QIAELL GI+ERF+W +++E   IIGL Q  QS+SLEPGGQFEL
Sbjct  103  TLKPMSYLQIAELLEGIAERFNWKRLIESGLIIGLTQDGQSVSLEPGGQFEL  154



>ref|XP_001785532.1| predicted protein [Physcomitrella patens]
 gb|EDQ49666.1| predicted protein [Physcomitrella patens]
Length=484

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 83/104 (80%), Gaps = 2/104 (2%)
 Frame = +2

Query  287  VAASPPTEDV--VTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE  460
            VAASPP  +     + EPLT++DLVGYLASGCK KEKWRIGTEHEKFGF+ + L+PM Y 
Sbjct  33   VAASPPNNNAGGSRSGEPLTRQDLVGYLASGCKPKEKWRIGTEHEKFGFQLDNLQPMTYA  92

Query  461  QIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            QI +LL G+++RF+W K+MEGD IIGL    QS+SLEPGGQFEL
Sbjct  93   QIRQLLEGLADRFEWKKVMEGDNIIGLTFDGQSVSLEPGGQFEL  136



>ref|XP_010439234.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=448

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +2

Query  305  TEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNG  484
            T   V   +PLTKEDL+ Y ASGCK KE WRIGTEHEK GFE +TLRP+K+EQI  LLNG
Sbjct  5    TASSVVTTKPLTKEDLIAYFASGCKPKEMWRIGTEHEKIGFEVKTLRPIKFEQITALLNG  64

Query  485  ISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            I+ER+DWDK+ME ++ IGL QG +SISLEPGGQ EL
Sbjct  65   IAERYDWDKVMENERTIGLTQGTKSISLEPGGQLEL  100



>ref|XP_010439231.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010439232.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010439233.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=448

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +2

Query  305  TEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNG  484
            T   V   +PLTKEDL+ Y ASGCK KE WRIGTEHEK GFE +TLRP+K+EQI  LLNG
Sbjct  5    TASSVVTTKPLTKEDLIAYFASGCKPKEMWRIGTEHEKIGFEVKTLRPIKFEQITALLNG  64

Query  485  ISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            I+ER+DWDK+ME ++ IGL QG +SISLEPGGQ EL
Sbjct  65   IAERYDWDKVMENERTIGLTQGTKSISLEPGGQLEL  100



>ref|XP_008346998.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Malus 
domestica]
Length=125

 Score =   138 bits (348),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  VAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQI  466
            V A PP+E    + +PLTKEDL+GY ASGCK KE WRIG EHE+FGF+ +TLRPMKYEQI
Sbjct  38   VNARPPSEAAAVSTDPLTKEDLIGYFASGCKPKENWRIGIEHERFGFDLKTLRPMKYEQI  97

Query  467  AELLNGISERFDWDKIMEGDKIIGLKQ  547
            AE LNGI+ERF WDK  EGD +I LKQ
Sbjct  98   AEFLNGIAERFGWDKXFEGDNVIALKQ  124



>ref|XP_010440635.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=443

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +2

Query  329  EPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDWD  508
            +PLTKEDL+ + ASGCK KE WRIGTE+EK GFE +TL PMKYEQ+A LL+GI+ERF+WD
Sbjct  57   KPLTKEDLIAFFASGCKPKEMWRIGTENEKLGFEVKTLCPMKYEQVAALLSGIAERFEWD  116

Query  509  KIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            K+ME DKIIGLKQG QSISLEPGGQ EL
Sbjct  117  KVMENDKIIGLKQGMQSISLEPGGQLEL  144



>emb|CDX94156.1| BnaC07g37900D [Brassica napus]
Length=491

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +2

Query  323  AAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFD  502
            A EPLTKEDL+ Y +SGCKTKE WRIGTEHEK GF+ +TLRP+KYEQI  LLNGISERFD
Sbjct  55   ATEPLTKEDLIAYFSSGCKTKEMWRIGTEHEKIGFDVKTLRPIKYEQITALLNGISERFD  114

Query  503  WDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            WDK+ME   IIGLKQG Q+ISLE G Q EL
Sbjct  115  WDKVMETGTIIGLKQGMQNISLERGCQLEL  144



>ref|XP_010435330.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
 ref|XP_010435331.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=492

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +2

Query  329  EPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDWD  508
            +PLTKEDL+ + ASGCK KE WRIGTE+EK GFE +TL PMKYEQ+A LL+GI+ERF+WD
Sbjct  57   KPLTKEDLIAFFASGCKPKEMWRIGTENEKLGFEVKTLCPMKYEQVAALLSGIAERFEWD  116

Query  509  KIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            K+ME DKIIGLKQG QSISLEPGGQ EL
Sbjct  117  KVMENDKIIGLKQGMQSISLEPGGQLEL  144



>ref|XP_010439229.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
 ref|XP_010439230.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=449

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  314  VVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISE  493
            VV   +PLTKEDL+ Y ASGCK KE WRIGTEHEK GFE +TLRP+K+EQI  LLNGI+E
Sbjct  9    VVATTKPLTKEDLIAYFASGCKPKEMWRIGTEHEKIGFEVKTLRPIKFEQITALLNGIAE  68

Query  494  RFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            R+DWDK+ME ++IIGLKQG +SI+LE GGQ EL
Sbjct  69   RYDWDKMMEDERIIGLKQGMKSITLEYGGQLEL  101



>ref|XP_010440632.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010440634.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=492

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +2

Query  329  EPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDWD  508
            +PLTKEDL+ + ASGCK KE WRIGTE+EK GFE +TL PMKYEQ+A LL+GI+ERF+WD
Sbjct  57   KPLTKEDLIAFFASGCKPKEMWRIGTENEKLGFEVKTLCPMKYEQVAALLSGIAERFEWD  116

Query  509  KIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            K+ME DKIIGLKQG QSISLEPGGQ EL
Sbjct  117  KVMENDKIIGLKQGMQSISLEPGGQLEL  144



>ref|XP_002974231.1| hypothetical protein SELMODRAFT_101407 [Selaginella moellendorffii]
 gb|EFJ24453.1| hypothetical protein SELMODRAFT_101407 [Selaginella moellendorffii]
Length=455

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  287  VAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQI  466
            VAA+P  ED +T A PLTK DLV YLASGCK K +WRIGTEHEKFGF+  TL+P+ Y QI
Sbjct  6    VAAAPAAEDRITKAAPLTKLDLVDYLASGCKPKSRWRIGTEHEKFGFDKSTLKPLDYPQI  65

Query  467  AELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            ++L  G+ ERF+W K MEGDK+ GLK+  QSISLEPGGQ EL
Sbjct  66   SQLFEGLCERFNWQKEMEGDKVTGLKKDGQSISLEPGGQLEL  107



>ref|XP_010433942.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=447

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 81/98 (83%), Gaps = 4/98 (4%)
 Frame = +2

Query  311  DVVTAA----EPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELL  478
            D  TA+    +PLTKEDL+ Y ASGCK KE WRIGTEHEKFGFE +TLRP+++EQI  LL
Sbjct  2    DTATASCVVTKPLTKEDLIAYFASGCKPKEMWRIGTEHEKFGFEIKTLRPIEFEQITALL  61

Query  479  NGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            NGI+ER+DWDK+ME ++IIGLKQG +SISLE GGQ EL
Sbjct  62   NGIAERYDWDKVMENERIIGLKQGIKSISLEYGGQLEL  99



>ref|XP_002977172.1| hypothetical protein SELMODRAFT_232900 [Selaginella moellendorffii]
 gb|EFJ21781.1| hypothetical protein SELMODRAFT_232900 [Selaginella moellendorffii]
Length=438

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  326  AEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDW  505
            AEPLTK DLV YLASGCK K KWRIGTEHEKFGF   +L P+ Y+QIA+LL G++ERF+W
Sbjct  2    AEPLTKLDLVDYLASGCKPKSKWRIGTEHEKFGFRMSSLEPIDYDQIAQLLEGLAERFNW  61

Query  506  DKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             ++MEGDKIIGLKQ  QSISLEPGGQFEL
Sbjct  62   QRVMEGDKIIGLKQDGQSISLEPGGQFEL  90



>emb|CDY63259.1| BnaA03g58670D [Brassica napus]
Length=491

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +2

Query  323  AAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFD  502
            A EPLTKEDL+ Y +SGCKTKE WRIGTEHEK GF+ +TLRP+ YEQI  LLNGISERFD
Sbjct  55   ATEPLTKEDLIAYFSSGCKTKEMWRIGTEHEKIGFDVKTLRPITYEQITALLNGISERFD  114

Query  503  WDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            WDK+ME   IIGLKQG Q+ISLE G Q EL
Sbjct  115  WDKVMETGTIIGLKQGMQNISLERGCQLEL  144



>ref|XP_010448773.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
 ref|XP_010448774.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=449

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  314  VVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISE  493
            VV A +PLTKEDL+ Y ASGCK KE WRIGTEHEK GFE +TLRP+K+EQI  LLNGI+E
Sbjct  9    VVAATKPLTKEDLIDYHASGCKPKEMWRIGTEHEKIGFEVKTLRPIKFEQITALLNGIAE  68

Query  494  RFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            R+DWDK+ME ++IIGLKQG ++I+LE GGQ EL
Sbjct  69   RYDWDKMMEDERIIGLKQGMKTITLEYGGQLEL  101



>ref|XP_004971557.1| PREDICTED: glutamate--cysteine ligase B, chloroplastic-like [Setaria 
italica]
Length=489

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +2

Query  284  TVAASPPTEDVV--TAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKY  457
              AASP  E+    T  EPLTKEDLV YLASGCK +  WRIGTEHEKFGF+ ETLRP+ Y
Sbjct  37   VAAASPLVEEAARATETEPLTKEDLVAYLASGCKPRSDWRIGTEHEKFGFQVETLRPINY  96

Query  458  EQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             QI +LLNGI++RF   ++MEG+ I+GLKQG Q+ISLEPGGQ EL
Sbjct  97   MQIRDLLNGIADRFGGRRVMEGNNIVGLKQGAQNISLEPGGQIEL  141



>ref|XP_007158499.1| hypothetical protein PHAVU_002G157600g [Phaseolus vulgaris]
 gb|ESW30493.1| hypothetical protein PHAVU_002G157600g [Phaseolus vulgaris]
Length=493

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = +2

Query  269  GHGGLTVAASPPTEDV-VTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLR  445
            G   + VA  P  +     A EPLTK+ L+ Y+ASGCK K+ WRIGTEHEKFGFE  TLR
Sbjct  38   GRRSVIVATGPAIDQAPAIAQEPLTKDHLIHYMASGCKPKQSWRIGTEHEKFGFERNTLR  97

Query  446  PMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             + Y+Q++ LLNGI+ERFDW+KIMEGD IIGLK  KQ+ISLE GGQFEL
Sbjct  98   SINYKQLSALLNGIAERFDWEKIMEGDNIIGLKNDKQNISLERGGQFEL  146



>ref|XP_002985600.1| hypothetical protein SELMODRAFT_122883 [Selaginella moellendorffii]
 gb|EFJ13178.1| hypothetical protein SELMODRAFT_122883 [Selaginella moellendorffii]
Length=455

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = +2

Query  287  VAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQI  466
            VAA+P  ED +T A PLTK DLV YLASGCK K +WRIGTEHEKFGF   TL+P+ Y QI
Sbjct  6    VAAAPAAEDSITKAAPLTKLDLVDYLASGCKPKSRWRIGTEHEKFGFNKSTLKPLDYPQI  65

Query  467  AELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            ++L   + ERF+W K MEGDK+ GLK+  QSISLEPGGQ EL
Sbjct  66   SQLFEALCERFNWQKEMEGDKVTGLKKDGQSISLEPGGQLEL  107



>ref|XP_009137312.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Brassica 
rapa]
 ref|XP_009137313.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Brassica 
rapa]
Length=491

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +2

Query  323  AAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFD  502
            A EPLTKEDL+ Y +SGCKTKE WRIGTEHEK GF+ +TLRP+ YEQI  LLNGISERFD
Sbjct  55   ATEPLTKEDLIAYFSSGCKTKEMWRIGTEHEKIGFDVKTLRPITYEQITALLNGISERFD  114

Query  503  WDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            WDK+ME   IIGLKQG ++ISLE G Q EL
Sbjct  115  WDKVMETGTIIGLKQGMKNISLERGCQLEL  144



>ref|XP_001757520.1| predicted protein [Physcomitrella patens]
 gb|EDQ77577.1| predicted protein [Physcomitrella patens]
Length=461

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = +2

Query  269  GHGGLTVAASPPTEDVVT-AAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLR  445
            G G   V  SPP+ D  +   EPLT++DLVGYLASGCK KEKWRIGTEHEKFGF+ + L+
Sbjct  5    GIGKGEVIGSPPSNDAGSYGGEPLTRQDLVGYLASGCKPKEKWRIGTEHEKFGFQLDNLQ  64

Query  446  PMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            PM Y QI +LL G+++RF+W ++MEGD IIGL    Q +SLEPGGQ EL
Sbjct  65   PMTYPQIKQLLEGLADRFEWQRVMEGDNIIGLTLDGQGVSLEPGGQVEL  113



>gb|AES94042.2| gamma glutamyl cysteine synthetase [Medicago truncatula]
Length=239

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +2

Query  362  LASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGL  541
            +  GCK KEKWRIGTEHEKFGFEF+TLRP+ Y+QI+ LLNGI+ RFDWDKIMEGD I+GL
Sbjct  1    MVHGCKPKEKWRIGTEHEKFGFEFDTLRPINYQQISALLNGIAARFDWDKIMEGDNIMGL  60

Query  542  KQGKQSISLEPGGQFEL  592
            K G QSISLE GGQ EL
Sbjct  61   KTGNQSISLEYGGQIEL  77



>gb|ADX30738.2| truncated gamma-glutamyl-cysteine synthetase, partial [Populus 
x canadensis]
Length=415

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +2

Query  392  WRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLE  571
            WRIGTEHEKFGFE  TLRPMKYEQIAELL+GI+ERFDWD+IMEGD IIGL+QGKQSISLE
Sbjct  1    WRIGTEHEKFGFEIGTLRPMKYEQIAELLHGIAERFDWDRIMEGDNIIGLQQGKQSISLE  60

Query  572  PGGQFEL  592
            PGGQFEL
Sbjct  61   PGGQFEL  67



>gb|ERN13322.1| hypothetical protein AMTR_s00041p00090940 [Amborella trichopoda]
Length=439

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  395  RIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEP  574
            RIGTEHEKFGFEF +LRP++Y+QIA+LL G++ERFDWDK+MEGD IIGL QGKQSISLEP
Sbjct  26   RIGTEHEKFGFEFGSLRPLRYDQIADLLTGLAERFDWDKVMEGDHIIGLVQGKQSISLEP  85

Query  575  GGQFEL  592
            GGQFEL
Sbjct  86   GGQFEL  91



>ref|XP_004971558.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--cysteine ligase A, 
chloroplastic-like [Setaria italica]
Length=445

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +2

Query  299  PPTEDVVTAAE--PLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAE  472
            PP E+ V A +  PL K DLV +LASGCK +  WRIGTEHEKFGF+ +TLRP+ Y+QI +
Sbjct  35   PPVEEAVRATDTVPLAKWDLVAHLASGCKPRHDWRIGTEHEKFGFQVQTLRPINYDQITQ  94

Query  473  LLNGISERFDWDKIMEGDKIIGLKQ  547
            L NGI++RF WD+ MEG+ +IGLKQ
Sbjct  95   LFNGIADRFGWDRAMEGNNVIGLKQ  119



>ref|XP_005844806.1| hypothetical protein CHLNCDRAFT_26566 [Chlorella variabilis]
 gb|EFN52704.1| hypothetical protein CHLNCDRAFT_26566 [Chlorella variabilis]
Length=477

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 75/117 (64%), Gaps = 7/117 (6%)
 Frame = +2

Query  242  QGLRLESRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKF  421
            Q  +L+ RR      VAA P T+        LTK+DLV YL SGCK +++WRIGTEHEK 
Sbjct  19   QRTQLKQRRRVAVRGVAAEPATQR-------LTKDDLVAYLESGCKPRDQWRIGTEHEKL  71

Query  422  GFEFETLRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            G+     R + YEQIA LL  I ERF+W  I+E   IIGL Q  QS++LEPGGQFEL
Sbjct  72   GYNVADGRRLTYEQIAALLTRIGERFNWQPIVEEGHIIGLTQDGQSVTLEPGGQFEL  128



>ref|XP_001778732.1| predicted protein [Physcomitrella patens]
 gb|EDQ56430.1| predicted protein [Physcomitrella patens]
Length=502

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 80/111 (72%), Gaps = 4/111 (4%)
 Frame = +2

Query  272  HGGLTVAASPPTEDVVTA----AEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFET  439
            H    VA+SP  E+         + LTKEDLV +L SGCK K +WRIGTEHEK GF+ +T
Sbjct  42   HTSHIVASSPAVEEAAAKAAARGKDLTKEDLVDFLRSGCKPKSEWRIGTEHEKLGFQLDT  101

Query  440  LRPMKYEQIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            L+ M ++QI++LL+G++ RF ++++MEG+ IIGL +   S+SLEPGGQFEL
Sbjct  102  LKRMTFDQISKLLDGMASRFGYERVMEGENIIGLSKDGASVSLEPGGQFEL  152



>ref|XP_003062187.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53899.1| predicted protein [Micromonas pusilla CCMP1545]
Length=488

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +2

Query  332  PLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDWDK  511
            PLTK DLV YL SG K K +WRIGTEHEKFG++   LRPM+Y+    LL  +  RFDW  
Sbjct  55   PLTKADLVEYLRSGSKPKSEWRIGTEHEKFGYQKSNLRPMEYDAHV-LLEALVRRFDWQP  113

Query  512  IMEGDKIIGLKQGKQSISLEPGGQFEL  592
            +MEGD IIG K   QS++LEPGGQFEL
Sbjct  114  MMEGDDIIGAKLDGQSVTLEPGGQFEL  140



>ref|XP_005646648.1| plant glutamate cysteine ligase in complex with Mg2+ and L-glutamate 
[Coccomyxa subellipsoidea C-169]
 gb|EIE22104.1| plant glutamate cysteine ligase in complex with Mg2+ and L-glutamate 
[Coccomyxa subellipsoidea C-169]
Length=452

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  ASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAE  472
            ++ P+     A + LTKEDLV YLASGCK +EKWRIGTEHEK G+       + Y+ I +
Sbjct  2    SAAPSTIAPEATQQLTKEDLVKYLASGCKPREKWRIGTEHEKLGYNTADNSRIGYDVIQK  61

Query  473  LLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            LL G+ +RF W  +MEG+ IIG +   QS+SLEPGGQFEL
Sbjct  62   LLQGLCDRFGWQPVMEGEYIIGAELDGQSVSLEPGGQFEL  101



>ref|XP_002507857.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69115.1| predicted protein [Micromonas sp. RCC299]
Length=489

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 67/92 (73%), Gaps = 3/92 (3%)
 Frame = +2

Query  320  TAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE-QIAELLNGISER  496
            TA   LTK+DLV YL SGCK K +  IGTEHEKFG++   LRPM+Y+  +A+LL+ + +R
Sbjct  52   TATNALTKKDLVAYLESGCKPKSQ--IGTEHEKFGYQLANLRPMEYDAHVAKLLHALVDR  109

Query  497  FDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            FDW+ I E   IIG K   QS++LEPGGQFEL
Sbjct  110  FDWEPITESGNIIGCKLNGQSVTLEPGGQFEL  141



>gb|KIY94325.1| glutamate--cysteine ligase [Monoraphidium neglectum]
Length=324

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +2

Query  326  AEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDW  505
            A P+T+EDL+ +++SGCKT+++WRIGTEHEK GF     R M Y++I ++   +  RF W
Sbjct  15   AVPVTREDLIEHISSGCKTRDRWRIGTEHEKLGFRVADKRRMDYDEIRQVFGKLESRFGW  74

Query  506  DKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
              I EGD  IG+   KQ+++LEPGGQFEL
Sbjct  75   KPIKEGDLTIGVALDKQTVTLEPGGQFEL  103



>ref|WP_035612545.1| glutamate--cysteine ligase [Hyphomonas johnsonii]
 gb|KCZ93869.1| glutamate--cysteine ligase [Hyphomonas johnsonii MHS-2]
Length=459

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = +2

Query  302  PTEDVVTAAEPL-TKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIA  469
            PT DV  A+  + +K +L+ YLA+G K +  WRIGTEHEKFGF  + LRP+ YE    + 
Sbjct  4    PTSDVDEASPRIESKAELIAYLAAGSKPQADWRIGTEHEKFGFLTDGLRPLPYEGTASVC  63

Query  470  ELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +L G+ +RF WD I+EG  +IGL Q   S+SLEPGGQFEL
Sbjct  64   AMLEGLRDRFGWDPIVEGGHLIGLTQDGASVSLEPGGQFEL  104



>ref|XP_001701647.1| gamma-glutamylcysteine synthetase [Chlamydomonas reinhardtii]
 gb|EDP06622.1| gamma-glutamylcysteine synthetase [Chlamydomonas reinhardtii]
Length=479

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 62/88 (70%), Gaps = 0/88 (0%)
 Frame = +2

Query  329  EPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDWD  508
            EPL K++LV YL SGC+ +  WRIGTEHEK GF       M Y+QIA++L  +  RF W+
Sbjct  44   EPLLKQELVDYLKSGCRPRSAWRIGTEHEKLGFNLADNSRMNYDQIAQVLRKLEARFGWE  103

Query  509  KIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             IME  +IIG++   QS++LEPGGQFEL
Sbjct  104  PIMEEGRIIGVQLDGQSVTLEPGGQFEL  131



>gb|KCZ62975.1| glutamate--cysteine ligase [Hyphomonas sp. L-53-1-40]
Length=459

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = +2

Query  302  PTEDVVTAAEPLT-KEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIA  469
            PT D+   ++ ++ K +LV Y  +G K K  WRIGTEHEKFGF  E LRP+ YE    + 
Sbjct  4    PTSDIDENSQRISGKSELVEYFEAGNKPKADWRIGTEHEKFGFLREGLRPLPYEGEASVL  63

Query  470  ELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +L G+ +RFDW  I+EG K+IGLK+   S+SLEPGGQFEL
Sbjct  64   AILEGLRDRFDWQPIVEGGKLIGLKKDGASVSLEPGGQFEL  104



>ref|WP_012568753.1| glutamate--cysteine ligase [Rhodospirillum centenum]
 gb|ACJ00977.1| glutamate--cysteine ligase [Rhodospirillum centenum SW]
Length=455

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 71/104 (68%), Gaps = 8/104 (8%)
 Frame = +2

Query  293  ASPPTEDVVTAAEPLT-KEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQ--  463
            ++PP     +  EP+T +  LV +L +GCK  ++WRIGTEHEKF F     RP+ Y+   
Sbjct  2    SAPPK----SRGEPITDRRQLVEHLEAGCKPADRWRIGTEHEKFAFRRADKRPLPYDGPD  57

Query  464  -IAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             I  +LN +++R+ W+++MEGD +I L +G+ S+SLEPGGQFEL
Sbjct  58   GIGAILNALADRYGWERVMEGDNVIALSKGEASVSLEPGGQFEL  101



>gb|AFC88288.1| gamma-glutamylcysteine synthetase [Chlamydomonas sp. ICE-L]
Length=483

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  LTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDWDKI  514
            LTKEDL+ +L  GCK + KWRIGTEHEK GF       M ++QIA++L  +  RF W  +
Sbjct  50   LTKEDLINHLRGGCKPRHKWRIGTEHEKLGFNLRDNSRMNHDQIAKMLRKLESRFGWTPM  109

Query  515  MEGDKIIGLKQGKQSISLEPGGQFEL  592
            ME  KIIG++   QS++LEPGGQFEL
Sbjct  110  MEAGKIIGVQMDGQSVTLEPGGQFEL  135



>ref|WP_035537514.1| glutamate--cysteine ligase [Hyphomonas oceanitis]
Length=459

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = +2

Query  302  PTEDVV-TAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIA  469
            PT D+  ++A   +K +LV YL +G K +  WRIGTEHEKFGF    LRP+ YE    I 
Sbjct  4    PTADIDESSARIESKTELVAYLDAGSKPRADWRIGTEHEKFGFTTADLRPLPYEGKASIL  63

Query  470  ELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +L G+ + FDW+ I+EG  +IGLK+   S+SLEPGGQFEL
Sbjct  64   AMLEGLRDTFDWEPIVEGGHLIGLKKDGASVSLEPGGQFEL  104



>ref|WP_027840020.1| glutamate--cysteine ligase [Mastigocoleus testarum]
Length=459

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = +2

Query  302  PTEDVV-TAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIA  469
            PT D+  T+    +K +L+ Y  +G K +++WR+GTEHEKFGF  E LRP+ YE    + 
Sbjct  4    PTSDIDETSRRIASKSELIEYFEAGNKPRDQWRVGTEHEKFGFLREGLRPLPYEGEASVL  63

Query  470  ELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +L G+ +RFDW  I+E  K+IGLK+   S+SLEPGGQFEL
Sbjct  64   AILEGLRDRFDWQPILEAGKLIGLKKDGASVSLEPGGQFEL  104



>gb|KDA02929.1| glutamate--cysteine ligase [Hyphomonas oceanitis SCH89]
Length=471

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = +2

Query  302  PTEDVV-TAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIA  469
            PT D+  ++A   +K +LV YL +G K +  WRIGTEHEKFGF    LRP+ YE    I 
Sbjct  16   PTADIDESSARIESKTELVAYLDAGSKPRADWRIGTEHEKFGFTTADLRPLPYEGKASIL  75

Query  470  ELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +L G+ + FDW+ I+EG  +IGLK+   S+SLEPGGQFEL
Sbjct  76   AMLEGLRDTFDWEPIVEGGHLIGLKKDGASVSLEPGGQFEL  116



>ref|WP_035583514.1| glutamate--cysteine ligase [Hyphomonas jannaschiana]
 gb|KCZ86785.1| glutamate--cysteine ligase [Hyphomonas jannaschiana VP2]
Length=459

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 65/101 (64%), Gaps = 4/101 (4%)
 Frame = +2

Query  302  PTEDVV-TAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAE--  472
            PT D+  T+     K +L  YL +GCK    WRIGTEHEKFGF  E L P+ YE  A   
Sbjct  4    PTSDIDETSPRIAGKHELAAYLEAGCKPASDWRIGTEHEKFGFLRENLAPLPYEGTASVL  63

Query  473  -LLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +L G+ +RF WD I+E  K+IGL++   S+SLEPGGQFEL
Sbjct  64   AMLEGLRDRFGWDPIVESGKLIGLQRDGASVSLEPGGQFEL  104



>ref|WP_045654749.1| glutamate--cysteine ligase [Hyphomonadaceae bacterium BRH_c29]
 gb|KJS27094.1| glutamate--cysteine ligase [Hyphomonadaceae bacterium BRH_c29]
Length=459

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 68/103 (66%), Gaps = 4/103 (4%)
 Frame = +2

Query  296  SPPTEDVV-TAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---Q  463
            S PT D+  T+A    K +LV YL  G K    WRIGTEHEKFGF  E LRP+ Y+    
Sbjct  2    STPTSDIDETSARIEDKRELVEYLEGGSKPAADWRIGTEHEKFGFLREGLRPLPYDGKAS  61

Query  464  IAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            +  +L G+ ++F WD I+EG K+IGL++   S+SLEPGGQFEL
Sbjct  62   VLAMLEGLRDKFGWDSIIEGGKLIGLQRDGASVSLEPGGQFEL  104



>gb|KCZ97952.1| glutamate--cysteine ligase [Hyphomonas polymorpha PS728]
Length=458

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = +2

Query  302  PTEDVVTAAEPLT-KEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIA  469
            PT D+  A+  ++ K +LV Y+  G K +  W IGTEHEKFGF ++ L+P+ YE    I 
Sbjct  4    PTSDIDEASPRISGKRELVAYMEGGAKPRSDWAIGTEHEKFGFIWDGLKPLPYEGPASIL  63

Query  470  ELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +L G+ +RF WD I+EG  +IGLK+   S+SLEPGGQFEL
Sbjct  64   AMLEGMRDRFGWDPILEGGYLIGLKKDGASVSLEPGGQFEL  104



>ref|WP_034815788.1| glutamate--cysteine ligase [Hyphomonas sp. L-53-1-40]
Length=452

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 61/87 (70%), Gaps = 3/87 (3%)
 Frame = +2

Query  341  KEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERFDWDK  511
            K +LV Y  +G K K  WRIGTEHEKFGF  E LRP+ YE    +  +L G+ +RFDW  
Sbjct  11   KSELVEYFEAGNKPKADWRIGTEHEKFGFLREGLRPLPYEGEASVLAILEGLRDRFDWQP  70

Query  512  IMEGDKIIGLKQGKQSISLEPGGQFEL  592
            I+EG K+IGLK+   S+SLEPGGQFEL
Sbjct  71   IVEGGKLIGLKKDGASVSLEPGGQFEL  97



>emb|CEG00964.1| Glutamate--cysteine ligase, plant, partial [Ostreococcus tauri]
Length=473

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 63/97 (65%), Gaps = 0/97 (0%)
 Frame = +2

Query  302  PTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLN  481
            P+   V  +  LT+E  V Y+  GCK +E +RIGTEHEK GF+  TLR M Y  +  +L 
Sbjct  22   PSTPCVKGSAALTREACVAYVREGCKPREMFRIGTEHEKLGFDAATLRRMDYPVVRHVLT  81

Query  482  GISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             + +R+ W  I EG+ IIG  + KQS++LEPGGQFEL
Sbjct  82   SLVDRYGWAPIYEGENIIGCTKDKQSVTLEPGGQFEL  118



>gb|KCZ49144.1| glutamate--cysteine ligase [Hyphomonas sp. CY54-11-8]
Length=459

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 66/101 (65%), Gaps = 4/101 (4%)
 Frame = +2

Query  302  PTEDVV-TAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIA  469
            PT D+  T+     K +LV YL +GCK  E WRIGTEHEKFGF  E L P+ YE    + 
Sbjct  4    PTSDIDETSPRIAGKHELVEYLEAGCKPSEDWRIGTEHEKFGFLRENLAPLPYEGKASVL  63

Query  470  ELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +L G+ +RF W  I+E  K+IGL++   S+SLEPGGQFEL
Sbjct  64   AMLEGLRDRFGWAPIVESGKLIGLQRDGASVSLEPGGQFEL  104



>ref|WP_018998172.1| glutamate--cysteine ligase [Hirschia maritima]
Length=458

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 72/103 (70%), Gaps = 4/103 (4%)
 Frame = +2

Query  296  SPPTEDVVTAAEPL-TKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---Q  463
            S PT+ + + A  + TK++L+ +LA GCK +E+WRIGTEHEKFGF  +  RP+ Y+    
Sbjct  2    STPTKPIDSNAPRIETKDELIAHLAKGCKPREEWRIGTEHEKFGFLKDGNRPLPYDGDSS  61

Query  464  IAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            +  +L G+ +RF+W  I E  ++IGLK+   S+SLEPGGQFEL
Sbjct  62   VRAVLEGLRDRFEWLPIEEDGRLIGLKKNGASVSLEPGGQFEL  104



>ref|WP_015826863.1| glutamate--cysteine ligase [Hirschia baltica]
 gb|ACT58713.1| glutamate/cysteine ligase [Hirschia baltica ATCC 49814]
Length=458

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 73/103 (71%), Gaps = 4/103 (4%)
 Frame = +2

Query  296  SPPTEDVVTAAEPL-TKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---Q  463
            S PT+ + + A  + +K++L+ +LA GCK +E+WRIGTEHEKFGF  +  +P+ Y+    
Sbjct  2    STPTKPIDSNAPRIESKDELIAHLAKGCKPREEWRIGTEHEKFGFLKDGNQPVPYDGHAS  61

Query  464  IAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            +  +L G+ +RF+W+ I E  +IIGLK+   S+SLEPGGQFEL
Sbjct  62   VRSMLEGLRDRFNWEPIEEDGRIIGLKKDGASVSLEPGGQFEL  104



>ref|WP_007256884.1| glutamate--cysteine ligase [Oceanicola granulosus]
 gb|EAR50361.1| glutamate--cysteine ligase [Oceanicola granulosus HTCC2516]
Length=456

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 61/87 (70%), Gaps = 3/87 (3%)
 Frame = +2

Query  341  KEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERFDWDK  511
            ++ L  YL  GCK KE WRIGTEHEKFG+  +TL+P+ YE    I  +L G+ +R+ W  
Sbjct  14   RDQLAAYLEEGCKPKEDWRIGTEHEKFGYCRDTLKPLPYEGDRSIRAMLEGLRDRYGWTP  73

Query  512  IMEGDKIIGLKQGKQSISLEPGGQFEL  592
            ++EGD IIGL++   ++SLEPGGQ EL
Sbjct  74   VLEGDNIIGLEKDGANVSLEPGGQLEL  100



>ref|WP_020085081.1| glutamate--cysteine ligase [Hyphomicrobium zavarzinii]
Length=464

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 71/118 (60%), Gaps = 16/118 (14%)
 Frame = +2

Query  260  SRRGHGGLTVAASPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFET  439
            S R  G    A SPP           ++++LV ++A+G K K+ WRIGTEHEKF F+ ET
Sbjct  2    STRQDGAQDGAKSPPVR---------SRDELVAWIAAGEKPKDDWRIGTEHEKFVFQTET  52

Query  440  LRPMKYE---QIAELLNGISERFDWDKIMEGDKIIGLK----QGKQSISLEPGGQFEL  592
            LRP+ YE    I  L+  +  R+DWD I EGD II LK    +   +ISLEPGGQFEL
Sbjct  53   LRPVPYEGNRGIRALMEHMMARYDWDPIKEGDNIIALKRPDGEAGGTISLEPGGQFEL  110



>ref|WP_038036730.1| glutamate--cysteine ligase [Thermopetrobacter sp. TC1]
Length=452

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 68/101 (67%), Gaps = 10/101 (10%)
 Frame = +2

Query  305  TEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAEL  475
            + +++T  EPL     + +L +GCK ++ WRIGTEHEKF F  +TL P+ YE    I  L
Sbjct  3    SSEIITGREPL-----IAWLEAGCKPRQAWRIGTEHEKFPFLTDTLAPVPYEGPHSIRAL  57

Query  476  LNGISERFDWDKIMEGDKIIGLK--QGKQSISLEPGGQFEL  592
            L G+ ER+ W  IMEG+ +IGLK  +G  SI+LEPGGQFEL
Sbjct  58   LEGLRERYGWQPIMEGEALIGLKDEKGGSSITLEPGGQFEL  98



>ref|WP_025311017.1| glutamate--cysteine ligase [Roseibacterium elongatum]
 gb|AHM03124.1| Glutamate--cysteine ligase [Roseibacterium elongatum DSM 19469]
Length=456

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 59/86 (69%), Gaps = 3/86 (3%)
 Frame = +2

Query  344  EDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERFDWDKI  514
            E L  YLASGCK K+ WRIGTEHEKFG+  +T  P+ Y+    I  +L G+ +RF W  I
Sbjct  15   EQLAEYLASGCKPKQDWRIGTEHEKFGYTQDTHAPLPYDGPRSIKAMLEGLRDRFGWSPI  74

Query  515  MEGDKIIGLKQGKQSISLEPGGQFEL  592
            +EGD IIGL+    +ISLEPGGQ EL
Sbjct  75   LEGDNIIGLELDGANISLEPGGQLEL  100



>ref|WP_043871177.1| glutamate--cysteine ligase [Celeribacter indicus]
 gb|AJE49000.1| glutamate--cysteine ligase [Celeribacter indicus]
Length=456

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 62/88 (70%), Gaps = 3/88 (3%)
 Frame = +2

Query  338  TKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKY---EQIAELLNGISERFDWD  508
            + +DLV YL SGCK ++ W+IGTEHEKFG+  +TL P+ Y     I  +L GI +RF W+
Sbjct  13   SHDDLVAYLMSGCKPRDAWKIGTEHEKFGYCKDTLAPLPYAGERSIKAILEGIQDRFGWN  72

Query  509  KIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             I EG+ +IGL++   +ISLEPGGQ EL
Sbjct  73   PIFEGEYLIGLEKDGANISLEPGGQLEL  100



>ref|WP_034763127.1| glutamate--cysteine ligase [Hyphomonas sp. CY54-11-8]
Length=445

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 60/87 (69%), Gaps = 3/87 (3%)
 Frame = +2

Query  341  KEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERFDWDK  511
            K +LV YL +GCK  E WRIGTEHEKFGF  E L P+ YE    +  +L G+ +RF W  
Sbjct  4    KHELVEYLEAGCKPSEDWRIGTEHEKFGFLRENLAPLPYEGKASVLAMLEGLRDRFGWAP  63

Query  512  IMEGDKIIGLKQGKQSISLEPGGQFEL  592
            I+E  K+IGL++   S+SLEPGGQFEL
Sbjct  64   IVESGKLIGLQRDGASVSLEPGGQFEL  90



>ref|WP_036701928.1| glutamate--cysteine ligase [Paracoccus sp. 10990]
 gb|KGJ20679.1| glutamate--cysteine ligase [Paracoccus sp. 10990]
Length=455

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 64/91 (70%), Gaps = 4/91 (4%)
 Frame = +2

Query  332  PLTKED-LVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERF  499
            P+ + D L  Y+ASG K +E WRIGTEHEKFGF ++TL P+ Y+    I  +L G+ +RF
Sbjct  10   PIERRDQLAAYIASGEKPREAWRIGTEHEKFGFLWDTLEPLPYDGERSIRAMLEGMRDRF  69

Query  500  DWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             W ++ EG K+IGL +   ++SLEPGGQFEL
Sbjct  70   GWAEVREGGKLIGLSRDGANVSLEPGGQFEL  100



>ref|WP_013383393.1| glutamate--cysteine ligase [Ketogulonicigenium vulgare]
 gb|ADO41742.1| glutamate/cysteine ligase [Ketogulonicigenium vulgare Y25]
Length=445

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +2

Query  344  EDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEG  523
            E L  +LA GCK KE WRIGTEHEKFGF      P+ Y  I +++  + +RF W  + EG
Sbjct  15   EQLAEFLAKGCKPKENWRIGTEHEKFGFVTADHAPLPYAGINQIMTRLIDRFGWSAVTEG  74

Query  524  DKIIGLKQGKQSISLEPGGQFEL  592
            D +IGLK+   +ISLEPGGQFEL
Sbjct  75   DSLIGLKRNGANISLEPGGQFEL  97



>ref|WP_014537450.1| glutamate--cysteine ligase [Ketogulonicigenium vulgare]
 ref|YP_005793973.1| hypothetical protein KVU_0138 [Ketogulonicigenium vulgare WSH-001]
 gb|AEM39977.1| hypothetical protein KVU_0138 [Ketogulonicigenium vulgare WSH-001]
Length=445

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +2

Query  344  EDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAELLNGISERFDWDKIMEG  523
            E L  +LA GCK KE WRIGTEHEKFGF      P+ Y  I +++  + +RF W  + EG
Sbjct  15   EQLAEFLAKGCKPKENWRIGTEHEKFGFVTADHAPLPYAGINQIMTRLIDRFGWSAVTEG  74

Query  524  DKIIGLKQGKQSISLEPGGQFEL  592
            D +IGLK+   +ISLEPGGQFEL
Sbjct  75   DSLIGLKRNGANISLEPGGQFEL  97



>ref|WP_036707793.1| glutamate--cysteine ligase [Paracoccus sp. 5503]
 gb|KGJ22973.1| glutamate--cysteine ligase [Paracoccus sp. 5503]
Length=455

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 64/91 (70%), Gaps = 4/91 (4%)
 Frame = +2

Query  332  PLTKED-LVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERF  499
            P+ + D L  Y+ASG K +E WRIGTEHEKFGF ++TL P+ Y+    I  +L G+ +RF
Sbjct  10   PIERRDQLAAYIASGEKPREAWRIGTEHEKFGFLWDTLEPLPYDGERSIRAMLEGMRDRF  69

Query  500  DWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             W ++ EG K+IGL +   ++SLEPGGQFEL
Sbjct  70   GWAEVREGGKLIGLSRDGANVSLEPGGQFEL  100



>ref|WP_011457023.1| glutamate--cysteine ligase [Jannaschia sp. CCS1]
 gb|ABD56826.1| glutamate--cysteine ligase [Jannaschia sp. CCS1]
Length=456

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 59/84 (70%), Gaps = 3/84 (4%)
 Frame = +2

Query  350  LVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERFDWDKIME  520
            L  YL+ GCK K  WRIGTEHEKFGF  +TL+P+ YE    +  +L G+ +RFDW  +ME
Sbjct  17   LAEYLSDGCKPKADWRIGTEHEKFGFCRDTLQPIPYEGARSVRAVLEGLRDRFDWTPVME  76

Query  521  GDKIIGLKQGKQSISLEPGGQFEL  592
            G  IIGL++   ++SLEPGGQ EL
Sbjct  77   GGHIIGLEKDGANVSLEPGGQLEL  100



>ref|WP_022694894.1| glutamate--cysteine ligase [Ponticaulis koreensis]
Length=460

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 67/101 (66%), Gaps = 4/101 (4%)
 Frame = +2

Query  302  PTEDVVTAAEPL-TKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIA  469
            PT D+   A  +  K + V YLA+G K K+ WRIGTEHEKFGF  +  RP+ Y+    + 
Sbjct  4    PTADIDENAPRIQDKREFVEYLATGNKPKDDWRIGTEHEKFGFLTDGYRPLPYDGEASVR  63

Query  470  ELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +L  + E+F WD I+EG+ IIGL++   S+SLEPGGQFEL
Sbjct  64   TVLQSLHEQFGWDPILEGEHIIGLQKDGASVSLEPGGQFEL  104



>ref|WP_034744831.1| glutamate--cysteine ligase [Hyphomonas chukchiensis]
Length=459

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 67/101 (66%), Gaps = 4/101 (4%)
 Frame = +2

Query  302  PTEDVV-TAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIA  469
            PT D+  ++A   +K +LV YL +G K +  WRIGTEHEKFGF    LRP+ YE    I 
Sbjct  4    PTADIDESSARIESKTELVEYLDAGSKPRADWRIGTEHEKFGFTTADLRPLPYEGKASIR  63

Query  470  ELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +L G+ + F W+ I+EG  +IGLK+   S+SLEPGGQFEL
Sbjct  64   AMLEGLRDTFGWESIIEGGHLIGLKKDGASVSLEPGGQFEL  104



>ref|WP_043131585.1| glutamate--cysteine ligase [Paracoccus sp. 4681]
 gb|KGJ14946.1| glutamate--cysteine ligase [Paracoccus sp. 4681]
Length=455

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 64/91 (70%), Gaps = 4/91 (4%)
 Frame = +2

Query  332  PLTKED-LVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERF  499
            P+ + D L  Y+ASG K +E WRIGTEHEKFGF ++TL P+ Y+    I  +L G+ +RF
Sbjct  10   PIERRDQLAAYIASGEKPREAWRIGTEHEKFGFLWDTLEPLPYDGERSIRAMLEGMRDRF  69

Query  500  DWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             W ++ EG K+IGL +   ++SLEPGGQFEL
Sbjct  70   GWAEVREGGKLIGLSRDGANVSLEPGGQFEL  100



>ref|WP_035571182.1| glutamate--cysteine ligase [Hyphomonas adhaerens]
 gb|KCZ86322.1| glutamate--cysteine ligase [Hyphomonas adhaerens MHS-3]
Length=459

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 66/101 (65%), Gaps = 4/101 (4%)
 Frame = +2

Query  302  PTEDVV-TAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIA  469
            PT D+  T+     K +LV YL +G K    WRIGTEHEKFGF  E L P+ Y+    + 
Sbjct  4    PTSDIDETSPRIAGKHELVEYLEAGNKPAADWRIGTEHEKFGFLRENLAPLPYDGKASVL  63

Query  470  ELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +L G+ +RF WD I+EG K+IGL++   S+SLEPGGQFEL
Sbjct  64   AMLEGLRDRFGWDPIVEGGKLIGLQRDGASVSLEPGGQFEL  104



>ref|WP_039718559.1| glutamate--cysteine ligase [Scytonema millei]
 gb|KIF12647.1| glutamate--cysteine ligase [Scytonema millei VB511283]
Length=457

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 63/89 (71%), Gaps = 5/89 (6%)
 Frame = +2

Query  338  TKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE----QIAELLNGISERFDW  505
            T EDL G+LA+GCK +E WRIGTEHEKFGF  E   P+ YE     + ++L G++ RF W
Sbjct  16   TIEDLAGHLATGCKPREAWRIGTEHEKFGFTLEGHHPLPYESDGPSVRKMLEGLT-RFGW  74

Query  506  DKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
            ++++E  K I LK+   S+SLEPGGQFEL
Sbjct  75   EEVLENGKPIALKRDGASVSLEPGGQFEL  103



>gb|KCZ53527.1| glutamate--cysteine ligase [Hyphomonas chukchiensis]
Length=471

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 67/101 (66%), Gaps = 4/101 (4%)
 Frame = +2

Query  302  PTEDVV-TAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIA  469
            PT D+  ++A   +K +LV YL +G K +  WRIGTEHEKFGF    LRP+ YE    I 
Sbjct  16   PTADIDESSARIESKTELVEYLDAGSKPRADWRIGTEHEKFGFTTADLRPLPYEGKASIR  75

Query  470  ELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +L G+ + F W+ I+EG  +IGLK+   S+SLEPGGQFEL
Sbjct  76   AMLEGLRDTFGWESIIEGGHLIGLKKDGASVSLEPGGQFEL  116



>ref|WP_043831764.1| glutamate--cysteine ligase [Roseomonas aerilata]
Length=447

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 67/101 (66%), Gaps = 5/101 (5%)
 Frame = +2

Query  296  SPPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQ--IA  469
            S P E  +T  E  +  DL G+ A+G K +  WR+GTEHEK GF  ET  P  YE   IA
Sbjct  2    SNPGEADLTPIE--SARDLAGWFAAGSKPRTAWRVGTEHEKIGFHRETFLPPAYEPAGIA  59

Query  470  ELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             LL G++ R  W++I +G KIIGLK+G+ S+SLEPGGQFEL
Sbjct  60   ALLEGLTAR-GWERIDDGGKIIGLKRGEASVSLEPGGQFEL  99



>ref|WP_045696674.1| glutamate--cysteine ligase [Hyphomonas sp. BRH_c22]
 gb|KJS36910.1| glutamate--cysteine ligase [Hyphomonas sp. BRH_c22]
Length=459

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = +2

Query  302  PTEDVVTAAEPL-TKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIA  469
            PT D+  ++  + +K +LV YLA+G K    WRIGTEHEKFGF  + LRP+ Y+    I 
Sbjct  4    PTSDIDESSTRIESKAELVDYLAAGSKPMADWRIGTEHEKFGFIKDGLRPLPYDGKASIL  63

Query  470  ELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +L G+ + F W+ I+EG  +IGLK+   S+SLEPGGQFEL
Sbjct  64   SMLEGLRDTFGWEPIVEGGHLIGLKKDGASVSLEPGGQFEL  104



>ref|WP_031555060.1| glutamate--cysteine ligase [Parvularcula oceani]
Length=446

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 67/101 (66%), Gaps = 12/101 (12%)
 Frame = +2

Query  299  PPTEDVVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKY---EQIA  469
            PP ED+          +L  YLASGCK K++WR+GTEHEKFGF  +TL P+ +     I 
Sbjct  2    PPIEDI---------SELSAYLASGCKPKDQWRLGTEHEKFGFLRDTLEPLPFSGERSIQ  52

Query  470  ELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +L+G+++RF W ++ E  +++ LK+   SISLEPGGQFEL
Sbjct  53   SVLSGLADRFGWQRMEEDGQLVALKKEGASISLEPGGQFEL  93



>ref|WP_007427205.1| glutamate--cysteine ligase [Oceaniovalibus guishaninsula]
 gb|EKE43719.1| glutamate--cysteine ligase [Oceaniovalibus guishaninsula JLT2003]
Length=456

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = +2

Query  350  LVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKY---EQIAELLNGISERFDWDKIME  520
            L  Y+ASGCK K  WRIGTEHEKFG+  +TL+P+ Y     +  +L G+ +RF WD + E
Sbjct  17   LADYMASGCKPKADWRIGTEHEKFGYCRDTLKPLPYHGPRSVEAVLTGLRDRFGWDPVTE  76

Query  521  GDKIIGLKQGKQSISLEPGGQFEL  592
              K+IGL +G  ++SLEPGGQ EL
Sbjct  77   DGKLIGLTKGAANVSLEPGGQLEL  100



>ref|WP_036733683.1| glutamate--cysteine ligase [Paracoccus sp. 39524]
 gb|KGJ17397.1| glutamate--cysteine ligase [Paracoccus sp. 39524]
Length=455

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 64/91 (70%), Gaps = 4/91 (4%)
 Frame = +2

Query  332  PLTKED-LVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERF  499
            P+ + D L  Y+ASG K +E WRIGTEHEKFGF ++TL P+ Y+    I  +L G+ +RF
Sbjct  10   PIERRDQLAAYIASGEKPREAWRIGTEHEKFGFLWDTLEPLPYDGERSIRAMLEGMRDRF  69

Query  500  DWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             W ++ EG K+IGL +   ++SLEPGGQFEL
Sbjct  70   GWAEVREGGKLIGLSREGANVSLEPGGQFEL  100



>ref|WP_035599559.1| glutamate--cysteine ligase [Hyphomonas polymorpha]
Length=444

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 3/87 (3%)
 Frame = +2

Query  341  KEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERFDWDK  511
            K +LV Y+  G K +  W IGTEHEKFGF ++ L+P+ YE    I  +L G+ +RF WD 
Sbjct  4    KRELVAYMEGGAKPRSDWAIGTEHEKFGFIWDGLKPLPYEGPASILAMLEGMRDRFGWDP  63

Query  512  IMEGDKIIGLKQGKQSISLEPGGQFEL  592
            I+EG  +IGLK+   S+SLEPGGQFEL
Sbjct  64   ILEGGYLIGLKKDGASVSLEPGGQFEL  90



>gb|ABI75913.1| glutamate--cysteine ligase [Hyphomonas neptunium ATCC 15444]
 gb|KCZ95674.1| glutamate--cysteine ligase [Hyphomonas hirschiana VP5]
Length=458

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 67/101 (66%), Gaps = 4/101 (4%)
 Frame = +2

Query  302  PTEDVVTAAEPLT-KEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIA  469
            PT D+  A+  ++ K +LV YL  G K    W IGTEHEKFGF ++ L+P+ YE    I 
Sbjct  4    PTSDIDEASPRISGKHELVEYLEGGSKPASDWAIGTEHEKFGFIWDGLKPLPYEGPASIL  63

Query  470  ELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +L G+ +RF W+ I+EG  +IGLK+   S+SLEPGGQFEL
Sbjct  64   AMLEGLRDRFAWEPILEGGYLIGLKKDGASVSLEPGGQFEL  104



>ref|WP_015921392.1| glutamate--cysteine ligase [Rhodobacter sphaeroides]
 gb|ACM02257.1| Glutamate--cysteine ligase [Rhodobacter sphaeroides KD131]
Length=454

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 59/88 (67%), Gaps = 3/88 (3%)
 Frame = +2

Query  338  TKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAE---LLNGISERFDWD  508
            + E L  Y+ +GCK  + WRIGTEHEKFG+    L+P+ YE  A    +L G+ +RF WD
Sbjct  13   SYEQLAAYMEAGCKPAQDWRIGTEHEKFGYLTADLKPLPYEGAASVRAILEGLRDRFGWD  72

Query  509  KIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +ME D IIGL++   ++SLEPGGQ EL
Sbjct  73   PVMERDAIIGLQRDGANVSLEPGGQLEL  100



>ref|WP_011570131.1| glutamate--cysteine ligase [Roseobacter denitrificans]
 gb|ABG33521.1| glutamate-cysteine ligase [Roseobacter denitrificans OCh 114]
Length=456

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 62/91 (68%), Gaps = 4/91 (4%)
 Frame = +2

Query  332  PLTKED-LVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERF  499
            P+T  D +VGYLASGCK KE WRIGTEHEKFG+  +TL P+ YE    I  +L G+ + F
Sbjct  10   PITSYDQMVGYLASGCKPKEDWRIGTEHEKFGYCKDTLLPLPYEGDRSIRAMLEGLRDTF  69

Query  500  DWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             W  + E  KIIGL++   ++SLEPGG  EL
Sbjct  70   GWAPVSEDGKIIGLEKDGANVSLEPGGALEL  100



>ref|WP_009572338.1| glutamate--cysteine ligase [Celeribacter baekdonensis]
 gb|EKE70709.1| glutamate--cysteine ligase [Celeribacter baekdonensis B30]
Length=456

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 59/88 (67%), Gaps = 3/88 (3%)
 Frame = +2

Query  338  TKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKY---EQIAELLNGISERFDWD  508
            + +DLV + A GCK +E W+IGTEHEKFG+  +TL P+ Y     I  LL G+ +RF WD
Sbjct  13   SYDDLVNFFAEGCKPRENWKIGTEHEKFGYCKDTLNPLPYAGDRSIKALLEGLQDRFGWD  72

Query  509  KIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             + EG+ +IGL     ++SLEPGGQ EL
Sbjct  73   PVFEGEHLIGLTLNGANVSLEPGGQLEL  100



>ref|WP_018147083.1| glutamate--cysteine ligase [Henriciella marina]
Length=459

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = +2

Query  302  PTEDVV-TAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIA  469
            PT D+   AA   +K +LV ++  GC  +  W+IGTEHEKFGF  E LRP+ Y+    I 
Sbjct  4    PTSDIDENAARIESKSELVEWIEEGCTPRSDWKIGTEHEKFGFIKEGLRPLPYDGEVSIR  63

Query  470  ELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +L+G++E+F W+ I+E   +IGLK+   S+SLEPGGQFEL
Sbjct  64   AMLDGLAEKFGWEPIVESGLLIGLKKDGASVSLEPGGQFEL  104



>ref|WP_008944552.1| glutamate--cysteine ligase [Oceanibaculum indicum]
 gb|EKE75824.1| gamma-glutamylcysteine synthetase [Oceanibaculum indicum P24]
Length=454

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 64/95 (67%), Gaps = 5/95 (5%)
 Frame = +2

Query  320  TAAEPLT-KEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGI  487
            +  EP+T K  LV YLAS  K K  WRIGTEHEKF ++ ++LRP+ YE    I  +L G+
Sbjct  7    SQGEPITDKRQLVEYLASAVKPKSDWRIGTEHEKFAYDLKSLRPLPYEGETGIRAILEGM  66

Query  488  SERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
              RF W+ I EGDKII L   K +I+LEPGGQFEL
Sbjct  67   L-RFGWEPIREGDKIIALSMDKCAITLEPGGQFEL  100



>ref|WP_037944812.1| glutamate--cysteine ligase [Sulfitobacter sp. CB2047]
 gb|KFC27054.1| glutamate--cysteine ligase [Sulfitobacter sp. CB2047]
Length=456

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 59/88 (67%), Gaps = 3/88 (3%)
 Frame = +2

Query  338  TKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERFDWD  508
            + + LV YLA GCK KE WRIGTEHEKFG+  ETL P+ YE    I  +L G+ +   WD
Sbjct  13   SYDQLVNYLADGCKPKEDWRIGTEHEKFGYNKETLLPLPYEGDCSIRAMLEGLRDGHGWD  72

Query  509  KIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             + EG K+IGL +   +ISLEPGGQ EL
Sbjct  73   PVEEGGKLIGLVKDGANISLEPGGQLEL  100



>ref|WP_037966014.1| glutamate--cysteine ligase [Sulfitobacter pontiacus]
 gb|KAJ29888.1| glutamate--cysteine ligase [Sulfitobacter pontiacus 3SOLIMAR09]
Length=456

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 58/86 (67%), Gaps = 3/86 (3%)
 Frame = +2

Query  344  EDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERFDWDKI  514
            + LV YLA GCK KE WRIGTEHEKFG+  ETL P+ YE    I  +L G+ +   WD +
Sbjct  15   DQLVNYLADGCKPKEDWRIGTEHEKFGYNKETLLPLPYEGDCSIRAMLEGLRDGHGWDPV  74

Query  515  MEGDKIIGLKQGKQSISLEPGGQFEL  592
             EG K+IGL +   +ISLEPGGQ EL
Sbjct  75   EEGGKLIGLVKDGANISLEPGGQLEL  100



>ref|WP_005849673.1| glutamate--cysteine ligase [Sulfitobacter sp. EE-36]
 gb|EAP85109.1| glutamate--cysteine ligase [Sulfitobacter sp. EE-36]
Length=456

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 59/88 (67%), Gaps = 3/88 (3%)
 Frame = +2

Query  338  TKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERFDWD  508
            + + LV YLA GCK KE WRIGTEHEKFG+  ETL P+ YE    I  +L G+ +   WD
Sbjct  13   SYDQLVNYLADGCKPKEDWRIGTEHEKFGYNKETLLPLPYEGDCSIRAMLEGLRDGHGWD  72

Query  509  KIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             + EG K+IGL +   +ISLEPGGQ EL
Sbjct  73   PVEEGGKLIGLVKDGANISLEPGGQLEL  100



>ref|WP_024088897.1| glutamate--cysteine ligase [Leisingera methylohalidivorans]
 gb|AHC99808.1| glutamate--cysteine ligase [Leisingera methylohalidivorans DSM 
14336]
Length=456

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 58/86 (67%), Gaps = 3/86 (3%)
 Frame = +2

Query  344  EDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKY---EQIAELLNGISERFDWDKI  514
            E L  YLA GCK KE WRIGTEHEKFGF  +TL+P+ Y     I  +L G+ +   WD +
Sbjct  15   EQLAEYLADGCKPKEDWRIGTEHEKFGFCKDTLKPLPYAGERSIQAVLEGLRDGHGWDPL  74

Query  515  MEGDKIIGLKQGKQSISLEPGGQFEL  592
            +EG  +IGL +G  +ISLEPGGQ EL
Sbjct  75   IEGGNLIGLTKGGANISLEPGGQLEL  100



>ref|WP_012654088.1| glutamate--cysteine ligase [Agrobacterium vitis]
 gb|ACM38846.1| glutamate--cysteine ligase [Agrobacterium vitis S4]
Length=457

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 63/98 (64%), Gaps = 6/98 (6%)
 Frame = +2

Query  317  VTAAEPLTK-EDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKY---EQIAELLNG  484
             T   PLT  ED+  Y+A GCK KE +RIGTEHEKFGF    L P+ Y     I+ LLNG
Sbjct  5    TTDDTPLTSIEDMAAYMAEGCKPKETFRIGTEHEKFGFFTADLSPVPYFGEASISALLNG  64

Query  485  ISERFDWDKIMEGDKIIGLK--QGKQSISLEPGGQFEL  592
            +  R  W+ I++G  IIGL    G+ +IS+EPGGQFEL
Sbjct  65   MQARLGWEPIIDGGNIIGLAGGSGQGAISIEPGGQFEL  102



>dbj|BAQ68193.1| glutamate-cysteine ligase [Rhodovulum sulfidophilum]
Length=456

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = +2

Query  338  TKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERFDWD  508
            + E LV YLASGCK K  WRIGTEHEKFG+  + L+P+ Y+    +  +L G+ +R  W 
Sbjct  13   SHEQLVEYLASGCKPKPDWRIGTEHEKFGYCRDALKPIPYDGPRSVKAVLEGLRDRHGWA  72

Query  509  KIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +MEG+ +IGL++   ++SLEPGGQ EL
Sbjct  73   PVMEGENLIGLQKDGANVSLEPGGQLEL  100



>ref|WP_042463612.1| glutamate--cysteine ligase [Rhodovulum sulfidophilum]
Length=456

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = +2

Query  338  TKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERFDWD  508
            + E LV YLASGCK K  WRIGTEHEKFG+  + L+P+ Y+    +  +L G+ +R  W 
Sbjct  13   SHEQLVEYLASGCKPKPDWRIGTEHEKFGYCRDALKPIPYDGPRSVKAVLEGLRDRHGWA  72

Query  509  KIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +MEG+ +IGL++   ++SLEPGGQ EL
Sbjct  73   PVMEGENLIGLQKDGANVSLEPGGQLEL  100



>ref|WP_036716534.1| glutamate--cysteine ligase [Paracoccus sphaerophysae]
 gb|KGJ09317.1| glutamate--cysteine ligase [Paracoccus sphaerophysae]
Length=455

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = +2

Query  344  EDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERFDWDKI  514
            E +  Y+ASG K ++ WRIGTEHEKFGF ++TL+P+ YE    I  +L G+ +RF W++I
Sbjct  15   EQMAEYVASGEKPRDSWRIGTEHEKFGFTWDTLKPLPYEGERSILAMLEGLRDRFGWEEI  74

Query  515  MEGDKIIGLKQGKQSISLEPGGQFEL  592
             E  K+IGL +   ++SLEPGGQ EL
Sbjct  75   RESGKLIGLSRDGANVSLEPGGQLEL  100



>ref|WP_043136175.1| glutamate--cysteine ligase [Ponticoccus sp. UMTAT08]
 gb|KHQ55136.1| Glutamate--cysteine ligase [Ponticoccus sp. UMTAT08]
Length=456

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 62/91 (68%), Gaps = 4/91 (4%)
 Frame = +2

Query  332  PLTKED-LVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERF  499
            P+T  D L  YLASGCK K++WRIGTEHEKFG+  ++L+P+ Y+    I  +L G+ +R 
Sbjct  10   PITSHDQLAEYLASGCKPKDQWRIGTEHEKFGYCKDSLKPLPYDGERSIRAVLEGLRDRH  69

Query  500  DWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             WD + EG  IIGL +   ++SLEPGG  EL
Sbjct  70   GWDPVHEGGHIIGLTKDGANVSLEPGGALEL  100



>ref|WP_002721323.1| glutamate--cysteine ligase [Rhodobacter sphaeroides]
 gb|EGJ22505.1| glutamate--cysteine ligase [Rhodobacter sphaeroides WS8N]
Length=454

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 59/88 (67%), Gaps = 3/88 (3%)
 Frame = +2

Query  338  TKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAE---LLNGISERFDWD  508
            + E L  Y+ +GCK  + WRIGTEHEKFG+    L+P+ YE  A    +L G+ +RF W+
Sbjct  13   SYEQLAAYMEAGCKPAQDWRIGTEHEKFGYLTADLKPLPYEGAASVRAILEGLRDRFGWE  72

Query  509  KIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +ME D IIGL++   ++SLEPGGQ EL
Sbjct  73   PVMERDAIIGLQRDGANVSLEPGGQLEL  100



>ref|WP_009563049.1| Glutamate--cysteine ligase [Rhodobacter sp. AKP1]
 gb|EKX58072.1| Glutamate--cysteine ligase [Rhodobacter sp. AKP1]
Length=454

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 59/88 (67%), Gaps = 3/88 (3%)
 Frame = +2

Query  338  TKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAE---LLNGISERFDWD  508
            + E L  Y+ +GCK  + WRIGTEHEKFG+    L+P+ YE  A    +L G+ +RF W+
Sbjct  13   SYEQLAAYMEAGCKPAQDWRIGTEHEKFGYLTADLKPLPYEGAASVRAILEGLRDRFGWE  72

Query  509  KIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +ME D IIGL++   ++SLEPGGQ EL
Sbjct  73   PVMERDAIIGLQRDGANVSLEPGGQLEL  100



>ref|WP_018304101.1| glutamate--cysteine ligase [Wenxinia marina]
 gb|KIQ70357.1| glutamate--cysteine ligase, plant type [Wenxinia marina DSM 24838]
Length=456

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +2

Query  344  EDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKY---EQIAELLNGISERFDWDKI  514
            E L  YLA GCK K++WRIGTEHEKFGF  ++ RP+ Y     I  +L+G+ +RF W  +
Sbjct  15   EQLAEYLAEGCKPKDQWRIGTEHEKFGFCTDSHRPLPYAGERSIHAVLSGLRDRFGWQPV  74

Query  515  MEGDKIIGLKQGKQSISLEPGGQFEL  592
             EG K+IGL++   ++SLEPGGQ EL
Sbjct  75   EEGGKLIGLQKDGANVSLEPGGQLEL  100



>ref|WP_028098740.1| glutamate--cysteine ligase [Dongia sp. URHE0060]
Length=454

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 69/104 (66%), Gaps = 9/104 (9%)
 Frame = +2

Query  293  ASPPTEDVVTAAEPLT-KEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQ--  463
            ++PP     +  EP+T K  LV Y +SG K K  WRIGTEHEKF F+ +TLRP+ Y+   
Sbjct  2    SAPPK----SQGEPITSKAQLVEYFSSGSKPKSAWRIGTEHEKFVFDAKTLRPVSYDAPN  57

Query  464  -IAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             I  +LNG++ RF W+KI E  K+I L +   ++SLEPGGQFEL
Sbjct  58   GIGAILNGLT-RFGWEKIEENGKVIALTKDGCNVSLEPGGQFEL  100



>ref|WP_011338651.1| glutamate--cysteine ligase [Rhodobacter sphaeroides]
 ref|YP_354089.1| putative glutathione synthetase [Rhodobacter sphaeroides 2.4.1]
 gb|ABA80188.1| putative glutathione synthetase [Rhodobacter sphaeroides 2.4.1]
Length=454

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 59/88 (67%), Gaps = 3/88 (3%)
 Frame = +2

Query  338  TKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYEQIAE---LLNGISERFDWD  508
            + E L  Y+ +GCK  + WRIGTEHEKFG+    L+P+ YE  A    +L G+ +RF W+
Sbjct  13   SYEQLAAYMEAGCKPAQDWRIGTEHEKFGYLTADLKPLPYEGAASVRAILEGLRDRFGWE  72

Query  509  KIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             +ME D IIGL++   ++SLEPGGQ EL
Sbjct  73   PVMERDAIIGLQRDGANVSLEPGGQLEL  100



>ref|WP_027256476.1| glutamate--cysteine ligase [Leisingera aquimarina]
Length=456

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 57/86 (66%), Gaps = 3/86 (3%)
 Frame = +2

Query  344  EDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERFDWDKI  514
            E L  YLA GCK KE WRIGTEHEKFGF  +TL+P+ YE    I  +L G+ +   W  +
Sbjct  15   EQLAEYLADGCKPKEDWRIGTEHEKFGFCKDTLKPLPYEGERSILAVLTGLRDGHGWAPL  74

Query  515  MEGDKIIGLKQGKQSISLEPGGQFEL  592
             EGD +IGL +   +ISLEPGGQ EL
Sbjct  75   TEGDNLIGLTKDGANISLEPGGQLEL  100



>ref|WP_013960367.1| glutamate--cysteine ligase [Roseobacter litoralis]
 gb|AEI92424.1| glutamate--cysteine ligase [Roseobacter litoralis Och 149]
Length=456

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 62/91 (68%), Gaps = 4/91 (4%)
 Frame = +2

Query  332  PLTKED-LVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERF  499
            P+T  D +V YLASGCK KE+WRIGTEHEKFG+  +TL P+ YE    I  +L G+ + F
Sbjct  10   PITSYDQMVSYLASGCKPKEEWRIGTEHEKFGYCKDTLLPLPYEGDRSIQAVLEGLRDTF  69

Query  500  DWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             W  + E  KIIGL++   ++SLEPGG  EL
Sbjct  70   GWAPVSEDGKIIGLEKDGANVSLEPGGALEL  100



>ref|WP_027298647.1| glutamate--cysteine ligase [Rhodospirillales bacterium URHD0088]
Length=454

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 67/104 (64%), Gaps = 9/104 (9%)
 Frame = +2

Query  293  ASPPTEDVVTAAEPLT-KEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---  460
            ++PPT    +  EP+T K  LV YLASG K +E WRIGTEHEKF F    LR + YE   
Sbjct  2    SAPPT----STGEPITDKRQLVEYLASGSKPQEAWRIGTEHEKFVFRRSDLRRVPYEGKD  57

Query  461  QIAELLNGISERFDWDKIMEGDKIIGLKQGKQSISLEPGGQFEL  592
             I  LL G++ RF W  ++E  K I L QG+ SISLEPGGQFEL
Sbjct  58   GIRALLEGLT-RFGWTPVLEDGKPIALSQGQCSISLEPGGQFEL  100



>ref|WP_031448324.1| glutamate--cysteine ligase [Caulobacteraceae bacterium PMMR1]
Length=456

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 64/100 (64%), Gaps = 8/100 (8%)
 Frame = +2

Query  314  VVTAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKY---EQIAELLNG  484
            ++    PLT +DL  YLASGCK    +RIG EHEKFGF   TLRP+ Y   + I  LL G
Sbjct  4    IIQDDRPLTLKDLAAYLASGCKPPADFRIGAEHEKFGFRHGTLRPVAYDGPDGIRALLEG  63

Query  485  ISERFDWDKIME----GDKIIGLKQGKQSISLEPGGQFEL  592
            +  RF W  + E    G  +IGL++GK +ISLEPGGQFEL
Sbjct  64   MM-RFGWQGVYEDQDHGRVLIGLERGKANISLEPGGQFEL  102



>ref|WP_037909876.1| glutamate--cysteine ligase [Sulfitobacter mediterraneus]
 gb|KAJ02242.1| glutamate--cysteine ligase [Sulfitobacter mediterraneus]
Length=456

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 3/87 (3%)
 Frame = +2

Query  341  KEDLVGYLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERFDWDK  511
            ++ L  YLA GCK KE WRIGTEHEKFG+  +TL P+ YE    I  +L G+ +R +W  
Sbjct  14   RDQLAQYLADGCKPKEAWRIGTEHEKFGYCKDTLLPLPYEGERSIRVMLEGLRDRHNWTP  73

Query  512  IMEGDKIIGLKQGKQSISLEPGGQFEL  592
            + EG K+IGL++   +ISLEPGGQ EL
Sbjct  74   VEEGGKLIGLEKDGANISLEPGGQLEL  100



>ref|WP_020057893.1| glutamate--cysteine ligase [alpha proteobacterium SCGC AAA076-C03]
Length=454

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 56/81 (69%), Gaps = 3/81 (4%)
 Frame = +2

Query  359  YLASGCKTKEKWRIGTEHEKFGFEFETLRPMKYE---QIAELLNGISERFDWDKIMEGDK  529
            YL SGCK  + WRIGTEHEKFGF+  TL+P+ YE    I  +L G+ + FDW  + E D 
Sbjct  20   YLESGCKPTKDWRIGTEHEKFGFDKSTLKPLPYEGSCSIKSMLEGLRDTFDWTPVYEQDN  79

Query  530  IIGLKQGKQSISLEPGGQFEL  592
            +IGL++   ++SLEPGGQ EL
Sbjct  80   LIGLEKNGANVSLEPGGQLEL  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 776783835245