BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7420

Length=701
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAP03999.1|  EIL3                                                    174   5e-49   Nicotiana tabacum [American tobacco]
dbj|BAA74714.1|  transcription factor TEIL                              178   3e-48   Nicotiana tabacum [American tobacco]
ref|XP_009801714.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     178   3e-48   Nicotiana sylvestris
ref|XP_009587969.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     177   7e-48   Nicotiana tomentosiformis
ref|NP_001234541.1|  EIL1 protein                                       177   9e-48   Solanum lycopersicum
ref|XP_006361129.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...    176   1e-47   Solanum tuberosum [potatoes]
emb|CDP19134.1|  unnamed protein product                                176   3e-47   Coffea canephora [robusta coffee]
ref|XP_009607986.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    175   3e-47   Nicotiana tomentosiformis
gb|AAP04000.1|  EIL4                                                    175   3e-47   Nicotiana tabacum [American tobacco]
ref|XP_009607827.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     175   4e-47   Nicotiana tomentosiformis
ref|XP_009798829.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    175   4e-47   Nicotiana sylvestris
gb|KHG04095.1|  ethylene insensitive 3 -like protein                    172   1e-46   Gossypium arboreum [tree cotton]
ref|XP_006364491.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     174   1e-46   Solanum tuberosum [potatoes]
ref|XP_003555660.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          174   1e-46   Glycine max [soybeans]
ref|NP_001234721.1|  EIL2 protein                                       173   2e-46   Solanum lycopersicum
gb|AID55343.1|  EIN3-like protein EIL1                                  172   3e-46   Actinidia chinensis
ref|XP_012066274.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     172   3e-46   
gb|EYU35998.1|  hypothetical protein MIMGU_mgv1a003505mg                172   4e-46   Erythranthe guttata [common monkey flower]
ref|NP_001233931.1|  EIN3-like protein                                  172   5e-46   Solanum lycopersicum
gb|ACD87815.1|  putative ethylene insensitive transcription factor      172   5e-46   Vicia faba [broad bean]
gb|KDP42895.1|  hypothetical protein JCGZ_23837                         162   7e-46   Jatropha curcas
gb|AID55344.1|  EIN3-like protein EIL2                                  171   8e-46   Actinidia chinensis
ref|XP_010031647.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     171   1e-45   Eucalyptus grandis [rose gum]
gb|KHN33829.1|  Protein ETHYLENE INSENSITIVE 3                          171   1e-45   Glycine soja [wild soybean]
ref|XP_006361131.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     171   1e-45   Solanum tuberosum [potatoes]
ref|XP_003543159.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          171   2e-45   Glycine max [soybeans]
ref|XP_009798827.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    170   2e-45   Nicotiana sylvestris
ref|XP_003617086.1|  Ethylene insensitive 3-like protein                170   2e-45   Medicago truncatula
gb|ACJ70675.1|  EIN3-like protein EIL2                                  170   2e-45   Actinidia deliciosa [Chinese gooseberry]
gb|ACP56697.1|  EIN3-like protein                                       170   3e-45   Lithospermum erythrorhizon
gb|AFI61908.1|  ethylene insensitive 3-like 2 protein                   169   7e-45   Paeonia suffruticosa [moutan peony]
ref|XP_011080514.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          169   8e-45   Sesamum indicum [beniseed]
gb|KJB26156.1|  hypothetical protein B456_004G227800                    168   9e-45   Gossypium raimondii
gb|KJB20248.1|  hypothetical protein B456_003G140600                    168   9e-45   Gossypium raimondii
gb|ACJ85584.1|  unknown                                                 168   1e-44   Medicago truncatula
ref|XP_011006497.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     168   1e-44   Populus euphratica
ref|XP_007016682.1|  Ethylene insensitive 3 family protein              168   1e-44   
gb|KDO66381.1|  hypothetical protein CISIN_1g0070172mg                  166   2e-44   Citrus sinensis [apfelsine]
ref|XP_003543154.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          167   2e-44   Glycine max [soybeans]
ref|XP_006384758.1|  EIN3-like family protein                           167   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_011043514.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          167   2e-44   Populus euphratica
ref|XP_011090234.1|  PREDICTED: LOW QUALITY PROTEIN: protein ETHY...    167   2e-44   
gb|EYU46131.1|  hypothetical protein MIMGU_mgv1a003270mg                167   2e-44   Erythranthe guttata [common monkey flower]
gb|KHN38437.1|  Protein ETHYLENE INSENSITIVE 3                          165   4e-44   Glycine soja [wild soybean]
ref|XP_002530192.1|  ETHYLENE-INSENSITIVE3 protein, putative            166   4e-44   Ricinus communis
gb|KDO66375.1|  hypothetical protein CISIN_1g0070172mg                  166   5e-44   Citrus sinensis [apfelsine]
ref|XP_004288382.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          166   5e-44   Fragaria vesca subsp. vesca
gb|KDO66378.1|  hypothetical protein CISIN_1g0070172mg                  166   6e-44   Citrus sinensis [apfelsine]
ref|XP_006446382.1|  hypothetical protein CICLE_v10014617mg             166   6e-44   Citrus clementina [clementine]
ref|XP_012066277.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     162   7e-44   
ref|XP_006470438.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...    166   1e-43   Citrus sinensis [apfelsine]
gb|KHN26027.1|  Protein ETHYLENE INSENSITIVE 3                          165   2e-43   Glycine soja [wild soybean]
ref|XP_003545483.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          165   2e-43   Glycine max [soybeans]
gb|AGK07288.1|  EIN3-3                                                  164   2e-43   Rosa hybrid cultivar
gb|AHB18380.1|  ethylene insensitive 3                                  164   2e-43   Momordica charantia [balsam pear]
ref|XP_003519487.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          164   3e-43   Glycine max [soybeans]
ref|XP_004491182.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...    164   4e-43   Cicer arietinum [garbanzo]
gb|AAL76271.1|AF467783_1  transcription factor EIL2                     162   1e-42   Vigna radiata [mung bean]
gb|AGV54673.1|  ethylene insensitive protein 3                          162   1e-42   Phaseolus vulgaris [French bean]
gb|AGV54306.1|  transcription factor EIL1                               162   1e-42   Phaseolus vulgaris [French bean]
ref|XP_007141570.1|  hypothetical protein PHAVU_008G207000g             162   1e-42   Phaseolus vulgaris [French bean]
ref|XP_002275284.2|  PREDICTED: protein ETHYLENE INSENSITIVE 3          162   1e-42   Vitis vinifera
gb|KHG09663.1|  ethylene insensitive 3 -like protein                    162   2e-42   Gossypium arboreum [tree cotton]
gb|AAL76272.1|AF467784_1  transcription factor EIL1                     161   3e-42   Vigna radiata [mung bean]
gb|AHC70432.1|  ethylene insensitive 3-like protein                     161   3e-42   Cucurbita pepo subsp. pepo [field pumpkin]
gb|ABK35086.1|  EIL2                                                    161   3e-42   Prunus persica
emb|CDY60391.1|  BnaA01g36840D                                          159   5e-42   Brassica napus [oilseed rape]
ref|XP_004306440.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    160   5e-42   Fragaria vesca subsp. vesca
ref|XP_004501972.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...    160   6e-42   Cicer arietinum [garbanzo]
ref|XP_007146084.1|  hypothetical protein PHAVU_006G011300g             159   1e-41   Phaseolus vulgaris [French bean]
gb|AHC70433.1|  ethylene insensitive 3 protein                          159   1e-41   Cucurbita pepo subsp. pepo [field pumpkin]
ref|XP_002312841.2|  EIN3-like family protein                           159   1e-41   
gb|KJB56070.1|  hypothetical protein B456_009G105400                    159   2e-41   Gossypium raimondii
ref|XP_004144109.2|  PREDICTED: protein ETHYLENE INSENSITIVE 3          159   2e-41   Cucumis sativus [cucumbers]
gb|AFK80347.1|  ethylene-insensitive 3                                  159   2e-41   Cucumis sativus [cucumbers]
gb|KDO53812.1|  hypothetical protein CISIN_1g009144mg                   156   2e-41   Citrus sinensis [apfelsine]
ref|XP_002315400.1|  EIN3-like family protein                           159   2e-41   
ref|XP_002310961.1|  hypothetical protein POPTR_0008s01200g             159   3e-41   
ref|XP_008451093.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          158   3e-41   Cucumis melo [Oriental melon]
gb|KJB83827.1|  hypothetical protein B456_013G266300                    157   6e-41   Gossypium raimondii
dbj|BAB64344.1|  EIN3-like protein                                      158   6e-41   Cucumis melo [Oriental melon]
emb|CDY19606.1|  BnaA05g20140D                                          156   7e-41   Brassica napus [oilseed rape]
ref|XP_010510821.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    157   7e-41   Camelina sativa [gold-of-pleasure]
emb|CDY06379.1|  BnaC05g31510D                                          156   8e-41   
emb|CDX83250.1|  BnaA03g22560D                                          157   9e-41   
ref|XP_011046481.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    157   9e-41   Populus euphratica
ref|XP_011012998.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    157   1e-40   Populus euphratica
ref|XP_009110178.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     157   1e-40   Brassica rapa
ref|XP_004140927.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    157   1e-40   Cucumis sativus [cucumbers]
emb|CDY38540.1|  BnaC03g26570D                                          156   1e-40   Brassica napus [oilseed rape]
ref|XP_008379003.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     154   1e-40   
ref|XP_010521603.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...    157   1e-40   
ref|XP_010417849.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    156   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009133914.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    156   1e-40   Brassica rapa
ref|XP_006408669.1|  hypothetical protein EUTSA_v10001938mg             156   1e-40   Eutrema salsugineum [saltwater cress]
ref|XP_010473094.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    156   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006293460.1|  hypothetical protein CARUB_v10022879mg             156   2e-40   Capsella rubella
ref|XP_010521602.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...    157   2e-40   
gb|AGI41324.1|  EIN3-like protein                                       156   2e-40   Malus domestica [apple tree]
ref|XP_008364747.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    156   2e-40   
gb|ADE41154.1|  ethylene insensitive 3 class transcription factor       156   2e-40   Malus domestica [apple tree]
ref|XP_009339245.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    156   2e-40   
ref|XP_010247605.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     156   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_009355060.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    155   3e-40   Pyrus x bretschneideri [bai li]
ref|XP_010417850.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    155   3e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010466283.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     155   3e-40   Camelina sativa [gold-of-pleasure]
gb|KDO53810.1|  hypothetical protein CISIN_1g009144mg                   155   3e-40   Citrus sinensis [apfelsine]
ref|XP_002879041.1|  hypothetical protein ARALYDRAFT_481586             155   3e-40   
emb|CDY32390.1|  BnaC03g41740D                                          155   3e-40   Brassica napus [oilseed rape]
ref|NP_180273.1|  ethylene insensitive 3-like 1 protein                 155   4e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009145590.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3 is...    155   4e-40   
ref|XP_009145591.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3 is...    155   4e-40   Brassica rapa
gb|AAC49746.1|  ethylene-insensitive3-like1                             155   4e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010694878.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    155   5e-40   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ33948.1|  unnamed protein product                                155   5e-40   Eutrema halophilum
gb|KFK39393.1|  protein ethylene insensitive 3-like                     155   5e-40   Arabis alpina [alpine rockcress]
ref|XP_006432536.1|  hypothetical protein CICLE_v10000608mg             155   5e-40   
ref|XP_010521598.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     155   5e-40   Tarenaya hassleriana [spider flower]
ref|XP_010488063.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     155   6e-40   Camelina sativa [gold-of-pleasure]
ref|XP_008231879.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    155   6e-40   Prunus mume [ume]
ref|XP_006406351.1|  hypothetical protein EUTSA_v10020292mg             155   6e-40   Eutrema salsugineum [saltwater cress]
gb|ADE41155.1|  ethylene insensitive 3 class transcription factor       155   6e-40   Malus domestica [apple tree]
ref|XP_008790465.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    155   6e-40   Phoenix dactylifera
ref|NP_001284429.1|  ETHYLENE INSENSITIVE 3-like 1 protein              155   6e-40   Cucumis melo [Oriental melon]
ref|XP_008456656.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    154   7e-40   Cucumis melo [Oriental melon]
ref|XP_008357657.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    154   8e-40   
ref|XP_009135708.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     154   9e-40   Brassica rapa
emb|CDX82228.1|  BnaA03g35930D                                          154   1e-39   
ref|XP_002276380.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    154   1e-39   Vitis vinifera
ref|XP_011032978.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    154   1e-39   Populus euphratica
gb|ABY28269.1|  EIN3-like protein EIL1                                  154   1e-39   Actinidia deliciosa [Chinese gooseberry]
ref|XP_010557480.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     154   1e-39   Tarenaya hassleriana [spider flower]
ref|NP_188713.1|  protein ethylene insensitive 3                        154   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002885403.1|  ethylene-insensitive3                              154   1e-39   
ref|XP_010509301.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3 is...    154   1e-39   
ref|XP_010509323.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3 is...    154   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006297205.1|  hypothetical protein CARUB_v10013213mg             154   2e-39   Capsella rubella
ref|XP_010243659.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     154   2e-39   Nelumbo nucifera [Indian lotus]
gb|AGI41325.1|  EIN3-like protein                                       153   2e-39   Malus domestica [apple tree]
ref|XP_009341360.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    154   2e-39   Pyrus x bretschneideri [bai li]
gb|ADE41153.1|  ethylene insensitive 3 class transcription factor       154   2e-39   Malus domestica [apple tree]
gb|AAK67355.1|AF387795_1  transcription factor                          153   2e-39   Cucumis melo [Oriental melon]
ref|XP_007146083.1|  hypothetical protein PHAVU_006G011200g             153   2e-39   Phaseolus vulgaris [French bean]
gb|AAY45885.1|  EIN3-like protein                                       147   2e-39   Cucurbita moschata [ayote]
ref|XP_006446380.1|  hypothetical protein CICLE_v10014617mg             153   3e-39   
gb|AAX84043.1|  EIN3-like protein                                       147   3e-39   Cucumis sativus [cucumbers]
gb|AAY45884.1|  EIN3-like protein                                       147   3e-39   Cucurbita maxima [Boston marrow]
ref|XP_010943685.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    153   3e-39   Elaeis guineensis
gb|AAV68141.1|  ethylene insensitive 3-like 3                           152   3e-39   Dianthus caryophyllus [carnation]
ref|NP_001275851.1|  ethylene-insensitive 3-like 1 protein              152   3e-39   Citrus sinensis [apfelsine]
ref|XP_008346133.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    152   4e-39   
gb|KDO53820.1|  hypothetical protein CISIN_1g007174mg                   151   4e-39   Citrus sinensis [apfelsine]
ref|XP_010689360.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    152   4e-39   Beta vulgaris subsp. vulgaris [field beet]
gb|AAF69017.1|AF261654_1  ethylene-insensitive 3-like protein 1         152   4e-39   Dianthus caryophyllus [carnation]
gb|AFH56407.1|  EIN3-like protein EIL1                                  152   5e-39   Diospyros kaki [Japanese persimmon]
ref|XP_003638449.1|  Ethylene insensitive 3-like protein                152   5e-39   
gb|ACX54782.1|  ethylene insensitive-like protein 1                     152   5e-39   Medicago truncatula
gb|KHG00335.1|  ethylene insensitive 3 -like protein                    150   6e-39   Gossypium arboreum [tree cotton]
gb|AGI41323.1|  EIN3-like protein                                       152   6e-39   Malus domestica [apple tree]
gb|AEK84143.1|  ethylene insensitive 3-like protein                     152   7e-39   Oncidium hybrid cultivar
gb|ABG89103.1|  ethylene insensitive-like protein 4                     152   9e-39   Musa acuminata [banana]
ref|XP_010943654.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    152   9e-39   
ref|XP_009404687.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    151   9e-39   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY27563.1|  BnaC01g32460D                                          151   9e-39   Brassica napus [oilseed rape]
gb|AHA93899.1|  ethylene insensitive 3                                  151   1e-38   Coffea arabica [arabica coffee]
dbj|BAF44109.1|  ethylene signal transcription factor                   151   1e-38   Musa acuminata AAA Group [Cavendish banana]
ref|XP_001766792.1|  EIN3a transcription factor                         146   1e-38   
ref|XP_008809629.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    151   1e-38   Phoenix dactylifera
dbj|BAI44821.1|  ethylene insensitive 3-like                            151   1e-38   Daucus carota [carrots]
gb|AAV68140.1|  ethylene insensitive 3-like 2                           151   1e-38   Dianthus caryophyllus [carnation]
gb|AIS20827.1|  EIL                                                     150   2e-38   Pyrus x bretschneideri [bai li]
gb|KDO53815.1|  hypothetical protein CISIN_1g007174mg                   150   2e-38   Citrus sinensis [apfelsine]
ref|XP_006432540.1|  hypothetical protein CICLE_v10000617mg             150   2e-38   Citrus clementina [clementine]
dbj|BAB78462.2|  ethylene-insensitive-3-like protein                    150   2e-38   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049978.1|  Os03g0324300                                       150   2e-38   
ref|XP_008231880.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    150   2e-38   Prunus mume [ume]
ref|XP_009595535.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    150   2e-38   Nicotiana tomentosiformis
gb|AAZ78349.1|  EIN3-like protein 1                                     150   3e-38   Oryza sativa Japonica Group [Japonica rice]
gb|ADZ97022.2|  EIL6                                                    150   3e-38   Nicotiana tabacum [American tobacco]
gb|ABF95697.1|  ETHYLENE-INSENSITIVE3-like 1 protein, putative, e...    150   3e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001753917.1|  EIN3b transcription factor                         145   3e-38   
ref|XP_007218956.1|  hypothetical protein PRUPE_ppa003550mg             150   3e-38   
gb|EAY89823.1|  hypothetical protein OsI_11369                          150   3e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_009355361.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    150   4e-38   Pyrus x bretschneideri [bai li]
gb|AFI61909.1|  ethylene insensitive 3-like 3 protein                   150   4e-38   Paeonia suffruticosa [moutan peony]
ref|XP_010544313.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     149   4e-38   Tarenaya hassleriana [spider flower]
ref|XP_008368189.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    150   4e-38   
ref|XP_011629273.1|  PREDICTED: LOW QUALITY PROTEIN: ETHYLENE INS...    149   5e-38   
gb|ERM97264.1|  hypothetical protein AMTR_s00119p00117410               149   6e-38   Amborella trichopoda
ref|XP_011091876.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     149   6e-38   
gb|EMT14050.1|  Protein ETHYLENE INSENSITIVE 3                          149   7e-38   
ref|NP_001146219.1|  uncharacterized protein LOC100279789               149   7e-38   Zea mays [maize]
gb|AGY30671.1|  ethylene insensitive 3                                  149   8e-38   Saccharum hybrid cultivar [sugarcane]
ref|XP_006650014.1|  PREDICTED: LOW QUALITY PROTEIN: ETHYLENE INS...    149   8e-38   Oryza brachyantha
gb|AGE45505.1|  ethylene insensitive like protein                       149   8e-38   Musa acuminata AAA Group [Cavendish banana]
dbj|BAJ95094.1|  predicted protein                                      149   9e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001152035.1|  ETHYLENE-INSENSITIVE3-like 1 protein               149   9e-38   
ref|XP_010067064.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    149   9e-38   Eucalyptus grandis [rose gum]
gb|ACN31333.1|  unknown                                                 149   9e-38   Zea mays [maize]
ref|XP_009402439.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    149   9e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN27664.1|  unknown                                                 149   1e-37   Zea mays [maize]
gb|AFU90136.4|  ethylene-insensitive 3                                  149   1e-37   Paeonia lactiflora [common garden peony]
ref|XP_009420955.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    149   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAF44108.1|  ethylene signal transcription factor                   149   1e-37   Musa acuminata AAA Group [Cavendish banana]
gb|AAV68142.1|  ethylene insensitive 3-like 4                           149   1e-37   Dianthus caryophyllus [carnation]
ref|XP_004984528.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     149   1e-37   Setaria italica
ref|XP_010106127.1|  Protein ETHYLENE INSENSITIVE 3                     148   1e-37   Morus notabilis
ref|XP_002467935.1|  hypothetical protein SORBIDRAFT_01g036740          148   1e-37   Sorghum bicolor [broomcorn]
ref|XP_003558012.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    148   2e-37   Brachypodium distachyon [annual false brome]
gb|ACM89299.1|  EIN3-like protein EIL1                                  147   2e-37   Eriobotrya japonica [loquat]
ref|XP_009414231.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    147   2e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEK84144.1|  ethylene insensitive 3-like protein                     147   3e-37   Oncidium hybrid cultivar
ref|XP_010106128.1|  Protein ETHYLENE INSENSITIVE 3                     147   3e-37   
gb|EYU26910.1|  hypothetical protein MIMGU_mgv1a026901mg                147   3e-37   Erythranthe guttata [common monkey flower]
ref|XP_010557481.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     146   4e-37   Tarenaya hassleriana [spider flower]
gb|EPS63662.1|  hypothetical protein M569_11122                         146   4e-37   Genlisea aurea
gb|AAY45886.1|  EIN3-like protein                                       141   5e-37   Citrullus lanatus [wild melon]
ref|XP_002980161.1|  hypothetical protein SELMODRAFT_112063             141   6e-37   
ref|XP_009384965.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     146   7e-37   
ref|NP_001234546.1|  EIL3 protein                                       145   1e-36   Solanum lycopersicum
ref|XP_010544311.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     145   1e-36   Tarenaya hassleriana [spider flower]
ref|XP_002463411.1|  hypothetical protein SORBIDRAFT_02g043350          145   1e-36   
ref|XP_009609268.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     139   1e-36   Nicotiana tomentosiformis
ref|XP_009389151.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    145   1e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006347695.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     145   2e-36   Solanum tuberosum [potatoes]
ref|XP_008653495.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     144   2e-36   Zea mays [maize]
ref|XP_009406830.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    145   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN33326.1|  ETHYLENE INSENSITIVE 3-like 3 protein                   144   3e-36   Glycine soja [wild soybean]
gb|AAP04001.1|  EIL5                                                    144   4e-36   Nicotiana tabacum [American tobacco]
ref|XP_009759370.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    144   4e-36   Nicotiana sylvestris
ref|XP_002445904.1|  hypothetical protein SORBIDRAFT_07g027790          144   6e-36   Sorghum bicolor [broomcorn]
ref|XP_002299248.2|  ETHYLENE-INSENSITIVE3-like 3 family protein        143   7e-36   Populus trichocarpa [western balsam poplar]
ref|XP_011037881.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    143   7e-36   Populus euphratica
gb|ACR38732.1|  unknown                                                 143   7e-36   Zea mays [maize]
ref|NP_001060678.1|  Os07g0685700                                       143   8e-36   
gb|EEC82710.1|  hypothetical protein OsI_27382                          143   8e-36   Oryza sativa Indica Group [Indian rice]
emb|CDP16004.1|  unnamed protein product                                143   8e-36   Coffea canephora [robusta coffee]
ref|XP_006597241.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    142   1e-35   Glycine max [soybeans]
gb|KHN30114.1|  ETHYLENE INSENSITIVE 3-like 3 protein                   142   1e-35   Glycine soja [wild soybean]
ref|XP_003543551.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    142   1e-35   Glycine max [soybeans]
ref|XP_004958734.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    142   2e-35   Setaria italica
ref|XP_009788578.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    142   2e-35   Nicotiana sylvestris
ref|XP_009788577.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    142   2e-35   Nicotiana sylvestris
ref|XP_009602832.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    142   2e-35   Nicotiana tomentosiformis
ref|XP_009602831.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    142   3e-35   Nicotiana tomentosiformis
ref|XP_009364709.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    141   3e-35   
ref|XP_009364731.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    141   3e-35   Pyrus x bretschneideri [bai li]
ref|XP_007150399.1|  hypothetical protein PHAVU_005G150100g             141   3e-35   Phaseolus vulgaris [French bean]
ref|XP_004295232.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    141   3e-35   Fragaria vesca subsp. vesca
ref|XP_008384462.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    141   3e-35   
ref|XP_011660117.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    141   4e-35   Cucumis sativus [cucumbers]
ref|XP_007220648.1|  hypothetical protein PRUPE_ppa003493mg             140   5e-35   
ref|XP_003597476.1|  ETHYLENE INSENSITIVE 3-like 3 protein              141   5e-35   Medicago truncatula
emb|CDP14093.1|  unnamed protein product                                141   5e-35   Coffea canephora [robusta coffee]
ref|XP_008450447.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    140   5e-35   Cucumis melo [Oriental melon]
gb|KHG30097.1|  ethylene insensitive 3-like 3 protein                   140   6e-35   Gossypium arboreum [tree cotton]
ref|XP_006850080.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    140   6e-35   Amborella trichopoda
ref|XP_006445977.1|  hypothetical protein CICLE_v10015261mg             139   6e-35   Citrus clementina [clementine]
ref|XP_010091992.1|  ETHYLENE INSENSITIVE 3-like 3 protein              140   7e-35   Morus notabilis
ref|XP_002513449.1|  ETHYLENE-INSENSITIVE3 protein, putative            140   8e-35   
ref|XP_004486935.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    140   8e-35   Cicer arietinum [garbanzo]
ref|XP_009391830.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    140   8e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006659571.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    140   9e-35   
emb|CAC09582.1|  ethylene insensitive (EIN3/EIL)-like transcripti...    140   9e-35   Fagus sylvatica
gb|EEC83849.1|  hypothetical protein OsI_29816                          135   1e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_012092781.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    139   1e-34   Jatropha curcas
ref|XP_010257394.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    139   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_006494725.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    139   1e-34   Citrus sinensis [apfelsine]
ref|XP_010257396.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    139   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_004973869.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    139   2e-34   Setaria italica
ref|XP_011025257.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    139   2e-34   Populus euphratica
ref|XP_008349446.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    139   2e-34   
emb|CBI16427.3|  unnamed protein product                                139   2e-34   Vitis vinifera
ref|NP_001151957.1|  ethylene-insensitive3-like protein                 139   2e-34   Zea mays [maize]
ref|XP_008670668.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    139   2e-34   Zea mays [maize]
ref|XP_010651274.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    139   2e-34   
ref|XP_008366164.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    139   2e-34   
gb|KJB55329.1|  hypothetical protein B456_009G071400                    139   2e-34   Gossypium raimondii
ref|XP_009374861.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    139   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_006386099.1|  hypothetical protein POPTR_0003s22090g             139   2e-34   
ref|XP_002285571.2|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    139   2e-34   
ref|XP_008354838.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     139   3e-34   
ref|XP_008797493.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    139   3e-34   
gb|ACD87814.1|  putative ethylene insensitive transcription factor      139   3e-34   
ref|XP_010044996.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    139   3e-34   
ref|XP_008798325.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    138   3e-34   
gb|AFI61907.1|  ethylene insensitive 3-like 1 protein                   138   4e-34   
gb|AID55346.1|  EIN3-like protein EIL4                                  139   4e-34   
emb|CAC87091.1|  ethylene-insensitive 3 protein                         138   4e-34   
gb|EYU40168.1|  hypothetical protein MIMGU_mgv1a022392mg                132   5e-34   
gb|KJB66132.1|  hypothetical protein B456_010G128700                    139   6e-34   
ref|XP_007014914.1|  Ethylene-insensitive 3f isoform 1                  137   7e-34   
ref|XP_008450448.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    137   8e-34   
gb|EYU18012.1|  hypothetical protein MIMGU_mgv1a002702mg                138   8e-34   
emb|CDY60137.1|  BnaA07g39030D                                          137   9e-34   
ref|XP_009106032.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    137   9e-34   
ref|XP_010926635.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    137   9e-34   
ref|XP_002979886.1|  hypothetical protein SELMODRAFT_16064              132   1e-33   
ref|NP_001062198.1|  Os08g0508700                                       137   1e-33   
ref|XP_011090401.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    138   1e-33   
ref|XP_010924320.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    137   1e-33   
ref|XP_009104797.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    136   1e-33   
gb|EYU40148.1|  hypothetical protein MIMGU_mgv1a023186mg                130   1e-33   
gb|AID55347.1|  EIN3-like protein EIL4                                  137   2e-33   
emb|CDY11093.1|  BnaC06g23450D                                          136   2e-33   
ref|XP_009355062.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     136   2e-33   
ref|XP_009417872.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    135   4e-33   
gb|EMS51390.1|  ETHYLENE INSENSITIVE 3-like 3 protein                   136   4e-33   
dbj|BAJ95390.1|  predicted protein                                      135   4e-33   
ref|XP_010519194.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    135   5e-33   
ref|XP_009419168.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    135   5e-33   
ref|XP_009415423.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    135   6e-33   
ref|XP_010688276.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    135   6e-33   
dbj|BAF44107.1|  ethylene signal transcription factor                   135   6e-33   
gb|EPS63427.1|  ethylene-insensitive 3f                                 135   6e-33   
gb|ACJ70676.1|  EIN3-like protein EIL3                                  135   8e-33   
ref|NP_177514.1|  ethylene insensitive 3-like 3 protein                 134   9e-33   
ref|XP_010265828.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    134   1e-32   
ref|XP_002888943.1|  hypothetical protein ARALYDRAFT_895235             134   1e-32   
ref|XP_007208306.1|  hypothetical protein PRUPE_ppa003113mg             134   1e-32   
ref|XP_008243598.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    134   1e-32   
gb|ABK35085.1|  EIL1                                                    134   1e-32   
ref|XP_004957192.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    134   1e-32   
ref|XP_006660770.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    134   1e-32   
gb|ADO21118.1|  ethylene insensitive-like 1                             134   1e-32   
ref|XP_009391636.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    134   1e-32   
dbj|BAK02286.1|  predicted protein                                      134   1e-32   
dbj|BAF44110.1|  ethylene signal transcription factor                   134   1e-32   
ref|XP_009128008.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    133   1e-32   
ref|XP_010428309.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    134   1e-32   
ref|XP_010471440.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    134   1e-32   
ref|XP_006302057.1|  hypothetical protein CARUB_v10020043mg             134   2e-32   
ref|XP_010416192.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    134   2e-32   
gb|AID55345.1|  EIN3-like protein EIL3                                  134   2e-32   
emb|CDY47740.1|  BnaA02g16550D                                          133   2e-32   
ref|XP_006390517.1|  hypothetical protein EUTSA_v10018327mg             133   3e-32   
emb|CDX73009.1|  BnaC06g34570D                                          133   3e-32   
ref|NP_001063537.1|  Os09g0490200                                       132   3e-32   
ref|XP_009339243.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    134   4e-32   
gb|EAZ45191.1|  hypothetical protein OsJ_29834                          132   5e-32   
ref|XP_002299246.2|  hypothetical protein POPTR_0001s05370g             132   6e-32   
ref|XP_010554461.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    132   7e-32   
ref|XP_003578327.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    132   7e-32   
gb|EMT14735.1|  ETHYLENE INSENSITIVE 3-like 3 protein                   132   1e-31   
gb|KGN46075.1|  hypothetical protein Csa_6G051520                       130   1e-31   
ref|XP_006355383.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    130   1e-31   
ref|XP_010537473.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    131   1e-31   
ref|XP_012092827.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    127   1e-31   
ref|XP_010537472.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    131   1e-31   
ref|XP_008358875.1|  PREDICTED: LOW QUALITY PROTEIN: ETHYLENE INS...    130   1e-31   
ref|XP_008650967.1|  PREDICTED: uncharacterized protein LOC100216...    131   2e-31   
ref|XP_010315880.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    131   2e-31   
ref|XP_009378550.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    130   2e-31   
gb|EAZ09571.1|  hypothetical protein OsI_31850                          130   2e-31   
gb|KDP46866.1|  hypothetical protein JCGZ_24075                         128   2e-31   
ref|XP_002462568.1|  hypothetical protein SORBIDRAFT_02g028390          130   3e-31   
ref|XP_002262659.2|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    129   3e-31   
ref|XP_009339244.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    132   3e-31   
gb|EMS55080.1|  ETHYLENE INSENSITIVE 3-like 3 protein                   130   6e-31   
ref|XP_003574748.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    129   6e-31   
gb|KHG04256.1|  ethylene insensitive 3-like 3 protein                   123   9e-31   
ref|XP_008375510.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     128   1e-30   
ref|XP_012064823.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    127   1e-30   
ref|XP_009792280.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    127   1e-30   
ref|XP_009622228.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    126   4e-30   
ref|XP_002993821.1|  hypothetical protein SELMODRAFT_449237             126   6e-30   
ref|XP_010090542.1|  Putative ETHYLENE INSENSITIVE 3-like 4 protein     125   7e-30   
ref|XP_007159632.1|  hypothetical protein PHAVU_002G253900g             124   2e-29   
gb|KJB18267.1|  hypothetical protein B456_003G043500                    124   3e-29   
gb|KJB83500.1|  hypothetical protein B456_013G250300                    122   3e-29   
ref|XP_003601983.1|  Ethylene insensitive-like protein                  123   3e-29   
ref|XP_009410464.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    125   4e-29   
ref|XP_004235464.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    123   4e-29   
gb|KJB83499.1|  hypothetical protein B456_013G250300                    122   5e-29   
ref|XP_002980165.1|  hypothetical protein SELMODRAFT_419761             124   7e-29   
ref|XP_003523907.2|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    125   8e-29   
ref|XP_003532834.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 5 pro...    122   1e-28   
ref|XP_011090514.1|  PREDICTED: LOW QUALITY PROTEIN: putative ETH...    122   1e-28   
gb|KHN38189.1|  Putative ETHYLENE INSENSITIVE 3-like 4 protein          120   1e-28   
gb|KHN29080.1|  ETHYLENE INSENSITIVE 3-like 5 protein                   122   1e-28   
ref|XP_008234872.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 5 pro...    121   1e-28   
ref|XP_009345481.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    121   2e-28   
ref|XP_004502508.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 5 pro...    121   2e-28   
ref|XP_006464249.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    121   3e-28   
ref|XP_006428161.1|  hypothetical protein CICLE_v10027510mg             121   3e-28   
ref|XP_007163637.1|  hypothetical protein PHAVU_001G251100g             120   3e-28   
ref|XP_010319747.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    120   4e-28   
ref|XP_002533137.1|  transcription factor, putative                     120   5e-28   
ref|XP_003525064.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    120   5e-28   
gb|AAG00419.1|AF247568_1  EIN3                                          115   5e-28   
gb|AFO38384.1|  putative ethylene insensitive 3-like 4 protein          119   6e-28   
gb|KHN26429.1|  ETHYLENE INSENSITIVE 3-like 1 protein                   122   7e-28   
ref|XP_010673484.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    119   1e-27   
gb|KHN44331.1|  ETHYLENE INSENSITIVE 3-like 1 protein                   117   1e-27   
ref|XP_008361490.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    118   1e-27   
gb|EYU31029.1|  hypothetical protein MIMGU_mgv1a021326mg                117   1e-27   
ref|XP_003526359.1|  PREDICTED: probable basic-leucine zipper tra...    120   2e-27   
gb|KHN26432.1|  Protein ETHYLENE INSENSITIVE 3                          120   2e-27   
ref|XP_006601939.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 5 pro...    118   3e-27   
emb|CDX81161.1|  BnaC03g04150D                                          114   3e-27   
ref|XP_011457546.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    116   3e-27   
gb|KHN31360.1|  ETHYLENE INSENSITIVE 3-like 5 protein                   118   3e-27   
gb|AAR08677.1|  EIL1                                                    119   3e-27   
gb|KHN02610.1|  ETHYLENE INSENSITIVE 3-like 1 protein                   120   4e-27   
ref|XP_007206277.1|  hypothetical protein PRUPE_ppa016118mg             117   7e-27   
ref|XP_010527327.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     116   1e-26   
gb|KCW54472.1|  hypothetical protein EUGRSUZ_I00420                     116   1e-26   
ref|XP_004499747.1|  PREDICTED: uncharacterized protein LOC101509307    118   2e-26   
ref|XP_009780540.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    116   2e-26   
ref|XP_010030420.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    116   2e-26   
ref|XP_009780539.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    116   2e-26   
gb|KGN53219.1|  hypothetical protein Csa_4G028430                       114   2e-26   
gb|ACK44513.1|  AT5G10120-like protein                                  115   3e-26   
ref|XP_002871406.1|  ethylene insensitive 3 family protein              115   3e-26   
ref|XP_008453800.1|  PREDICTED: LOW QUALITY PROTEIN: putative ETH...    115   4e-26   
ref|XP_007048002.1|  Transcription factor, putative                     114   4e-26   
gb|ADD09616.1|  ethylene insensitive-like protein                       114   5e-26   
gb|ABG89102.1|  ethylene insensitive-like protein 3                     115   5e-26   
ref|XP_006287753.1|  hypothetical protein CARUB_v10000964mg             114   6e-26   
ref|XP_006366537.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    114   6e-26   
ref|XP_009125328.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    114   8e-26   
emb|CDX85778.1|  BnaA02g00350D                                          114   8e-26   
ref|XP_010491666.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    114   9e-26   
ref|XP_003630065.1|  Ethylene insensitive-like protein                  114   9e-26   
ref|XP_004146925.2|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    114   9e-26   
gb|AET04541.2|  ethylene insensitive protein                            113   1e-25   
ref|XP_010453034.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    113   1e-25   
gb|ADD09594.1|  ethylene insensitive-like protein                       113   1e-25   
emb|CDX78369.1|  BnaA03g02810D                                          112   1e-25   
ref|XP_009366398.1|  PREDICTED: LOW QUALITY PROTEIN: ETHYLENE INS...    112   1e-25   
ref|XP_010422888.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    113   1e-25   
ref|NP_196574.1|  putative ethylene insensitive 3-like 4 protein        112   2e-25   
gb|KJB44228.1|  hypothetical protein B456_007G241000                    112   2e-25   
gb|ABG89100.1|  ethylene insensitive-like protein 1                     113   2e-25   
dbj|BAD07669.1|  putative transcription factor EIL1                     112   3e-25   
ref|XP_002871968.1|  hypothetical protein ARALYDRAFT_351206             112   3e-25   
ref|XP_009131144.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    111   5e-25   
emb|CDY40078.1|  BnaC02g00520D                                          111   6e-25   
ref|XP_010931518.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    113   7e-25   
ref|XP_004504054.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...    111   7e-25   
ref|XP_008807367.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 3 pro...    110   1e-24   
emb|CDY09099.1|  BnaA02g05250D                                          109   2e-24   
emb|CDY14539.1|  BnaC03g49200D                                          109   2e-24   
ref|XP_006399502.1|  hypothetical protein EUTSA_v10015634mg             109   2e-24   
ref|XP_010923033.1|  PREDICTED: uncharacterized protein LOC105046219    111   2e-24   
ref|XP_002866649.1|  ethylene insensitive 3 family protein              110   3e-24   
emb|CDY08821.1|  BnaA06g24030D                                          108   3e-24   
ref|XP_003619645.1|  Ethylene insensitive 3-like protein                111   3e-24   
ref|XP_007148764.1|  hypothetical protein PHAVU_005G012200g             110   4e-24   
ref|XP_010444484.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 5 pro...    110   4e-24   
ref|XP_006281975.1|  hypothetical protein CARUB_v10028199mg             110   4e-24   
ref|XP_010484313.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 5 pro...    109   5e-24   
ref|NP_201315.1|  Ethylene insensitive 3 family protein                 110   5e-24   
gb|ACQ44230.1|  putative ethylene insensitive 3 protein                 108   6e-24   
gb|EYU31028.1|  hypothetical protein MIMGU_mgv1a024437mg                107   6e-24   
ref|NP_197611.1|  ethylene insensitive 3-like 2 protein                 108   8e-24   
ref|XP_009150591.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 5 pro...    108   9e-24   
gb|KEH26454.1|  ethylene insensitive 3 family protein                   109   1e-23   
ref|XP_008792546.1|  PREDICTED: uncharacterized protein LOC103709120    109   1e-23   
ref|XP_009126501.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 2 pro...    108   1e-23   
gb|KFK25305.1|  hypothetical protein AALP_AA8G095300                    107   1e-23   
ref|XP_006394078.1|  hypothetical protein EUTSA_v10005551mg             108   1e-23   
gb|AAY15109.1|  EIN3-2                                                  103   2e-23   
ref|XP_006287498.1|  hypothetical protein CARUB_v10000708mg             107   3e-23   
gb|KDO56618.1|  hypothetical protein CISIN_1g038853mg                   106   3e-23   
gb|ADW95824.1|  transcription factor EIN3                               100   4e-23   
ref|XP_006400682.1|  hypothetical protein EUTSA_v10013166mg             107   5e-23   
ref|XP_010090543.1|  Putative ETHYLENE INSENSITIVE 3-like 4 protein     106   1e-22   
gb|EYU31027.1|  hypothetical protein MIMGU_mgv1a018817mg                103   1e-22   
emb|CDY59518.1|  BnaCnng35080D                                          104   3e-22   
gb|ABG89101.1|  ethylene insensitive-like protein 2                     104   3e-22   
ref|XP_003572647.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 5 pro...    103   4e-22   
gb|AFW62710.1|  hypothetical protein ZEAMMB73_724869                    103   5e-22   
ref|XP_008678720.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 5 pro...    103   5e-22   
gb|ACD43364.1|  transcription factor                                  99.8    6e-22   
gb|EYU31026.1|  hypothetical protein MIMGU_mgv1a022427mg                101   6e-22   
ref|NP_001173118.1|  Os02g0689132                                     96.7    7e-22   
emb|CDX92408.1|  BnaA10g14470D                                          103   9e-22   
ref|XP_009120725.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 2 pro...    102   1e-21   
gb|KFK28195.1|  hypothetical protein AALP_AA8G484700                    101   1e-21   
gb|AAL14267.1|  EIN3-like transcription factor                        96.7    3e-21   
ref|XP_010454435.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 2 pro...    101   3e-21   
ref|XP_009387670.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     101   4e-21   
gb|EEC78449.1|  hypothetical protein OsI_18311                          100   5e-21   
gb|EEE57239.1|  hypothetical protein OsJ_07233                          100   6e-21   
gb|ACA04846.1|  EIN3-like protein                                     97.1    7e-21   
emb|CDY70411.1|  BnaCnng68230D                                        96.3    7e-21   
ref|XP_010493232.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 2 pro...    100   8e-21   
ref|XP_010420961.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 2 pro...    100   1e-20   
emb|CDM85328.1|  unnamed protein product                              99.4    1e-20   
ref|XP_010493230.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 2 pro...    100   1e-20   
dbj|BAK05002.1|  predicted protein                                    99.4    2e-20   
emb|CAH67021.1|  H0523F07.9                                           98.2    2e-20   
gb|EAZ30951.1|  hypothetical protein OsJ_15028                        98.6    2e-20   
emb|CAD40887.2|  OSJNBa0036B21.5                                      98.6    2e-20   
gb|EMT18044.1|  ETHYLENE INSENSITIVE 3-like 5 protein                 98.6    2e-20   
gb|EMT09903.1|  ETHYLENE INSENSITIVE 3-like 5 protein                 98.2    3e-20   
ref|XP_002452325.1|  hypothetical protein SORBIDRAFT_04g023730        99.0    3e-20   
gb|EAY86389.1|  hypothetical protein OsI_07768                        99.0    3e-20   
ref|XP_004955019.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 5 pro...  98.2    4e-20   



>gb|AAP03999.1| EIL3 [Nicotiana tabacum]
Length=300

 Score =   174 bits (441),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 126/160 (79%), Gaps = 9/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMFDDM FC DLD F APLKE           + E      V+DDYSD+E+D++ELERR
Sbjct  1    MMMFDDMRFCGDLDFFSAPLKE-----VEAAAPQTEPEPEPVVDDDYSDEEIDVDELERR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKMKLKRLKEM+KSKEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDKMKLKRLKEMTKSKEGVDPA----KHRQSQEQARRKKMSRAQDGILKYMLKMMEVC  111

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV GASDNLREWWKDKVRFD NGPA
Sbjct  112  KAQGFVYGIIPEKGKPVGGASDNLREWWKDKVRFDRNGPA  151



>dbj|BAA74714.1| transcription factor TEIL [Nicotiana tabacum]
Length=615

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 128/160 (80%), Gaps = 8/160 (5%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGFC DLD F APLKE          ++ E      ++DDYSD+E+D++ELERR
Sbjct  1    MMMFEEMGFCGDLDFFPAPLKE-----VETAASQIEQESEPVMDDDYSDEEIDVDELERR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKMKLKRLKEM+K  +   +   +R+   SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDKMKLKRLKEMTKGGKEGVDAVKQRQ---SQEQARRKKMSRAQDGILKYMLKMMEVC  112

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  113  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  152



>ref|XP_009801714.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana sylvestris]
 gb|AAP03998.1| EIL2 [Nicotiana tabacum]
Length=616

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 128/160 (80%), Gaps = 8/160 (5%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGFC DLD F APLKE          ++ E      ++DDYSD+E+D++ELERR
Sbjct  1    MMMFEEMGFCGDLDFFPAPLKE-----VETAASQIEQESEPVMDDDYSDEEIDVDELERR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKMKLKRLKEM+K  +   +   +R+   SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDKMKLKRLKEMTKGGKEGVDAVKQRQ---SQEQARRKKMSRAQDGILKYMLKMMEVC  112

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  113  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  152



>ref|XP_009587969.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana tomentosiformis]
 gb|AAP03997.1| EIL1 [Nicotiana tabacum]
Length=618

 Score =   177 bits (449),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 128/160 (80%), Gaps = 6/160 (4%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGFC DLD F APLKE   +       E E      ++DDYSD+E+D++ELERR
Sbjct  1    MMMFEEMGFCGDLDFFPAPLKE---VETAASQIEQEQEQEPVMDDDYSDEEIDVDELERR  57

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKMKLKRLKEM+K  +   +   +R+   SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  58   MWRDKMKLKRLKEMTKGGKEGVDAVKQRQ---SQEQARRKKMSRAQDGILKYMLKMMEVC  114

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  115  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  154



>ref|NP_001234541.1| EIL1 protein [Solanum lycopersicum]
 gb|AAK58857.1|AF328784_1 EIL1 [Solanum lycopersicum]
Length=610

 Score =   177 bits (448),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 124/160 (78%), Gaps = 8/160 (5%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGFC DLD F APLKE    V             V  +D   ++E++++ELERR
Sbjct  1    MMMFEEMGFCGDLDFFPAPLKE----VEVSAPQSQTEPDSVVDDDYSDEEEIEVDELERR  56

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKMKLKRLKEMSKSKEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  57   MWRDKMKLKRLKEMSKSKEGVDPA----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC  112

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFD NGPA
Sbjct  113  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDRNGPA  152



>ref|XP_006361129.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006361130.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Solanum 
tuberosum]
Length=616

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 124/160 (78%), Gaps = 6/160 (4%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGFC DLD F APLKE    V             V  +D   ++E+D++ELERR
Sbjct  1    MMMFEEMGFCGDLDFFPAPLKEV--EVEVAAPQSQTEPDSVVDDDYSDEEEIDVDELERR  58

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKMKLKRLKEMSKSKEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  59   MWRDKMKLKRLKEMSKSKEGVDPA----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC  114

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFD NGPA
Sbjct  115  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDRNGPA  154



>emb|CDP19134.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 121/160 (76%), Gaps = 9/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMFDD+GFC DL+ F APLKE AD V P    E +  V  +  D+  D +       RR
Sbjct  1    MMMFDDIGFCGDLEFFSAPLKE-ADSVTPQAEPESDPVVDDDYTDEEIDVDELE----RR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKEM+K K+G      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDKMRLKRLKEMNKGKDGVDVAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  111

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFD NGPA
Sbjct  112  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDRNGPA  151



>ref|XP_009607986.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana tomentosiformis]
 ref|XP_009607987.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana tomentosiformis]
Length=615

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 126/160 (79%), Gaps = 9/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMFDDM FC DLD F APLKE           + E      V+DDYSD+E+D++ELERR
Sbjct  1    MMMFDDMRFCGDLDFFSAPLKE-----VEAAAPQTEPEPEPVVDDDYSDEEIDVDELERR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKMKLKRLKEM+KSKEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDKMKLKRLKEMTKSKEGVDPA----KHRQSQEQARRKKMSRAQDGILKYMLKMMEVC  111

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV GASDNLREWWKDKVRFD NGPA
Sbjct  112  KAQGFVYGIIPEKGKPVGGASDNLREWWKDKVRFDRNGPA  151



>gb|AAP04000.1| EIL4 [Nicotiana tabacum]
Length=603

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 127/160 (79%), Gaps = 9/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGFC DLD F APLKE             E    + V+DDYSD+E+DM+ELERR
Sbjct  1    MMMFEEMGFCGDLDFFPAPLKE-----VEVAAPHTEPEPELVVDDDYSDEEIDMDELERR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKMKLKRLKEM+KSKEG      ++    SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDKMKLKRLKEMTKSKEGVDPAKHRQ----SQEQARRKKMSRAQDGILKYMLKMMEVC  111

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV GASDNLREWWKDKVRFD NGPA
Sbjct  112  KAQGFVYGIIPEKGKPVGGASDNLREWWKDKVRFDRNGPA  151



>ref|XP_009607827.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana tomentosiformis]
 ref|XP_009607828.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana tomentosiformis]
Length=600

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 126/160 (79%), Gaps = 9/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMFDDM FC DLD F APLKE           + E      V+DDYSD+E+D++ELERR
Sbjct  1    MMMFDDMRFCGDLDFFSAPLKE-----VEAAAPQTEPEPEPVVDDDYSDEEIDVDELERR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKMKLKRLKEM+KSKEG      ++    SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDKMKLKRLKEMTKSKEGVDPAKHRQ----SQEQARRKKMSRAQDGILKYMLKMMEVC  111

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV GASDNLREWWKDKVRFD NGPA
Sbjct  112  KAQGFVYGIIPEKGKPVGGASDNLREWWKDKVRFDRNGPA  151



>ref|XP_009798829.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
 ref|XP_009798831.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
Length=603

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 127/160 (79%), Gaps = 9/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGFC DLD F APLKE             E    + V+DDYSD+E+DM+ELERR
Sbjct  1    MMMFEEMGFCGDLDFFPAPLKE-----VEVAAPHTEPKPELVVDDDYSDEEIDMDELERR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKMKLKRLKEM+KSKEG      ++    SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDKMKLKRLKEMTKSKEGVDPAKHRQ----SQEQARRKKMSRAQDGILKYMLKMMEVC  111

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV GASDNLREWWKDKVRFD NGPA
Sbjct  112  KAQGFVYGIIPEKGKPVGGASDNLREWWKDKVRFDRNGPA  151



>gb|KHG04095.1| ethylene insensitive 3 -like protein [Gossypium arboreum]
Length=469

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 128/164 (78%), Gaps = 10/164 (6%)
 Frame = +2

Query  209  LGLKMMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmee  388
            LG+ MMMFDDMG C D+D F AP  E          A   A+    VEDDYSD+E+D++E
Sbjct  24   LGI-MMMFDDMGICGDMDFFSAPFGE-----KDAATATLAASHAEPVEDDYSDEEIDVDE  77

Query  389  leRRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKM  568
            LERRMWRDKM+LKRLKE +KSK+G      +    +SQEQAR+KKMSRAQDGILKYMLKM
Sbjct  78   LERRMWRDKMRLKRLKEQNKSKDGVDIVKQR----QSQEQARKKKMSRAQDGILKYMLKM  133

Query  569  MEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MEVCKAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  134  MEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  177



>ref|XP_006364491.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Solanum tuberosum]
Length=614

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 127/160 (79%), Gaps = 9/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF+D+GFC DLD F APLKE     A    A P       ++DD SD+E+D++ELE+R
Sbjct  1    MMMFEDIGFCGDLDFFPAPLKE-----AETVAAVPLIEPEPMMDDDDSDEEIDVDELEKR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKMKLKRLKEMSK KEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDKMKLKRLKEMSKGKEGVDAV----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC  111

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  112  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  151



>ref|XP_003555660.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
 gb|KHN46383.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=624

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 125/160 (78%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF+DMGFC DLD F APL E             +    V VEDDYSD+E+D++ELERR
Sbjct  1    MMMFEDMGFCGDLDMFSAPLGE-------GDITTRQTEPEVIVEDDYSDEEIDVDELERR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE SK KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   MWRDKMRLKRLKEQSKPKEGIDAVKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  149



>ref|NP_001234721.1| EIL2 protein [Solanum lycopersicum]
 gb|AAK58858.1|AF328785_1 EIL2 [Solanum lycopersicum]
Length=614

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 127/160 (79%), Gaps = 9/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF+D+GFC DLD F APLKE     A    A P       ++DD SD+E+D++ELE+R
Sbjct  1    MMMFEDIGFCADLDFFPAPLKE-----AETVAAVPPIVPEPMMDDDDSDEEIDVDELEKR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKMKLKRLKEMSK KEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDKMKLKRLKEMSKGKEGVDAV----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC  111

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  112  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  151



>gb|AID55343.1| EIN3-like protein EIL1 [Actinidia chinensis]
Length=620

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 124/160 (78%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MM+FD+MGFC D+D F APL E            P+       +DDYSD+EMD++ELERR
Sbjct  1    MMIFDEMGFCGDVDFFSAPLGE-------GDVTAPQTEQEAVADDDYSDEEMDVDELERR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKEM+K KE       +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   MWRDKMRLKRLKEMTKGKECVDTAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDRNGPA  149



>ref|XP_012066274.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Jatropha curcas]
 ref|XP_012066275.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Jatropha curcas]
 ref|XP_012066276.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Jatropha curcas]
 gb|KDP42896.1| hypothetical protein JCGZ_23838 [Jatropha curcas]
Length=619

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 127/160 (79%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMFD+MGFC+D+D F AP  E          A P+A     VEDDYSD+E D++ELERR
Sbjct  1    MMMFDEMGFCSDMDFFSAPFGE--------DVAAPQAEPEPTVEDDYSDEETDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE +KSKEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDKMRLKRLKEQNKSKEGIDIAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  148



>gb|EYU35998.1| hypothetical protein MIMGU_mgv1a003505mg [Erythranthe guttata]
Length=581

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 122/164 (74%), Gaps = 6/164 (4%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLA-PLKEPADmvapppgaepeaavvveveddysddemdmeeleR  397
            MMMFDDM FC D D F + P+KE AD+ APPP +  E     E +    + ++   E  R
Sbjct  1    MMMFDDMAFCGDFDFFSSVPIKETADLSAPPPQSNNEPDPTEEDDYTDDEIDVYELE--R  58

Query  398  RMWRDKMKLKRLkemskskegegedgakRETNK---SQEQARRKKMSRAQDGILKYMLKM  568
            R+WRDKM+LKRLKE++K KE    +    ++ K   SQEQARRKKMSRAQDGILKYMLKM
Sbjct  59   RVWRDKMRLKRLKELNKGKEVNNSNANTDDSTKQRQSQEQARRKKMSRAQDGILKYMLKM  118

Query  569  MEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MEVCKAQGFVYGIIPEKGKPV GASDNLREWWKDKVRFD NGPA
Sbjct  119  MEVCKAQGFVYGIIPEKGKPVGGASDNLREWWKDKVRFDRNGPA  162



>ref|NP_001233931.1| EIN3-like protein [Solanum lycopersicum]
 dbj|BAC99307.1| EIN3-like protein [Solanum lycopersicum]
Length=605

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 125/160 (78%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGFC DLD F APLKE          A P+      V+DDYSD+++D++ELE+R
Sbjct  1    MMMFEEMGFCGDLDFFPAPLKE-------VEVAAPQTEAEQVVDDDYSDEDIDVDELEKR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            +WRDKMKLKRLKEM++  E       +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   VWRDKMKLKRLKEMNQGMEDVDSVKRR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV GASDNLREWWKDKVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVGGASDNLREWWKDKVRFDRNGPA  149



>gb|ACD87815.1| putative ethylene insensitive transcription factor [Vicia faba]
Length=638

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 124/160 (78%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMFDDMGFC DLD F   L E          +  +      VEDDYSD+EMD++ELERR
Sbjct  1    MMMFDDMGFCGDLDMFCGTLGE-------GDISVRQTEPDSVVEDDYSDEEMDVDELERR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE +K+KEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   MWRDKMRLKRLKEQTKAKEGIDAA----KARQSQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  149



>gb|KDP42895.1| hypothetical protein JCGZ_23837 [Jatropha curcas]
Length=197

 Score =   162 bits (411),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 122/160 (76%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMFD+MGF  D+D F AP  E          A PE      VEDDYSD+E+ ++ELERR
Sbjct  1    MMMFDEMGFLGDMDFFSAPFGEDV--------AGPETEPEPTVEDDYSDEEIYIDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LK LKE  KSKEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDKMRLKWLKEQIKSKEGIDIA----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  148



>gb|AID55344.1| EIN3-like protein EIL2 [Actinidia chinensis]
Length=618

 Score =   171 bits (434),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 126/160 (79%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M+MFD+MGFC DLD F APL E          A P+    V V+DDYSD+E+D++ELERR
Sbjct  1    MIMFDEMGFCGDLDFFSAPLGE-------GDMAAPQTEPEVVVDDDYSDEEIDVDELERR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM LKRLKEM+K KE       +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   MWRDKMLLKRLKEMNKGKECVDAAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDRNGPA  149



>ref|XP_010031647.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Eucalyptus grandis]
 ref|XP_010031648.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Eucalyptus grandis]
 ref|XP_010031649.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Eucalyptus grandis]
 gb|KCW51004.1| hypothetical protein EUGRSUZ_J00631 [Eucalyptus grandis]
Length=611

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 124/160 (78%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF+DMG C DLD F APL E         G   +      VEDDYSD+E+D++ELERR
Sbjct  1    MMMFEDMGICGDLDFFSAPLGE-------GHGVALQTEPEATVEDDYSDEEIDVDELERR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE +K KEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   MWRDKMRLKRLKEQNKGKEGVDIA----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  149



>gb|KHN33829.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=621

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 124/160 (78%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMM +DMGFC DLD F APL E             +    V VEDDYSD+E+D++ELERR
Sbjct  2    MMMLEDMGFCGDLDMFSAPLGE-------GDITARQTEPEVIVEDDYSDEEIDVDELERR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE SK KEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWRDKMRLKRLKEQSKPKEGFDAV----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>ref|XP_006361131.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Solanum tuberosum]
Length=605

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 125/160 (78%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGFC DLD F APLK+          A P+      V+DDYSD+++D++ELE+R
Sbjct  1    MMMFEEMGFCGDLDFFPAPLKD-------VEVAAPQTEAEQVVDDDYSDEDIDVDELEKR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            +WRDKMKLKRLKEM++  E       +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   VWRDKMKLKRLKEMNQGMEDVDSVKRR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV GASDNLREWWKDKVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVGGASDNLREWWKDKVRFDRNGPA  149



>ref|XP_003543159.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
Length=621

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 124/160 (78%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMM +DMGFC DLD F APL E             +    V VEDDYSD+E+D++ELERR
Sbjct  2    MMMLEDMGFCGDLDMFSAPLGE-------GDITARQTEPEVIVEDDYSDEEIDVDELERR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE SK KEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWRDKMRLKRLKEQSKPKEGFDAV----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>ref|XP_009798827.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
 ref|XP_009798828.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
Length=615

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 124/160 (78%), Gaps = 9/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGFC DLD F APLKE             E      ++DDYSD+++D++ELE+R
Sbjct  1    MMMFEEMGFCGDLDFFPAPLKE-----VEVAAPHTELDGEPAMDDDYSDEDIDVDELEKR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            +WRDKMKLKR+KEM++ KE       ++    SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   VWRDKMKLKRMKEMNQGKEDIDSAKRRQ----SQEQARRKKMSRAQDGILKYMLKMMEVC  111

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV GASDNLREWWKDKVRFD NGPA
Sbjct  112  KAQGFVYGIIPEKGKPVGGASDNLREWWKDKVRFDRNGPA  151



>ref|XP_003617086.1| Ethylene insensitive 3-like protein [Medicago truncatula]
 gb|AET00045.1| ethylene insensitive transcription factor [Medicago truncatula]
Length=615

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 124/160 (78%), Gaps = 10/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF+DMGFC DLD F   L E          +  +      VEDDYSD+EMD++ELERR
Sbjct  1    MMMFEDMGFCGDLDVFCGTLGE------GDISSVRQTEPDSVVEDDYSDEEMDVDELERR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE +K+KEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWRDKMRLKRLKEQTKAKEGIDAA----KARQSQEQARRKKMSRAQDGILKYMLKMMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>gb|ACJ70675.1| EIN3-like protein EIL2 [Actinidia deliciosa]
Length=618

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 122/160 (76%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMFD+MGFC DLD   APL +             +      V+DDYSD+EM ++ELERR
Sbjct  1    MMMFDEMGFCGDLDFLSAPLGD-------GDVTASQTEPEAVVDDDYSDEEMGVDELERR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKEM+K KE       +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   MWRDKMRLKRLKEMNKGKECVAAAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLREWWK+KVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVSGASDNLREWWKNKVRFDRNGPA  149



>gb|ACP56697.1| EIN3-like protein [Lithospermum erythrorhizon]
Length=635

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 124/160 (78%), Gaps = 8/160 (5%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGFC D D F A +K+           + E      VEDDYSDDEMD++ELE+R
Sbjct  1    MMMFEEMGFCGDFDFFPAQMKQ-----QDVSAPQDEPESEPGVEDDYSDDEMDVDELEKR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKMKLKRLKEMS   +   +   +R+   SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDKMKLKRLKEMSSKGKECVDAAKQRQ---SQEQARRKKMSRAQDGILKYMLKMMEVC  112

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFD NGPA
Sbjct  113  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDRNGPA  152



>gb|AFI61908.1| ethylene insensitive 3-like 2 protein [Paeonia suffruticosa]
Length=607

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 124/160 (78%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M+MF +MG+C DLD F APL+E          +  +      VED+Y+DDE+D++ELERR
Sbjct  1    MIMFGEMGYCGDLDYFCAPLEE-------KDMSTMQTEPDGTVEDEYTDDEIDVDELERR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE  KSKEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   MWRDKMRLKRLKEQGKSKEGVDSTKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV GASDNLREWWKDKV+FD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVGGASDNLREWWKDKVKFDRNGPA  149



>ref|XP_011080514.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Sesamum indicum]
 ref|XP_011080515.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Sesamum indicum]
Length=616

 Score =   169 bits (427),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 116/160 (73%), Gaps = 9/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF+DMGFC DLD F +   + AD+                 +++   DE++     RR
Sbjct  1    MMMFEDMGFCGDLDFFSSASIKEADVCPLQSAEPEPVVEDDYSDEEIDVDELE-----RR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKEM+K KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDKMRLKRLKEMNKGKEGIDAAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  111

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFD NGPA
Sbjct  112  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDRNGPA  151



>gb|KJB26156.1| hypothetical protein B456_004G227800 [Gossypium raimondii]
 gb|KJB26157.1| hypothetical protein B456_004G227800 [Gossypium raimondii]
Length=614

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 123/160 (77%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMFD+MG C D+D F APL E          A  +      VEDDYSD+E+D++ELERR
Sbjct  1    MMMFDEMGICGDMDFFSAPLGE-------KDVAASQIEPEATVEDDYSDEEIDVDELERR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKR+KE +K KEG      +     SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   MWRDKMRLKRIKEQNKCKEGIDIAKQRL----SQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  149



>gb|KJB20248.1| hypothetical protein B456_003G140600 [Gossypium raimondii]
 gb|KJB20249.1| hypothetical protein B456_003G140600 [Gossypium raimondii]
 gb|KJB20250.1| hypothetical protein B456_003G140600 [Gossypium raimondii]
Length=615

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 124/160 (78%), Gaps = 6/160 (4%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMFDDMG C D+D F AP  E     A    A         VEDDYSD+E+D++ELERR
Sbjct  1    MMMFDDMGICGDMDFFSAPFGE--KDAATATLAALRTEPEATVEDDYSDEEIDVDELERR  58

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE +KSK+G      ++    SQEQAR+KKMSRAQDGILKYMLKMMEVC
Sbjct  59   MWRDKMRLKRLKEQNKSKDGVDIVKQRQ----SQEQARKKKMSRAQDGILKYMLKMMEVC  114

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  115  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  154



>gb|ACJ85584.1| unknown [Medicago truncatula]
 gb|AFK35026.1| unknown [Medicago truncatula]
Length=615

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 124/160 (78%), Gaps = 10/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF+DMGFC DLD F   L E          +  +      VEDDYSD+EMD++ELERR
Sbjct  1    MMMFEDMGFCGDLDVFCGTLGE------GDISSVRQTEPDSVVEDDYSDEEMDVDELERR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE +K+KEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWRDKMRLKRLKEQTKAKEGIDAA----KARQSQEQARRKKMSRAQDGILKYMLKMMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KA+GFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  KARGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>ref|XP_011006497.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Populus euphratica]
 ref|XP_011006504.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Populus euphratica]
Length=617

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 125/160 (78%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M MFD+ GFC D+D F  PL E          + P+    V VEDDYSD+E+D++ELERR
Sbjct  2    MSMFDETGFCGDMDFFCTPLVE-------GDVSAPQVEPEVTVEDDYSDEEIDVDELERR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE +KSKEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWRDKMRLKRLKEQTKSKEGIDIAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>ref|XP_007016682.1| Ethylene insensitive 3 family protein [Theobroma cacao]
 gb|EOY34301.1| Ethylene insensitive 3 family protein [Theobroma cacao]
Length=615

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 124/160 (78%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MM+F++MG C D+D F APL E          A  +      VEDDY+D+E+D++ELERR
Sbjct  1    MMIFEEMGICGDMDFFSAPLGE-------KDVAASQTEPEATVEDDYTDEEIDVDELERR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE +K KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   MWRDKMRLKRLKEQNKGKEGIDIAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  149



>gb|KDO66381.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
Length=465

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 115/160 (72%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MM FD+MGFC D++ F APL + ADM   P   E         E+   D+        RR
Sbjct  2    MMSFDEMGFCGDMNFFSAPLGD-ADMAVQPSEPEATVEDDYTDEEMDVDELE------RR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MW+DKM+LKRLKE S+ KEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWKDKMRLKRLKEQSRGKEGIDMA----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>ref|XP_003543154.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
 gb|KHN33830.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=618

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 124/160 (78%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMFD+MG CN+LD   APL E             +    V VEDD++D+E+ ++ELE+R
Sbjct  2    MMMFDEMGLCNNLDMISAPLGE-------EDITTRQTDPEVIVEDDFTDEEIGVDELEQR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MW+DKM+LKRLKE SKSKEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWKDKMRLKRLKEQSKSKEGIDAVKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>ref|XP_006384758.1| EIN3-like family protein [Populus trichocarpa]
 gb|ERP62555.1| EIN3-like family protein [Populus trichocarpa]
Length=617

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 125/160 (78%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M MFD+ GFC D+D F  PL E          + P+    V VEDDYSD+E+D++ELERR
Sbjct  2    MSMFDETGFCGDMDFFCTPLVE-------GDVSAPQVEPEVTVEDDYSDEEIDVDELERR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE ++SKEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWRDKMRLKRLKEQTRSKEGIDIAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>ref|XP_011043514.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Populus euphratica]
Length=632

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 123/160 (77%), Gaps = 10/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M MFD+MGFC D+D F APL E          A         V+DDYSD+E+D++ELERR
Sbjct  1    MSMFDEMGFCGDIDFFSAPLVE------GDVAAPQAEPEATVVDDDYSDEEIDVDELERR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE +KSKEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWRDKMRLKRLKEQTKSKEGIDIAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGII EKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  KAQGFVYGIITEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>ref|XP_011090234.1| PREDICTED: LOW QUALITY PROTEIN: protein ETHYLENE INSENSITIVE 
3 [Sesamum indicum]
Length=598

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 125/161 (78%), Gaps = 10/161 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFL-APLKEPADmvapppgaepeaavvveveddysddemdmeeleR  397
            MMMFDDMGFC DLD F  AP+K           A     V   V+DDY+D+E+D++ELER
Sbjct  1    MMMFDDMGFCGDLDFFSSAPIK------GAEVCAPQAVEVEPVVDDDYTDEEIDVDELER  54

Query  398  RMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEV  577
            RMWRDKM  KRLKEM+K K G  +   +R+   SQEQARRKKMSRAQDGILKYMLKMMEV
Sbjct  55   RMWRDKMLHKRLKEMNKGKVGVTDAAKQRQ---SQEQARRKKMSRAQDGILKYMLKMMEV  111

Query  578  CKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            CKAQGFVYGIIPEKGKPVSGASDNLREWWK+KVRFD NGPA
Sbjct  112  CKAQGFVYGIIPEKGKPVSGASDNLREWWKEKVRFDRNGPA  152



>gb|EYU46131.1| hypothetical protein MIMGU_mgv1a003270mg [Erythranthe guttata]
Length=595

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 127/165 (77%), Gaps = 7/165 (4%)
 Frame = +2

Query  227  MFDDMGFCNDLDSFL-APL-KEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MFDD+GFC D D F  AP+ KEPAD         P     +  ++DY+DD++DM+ELERR
Sbjct  1    MFDDLGFCGDFDFFSSAPIVKEPADTCPLQSSEPPGQQHDLAGDEDYTDDDIDMDELERR  60

Query  401  MWRDKMKLKRLkemskskegegedgakRETN-----KSQEQARRKKMSRAQDGILKYMLK  565
            MWRDKM+LKRLKE ++ K+G G  G     +     +SQEQARRKKMSRAQDGILKYMLK
Sbjct  61   MWRDKMRLKRLKESNRGKDGGGGGGGGSALDLAKQRQSQEQARRKKMSRAQDGILKYMLK  120

Query  566  MMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MMEVCKAQGFVYGIIPEKGKPVSG+SDNLREWWK+KVRFD NGPA
Sbjct  121  MMEVCKAQGFVYGIIPEKGKPVSGSSDNLREWWKEKVRFDRNGPA  165



>gb|KHN38437.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=469

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 122/160 (76%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF+DMGFC DLD     L E          A  +      VEDDYSD+E+D++ELE+R
Sbjct  1    MMMFEDMGFCGDLDMLCVSLGE-------GDIAVRQTEPDPVVEDDYSDEEIDVDELEKR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+ KRLKE +KSKEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   MWRDKMRHKRLKEQTKSKEGTDATKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  149



>ref|XP_002530192.1| ETHYLENE-INSENSITIVE3 protein, putative [Ricinus communis]
 gb|EEF32182.1| ETHYLENE-INSENSITIVE3 protein, putative [Ricinus communis]
Length=617

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 126/160 (79%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMFD++GFC D+D F + L E          A  +A     VEDDYSD+E+D++ELERR
Sbjct  1    MMMFDEIGFCGDMDFFSSSLGE--------DVAAQQAEHEPTVEDDYSDEEIDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LK+LKE +KSKEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDKMRLKKLKEQNKSKEGIDMA----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  148



>gb|KDO66375.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
 gb|KDO66376.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
 gb|KDO66377.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
Length=582

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 115/160 (72%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MM FD+MGFC D++ F APL + ADM   P   E         E+   D+        RR
Sbjct  2    MMSFDEMGFCGDMNFFSAPLGD-ADMAVQPSEPEATVEDDYTDEEMDVDELE------RR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MW+DKM+LKRLKE S+ KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWKDKMRLKRLKEQSRGKEGIDMAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>ref|XP_004288382.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Fragaria vesca subsp. 
vesca]
Length=618

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 124/161 (77%), Gaps = 12/161 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLA-PLKEPADmvapppgaepeaavvveveddysddemdmeeleR  397
            MMMFD+MGFC DLD   A P  E A          P+A     +EDDY+DDE+D++ELER
Sbjct  2    MMMFDEMGFCGDLDFISATPGGEVA---------IPQAETEATMEDDYTDDEIDVDELER  52

Query  398  RMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEV  577
            RMWRDKM+LKRLKE +     +    AK+   +SQEQARRKKMSRAQDGILKYMLKMMEV
Sbjct  53   RMWRDKMRLKRLKEQTTKGGKDVIVTAKQR--QSQEQARRKKMSRAQDGILKYMLKMMEV  110

Query  578  CKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            CKAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  CKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  151



>gb|KDO66378.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
 gb|KDO66379.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
 gb|KDO66380.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
Length=621

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 115/160 (72%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MM FD+MGFC D++ F APL + ADM   P   E         E+   D+        RR
Sbjct  2    MMSFDEMGFCGDMNFFSAPLGD-ADMAVQPSEPEATVEDDYTDEEMDVDELE------RR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MW+DKM+LKRLKE S+ KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWKDKMRLKRLKEQSRGKEGIDMAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>ref|XP_006446382.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 ref|XP_006446383.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 gb|ESR59622.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 gb|ESR59623.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
Length=621

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 115/160 (72%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MM FD+MGFC D++ F APL + ADM   P   E         E+   D+        RR
Sbjct  2    MMSFDEMGFCGDMNFFSAPLGD-ADMAVQPSEPEATVEDDYTDEEMDVDELE------RR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MW+DKM+LKRLKE S+ KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWKDKMRLKRLKEQSRGKEGIDMAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>ref|XP_012066277.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Jatropha curcas]
 ref|XP_012066278.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Jatropha curcas]
Length=389

 Score =   162 bits (411),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 122/160 (76%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMFD+MGF  D+D F AP  E          A PE      VEDDYSD+E+ ++ELERR
Sbjct  1    MMMFDEMGFLGDMDFFSAPFGEDV--------AGPETEPEPTVEDDYSDEEIYIDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LK LKE  KSKEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDKMRLKWLKEQIKSKEGIDIA----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  148



>ref|XP_006470438.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006470439.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Citrus 
sinensis]
Length=621

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 115/160 (72%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MM FD+MGFC D++ F APL + ADM   P   E         E+   D+        RR
Sbjct  2    MMSFDEMGFCGDMNFFSAPLGD-ADMAVQPSEPEATVEDDYTDEEMDVDELE------RR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MW+DKM++KRLKE S+ KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWKDKMRIKRLKEQSRGKEGIDMAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>gb|KHN26027.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=614

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 123/160 (77%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF+DMGFC DLD     L +          A  +      VEDDYSD+E+D++ELE+R
Sbjct  1    MMMFEDMGFCGDLDMLCGSLGD-------GDIAVRQTEPDPVVEDDYSDEEIDVDELEKR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE +KSKEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   MWRDKMRLKRLKEQTKSKEGTDAAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  149



>ref|XP_003545483.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
Length=610

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 123/160 (77%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF+DMGFC DLD     L +          A  +      VEDDYSD+E+D++ELE+R
Sbjct  1    MMMFEDMGFCGDLDMLCGSLGD-------GDIAVRQTEPDPVVEDDYSDEEIDVDELEKR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE +KSKEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   MWRDKMRLKRLKEQTKSKEGTDAAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  149



>gb|AGK07288.1| EIN3-3 [Rosa hybrid cultivar]
Length=618

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 123/161 (76%), Gaps = 12/161 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSF-LAPLKEPADmvapppgaepeaavvveveddysddemdmeeleR  397
            +MMFD+MGFC DLD     P  E A          P+A     VEDDY+DDE+D++ELER
Sbjct  2    IMMFDEMGFCGDLDFISTTPGGEVA---------IPQAETEATVEDDYTDDEIDVDELER  52

Query  398  RMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEV  577
            RMWRDKM+LKRL+E +     E    AK+   +SQEQARRKKMSRAQDGILKYMLKMMEV
Sbjct  53   RMWRDKMRLKRLREQTTKGGKEVIVTAKQR--QSQEQARRKKMSRAQDGILKYMLKMMEV  110

Query  578  CKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            CKAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  CKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  151



>gb|AHB18380.1| ethylene insensitive 3 [Momordica charantia]
Length=629

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 122/160 (76%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGFC+D+D   AP+ E            P       +EDDYSD+E+D +ELERR
Sbjct  2    MMMFNEMGFCDDMDFLCAPIVE-------GDAIAPPTDPDAAMEDDYSDEEIDADELERR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWR KM+LKRL+E SK KEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWRYKMRLKRLEEQSKGKEGIDIA----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>ref|XP_003519487.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
Length=614

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 122/160 (76%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF+DMGFC DLD     L E          A  +      VEDDYSD+E+D++ELE+R
Sbjct  1    MMMFEDMGFCGDLDMLCVSLGE-------GDIAVRQTEPDPVVEDDYSDEEIDVDELEKR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+ KRLKE +KSKEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   MWRDKMRHKRLKEQTKSKEGTDATKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  149



>ref|XP_004491182.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Cicer 
arietinum]
 ref|XP_004491183.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Cicer 
arietinum]
Length=611

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 122/160 (76%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMFDD+GFC DLD F   L E          +  +      VEDDYSD+EMD++ELERR
Sbjct  1    MMMFDDIGFCGDLDMFCGTLGE-------GDISVRQTEPDSVVEDDYSDEEMDLDELERR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWR KM+ KR+KE +K+KEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   MWRYKMRYKRMKEQTKAKEGIDAA----KARQSQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  149



>gb|AAL76271.1|AF467783_1 transcription factor EIL2 [Vigna radiata]
Length=622

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 120/157 (76%), Gaps = 11/157 (7%)
 Frame = +2

Query  230  FDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRRMWR  409
            FD+MGFCNDLD+  A L E             +A     VEDD+SD+E+ ++ELE RMW+
Sbjct  6    FDEMGFCNDLDTVTATLGE-------ENITTGQADPEAIVEDDFSDEEIGVDELEHRMWK  58

Query  410  DKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVCKAQ  589
            DKM LKRLKE SKSKEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVCKAQ
Sbjct  59   DKMLLKRLKEQSKSKEGIDAVKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVCKAQ  114

Query  590  GFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            GFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  115  GFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  151



>gb|AGV54673.1| ethylene insensitive protein 3 [Phaseolus vulgaris]
Length=609

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 122/160 (76%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF+D+GFC DLD    PL E          A  +      VE+DYSD+E+DM+ELE+R
Sbjct  1    MMMFEDIGFCGDLDLLSCPLGE-------EDVAVRQIEPDPVVEEDYSDEEIDMDELEKR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDK++ KRLKE  K+KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   MWRDKVRHKRLKEQIKAKEGTDAVRQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  149



>gb|AGV54306.1| transcription factor EIL1 [Phaseolus vulgaris]
Length=610

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 122/160 (76%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF+D+GFC DLD    PL E          A  +      VE+DYSD+E+DM+ELE+R
Sbjct  1    MMMFEDIGFCGDLDLLSCPLGE-------EDVAVRQIEPDPVVEEDYSDEEIDMDELEKR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDK++ KRLKE  K+KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   MWRDKVRHKRLKEQIKAKEGTDAVRQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  149



>ref|XP_007141570.1| hypothetical protein PHAVU_008G207000g [Phaseolus vulgaris]
 gb|ESW13564.1| hypothetical protein PHAVU_008G207000g [Phaseolus vulgaris]
Length=611

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 122/160 (76%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF+D+GFC DLD    PL E          A  +      VE+DYSD+E+DM+ELE+R
Sbjct  1    MMMFEDIGFCGDLDLLSCPLGE-------EDVAVRQIEPDPVVEEDYSDEEIDMDELEKR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDK++ KRLKE  K+KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   MWRDKVRHKRLKEQIKAKEGTDAVRQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  149



>ref|XP_002275284.2| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Vitis vinifera]
 ref|XP_010651613.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Vitis vinifera]
Length=610

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 120/160 (75%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMFD+MG C +L+    P  E          A  +   V  V+D+Y+D+EMD++EL+RR
Sbjct  1    MMMFDEMGICGNLEFMSVPFME-------GDMAASQPEQVAPVDDEYTDEEMDVDELQRR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDK++LKRLKE  + + G        +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   MWRDKLRLKRLKEQKEDQNGADTV----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDRNGPA  149



>gb|KHG09663.1| ethylene insensitive 3 -like protein [Gossypium arboreum]
Length=634

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 123/160 (77%), Gaps = 10/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MG C D+D F A   E          A  +  +   V+DDYSD+E+D++ELERR
Sbjct  39   MMMFEEMGICGDMDFFGASFGE------KDVTAASQVEMDALVDDDYSDEEVDVDELERR  92

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            +WRDKM+LKRLK+ SK K+G      ++    SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  93   VWRDKMRLKRLKDQSKGKDGVDTAKQRQ----SQEQARRKKMSRAQDGILKYMLKMMEVC  148

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  149  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  188



>gb|AAL76272.1|AF467784_1 transcription factor EIL1 [Vigna radiata]
Length=609

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 121/160 (76%), Gaps = 10/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF+D+GFC DLD    PL +          A         VEDDYSD+E+D++ELE+R
Sbjct  1    MMMFEDIGFCGDLDLLSCPLGD------EDVVAVRHTDPDPVVEDDYSDEEIDVDELEKR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDK++ KRLKE  K+KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWRDKVRHKRLKEQQKAKEGTDAVKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>gb|AHC70432.1| ethylene insensitive 3-like protein [Cucurbita pepo subsp. pepo]
Length=599

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 125/160 (78%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGFC+D+D   AP+ E            P+A   V VEDDYSD+E+D++ELERR
Sbjct  1    MMMFNEMGFCDDIDFLSAPIVE-------GDVVAPQADPEVVVEDDYSDEEIDVDELERR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MW+DKM+LKRLKE SK KEG        +  +SQ+QARRKKMSRA DGILKYMLK+MEVC
Sbjct  54   MWKDKMRLKRLKEQSKVKEGVDIA----KQRQSQDQARRKKMSRAHDGILKYMLKIMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
             AQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  NAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  149



>gb|ABK35086.1| EIL2 [Prunus persica]
Length=601

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 119/160 (74%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M MF+DMGFC +LD   AP  E          A PE       E+D SD EMD++ELERR
Sbjct  1    MGMFEDMGFCGNLDFLSAPPGE--------GEAAPEHDPEATAEEDNSDKEMDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LKRLKE SK KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLKRLKEQSKGKEGVDNARQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLREWWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLREWWKEKVRFDRNGPA  148



>emb|CDY60391.1| BnaA01g36840D [Brassica napus]
Length=425

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRDKM+LKRLKE       +G D    +  +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  53   RRMWRDKMRLKRLKEQDNKSSKQGVDYDSAKQRQSQEQARRKKMSRAQDGILKYMLKMME  112

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  113  VCKAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  154



>ref|XP_004306440.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Fragaria vesca 
subsp. vesca]
Length=604

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 120/160 (75%), Gaps = 14/160 (9%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F+DMGFC +LD F AP  E           E        VE+DYSD+E+D++ELERR
Sbjct  1    MGIFEDMGFCGNLDFFSAPAGE----------GEVVPEPEATVEEDYSDEELDVDELERR  50

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD++ LKRL+E ++ KE       +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  51   MWRDRILLKRLREQTRGKEAADNARQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  106

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLREWWK+KVRFD NGPA
Sbjct  107  KAQGFVYGIIPEKGKPVSGASDNLREWWKEKVRFDRNGPA  146



>ref|XP_004501972.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Cicer 
arietinum]
 ref|XP_004501973.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Cicer 
arietinum]
Length=624

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 119/160 (74%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MG   D+D F APL E             +      V+DDYSD+E+D+ ELERR
Sbjct  2    MMMFEEMGTPVDMDMFSAPLGE-------GNVTARQTEPEAMVDDDYSDEEIDVYELERR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE  K KE         +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWRDKMRLKRLKEQIKPKEEFDAA----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWK+KVRFD NGPA
Sbjct  111  KAQGFVYGIIPEKGKPVTGASDNLREWWKNKVRFDRNGPA  150



>ref|XP_007146084.1| hypothetical protein PHAVU_006G011300g [Phaseolus vulgaris]
 gb|ESW18078.1| hypothetical protein PHAVU_006G011300g [Phaseolus vulgaris]
Length=624

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 117/157 (75%), Gaps = 11/157 (7%)
 Frame = +2

Query  230  FDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRRMWR  409
            FD+MGFCNDLD     L E             +      VEDD+SD+E+ ++ELE RMW+
Sbjct  6    FDEMGFCNDLDPVPGTLGE-------ENITSGQTDPETIVEDDFSDEEIGVDELEHRMWK  58

Query  410  DKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVCKAQ  589
            DKM LKRLKE SKSKEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVCKAQ
Sbjct  59   DKMLLKRLKEQSKSKEGIDAVKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVCKAQ  114

Query  590  GFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            GFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  115  GFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  151



>gb|AHC70433.1| ethylene insensitive 3 protein [Cucurbita pepo subsp. pepo]
Length=618

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 113/166 (68%), Gaps = 23/166 (14%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKE------PADmvapppgaepeaavvveveddysddemdm  382
            MMMF++MGFC+D+D   AP+ +      PAD          +  + V+  +         
Sbjct  2    MMMFNEMGFCDDMDFLSAPIVDGDVVARPADPEVVVEDDYSDEEIDVDELE---------  52

Query  383  eeleRRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYML  562
                RRMWRDKM+LKRLKE SK KEG        +  +S++QARRKKMSRA DGILKYML
Sbjct  53   ----RRMWRDKMRLKRLKEQSKVKEGIDIA----KQRQSRDQARRKKMSRAHDGILKYML  104

Query  563  KMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            K+MEVC AQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  105  KIMEVCNAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>ref|XP_002312841.2| EIN3-like family protein [Populus trichocarpa]
 gb|EEE86796.2| EIN3-like family protein [Populus trichocarpa]
Length=625

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 121/154 (79%), Gaps = 11/154 (7%)
 Frame = +2

Query  239  MGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRRMWRDKM  418
            MGFC D+D F APL E          A P+A     V+DDYSD+E+D++ELERRMWRDKM
Sbjct  1    MGFCGDIDFFCAPLVE-------GDVAAPQAEPEATVDDDYSDEEIDVDELERRMWRDKM  53

Query  419  KLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFV  598
            +LKRLKE +KSKEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFV
Sbjct  54   RLKRLKEQTKSKEGIDIAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFV  109

Query  599  YGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            YGII EKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  YGIITEKGKPVTGASDNLREWWKDKVRFDRNGPA  143



>gb|KJB56070.1| hypothetical protein B456_009G105400 [Gossypium raimondii]
Length=612

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 121/159 (76%), Gaps = 11/159 (7%)
 Frame = +2

Query  224  MMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRRM  403
            MMFD+M  C D++ F APL E          A  ++     VEDDY+D+E+D++ELERR+
Sbjct  1    MMFDEMTMCGDMNFFSAPLGE-------KDVAVSQSEAEATVEDDYTDEEVDVDELERRL  53

Query  404  WRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVCK  583
            WR KM+LKRLKE  K KEG      ++    SQEQARRKKMSRAQDGILKYMLKMMEVCK
Sbjct  54   WRYKMRLKRLKEQHKGKEGIDIAKQRQ----SQEQARRKKMSRAQDGILKYMLKMMEVCK  109

Query  584  AQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            AQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  AQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  148



>ref|XP_004144109.2| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Cucumis sativus]
 gb|KGN66413.1| EIN3-like protein [Cucumis sativus]
Length=630

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 122/160 (76%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGFC+D+D   A + E            P     V VEDDYSD+E+DM+ELERR
Sbjct  2    MMMFNEMGFCDDMDFLSASITE-------GDAVAPPTDPEVVVEDDYSDEEIDMDELERR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE SK KEG      +    +SQ+QARRKKMSRA DGILKYMLK+MEVC
Sbjct  55   MWRDKMRLKRLKEQSKVKEGIDIVKQR----QSQDQARRKKMSRAHDGILKYMLKIMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
             AQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  NAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>gb|AFK80347.1| ethylene-insensitive 3 [Cucumis sativus]
Length=635

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 122/160 (76%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGFC+D+D   A + E            P     V VEDDYSD+E+DM+ELERR
Sbjct  2    MMMFNEMGFCDDMDFLSASITE-------GDAVAPPTDPEVVVEDDYSDEEIDMDELERR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE SK KEG        +  +SQ+QARRKKMSRA DGILKYMLK+MEVC
Sbjct  55   MWRDKMRLKRLKEQSKVKEGIDIV----KQRQSQDQARRKKMSRAHDGILKYMLKIMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
             AQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  NAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>gb|KDO53812.1| hypothetical protein CISIN_1g009144mg [Citrus sinensis]
Length=381

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 120/160 (75%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFC +L+ F +P  E          A  E       E+DYSD+EMD++ELERR
Sbjct  1    MGIFEEMGFCGNLEFFSSPHGE--------GEAFLEHEQETAAEEDYSDEEMDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LK+LKE SKSKE       +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLKKLKEQSKSKECVDSAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  148



>ref|XP_002315400.1| EIN3-like family protein [Populus trichocarpa]
 gb|EEF01571.1| EIN3-like family protein [Populus trichocarpa]
Length=603

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 121/160 (76%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFCN+LD F AP  E          A PE      +E+DYSD+EMD++ELERR
Sbjct  1    MGIFEEMGFCNNLDFFSAPPGE--------MDAVPEREPGATIEEDYSDEEMDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M L+RLKE  K+ E       +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLRRLKEQGKNTEVVDHAKHR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  148



>ref|XP_002310961.1| hypothetical protein POPTR_0008s01200g [Populus trichocarpa]
 ref|XP_006379422.1| EIN3-like family protein [Populus trichocarpa]
 gb|EEE88328.1| hypothetical protein POPTR_0008s01200g [Populus trichocarpa]
 gb|ERP57219.1| EIN3-like family protein [Populus trichocarpa]
Length=603

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 121/160 (76%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFCN+LD F AP  E            PE      +E+DYSD+EMD++ELERR
Sbjct  1    MGIFEEMGFCNNLDFFSAPPGE--------MDVVPECEPEATIEEDYSDEEMDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M L+RLKE SK+ E         +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLRRLKEQSKNTEVVDNA----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  148



>ref|XP_008451093.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Cucumis melo]
Length=625

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 122/160 (76%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGFC+D+D   A + E            P     V VEDDYSD+E+DM+ELERR
Sbjct  2    MMMFNEMGFCDDMDFLSASIVE-------GDAVAPPTDPEVLVEDDYSDEEIDMDELERR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE SK KEG        +  +SQ+QARRKKMSRA DGILKYMLK+MEVC
Sbjct  55   MWRDKMRLKRLKEQSKVKEGIDIV----KQRQSQDQARRKKMSRAHDGILKYMLKIMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
             AQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  NAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>gb|KJB83827.1| hypothetical protein B456_013G266300 [Gossypium raimondii]
 gb|KJB83828.1| hypothetical protein B456_013G266300 [Gossypium raimondii]
Length=594

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 121/160 (76%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MG C D+D F A              A  +  +   V+DDYSD+E+D++ELERR
Sbjct  1    MMMFEEMGICGDMDFFGA-------FGEKDVTAASQVEMDAAVDDDYSDEEIDVDELERR  53

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            +WRDKM LKRLK+ SK K+G      ++    SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  54   VWRDKMLLKRLKDQSKGKDGVDTAKQRQ----SQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  149



>dbj|BAB64344.1| EIN3-like protein [Cucumis melo]
Length=693

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 122/160 (76%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGFC+D+D   A + E            P     V VEDDYSD+E+DM+ELERR
Sbjct  2    MMMFNEMGFCDDMDFLSASIVE-------GDAVAPPTDPEVLVEDDYSDEEIDMDELERR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE SK KEG        +  +SQ+QARRKKMSRA DGILKYMLK+MEVC
Sbjct  55   MWRDKMRLKRLKEQSKVKEGIDIV----KQRQSQDQARRKKMSRAHDGILKYMLKIMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
             AQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  NAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>emb|CDY19606.1| BnaA05g20140D [Brassica napus]
Length=460

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 122/160 (76%), Gaps = 8/160 (5%)
 Frame = +2

Query  224  MMFDDMGFCNDLDSFL-APLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMF++MG C ++D F  A L E          A         VEDDY+DDE+D++ELERR
Sbjct  1    MMFNEMGMCGNMDFFSPASLGE-----VDFCPAPAHPEPDSVVEDDYTDDEIDVDELERR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE  KS   EG D AK+   +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDKMRLKRLKEQDKSGSKEGVDAAKQR--QSQEQARRKKMSRAQDGILKYMLKMMEVC  113

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  114  KAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  153



>ref|XP_010510821.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Camelina sativa]
 ref|XP_010510822.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Camelina sativa]
Length=580

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 111/160 (69%), Gaps = 9/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MG   ++D F  P   P D+   P   +      V+  DD  D +       +R
Sbjct  1    MMMFNEMGMYGNMDFF--PSSTPLDVCPLPQAEQEPMVEDVDYTDDEMDVDELE----KR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE     +   +   +R+   SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWRDKMRLKRLKEQQSKCKDGVDGSKQRQ---SQEQARRKKMSRAQDGILKYMLKMMEVC  111

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  112  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  151



>emb|CDY06379.1| BnaC05g31510D [Brassica napus]
Length=487

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 123/164 (75%), Gaps = 16/164 (10%)
 Frame = +2

Query  224  MMFDDMGFCNDLDSFL-APLKE----PADmvapppgaepeaavvveveddysddemdmee  388
            MMF++MG C ++D F  A L E    PA                  V+DDY+DDE+D++E
Sbjct  17   MMFNEMGMCGNMDFFSPASLGEVDFCPA---------PTHPEPDSVVDDDYTDDEIDVDE  67

Query  389  leRRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKM  568
            LERRMWRDKM+LKRLKE  KS   EG D AK+   +SQEQARRKKMSRAQDGILKYMLKM
Sbjct  68   LERRMWRDKMRLKRLKEQDKSGSKEGVDAAKQR--QSQEQARRKKMSRAQDGILKYMLKM  125

Query  569  MEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MEVCKAQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  126  MEVCKAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  169



>emb|CDX83250.1| BnaA03g22560D [Brassica napus]
Length=570

 Score =   157 bits (396),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 88/102 (86%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRDKM+LKRLKE     + E +    ++  +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  52   RRMWRDKMRLKRLKEQQSKCKEEVDAS--KQQRQSQEQARRKKMSRAQDGILKYMLKMME  109

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  VCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  151



>ref|XP_011046481.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
 ref|XP_011046482.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
Length=658

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 121/160 (76%), Gaps = 13/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFCN+LD F AP +  A          PE      +E+DYSD+EMD++ELERR
Sbjct  1    MGIFEEMGFCNNLDFFSAPGEMDA---------VPEREPGATIEEDYSDEEMDVDELERR  51

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M L+RLKE  K+ E       +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  52   MWRDRMLLRRLKEQGKNTEVVDHAKHR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  107

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  108  KAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  147



>ref|XP_011012998.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
 ref|XP_011012999.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
 ref|XP_011013000.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
 ref|XP_011013001.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
Length=658

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 121/160 (76%), Gaps = 13/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFCN+LD F AP +  A          PE      +E+DYSD+EMD++ELERR
Sbjct  1    MGIFEEMGFCNNLDFFSAPGEMDA---------VPEREPGATIEEDYSDEEMDVDELERR  51

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M L+RLKE  K+ E       +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  52   MWRDRMLLRRLKEQGKNTEVVDHAKHR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  107

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  108  KAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  147



>ref|XP_009110178.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Brassica rapa]
Length=605

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRDKM+LKRLKE       +G D    +  +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  54   RRMWRDKMRLKRLKEQDNKSSKQGVDYDSAKQRQSQEQARRKKMSRAQDGILKYMLKMME  113

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  114  VCKAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  155



>ref|XP_004140927.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis sativus]
 ref|XP_011656591.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis sativus]
Length=615

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 120/160 (75%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F+D+GFC +L+ F AP  E             E      +E+DYSD+E+D++ELERR
Sbjct  4    MGIFEDIGFCRNLEYFSAPPGE--------QETAQEHEAEAVLEEDYSDEELDVDELERR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M L+RLKE SK KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDRMLLRRLKEQSKEKEGADSSKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  111

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  112  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  151



>emb|CDY38540.1| BnaC03g26570D [Brassica napus]
Length=563

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRDKM+LKRLKE     +   +    ++  +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  52   RRMWRDKMRLKRLKEQQSKCKEGVDAS--KQQRQSQEQARRKKMSRAQDGILKYMLKMME  109

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  VCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  151



>ref|XP_008379003.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Malus domestica]
Length=391

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 121/160 (76%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F+++GFC++LD   AP  E          A PE       E+DYSD+EMD++ELE+R
Sbjct  1    MGIFEELGFCDNLDFLSAPSXE--------GDAAPEHEPEATAEEDYSDEEMDVDELEKR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LKRLKE +K KEG      ++    SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLKRLKEQTKGKEGVDNARQRQ----SQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  148



>ref|XP_010521603.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Tarenaya 
hassleriana]
Length=665

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 116/161 (72%), Gaps = 6/161 (4%)
 Frame = +2

Query  218  KMMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleR  397
            KMMMF +MG C ++D F +      D+   PP        VVE +    + ++D  E  R
Sbjct  19   KMMMFSEMGMCGNMDFFSSASLGEVDICPAPPAETEPEEPVVEDDYTDEEMDVDELE--R  76

Query  398  RMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEV  577
            RMWRDK++LKRLKE +K+ EG      +    +SQEQARRKKMSRAQDGILKYMLKMMEV
Sbjct  77   RMWRDKLRLKRLKEQTKTPEGADAAKRR----QSQEQARRKKMSRAQDGILKYMLKMMEV  132

Query  578  CKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            CKAQGFVYGIIPEKGKPV+GASDNLREWWKD+VRFD NGPA
Sbjct  133  CKAQGFVYGIIPEKGKPVTGASDNLREWWKDRVRFDRNGPA  173



>ref|XP_010417849.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein isoform X1 [Camelina 
sativa]
Length=590

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 115/163 (71%), Gaps = 8/163 (5%)
 Frame = +2

Query  212  GLKMMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeel  391
            G  MMMF++MG   ++D F  P   P D+   P   +      V+  DD  D        
Sbjct  13   GRDMMMFNEMGMYGNMDFF--PSSTPLDVCPLPQAEQEPVVEDVDYTDDEMDVGELE---  67

Query  392  eRRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMM  571
             +RMWRDKM+LKRLKE     + EG DG+K+   +SQEQARRKKMSRAQDGILKYMLKMM
Sbjct  68   -KRMWRDKMRLKRLKEQQSKCKEEGVDGSKQR--QSQEQARRKKMSRAQDGILKYMLKMM  124

Query  572  EVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            EVCKAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  125  EVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  167



>ref|XP_009133914.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Brassica rapa]
 ref|XP_009133915.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Brassica rapa]
 ref|XP_009133916.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Brassica rapa]
 ref|XP_009133918.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Brassica rapa]
Length=571

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRDKM+LKRLKE     +   +    ++  +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  52   RRMWRDKMRLKRLKEQQSKCKEGVDAS--KQQRQSQEQARRKKMSRAQDGILKYMLKMME  109

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  VCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  151



>ref|XP_006408669.1| hypothetical protein EUTSA_v10001938mg [Eutrema salsugineum]
 dbj|BAJ33951.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ50122.1| hypothetical protein EUTSA_v10001938mg [Eutrema salsugineum]
Length=581

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 87/102 (85%), Gaps = 3/102 (3%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRDKM+LKRLKE     +   +   +R+   SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  55   RRMWRDKMRLKRLKEQQGKCKEGVDASKQRQ---SQEQARRKKMSRAQDGILKYMLKMME  111

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  112  VCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  153



>ref|XP_010473094.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Camelina sativa]
Length=578

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 115/160 (72%), Gaps = 7/160 (4%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MG   ++D F  P   P D+   P   +    V      D   D  ++E   +R
Sbjct  1    MMMFNEMGMYGNMDFF--PTSTPLDVCPLPQAEQEPVLVEDVDYTDDEMDVDELE---KR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE     + EG DG+K+   +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDKMRLKRLKEQQSKCKEEGVDGSKQR--QSQEQARRKKMSRAQDGILKYMLKMMEVC  113

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  114  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  153



>ref|XP_006293460.1| hypothetical protein CARUB_v10022879mg [Capsella rubella]
 gb|EOA26358.1| hypothetical protein CARUB_v10022879mg [Capsella rubella]
Length=587

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 119/160 (74%), Gaps = 8/160 (5%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MG   ++D F      P+                V  + DY+DDEMD++ELE+R
Sbjct  1    MMMFNEMGMYGNMDFF------PSSTSIDVCPLPQAEQEPVVEDVDYTDDEMDVDELEKR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE       EG DG+K+   +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWRDKMRLKRLKEQQSKCSKEGVDGSKQR--QSQEQARRKKMSRAQDGILKYMLKMMEVC  112

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  113  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  152



>ref|XP_010521602.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Tarenaya 
hassleriana]
Length=692

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 116/161 (72%), Gaps = 6/161 (4%)
 Frame = +2

Query  218  KMMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleR  397
            KMMMF +MG C ++D F +      D+   PP        VVE +    + ++D  E  R
Sbjct  46   KMMMFSEMGMCGNMDFFSSASLGEVDICPAPPAETEPEEPVVEDDYTDEEMDVDELE--R  103

Query  398  RMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEV  577
            RMWRDK++LKRLKE +K+ EG      +    +SQEQARRKKMSRAQDGILKYMLKMMEV
Sbjct  104  RMWRDKLRLKRLKEQTKTPEGADAAKRR----QSQEQARRKKMSRAQDGILKYMLKMMEV  159

Query  578  CKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            CKAQGFVYGIIPEKGKPV+GASDNLREWWKD+VRFD NGPA
Sbjct  160  CKAQGFVYGIIPEKGKPVTGASDNLREWWKDRVRFDRNGPA  200



>gb|AGI41324.1| EIN3-like protein [Malus domestica]
Length=611

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 120/160 (75%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFC +LD   AP  E          A PE      VE+DYSD+EMD++ELERR
Sbjct  1    MGIFEEMGFCGNLDFLTAPSGE--------GDAAPEHEPEAAVEEDYSDEEMDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LKRL+E +K KE       +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLKRLREQTKGKERVDNARQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  148



>ref|XP_008364747.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
Length=611

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 120/160 (75%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFC +LD   AP  E          A PE      VE+DYSD+EMD++ELERR
Sbjct  1    MGIFEEMGFCGNLDFLTAPSGE--------GDAAPEHEPEAAVEEDYSDEEMDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LKRL+E +K KE       +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLKRLREQTKGKERVDNARQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  148



>gb|ADE41154.1| ethylene insensitive 3 class transcription factor [Malus domestica]
Length=611

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 120/160 (75%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFC +LD   AP  E          A PE      VE+DYSD+EMD++ELERR
Sbjct  1    MGIFEEMGFCGNLDFLTAPSGE--------GDAAPEHEPEAAVEEDYSDEEMDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LKRL+E +K KE       +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLKRLREQTKGKERVDNARQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  148



>ref|XP_009339245.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
 ref|XP_009339246.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
 ref|XP_009339249.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
 ref|XP_009339251.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
Length=611

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 119/160 (74%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFC +LD   AP  E          A PE      VE+DYSD+EMD+ ELERR
Sbjct  1    MGIFEEMGFCGNLDFLTAPSGE--------GDAAPEHEPEAAVEEDYSDEEMDVGELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LKRL+E +K KE       +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLKRLREQTKGKEKVDNARQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  148



>ref|XP_010247605.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nelumbo nucifera]
Length=618

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 123/160 (77%), Gaps = 10/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M MF++MGFC +LD FLAP      +        PE      VE+DY+D+EMD++ELERR
Sbjct  2    MGMFEEMGFCGNLD-FLAP-----SVTTGEGDPVPETEPEATVEEDYTDEEMDVDELERR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M L++LKE +KSK+G      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDRMLLRKLKEQNKSKDGVDTAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  111

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  112  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  151



>ref|XP_009355060.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
 ref|XP_009355061.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
Length=606

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 119/160 (74%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFC +LD   AP  E          A PE       E+DYSD+EMD++ELERR
Sbjct  1    MGIFEEMGFCGNLDFLSAPSGE--------GEAAPEHEPEATGEEDYSDEEMDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LKRLKE +K KE       +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLKRLKEQTKGKERVDNARQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  148



>ref|XP_010417850.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein isoform X2 [Camelina 
sativa]
Length=575

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 114/160 (71%), Gaps = 8/160 (5%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MG   ++D F  P   P D+   P   +      V+  DD  D         +R
Sbjct  1    MMMFNEMGMYGNMDFF--PSSTPLDVCPLPQAEQEPVVEDVDYTDDEMDVGELE----KR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE     + EG DG+K+   +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWRDKMRLKRLKEQQSKCKEEGVDGSKQR--QSQEQARRKKMSRAQDGILKYMLKMMEVC  112

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  113  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  152



>ref|XP_010466283.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Camelina sativa]
Length=629

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 121/168 (72%), Gaps = 25/168 (15%)
 Frame = +2

Query  224  MMFDDMGFCNDLDSF---------LAPLKEPADmvapppgaepeaavvveveddysddem  376
            MMF++MG C ++D F           PL  P            +A     VEDDY+DDE+
Sbjct  1    MMFNEMGMCGNMDFFSTGSLGEVDFCPLPPP------------QAEPDSIVEDDYTDDEI  48

Query  377  dmeeleRRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKY  556
            D++ELERRMWRDKM+LKRLKE  KSKEG        +  +SQEQARRKKMSRAQDGILKY
Sbjct  49   DVDELERRMWRDKMRLKRLKEQDKSKEGVDAA----KQRQSQEQARRKKMSRAQDGILKY  104

Query  557  MLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MLKMMEVCKAQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  105  MLKMMEVCKAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  152



>gb|KDO53810.1| hypothetical protein CISIN_1g009144mg [Citrus sinensis]
 gb|KDO53811.1| hypothetical protein CISIN_1g009144mg [Citrus sinensis]
Length=542

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 120/160 (75%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFC +L+ F +P  E          A  E       E+DYSD+EMD++ELERR
Sbjct  1    MGIFEEMGFCGNLEFFSSPHGE--------GEAFLEHEQETAAEEDYSDEEMDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LK+LKE SKSKE         +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLKKLKEQSKSKECVDSA----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  148



>ref|XP_002879041.1| hypothetical protein ARALYDRAFT_481586 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55300.1| hypothetical protein ARALYDRAFT_481586 [Arabidopsis lyrata subsp. 
lyrata]
Length=579

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 87/102 (85%), Gaps = 3/102 (3%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            +RMWRDKM+LKRLKE     +   +   +R+   SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  53   KRMWRDKMRLKRLKEQQSKCKEGVDGSKQRQ---SQEQARRKKMSRAQDGILKYMLKMME  109

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  VCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  151



>emb|CDY32390.1| BnaC03g41740D [Brassica napus]
Length=549

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 113/159 (71%), Gaps = 12/159 (8%)
 Frame = +2

Query  224  MMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRRM  403
            MMF++MG C ++D F                  P        E+DY+D+E+D++ELERRM
Sbjct  1    MMFNEMGMCGNMDFF-----------GELDFCPPPPQPEPVTEEDYTDEEIDVDELERRM  49

Query  404  WRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVCK  583
            WRDKM+LKRLKE          D A ++   SQEQARRKKMSRAQDGILKYMLKMMEVCK
Sbjct  50   WRDKMRLKRLKEQKDKSREGAVDAA-KQRQSSQEQARRKKMSRAQDGILKYMLKMMEVCK  108

Query  584  AQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            AQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  109  AQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  147



>ref|NP_180273.1| ethylene insensitive 3-like 1 protein [Arabidopsis thaliana]
 sp|Q9SLH0.1|EIL1_ARATH RecName: Full=ETHYLENE INSENSITIVE 3-like 1 protein [Arabidopsis 
thaliana]
 gb|AAC77863.1| ethylene-insensitive3-like1 (EIL1) [Arabidopsis thaliana]
 gb|AAL38367.1| ethylene-insensitive3-like1 (EIL1) [Arabidopsis thaliana]
 gb|AAO29962.1| ethylene-insensitive3-like1 (EIL1) [Arabidopsis thaliana]
 gb|AEC07930.1| ethylene insensitive 3-like 1 protein [Arabidopsis thaliana]
Length=584

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 87/102 (85%), Gaps = 3/102 (3%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            +RMWRDKM+LKRLKE     +   +   +R+   SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  53   KRMWRDKMRLKRLKEQQSKCKEGVDGSKQRQ---SQEQARRKKMSRAQDGILKYMLKMME  109

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  VCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  151



>ref|XP_009145590.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X1 [Brassica 
rapa]
Length=614

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 122/160 (76%), Gaps = 8/160 (5%)
 Frame = +2

Query  224  MMFDDMGFCNDLDSFL-APLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMF++MG C ++D F  A L E          A         VEDDY+DDE+D++ELERR
Sbjct  1    MMFNEMGMCGNMDFFSPASLGE-----VDFCPAPAHPEPDSVVEDDYTDDEIDVDELERR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE  KS   EG D AK+   +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDKMRLKRLKEQDKSGSKEGVDAAKQR--QSQEQARRKKMSRAQDGILKYMLKMMEVC  113

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  114  KAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  153



>ref|XP_009145591.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X2 [Brassica 
rapa]
Length=613

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 122/160 (76%), Gaps = 8/160 (5%)
 Frame = +2

Query  224  MMFDDMGFCNDLDSFL-APLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMF++MG C ++D F  A L E          A         VEDDY+DDE+D++ELERR
Sbjct  1    MMFNEMGMCGNMDFFSPASLGE-----VDFCPAPAHPEPDSVVEDDYTDDEIDVDELERR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE  KS   EG D AK+   +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDKMRLKRLKEQDKSGSKEGVDAAKQR--QSQEQARRKKMSRAQDGILKYMLKMMEVC  113

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  114  KAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  153



>gb|AAC49746.1| ethylene-insensitive3-like1 [Arabidopsis thaliana]
Length=584

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 88/102 (86%), Gaps = 3/102 (3%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            +RMWRDKM+LKRLKE     +G  +   +R+   SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  53   KRMWRDKMRLKRLKEQQSKCKGGVDGSKQRQ---SQEQARRKKMSRAQDGILKYMLKMME  109

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  VCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  151



>ref|XP_010694878.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Beta vulgaris 
subsp. vulgaris]
Length=705

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 113/161 (70%), Gaps = 7/161 (4%)
 Frame = +2

Query  218  KMMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleR  397
            KM  F+DMGFC++ D F  P     +           A      +D+   DE++     R
Sbjct  7    KMGYFEDMGFCSNFDFFAPPPSMAGEGEVGREAEAEAAVDEEYSDDEVDVDELE-----R  61

Query  398  RMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEV  577
            RMWRD+M LK+LKE SK K  EG D AK+   +SQEQARRKKMSRAQDGILKYMLKMMEV
Sbjct  62   RMWRDRMLLKKLKEQSKDKAKEGVDAAKQR--QSQEQARRKKMSRAQDGILKYMLKMMEV  119

Query  578  CKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            CKAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  120  CKAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  160



>dbj|BAJ33948.1| unnamed protein product [Thellungiella halophila]
Length=629

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 120/170 (71%), Gaps = 31/170 (18%)
 Frame = +2

Query  224  MMFDDMGFCNDLDSFL-----------APLKEPADmvapppgaepeaavvveveddysdd  370
            MMF++MG C ++D F            AP  EP                   VEDDY+DD
Sbjct  1    MMFNEMGMCGNMDFFSSGSLGEVDFCPAPQAEP----------------DSIVEDDYTDD  44

Query  371  emdmeeleRRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGIL  550
            E+D++ELERRMWRDKM+LKRLKE  KSKEG        +  +SQEQARRKKMSRAQDGIL
Sbjct  45   EIDVDELERRMWRDKMRLKRLKEQDKSKEGVDAA----KQRQSQEQARRKKMSRAQDGIL  100

Query  551  KYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KYMLKMMEVCKAQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  101  KYMLKMMEVCKAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  150



>gb|KFK39393.1| protein ethylene insensitive 3-like [Arabis alpina]
Length=632

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 120/170 (71%), Gaps = 31/170 (18%)
 Frame = +2

Query  224  MMFDDMGFCNDLDSF-----------LAPLKEPADmvapppgaepeaavvveveddysdd  370
            MMF++MG C ++D F            AP  EP                   VEDDY+DD
Sbjct  1    MMFNEMGMCGNMDFFSTGSLGEVDFCAAPQTEP----------------DSIVEDDYTDD  44

Query  371  emdmeeleRRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGIL  550
            E+D++ELERRMWRDKM+LKRLKE  KSKEG        +  +SQEQARRKKMSRAQDGIL
Sbjct  45   EIDVDELERRMWRDKMRLKRLKEQDKSKEGVDAA----KQRQSQEQARRKKMSRAQDGIL  100

Query  551  KYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KYMLKMMEVCKAQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  101  KYMLKMMEVCKAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  150



>ref|XP_006432536.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 ref|XP_006432537.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 ref|XP_006432538.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 ref|XP_006432539.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 ref|XP_006471293.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Citrus 
sinensis]
 gb|ESR45776.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 gb|ESR45777.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 gb|ESR45778.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 gb|ESR45779.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
Length=617

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 120/160 (75%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFC +L+ F +P  E          A  E       E+DYSD+EMD++ELERR
Sbjct  1    MGIFEEMGFCGNLEFFSSPHGE--------GEAFLEHEQETAAEEDYSDEEMDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LK+LKE SKSKE         +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLKKLKEQSKSKECVDSA----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  148



>ref|XP_010521598.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
 ref|XP_010521599.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
 ref|XP_010521601.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
Length=608

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 108/161 (67%), Gaps = 20/161 (12%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFL-APLKEPADmvapppgaepeaavvveveddysddemdmeeleR  397
            MMMF++MG C ++D F  A   EP +        + E  V                   R
Sbjct  1    MMMFNEMGMCGNMDFFSSASQAEPEEPTVEDDCTDEEMGVDELE---------------R  45

Query  398  RMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEV  577
            R+WRDKM LKRLKE SKSKEG        +  +S+EQARRKKMSRAQDGILKYMLKMMEV
Sbjct  46   RVWRDKMHLKRLKEQSKSKEGVDSA----KLRQSREQARRKKMSRAQDGILKYMLKMMEV  101

Query  578  CKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            CKAQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  102  CKAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  142



>ref|XP_010488063.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Camelina sativa]
Length=632

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 121/168 (72%), Gaps = 25/168 (15%)
 Frame = +2

Query  224  MMFDDMGFCNDLDSF---------LAPLKEPADmvapppgaepeaavvveveddysddem  376
            MMF++MG C ++D F           P+  P            +A     VEDDY+DDE+
Sbjct  1    MMFNEMGMCGNMDFFSTGSLGEVDFCPVPPP------------QAEPDSIVEDDYTDDEI  48

Query  377  dmeeleRRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKY  556
            D++ELERRMWRDKM+LKRLKE  KSKEG        +  +SQEQARRKKMSRAQDGILKY
Sbjct  49   DVDELERRMWRDKMRLKRLKEQDKSKEGVDAA----KQRQSQEQARRKKMSRAQDGILKY  104

Query  557  MLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MLKMMEVCKAQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  105  MLKMMEVCKAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  152



>ref|XP_008231879.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Prunus mume]
Length=601

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 120/160 (75%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFC +LD   A   E          A PE      VE+D SD+EMD++ELERR
Sbjct  1    MGIFEEMGFCGNLDFLSAAPGE--------GEAAPEHDPEATVEEDNSDEEMDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LKRLKE SK KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLKRLKEQSKGKEGVDNARQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLREWWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLREWWKEKVRFDRNGPA  148



>ref|XP_006406351.1| hypothetical protein EUTSA_v10020292mg [Eutrema salsugineum]
 gb|ESQ47804.1| hypothetical protein EUTSA_v10020292mg [Eutrema salsugineum]
Length=629

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 120/170 (71%), Gaps = 31/170 (18%)
 Frame = +2

Query  224  MMFDDMGFCNDLDSFL-----------APLKEPADmvapppgaepeaavvveveddysdd  370
            MMF++MG C ++D F            AP  EP                   VEDDY+DD
Sbjct  1    MMFNEMGMCGNMDFFSSGSLGEVDFCPAPQAEP----------------DSIVEDDYTDD  44

Query  371  emdmeeleRRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGIL  550
            E+D++ELERRMWRDKM+LKRLKE  KSKEG        +  +SQEQARRKKMSRAQDGIL
Sbjct  45   EIDVDELERRMWRDKMRLKRLKEQDKSKEGVDAA----KQRQSQEQARRKKMSRAQDGIL  100

Query  551  KYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KYMLKMMEVCKAQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  101  KYMLKMMEVCKAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  150



>gb|ADE41155.1| ethylene insensitive 3 class transcription factor [Malus domestica]
Length=625

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 122/160 (76%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F+++GFC++LD   AP +E          A PE       E+DYSD+EMD++ELE+R
Sbjct  1    MGIFEELGFCDNLDFLSAPSEE--------GDAAPEHEPEATAEEDYSDEEMDVDELEKR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LKRLKE +K KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLKRLKEQTKGKEGVDNARQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  148



>ref|XP_008790465.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Phoenix dactylifera]
Length=651

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD+M+LKRLKE  ++K  E          +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  79   RRMWRDRMRLKRLKEQQQNKNKEQGAADSARQRQSQEQARRKKMSRAQDGILKYMLKMME  138

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  139  VCKAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  180



>ref|NP_001284429.1| ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis melo]
 dbj|BAB64345.1| EIN3-like protein [Cucumis melo]
Length=615

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 119/160 (74%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F+D+ FC +L+ F AP  E             E      +E+DYSD+E+D++ELERR
Sbjct  4    MGIFEDISFCRNLEYFSAPPGE--------QETAQEHEAEAVLEEDYSDEELDVDELERR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M L+RLKE SK KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDRMLLRRLKEQSKEKEGADSSKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  111

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  112  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  151



>ref|XP_008456656.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis melo]
 ref|XP_008456657.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis melo]
Length=615

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 119/160 (74%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F+D+ FC +L+ F AP  E             E      +E+DYSD+E+D++ELERR
Sbjct  4    MGIFEDISFCRNLEYFSAPPGE--------QETAQEHEAEAVLEEDYSDEELDVDELERR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M L+RLKE SK KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDRMLLRRLKEQSKEKEGADSSKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  111

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  112  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  151



>ref|XP_008357657.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
Length=625

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 121/160 (76%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F+++GFC++LD   AP  E          A PE       E+DYSD+EMD++ELE+R
Sbjct  1    MGIFEELGFCDNLDFLSAPSXE--------GDAAPEHEPEATAEEDYSDEEMDVDELEKR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LKRLKE +K KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLKRLKEQTKGKEGVDNARQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  148



>ref|XP_009135708.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Brassica rapa]
 ref|XP_009135709.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Brassica rapa]
Length=581

 Score =   154 bits (389),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 86/102 (84%), Gaps = 1/102 (1%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRDKM+LKRLKE        G D A ++   SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  47   RRMWRDKMRLKRLKEHKDKSREGGVDAA-KQRQSSQEQARRKKMSRAQDGILKYMLKMME  105

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  106  VCKAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  147



>emb|CDX82228.1| BnaA03g35930D [Brassica napus]
Length=541

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 86/102 (84%), Gaps = 1/102 (1%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRDKM+LKRLKE        G D A ++   SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  47   RRMWRDKMRLKRLKEHKDKSREGGVDAA-KQRQSSQEQARRKKMSRAQDGILKYMLKMME  105

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  106  VCKAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  147



>ref|XP_002276380.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Vitis vinifera]
 ref|XP_010659025.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Vitis vinifera]
Length=616

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 120/160 (75%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFC +LD   AP  E            PE      VE+DYSD+EMD++ELERR
Sbjct  1    MGIFEEMGFCGNLDFLSAPPGE--------GEVAPENEPEATVEEDYSDEEMDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M L+RLKE +K KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLRRLKEQNKGKEGVDNAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  148



>ref|XP_011032978.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
Length=662

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 120/160 (75%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M ++++M FCN+LD F AP  E            PE      +E+DYSD+EMD++ELERR
Sbjct  1    MGIYEEMEFCNNLDFFSAPPGE--------MDVVPEREPEATIEEDYSDEEMDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M L+RLKE SK+ E       +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLRRLKEQSKNTEVVDNAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  148



>gb|ABY28269.1| EIN3-like protein EIL1 [Actinidia deliciosa]
Length=570

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 89/102 (87%), Gaps = 4/102 (4%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            +RMWRDKM+LKRLKEM+K KE       +    +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  2    KRMWRDKMRLKRLKEMNKGKECIDAAKQR----QSQEQARRKKMSRAQDGILKYMLKMME  57

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFD NGPA
Sbjct  58   VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDRNGPA  99



>ref|XP_010557480.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
Length=609

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 121/160 (76%), Gaps = 10/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MG C  +D   A   E            P+A     VEDDY+D+E+D++ELERR
Sbjct  1    MMMFNEMGMCGGMDFSSASFGE------MDICPPPQAEPESVVEDDYTDEEIDVDELERR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            +WRDK++LKRLKE SK KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   VWRDKLRLKRLKEQSKGKEGVDPAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  110

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>ref|NP_188713.1| protein ethylene insensitive 3 [Arabidopsis thaliana]
 sp|O24606.1|EIN3_ARATH RecName: Full=Protein ETHYLENE INSENSITIVE 3 [Arabidopsis thaliana]
 gb|AAC49749.1| ethylene-insensitive3 [Arabidopsis thaliana]
 gb|AAC49750.1| ethylene-insensitive3 [Arabidopsis thaliana]
 dbj|BAB02485.1| ethylene-insensitive3 [Arabidopsis thaliana]
 gb|AAL47431.2| AT3g20770/MOE17_6 [Arabidopsis thaliana]
 gb|AEE76421.1| protein ethylene insensitive 3 [Arabidopsis thaliana]
Length=628

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 120/159 (75%), Gaps = 9/159 (6%)
 Frame = +2

Query  224  MMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRRM  403
            MMF++MG C ++D F +       +        P+A     VEDDY+DDE+D++ELERRM
Sbjct  1    MMFNEMGMCGNMDFFSS-----GSLGEVDFCPVPQAEPDSIVEDDYTDDEIDVDELERRM  55

Query  404  WRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVCK  583
            WRDKM+LKRLKE  K KEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEVCK
Sbjct  56   WRDKMRLKRLKEQDKGKEGVDAA----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVCK  111

Query  584  AQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            AQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  112  AQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  150



>ref|XP_002885403.1| ethylene-insensitive3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61662.1| ethylene-insensitive3 [Arabidopsis lyrata subsp. lyrata]
Length=617

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 88/102 (86%), Gaps = 4/102 (4%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRDKM+LKRLKE  KSKEG      +    +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  42   RRMWRDKMRLKRLKEQDKSKEGVDAAKQR----QSQEQARRKKMSRAQDGILKYMLKMME  97

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  98   VCKAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  139



>ref|XP_010509301.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X1 [Camelina 
sativa]
 ref|XP_010509308.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X2 [Camelina 
sativa]
 ref|XP_010509316.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X3 [Camelina 
sativa]
Length=629

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 120/171 (70%), Gaps = 32/171 (19%)
 Frame = +2

Query  224  MMFDDMGFCNDLDSF------------LAPLKEPADmvapppgaepeaavvveveddysd  367
            MMF++MG C ++D F            + P  EP                   VEDDY+D
Sbjct  1    MMFNEMGMCGNMDFFSTGSLGEVDFCPVPPQAEP----------------DSVVEDDYTD  44

Query  368  demdmeeleRRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGI  547
            DE+D++ELERRMWRDKM+LKRLKE  KSKEG        +  +SQEQARRKKMSRAQDGI
Sbjct  45   DEIDVDELERRMWRDKMRLKRLKEQDKSKEGVDAA----KQRQSQEQARRKKMSRAQDGI  100

Query  548  LKYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            LKYMLKMMEVCKAQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  101  LKYMLKMMEVCKAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  151



>ref|XP_010509323.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X4 [Camelina 
sativa]
Length=630

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 120/171 (70%), Gaps = 32/171 (19%)
 Frame = +2

Query  224  MMFDDMGFCNDLDSF------------LAPLKEPADmvapppgaepeaavvveveddysd  367
            MMF++MG C ++D F            + P  EP                   VEDDY+D
Sbjct  1    MMFNEMGMCGNMDFFSTGSLGEVDFCPVPPQAEP----------------DSVVEDDYTD  44

Query  368  demdmeeleRRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGI  547
            DE+D++ELERRMWRDKM+LKRLKE  KSKEG        +  +SQEQARRKKMSRAQDGI
Sbjct  45   DEIDVDELERRMWRDKMRLKRLKEQDKSKEGVDAA----KQRQSQEQARRKKMSRAQDGI  100

Query  548  LKYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            LKYMLKMMEVCKAQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  101  LKYMLKMMEVCKAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  151



>ref|XP_006297205.1| hypothetical protein CARUB_v10013213mg [Capsella rubella]
 gb|EOA30103.1| hypothetical protein CARUB_v10013213mg [Capsella rubella]
Length=627

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 120/170 (71%), Gaps = 31/170 (18%)
 Frame = +2

Query  224  MMFDDMGFCNDLDSFL-----------APLKEPADmvapppgaepeaavvveveddysdd  370
            MMF+++G C ++D F            AP  EP                   VEDDY+DD
Sbjct  1    MMFNEIGMCGNMDFFSSGSLGEVDFCPAPQAEP----------------DSIVEDDYTDD  44

Query  371  emdmeeleRRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGIL  550
            E+D++ELERRMWRDKM+LKRLKE  KSKEG        +  +SQEQARRKKMSRAQDGIL
Sbjct  45   EIDVDELERRMWRDKMRLKRLKEQDKSKEGVDAA----KQRQSQEQARRKKMSRAQDGIL  100

Query  551  KYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KYMLKMMEVCKAQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  101  KYMLKMMEVCKAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  150



>ref|XP_010243659.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nelumbo nucifera]
Length=615

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 120/170 (71%), Gaps = 30/170 (18%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSF----------LAPLKEPADmvapppgaepeaavvveveddysdd  370
            M M ++MGFC +LD F          LAP  EP                   VE+DY+D+
Sbjct  2    MGMLEEMGFCGNLDFFAPPETIGEGDLAPEAEP----------------EATVEEDYTDE  45

Query  371  emdmeeleRRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGIL  550
            EMD++ELERRMWRD+M L+RLKE +K KEG      +    +SQEQARRKKMSRAQDGIL
Sbjct  46   EMDVDELERRMWRDRMLLRRLKEQNKGKEGVDTAKQR----QSQEQARRKKMSRAQDGIL  101

Query  551  KYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  102  KYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  151



>gb|AGI41325.1| EIN3-like protein [Malus domestica]
Length=625

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 122/160 (76%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F+++GFC++LD   AP +E          A PE       E+DYSD+EMD++ELE+R
Sbjct  1    MGIFEELGFCDNLDFLSAPSEE--------GDAAPEHEPEATAEEDYSDEEMDVDELEKR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LKRLKE +K KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLKRLKEQTKGKEGVDNARQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNL+ WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLKAWWKEKVRFDRNGPA  148



>ref|XP_009341360.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
Length=659

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 122/160 (76%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F+++GF  +LD  LAP  E          A PE      VE+DYSD+EMD++ELE+R
Sbjct  1    MGIFEELGFSGNLDYLLAPSGE--------GDAAPEHEQEATVEEDYSDEEMDVDELEKR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M+LKRLKE +K +EG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMRLKRLKEQTKGREGVDNARQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  148



>gb|ADE41153.1| ethylene insensitive 3 class transcription factor [Malus domestica]
Length=659

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 122/160 (76%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M++F+++GF  +LD  LAP  E          A PE      VE+DYSD+EMD++ELE+R
Sbjct  1    MVIFEELGFSGNLDYLLAPSGE--------GDAAPEHEQEATVEEDYSDEEMDVDELEKR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LKRLKE +K KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLKRLKEQTKGKEGVDNARQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  148



>gb|AAK67355.1|AF387795_1 transcription factor [Cucumis melo]
Length=621

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 119/159 (75%), Gaps = 11/159 (7%)
 Frame = +2

Query  224  MMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRRM  403
            MMF++MG C D+D   A + E            P     V VEDDYSD+E+DM+ELERRM
Sbjct  1    MMFNEMGMCGDMDFLSASIVE-------GDAVAPPTDPEVVVEDDYSDEEIDMDELERRM  53

Query  404  WRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVCK  583
            WRDKM+LKRLKE SK KEG        +  +SQ+QARRKKMSRA DGILKYMLK+MEVC 
Sbjct  54   WRDKMRLKRLKEQSKVKEGIDIV----KQRQSQDQARRKKMSRAHDGILKYMLKIMEVCN  109

Query  584  AQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            AQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  110  AQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  148



>ref|XP_007146083.1| hypothetical protein PHAVU_006G011200g [Phaseolus vulgaris]
 gb|ESW18077.1| hypothetical protein PHAVU_006G011200g [Phaseolus vulgaris]
Length=619

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 90/102 (88%), Gaps = 4/102 (4%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMW+DKM+LKRLKE SKSKEG      +    +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  53   RRMWKDKMRLKRLKEQSKSKEGIDAVKQR----QSQEQARRKKMSRAQDGILKYMLKMME  108

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  109  VCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  150



>gb|AAY45885.1| EIN3-like protein [Cucurbita moschata]
Length=241

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 87/102 (85%), Gaps = 4/102 (4%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRDKM+LKRLKE SK KEG        +  +SQ+QARRKKMSRA DGILKYMLK+ME
Sbjct  3    RRMWRDKMRLKRLKEQSKVKEGIDIA----KQRQSQDQARRKKMSRAHDGILKYMLKIME  58

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VC AQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  59   VCNAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  100



>ref|XP_006446380.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 ref|XP_006446381.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 gb|ESR59620.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 gb|ESR59621.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
Length=596

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 89/102 (87%), Gaps = 4/102 (4%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMW+DKM+LKRLKE S+ KEG      +    +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  28   RRMWKDKMRLKRLKEQSRGKEGIDMAKQR----QSQEQARRKKMSRAQDGILKYMLKMME  83

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  84   VCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  125



>gb|AAX84043.1| EIN3-like protein [Cucumis sativus]
Length=241

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 87/102 (85%), Gaps = 4/102 (4%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRDKM+LKRLKE SK KEG        +  +SQ+QARRKKMSRA DGILKYMLK+ME
Sbjct  3    RRMWRDKMRLKRLKEQSKVKEGIDIV----KQRQSQDQARRKKMSRAHDGILKYMLKIME  58

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VC AQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  59   VCNAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  100



>gb|AAY45884.1| EIN3-like protein [Cucurbita maxima]
Length=241

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 87/102 (85%), Gaps = 4/102 (4%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRDKM+LKRLKE SK KEG        +  +SQ+QARRKKMSRA DGILKYMLK+ME
Sbjct  3    RRMWRDKMRLKRLKEQSKVKEGIDIV----KQRQSQDQARRKKMSRAHDGILKYMLKIME  58

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VC AQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  59   VCNAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  100



>ref|XP_010943685.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Elaeis guineensis]
Length=636

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 89/102 (87%), Gaps = 1/102 (1%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD+M+LKRLKE  ++K  E    + ++  +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  76   RRMWRDRMRLKRLKEQQQNKNKEQGADSAKQ-RQSQEQARRKKMSRAQDGILKYMLKMME  134

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  135  VCKAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  176



>gb|AAV68141.1| ethylene insensitive 3-like 3 [Dianthus caryophyllus]
Length=591

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 89/102 (87%), Gaps = 4/102 (4%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRDKM+LKRLK+ SK KEG      +    +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  56   RRMWRDKMRLKRLKDQSKVKEGVDVAKQR----QSQEQARRKKMSRAQDGILKYMLKMME  111

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPV+GASDNLREWWK+KVRFD NGPA
Sbjct  112  VCKAQGFVYGIIPEKGKPVTGASDNLREWWKEKVRFDRNGPA  153



>ref|NP_001275851.1| ethylene-insensitive 3-like 1 protein [Citrus sinensis]
 gb|ADI40102.1| ethylene-insensitive 3-like 1 protein [Citrus sinensis]
Length=614

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 120/160 (75%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFC +L+ F +P  E          A  E       E+DYSD+E+D++ELERR
Sbjct  1    MGIFEEMGFCGNLEFFSSPHGE--------GEAFLEHEHETAAEEDYSDEELDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LK+LKE SKSKE         +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLKKLKEQSKSKECVDSA----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  148



>ref|XP_008346133.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
 ref|XP_008346139.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
Length=606

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 119/160 (74%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFC +LD   AP  E          A PE      VE+DYSD+EMD++ELERR
Sbjct  1    MGIFEEMGFCGNLDFLSAPSGE--------GEAAPEHEPEATVEEDYSDEEMDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWR +M LKRLKE +K KE       +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRYRMLLKRLKEQTKGKERVDNARQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  148



>gb|KDO53820.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
Length=466

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 120/160 (75%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFC +L+ F A   E          A     +   VE+D SD+E+D++ELERR
Sbjct  1    MGIFEEMGFCGNLEFFSALPGE--------GEAVMGHEMETAVEEDCSDEEVDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD++ LKRLKE +KSKEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRLLLKRLKEQNKSKEGVDSAKHR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVTGASDNLRAWWKEKVRFDRNGPA  148



>ref|XP_010689360.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Beta vulgaris 
subsp. vulgaris]
Length=619

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 87/102 (85%), Gaps = 4/102 (4%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            R+MWRDKM+LKRLKE ++  +G       R+ ++SQEQ+RRKKMSR QDGILKYMLKMME
Sbjct  52   RKMWRDKMRLKRLKEQNRVNKGFDA----RKNHQSQEQSRRKKMSRVQDGILKYMLKMME  107

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VC AQGFVYGIIPEKGKPV GASDNLREWWKDKVRFD NGPA
Sbjct  108  VCNAQGFVYGIIPEKGKPVGGASDNLREWWKDKVRFDRNGPA  149



>gb|AAF69017.1|AF261654_1 ethylene-insensitive 3-like protein 1 [Dianthus caryophyllus]
Length=662

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 89/102 (87%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRDKM LKRLKE +K +  EG D  K+   +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  52   RRMWRDKMLLKRLKEQNKDRCREGIDNVKKR--QSQEQARRKKMSRAQDGILKYMLKMME  109

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPVSGASDNLR WWKDKVRFD NGPA
Sbjct  110  VCKAQGFVYGIIPEKGKPVSGASDNLRAWWKDKVRFDRNGPA  151



>gb|AFH56407.1| EIN3-like protein EIL1, partial [Diospyros kaki]
Length=594

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 90/102 (88%), Gaps = 4/102 (4%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRDKM+LKRLKE++K KEG        +  +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  40   RRMWRDKMRLKRLKELNKGKEGVDAA----KHRQSQEQARRKKMSRAQDGILKYMLKMME  95

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VC+AQGFVYGIIPEKGKPVSGASDNLREWWK+KVRFD NGPA
Sbjct  96   VCEAQGFVYGIIPEKGKPVSGASDNLREWWKEKVRFDRNGPA  137



>ref|XP_003638449.1| Ethylene insensitive 3-like protein [Medicago truncatula]
Length=654

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 118/161 (73%), Gaps = 10/161 (6%)
 Frame = +2

Query  221  MMMFD-DMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleR  397
            MMMFD +M    DLD+F A  ++P                   V++DYSDD++D+ ELER
Sbjct  2    MMMFDHEMAMSGDLDAFSA--QQP---QVEGDITARLTEPEAMVDEDYSDDDIDVAELER  56

Query  398  RMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEV  577
            RMWRDK+ LKRLKE  K KEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEV
Sbjct  57   RMWRDKVLLKRLKEQVKPKEGSDAA----KQRQSQEQARRKKMSRAQDGILKYMLKMMEV  112

Query  578  CKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            CKAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  113  CKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  153



>gb|ACX54782.1| ethylene insensitive-like protein 1 [Medicago truncatula]
 gb|KEH35106.1| ethylene insensitive transcription factor [Medicago truncatula]
Length=629

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 118/161 (73%), Gaps = 10/161 (6%)
 Frame = +2

Query  221  MMMFD-DMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleR  397
            MMMFD +M    DLD+F A  ++P                   V++DYSDD++D+ ELER
Sbjct  2    MMMFDHEMAMSGDLDAFSA--QQP---QVEGDITARLTEPEAMVDEDYSDDDIDVAELER  56

Query  398  RMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEV  577
            RMWRDK+ LKRLKE  K KEG        +  +SQEQARRKKMSRAQDGILKYMLKMMEV
Sbjct  57   RMWRDKVLLKRLKEQVKPKEGSDAA----KQRQSQEQARRKKMSRAQDGILKYMLKMMEV  112

Query  578  CKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            CKAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  113  CKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  153



>gb|KHG00335.1| ethylene insensitive 3 -like protein [Gossypium arboreum]
Length=397

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 86/100 (86%), Gaps = 4/100 (4%)
 Frame = +2

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKE +K KEG      +     SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  1    MWRDKMRLKRLKEQNKCKEGIDIAKQRL----SQEQARRKKMSRAQDGILKYMLKMMEVC  56

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  57   KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA  96



>gb|AGI41323.1| EIN3-like protein [Malus domestica]
Length=659

 Score =   152 bits (384),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 122/160 (76%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M++F+++GF  +LD  LAP  E          A PE      VE+DYSD+EMD++ELE+R
Sbjct  1    MVIFEELGFSGNLDYLLAPSGE--------GDAAPEHEQEAIVEEDYSDEEMDVDELEKR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LKRLKE +K KEG      +    +SQEQARRKKMSRAQDGILKYML+MMEVC
Sbjct  53   MWRDRMLLKRLKEQTKGKEGVDNARQR----QSQEQARRKKMSRAQDGILKYMLEMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  148



>gb|AEK84143.1| ethylene insensitive 3-like protein [Oncidium hybrid cultivar]
Length=645

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 89/102 (87%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD+++LKRLKE  ++K  E  D  K+   +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  85   RRMWRDRLRLKRLKEQQQNKNKELGDSTKQR--QSQEQARRKKMSRAQDGILKYMLKMME  142

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  143  VCKAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  184



>gb|ABG89103.1| ethylene insensitive-like protein 4 [Musa acuminata]
Length=635

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD+M+LKRL+E  ++K  E  D AK+  ++SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  78   RRMWRDRMRLKRLREQQQNKNKEQGDTAKQ--HQSQEQARRKKMSRAQDGILKYMLKMME  135

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  136  VCQAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  177



>ref|XP_010943654.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Elaeis guineensis]
Length=649

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 88/102 (86%), Gaps = 1/102 (1%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD+M+LKRLKE  ++K  E      ++  +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  79   RRMWRDRMRLKRLKEQQQNKNKEQGGDLSKQ-RQSQEQARRKKMSRAQDGILKYMLKMME  137

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  138  VCKAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  179



>ref|XP_009404687.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
Length=635

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD+M+LKRL+E  ++K  E  D AK+  ++SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  78   RRMWRDRMRLKRLREQQQNKNKEQGDTAKQ--HQSQEQARRKKMSRAQDGILKYMLKMME  135

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  136  VCQAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  177



>emb|CDY27563.1| BnaC01g32460D [Brassica napus]
Length=587

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 84/104 (81%), Gaps = 2/104 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNK--SQEQARRKKMSRAQDGILKYMLKM  568
            RRMWRDKM+LKRLKE  +  +   +        +  SQEQARRKKMSRAQDGILKYMLKM
Sbjct  55   RRMWRDKMRLKRLKEQQQDNKSSKQGVDYDSAKQRQSQEQARRKKMSRAQDGILKYMLKM  114

Query  569  MEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MEVCKAQGFVYGIIPE GKPV GASDNLREWWKDKVRFD NGPA
Sbjct  115  MEVCKAQGFVYGIIPENGKPVIGASDNLREWWKDKVRFDRNGPA  158



>gb|AHA93899.1| ethylene insensitive 3 [Coffea arabica]
Length=589

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 88/100 (88%), Gaps = 4/100 (4%)
 Frame = +2

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRDKM+LKRLKEM+K K+G      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  1    MWRDKMRLKRLKEMNKGKDGVDVAKQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  56

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFD NGPA
Sbjct  57   KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDRNGPA  96



>dbj|BAF44109.1| ethylene signal transcription factor [Musa acuminata AAA Group]
Length=592

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD+M+LKRL+E  ++K  E  D AK+  ++SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  78   RRMWRDRMRLKRLREQQQNKNKEQGDTAKQ--HQSQEQARRKKMSRAQDGILKYMLKMME  135

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  136  VCQAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  177



>ref|XP_001766792.1| EIN3a transcription factor [Physcomitrella patens]
 gb|EDQ68423.1| EIN3a transcription factor, partial [Physcomitrella patens]
Length=265

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 87/102 (85%), Gaps = 4/102 (4%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            +RMWRDKM+LKR+KE+ K +E     G      +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  19   KRMWRDKMRLKRIKELQKDREMRSGTGH----KQSQEQARRKKMSRAQDGILKYMLKMME  74

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VC+AQGFVYGIIPEKGKPVSGASDN+R WWK+KVRFD NGPA
Sbjct  75   VCQAQGFVYGIIPEKGKPVSGASDNIRAWWKEKVRFDRNGPA  116



>ref|XP_008809629.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Phoenix dactylifera]
 ref|XP_008809630.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Phoenix dactylifera]
Length=640

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 88/102 (86%), Gaps = 1/102 (1%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD+M LKRLKE  ++K  E    + ++  +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  79   RRMWRDRMLLKRLKEQLQNKNKEQGADSSKQ-RQSQEQARRKKMSRAQDGILKYMLKMME  137

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  138  VCKAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  179



>dbj|BAI44821.1| ethylene insensitive 3-like [Daucus carota]
Length=619

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 118/160 (74%), Gaps = 13/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++M F  +LD F AP+ E            PE+     V+DDYSD+EMD++ELERR
Sbjct  1    MGIFEEMNFSGNLDFFSAPMGE--------GEVVPESEHDANVDDDYSDEEMDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M L+RLKE    +  +       +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLRRLKEQKGKEGVDSA-----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC  107

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  108  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  147



>gb|AAV68140.1| ethylene insensitive 3-like 2 [Dianthus caryophyllus]
Length=662

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 88/102 (86%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRDKM LKRLKE +K +  E  D  K+   +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  52   RRMWRDKMLLKRLKEQNKDRCREWIDNVKKR--QSQEQARRKKMSRAQDGILKYMLKMME  109

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPVSGASDNLR WWKDKVRFD NGPA
Sbjct  110  VCKAQGFVYGIIPEKGKPVSGASDNLRAWWKDKVRFDRNGPA  151



>gb|AIS20827.1| EIL [Pyrus x bretschneideri]
Length=600

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 114/154 (74%), Gaps = 12/154 (8%)
 Frame = +2

Query  239  MGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRRMWRDKM  418
            MGFC +LD   AP  E          A PE       E+DYSD+EMD++ELERRMWRD+M
Sbjct  1    MGFCGNLDFLSAPSGE--------GEAAPEHEPEATGEEDYSDEEMDVDELERRMWRDRM  52

Query  419  KLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFV  598
             LKRLKE +K KE       +    +SQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFV
Sbjct  53   LLKRLKEQTKGKERVDNARQR----QSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFV  108

Query  599  YGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            YGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  YGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  142



>gb|KDO53815.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
 gb|KDO53816.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
 gb|KDO53817.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
 gb|KDO53818.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
 gb|KDO53819.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
Length=614

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 120/160 (75%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFC +L+ F A   E          A     +   VE+D SD+E+D++ELERR
Sbjct  1    MGIFEEMGFCGNLEFFSALPGE--------GEAVMGHEMETAVEEDCSDEEVDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD++ LKRLKE +KSKEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRLLLKRLKEQNKSKEGVDSAKHR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVTGASDNLRAWWKEKVRFDRNGPA  148



>ref|XP_006432540.1| hypothetical protein CICLE_v10000617mg [Citrus clementina]
 ref|XP_006432541.1| hypothetical protein CICLE_v10000617mg [Citrus clementina]
 ref|XP_006471295.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006471296.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Citrus 
sinensis]
 ref|XP_006471297.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X3 [Citrus 
sinensis]
 ref|XP_006471298.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X4 [Citrus 
sinensis]
 gb|ESR45780.1| hypothetical protein CICLE_v10000617mg [Citrus clementina]
 gb|ESR45781.1| hypothetical protein CICLE_v10000617mg [Citrus clementina]
Length=614

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 120/160 (75%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFC +L+ F A   E          A     +   VE+D SD+E+D++ELERR
Sbjct  1    MGIFEEMGFCGNLEFFSALPGE--------GEAVMGHEMETAVEEDCSDEEVDVDELERR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD++ LKRLKE +KSKEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRLLLKRLKEQNKSKEGVDSAKHR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPV+GASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVTGASDNLRAWWKEKVRFDRNGPA  148



>dbj|BAB78462.2| ethylene-insensitive-3-like protein [Oryza sativa Japonica Group]
 gb|ABF95695.1| ETHYLENE-INSENSITIVE3-like 1 protein, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABF95696.1| ETHYLENE-INSENSITIVE3-like 1 protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=644

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 89/105 (85%), Gaps = 3/105 (3%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNK---SQEQARRKKMSRAQDGILKYMLK  565
            RRMWRD+MKLKRLKE+  S+  +   G   + +K   SQEQARRKKMSRAQDGILKYMLK
Sbjct  83   RRMWRDRMKLKRLKELQLSRGKDPAGGVVGDPSKPRQSQEQARRKKMSRAQDGILKYMLK  142

Query  566  MMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MMEVC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  143  MMEVCRAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  187



>ref|NP_001049978.1| Os03g0324300 [Oryza sativa Japonica Group]
 dbj|BAF11892.1| Os03g0324300 [Oryza sativa Japonica Group]
Length=528

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 89/105 (85%), Gaps = 3/105 (3%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNK---SQEQARRKKMSRAQDGILKYMLK  565
            RRMWRD+MKLKRLKE+  S+  +   G   + +K   SQEQARRKKMSRAQDGILKYMLK
Sbjct  83   RRMWRDRMKLKRLKELQLSRGKDPAGGVVGDPSKPRQSQEQARRKKMSRAQDGILKYMLK  142

Query  566  MMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MMEVC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  143  MMEVCRAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  187



>ref|XP_008231880.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Prunus mume]
Length=622

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 113/160 (71%), Gaps = 9/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFC +LD FL+      D V   P  EPE  V  +  D+  D +       +R
Sbjct  1    MGIFEEMGFCGELD-FLSTTSGEGDGVDAAPEHEPETTVEEDYSDEEMDVDELE----KR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LK+LKE +K KE       +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDRMLLKKLKEQNKGKERVDNARQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  111

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  112  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  151



>ref|XP_009595535.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana tomentosiformis]
Length=609

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 111/160 (69%), Gaps = 8/160 (5%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGF  + +    PL    D+                 +++   DE++     RR
Sbjct  1    MMMFEEMGFPGNFEFMSDPLGCGGDVAQEIEHKPTGVEEEDYSDEEMDVDELE-----RR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M L+RLKE +K+KE  G+   +R+   SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDRMLLRRLKEKNKNKEVGGDGAKQRQ---SQEQARRKKMSRAQDGILKYMLKMMEVC  112

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
             AQGFVYGIIPEKGKPV+GASDNLR WWK+KVRFD NGPA
Sbjct  113  NAQGFVYGIIPEKGKPVTGASDNLRAWWKEKVRFDRNGPA  152



>gb|AAZ78349.1| EIN3-like protein 1 [Oryza sativa Japonica Group]
 gb|EAZ26760.1| hypothetical protein OsJ_10672 [Oryza sativa Japonica Group]
Length=640

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 89/105 (85%), Gaps = 3/105 (3%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNK---SQEQARRKKMSRAQDGILKYMLK  565
            RRMWRD+MKLKRLKE+  S+  +   G   + +K   SQEQARRKKMSRAQDGILKYMLK
Sbjct  82   RRMWRDRMKLKRLKELQLSRGKDPAGGVVGDPSKPRQSQEQARRKKMSRAQDGILKYMLK  141

Query  566  MMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MMEVC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  142  MMEVCRAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  186



>gb|ADZ97022.2| EIL6, partial [Nicotiana tabacum]
Length=607

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 111/160 (69%), Gaps = 8/160 (5%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGF  + +    PL    D+                 +++   DE++     RR
Sbjct  1    MMMFEEMGFPGNFEFMSDPLGCGGDVAQEIEHKPTGVEEEDYSDEEMDVDELE-----RR  55

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M L+RLKE +K+KE  G+   +R+   SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  56   MWRDRMLLRRLKEKNKNKEVGGDGAKQRQ---SQEQARRKKMSRAQDGILKYMLKMMEVC  112

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
             AQGFVYGIIPEKGKPV+GASDNLR WWK+KVRFD NGPA
Sbjct  113  NAQGFVYGIIPEKGKPVTGASDNLRAWWKEKVRFDRNGPA  152



>gb|ABF95697.1| ETHYLENE-INSENSITIVE3-like 1 protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAG95963.1| unnamed protein product [Oryza sativa Japonica Group]
Length=641

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 89/105 (85%), Gaps = 3/105 (3%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNK---SQEQARRKKMSRAQDGILKYMLK  565
            RRMWRD+MKLKRLKE+  S+  +   G   + +K   SQEQARRKKMSRAQDGILKYMLK
Sbjct  83   RRMWRDRMKLKRLKELQLSRGKDPAGGVVGDPSKPRQSQEQARRKKMSRAQDGILKYMLK  142

Query  566  MMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MMEVC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  143  MMEVCRAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  187



>ref|XP_001753917.1| EIN3b transcription factor [Physcomitrella patens]
 gb|EDQ81239.1| EIN3b transcription factor, partial [Physcomitrella patens]
Length=264

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 88/102 (86%), Gaps = 5/102 (5%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            +RMWRDK++LKR+KE+ K +E  G      +  +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  19   KRMWRDKIRLKRIKELRKDREMRGG-----QHKQSQEQARRKKMSRAQDGILKYMLKMME  73

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VC+AQGFVYGIIPEKGKPVSGASDN+R WWK+KVRFD NGPA
Sbjct  74   VCQAQGFVYGIIPEKGKPVSGASDNIRAWWKEKVRFDRNGPA  115



>ref|XP_007218956.1| hypothetical protein PRUPE_ppa003550mg [Prunus persica]
 gb|EMJ20155.1| hypothetical protein PRUPE_ppa003550mg [Prunus persica]
Length=566

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 112/160 (70%), Gaps = 7/160 (4%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F++MGFC +LD FL+      D        E E    VE +    + ++D  E  +R
Sbjct  1    MGIFEEMGFCGELD-FLSTTSGEGDGDGVDAAPEHEPEATVEEDYSDEEMDVDELE--KR  57

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LK+LKE +K KE       +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  58   MWRDRMLLKKLKEQNKGKERVDNARQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  113

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  114  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  153



>gb|EAY89823.1| hypothetical protein OsI_11369 [Oryza sativa Indica Group]
Length=640

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 89/105 (85%), Gaps = 3/105 (3%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNK---SQEQARRKKMSRAQDGILKYMLK  565
            RRMWRD+MKLKRLKE+  S+  +   G   + +K   SQEQARRKKMSRAQDGILKYMLK
Sbjct  82   RRMWRDRMKLKRLKELQLSRGKDPAGGVVGDPSKPRQSQEQARRKKMSRAQDGILKYMLK  141

Query  566  MMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MMEVC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  142  MMEVCRAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  186



>ref|XP_009355361.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
Length=627

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 120/160 (75%), Gaps = 11/160 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +F+++GFC +LD   AP  E          A PE  +   VE+DYSDDE D++ELE+R
Sbjct  1    MGIFEELGFCGNLDFLSAPSGE--------GDAAPEHELEATVEEDYSDDETDVDELEKR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LK+  ++ +  +G+      R+  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLKK--KLKEQTKGKEGVDNARQC-QSQEQARRKKMSRAQDGILKYMLKMMEVC  109

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  110  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  149



>gb|AFI61909.1| ethylene insensitive 3-like 3 protein [Paeonia suffruticosa]
Length=652

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 108/160 (68%), Gaps = 7/160 (4%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M +FD+MG+  + D   AP     D      G           +D+   ++++     RR
Sbjct  2    MGIFDEMGYSGNFDFLAAPPPPLGDGEIAIEGEPEATVEEDYSDDELDVEQLE-----RR  56

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD++ LKRLKE +     EG D  K+   +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  57   MWRDRVLLKRLKEQNVKGAKEGVDIVKQR--QSQEQARRKKMSRAQDGILKYMLKMMEVC  114

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  115  KAQGFVYGIIPEKGKPVSGASDNLRPWWKEKVRFDRNGPA  154



>ref|XP_010544313.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
Length=615

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 121/160 (76%), Gaps = 7/160 (4%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MG C + D F++ +      +      + E  +VV  +D   ++E+D++ELERR
Sbjct  1    MMMFNEMGMCGNAD-FVSSVS--LGGIDVCAAPQEEVELVVVEDDYTDEEEIDVDELERR  57

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            +WRDK++LKRLKE SKS+EG      +     SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  58   VWRDKLRLKRLKEQSKSREGVDSAKQRL----SQEQARRKKMSRAQDGILKYMLKMMEVC  113

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  114  KAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  153



>ref|XP_008368189.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
Length=659

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 121/160 (76%), Gaps = 12/160 (8%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            M++F+++GF  +LD  LAP        +    A PE      VE+DYSD+EMD++ELE+R
Sbjct  1    MVIFEELGFSGNLDYLLAP--------SGXGDAAPEHEQEATVEEDYSDEEMDVDELEKR  52

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWRD+M LK LKE +K KEG      +    +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  53   MWRDRMLLKXLKEQTKGKEGVDNARQR----QSQEQARRKKMSRAQDGILKYMLKMMEVC  108

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  109  KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  148



>ref|XP_011629273.1| PREDICTED: LOW QUALITY PROTEIN: ETHYLENE INSENSITIVE 3-like 1 
protein [Amborella trichopoda]
Length=647

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 91/102 (89%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRDK++L+RLKE SK KE  G D AK+   +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  53   RRMWRDKLRLRRLKEQSKGKEAMGGDLAKQR--QSQEQARRKKMSRAQDGILKYMLKMME  110

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  111  VCKAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  152



>gb|ERM97264.1| hypothetical protein AMTR_s00119p00117410 [Amborella trichopoda]
Length=637

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 91/102 (89%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRDK++L+RLKE SK KE  G D AK+   +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  53   RRMWRDKLRLRRLKEQSKGKEAMGGDLAKQR--QSQEQARRKKMSRAQDGILKYMLKMME  110

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  111  VCKAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  152



>ref|XP_011091876.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Sesamum indicum]
Length=580

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 85/102 (83%), Gaps = 3/102 (3%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RR+WRDKM L+RLKE  K+K        +R    SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  20   RRIWRDKMLLRRLKEQKKTKNEIDGSTKQRH---SQEQARRKKMSRAQDGILKYMLKMME  76

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VC+AQGFVYGIIPEKGKPV+GASDNLR WWK+KVRFD NGPA
Sbjct  77   VCRAQGFVYGIIPEKGKPVTGASDNLRPWWKEKVRFDRNGPA  118



>gb|EMT14050.1| Protein ETHYLENE INSENSITIVE 3 [Aegilops tauschii]
Length=648

 Score =   149 bits (376),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 89/107 (83%), Gaps = 5/107 (5%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETN-----KSQEQARRKKMSRAQDGILKYM  559
            RRMWRD+MKLKRLKE+ +S+  E   G     +     +SQEQARRKKMSRAQDGILKYM
Sbjct  83   RRMWRDRMKLKRLKELQQSRGKEQAAGGGGVGDGLKPRQSQEQARRKKMSRAQDGILKYM  142

Query  560  LKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            LKMMEVC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  143  LKMMEVCRAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  189



>ref|NP_001146219.1| uncharacterized protein LOC100279789 [Zea mays]
 gb|ACL53490.1| unknown [Zea mays]
 gb|AFW88507.1| hypothetical protein ZEAMMB73_148027 [Zea mays]
Length=642

 Score =   149 bits (376),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 88/108 (81%), Gaps = 6/108 (6%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemsks------kegegedgakRETNKSQEQARRKKMSRAQDGILKY  556
            RRMWRD+MKLKRL+E+ ++        G G      +  +SQEQARRKKMSRAQDGILKY
Sbjct  82   RRMWRDRMKLKRLRELQQTRGKDSLASGAGLADGSSKPRQSQEQARRKKMSRAQDGILKY  141

Query  557  MLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MLKMMEVC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  142  MLKMMEVCRAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  189



>gb|AGY30671.1| ethylene insensitive 3, partial [Saccharum hybrid cultivar]
Length=639

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 88/108 (81%), Gaps = 6/108 (6%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemsks------kegegedgakRETNKSQEQARRKKMSRAQDGILKY  556
            RRMWRD+MKLKRL+E+ +S        G G      +  +SQEQARRKKMSRAQDGILKY
Sbjct  75   RRMWRDRMKLKRLRELQQSRGKDPMASGGGLADGSSKPRQSQEQARRKKMSRAQDGILKY  134

Query  557  MLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MLKMMEVC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  135  MLKMMEVCRAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  182



>ref|XP_006650014.1| PREDICTED: LOW QUALITY PROTEIN: ETHYLENE INSENSITIVE 3-like 1 
protein-like [Oryza brachyantha]
Length=639

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 90/104 (87%), Gaps = 2/104 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemsks--kegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKM  568
            RRMWRD+MKLKRLKE+ +S  K+  G  G   +  +SQEQARRKKMSRAQDGILKYMLKM
Sbjct  83   RRMWRDRMKLKRLKELQQSRGKDPAGGGGDLSKPRQSQEQARRKKMSRAQDGILKYMLKM  142

Query  569  MEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MEVC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  143  MEVCRAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  186



>gb|AGE45505.1| ethylene insensitive like protein [Musa acuminata AAA Group]
Length=627

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 88/102 (86%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD+M+ KRLKE  +SK  E  D  K+   +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  76   RRMWRDRMRHKRLKEQQQSKNKEQGDAEKQ--CQSQEQARRKKMSRAQDGILKYMLKMME  133

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  134  VCKAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  175



>dbj|BAJ95094.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=651

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 89/107 (83%), Gaps = 5/107 (5%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETN-----KSQEQARRKKMSRAQDGILKYM  559
            RRMWRD+MKLKRLKE+ +S+  E   G     +     +SQEQARRKKMSRAQDGILKYM
Sbjct  85   RRMWRDRMKLKRLKELQQSRGKEQAAGGGGVGDGLKPRQSQEQARRKKMSRAQDGILKYM  144

Query  560  LKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            LKMMEVC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  145  LKMMEVCRAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  191



>ref|NP_001152035.1| ETHYLENE-INSENSITIVE3-like 1 protein [Zea mays]
 gb|ACG45492.1| ETHYLENE-INSENSITIVE3-like 1 protein [Zea mays]
Length=646

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 88/108 (81%), Gaps = 6/108 (6%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemsks------kegegedgakRETNKSQEQARRKKMSRAQDGILKY  556
            RRMWRD+MKLKRL+E+ +S        G G      +  +SQEQARRKKMSRAQDGILKY
Sbjct  82   RRMWRDRMKLKRLRELQQSRGKDPMASGGGLADGSSKPRQSQEQARRKKMSRAQDGILKY  141

Query  557  MLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MLKMMEVC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  142  MLKMMEVCRAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  189



>ref|XP_010067064.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Eucalyptus 
grandis]
 ref|XP_010067065.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Eucalyptus 
grandis]
 ref|XP_010067066.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Eucalyptus 
grandis]
 gb|KCW65129.1| hypothetical protein EUGRSUZ_G02632 [Eucalyptus grandis]
Length=617

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 87/102 (85%), Gaps = 4/102 (4%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            +RMWRD+M LKRLKE SK+KE         +  +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  51   KRMWRDRMLLKRLKEQSKNKEVLDGA----KQRQSQEQARRKKMSRAQDGILKYMLKMME  106

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  107  VCKAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  148



>gb|ACN31333.1| unknown [Zea mays]
Length=647

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 88/108 (81%), Gaps = 6/108 (6%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemsks------kegegedgakRETNKSQEQARRKKMSRAQDGILKY  556
            RRMWRD+MKLKRL+E+ +S        G G      +  +SQEQARRKKMSRAQDGILKY
Sbjct  82   RRMWRDRMKLKRLRELQQSRGKDPMASGGGLADGSSKPRQSQEQARRKKMSRAQDGILKY  141

Query  557  MLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MLKMMEVC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  142  MLKMMEVCRAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  189



>ref|XP_009402439.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
Length=627

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 88/102 (86%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD+M+ KRLKE  +SK  E  D  K+   +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  76   RRMWRDRMRHKRLKEQQQSKNKEQGDAEKQ--CQSQEQARRKKMSRAQDGILKYMLKMME  133

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  134  VCKAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  175



>gb|ACN27664.1| unknown [Zea mays]
 gb|ACN28151.1| unknown [Zea mays]
 gb|ADX60075.1| EIL transcription factor [Zea mays]
 tpg|DAA45119.1| TPA: ETHYLENE-INSENSITIVE3-like 1 protein [Zea mays]
Length=647

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 88/108 (81%), Gaps = 6/108 (6%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemsks------kegegedgakRETNKSQEQARRKKMSRAQDGILKY  556
            RRMWRD+MKLKRL+E+ +S        G G      +  +SQEQARRKKMSRAQDGILKY
Sbjct  82   RRMWRDRMKLKRLRELQQSRGKDPMASGGGLADGSSKPRQSQEQARRKKMSRAQDGILKY  141

Query  557  MLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MLKMMEVC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  142  MLKMMEVCRAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  189



>gb|AFU90136.4| ethylene-insensitive 3 [Paeonia lactiflora]
Length=653

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD++ LKRLKE +     EG D  K+   +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  54   RRMWRDRVLLKRLKEQNVKGAKEGVDIVKQR--QSQEQARRKKMSRAQDGILKYMLKMME  111

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  112  VCKAQGFVYGIIPEKGKPVSGASDNLRPWWKEKVRFDRNGPA  153



>ref|XP_009420955.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
Length=637

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 90/102 (88%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD+++LKRLKE  ++K  E  D AK+   +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  76   RRMWRDRVRLKRLKEQQQNKNKEQGDAAKQW--QSQEQARRKKMSRAQDGILKYMLKMME  133

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  134  VCKAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  175



>dbj|BAF44108.1| ethylene signal transcription factor [Musa acuminata AAA Group]
Length=637

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 90/102 (88%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD+++LKRLKE  ++K  E  D AK+   +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  76   RRMWRDRVRLKRLKEQQQNKNKEQGDAAKQW--QSQEQARRKKMSRAQDGILKYMLKMME  133

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  134  VCKAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  175



>gb|AAV68142.1| ethylene insensitive 3-like 4 [Dianthus caryophyllus]
Length=704

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            +RMWRDKM L+RLKE +K K     D  K+  ++SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  46   QRMWRDKMLLRRLKEQTKDKCATEVDCGKK--HQSQEQARRKKMSRAQDGILKYMLKMME  103

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VC AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  104  VCNAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  145



>ref|XP_004984528.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Setaria italica]
Length=647

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 88/108 (81%), Gaps = 6/108 (6%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemsks------kegegedgakRETNKSQEQARRKKMSRAQDGILKY  556
            RRMWRD+MKLKRL+E+ +S        G G      +  +SQEQARRKKMSRAQDGILKY
Sbjct  82   RRMWRDRMKLKRLRELQQSRGKDQAAAGSGVGDGSSKPRQSQEQARRKKMSRAQDGILKY  141

Query  557  MLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MLKMMEVC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  142  MLKMMEVCRAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  189



>ref|XP_010106127.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
 gb|EXC07787.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
Length=617

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 87/102 (85%), Gaps = 4/102 (4%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD+M L+RLKE +K K+G      +    +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  52   RRMWRDRMLLRRLKEQNKGKQGADNARQR----QSQEQARRKKMSRAQDGILKYMLKMME  107

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  108  VCKAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  149



>ref|XP_002467935.1| hypothetical protein SORBIDRAFT_01g036740 [Sorghum bicolor]
 gb|EER94933.1| hypothetical protein SORBIDRAFT_01g036740 [Sorghum bicolor]
Length=643

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 88/108 (81%), Gaps = 6/108 (6%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegeged------gakRETNKSQEQARRKKMSRAQDGILKY  556
            RRMWRD+MKLKRL+E+ +S+  +             +  +SQEQARRKKMSRAQDGILKY
Sbjct  82   RRMWRDRMKLKRLRELQQSRGKDSIAGGGGLADGSSKPRQSQEQARRKKMSRAQDGILKY  141

Query  557  MLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MLKMMEVC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  142  MLKMMEVCRAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  189



>ref|XP_003558012.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Brachypodium 
distachyon]
 ref|XP_010228682.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Brachypodium 
distachyon]
Length=650

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 89/108 (82%), Gaps = 6/108 (6%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETN------KSQEQARRKKMSRAQDGILKY  556
            RRMWRD+MKLKRLKE+ +S+  E   G     +      +SQEQARRKKMSRAQDGILKY
Sbjct  83   RRMWRDRMKLKRLKELQQSRGKEQAGGGGMGADGGLKPRQSQEQARRKKMSRAQDGILKY  142

Query  557  MLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MLKMMEVC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  143  MLKMMEVCRAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA  190



>gb|ACM89299.1| EIN3-like protein EIL1 [Eriobotrya japonica]
Length=558

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 86/102 (84%), Gaps = 4/102 (4%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD+M LKRLKE +K +E       +    +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  3    RRMWRDRMLLKRLKEQTKGRERVDIVRQR----QSQEQARRKKMSRAQDGILKYMLKMME  58

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKG+PVSGASDNLR WWK+KVRFD NGPA
Sbjct  59   VCKAQGFVYGIIPEKGRPVSGASDNLRAWWKEKVRFDRNGPA  100



>ref|XP_009414231.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
Length=635

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD+M+LKRLKE  ++K  E  D AK+   +SQEQARRK MSRAQDGILKYMLKMME
Sbjct  75   RRMWRDRMRLKRLKEQQQNKNKEQVDSAKQR--QSQEQARRKTMSRAQDGILKYMLKMME  132

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VC AQGFVYGIIPEKGKPVSGASDN R WWK+KVRFD NGPA
Sbjct  133  VCNAQGFVYGIIPEKGKPVSGASDNFRGWWKEKVRFDRNGPA  174



>gb|AEK84144.1| ethylene insensitive 3-like protein [Oncidium hybrid cultivar]
Length=597

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 85/102 (83%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD+++ KRLKE   +K  +  D    E  +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  72   RRMWRDRLRHKRLKEKQNAKNRDHGDSL--EHRQSQEQARRKKMSRAQDGILKYMLKMME  129

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPV GASDNLR WWK+KVRFD NGPA
Sbjct  130  VCKAQGFVYGIIPEKGKPVGGASDNLRAWWKEKVRFDRNGPA  171



>ref|XP_010106128.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
 gb|EXC07788.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
Length=607

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 87/102 (85%), Gaps = 4/102 (4%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD+M L+RLKE +K K+G      +    +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  45   RRMWRDRMLLRRLKEQNKGKQGADNAKQR----QSQEQARRKKMSRAQDGILKYMLKMME  100

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPV+GASDNLR WWK+KVRFD NGPA
Sbjct  101  VCKAQGFVYGIIPEKGKPVTGASDNLRAWWKEKVRFDRNGPA  142



>gb|EYU26910.1| hypothetical protein MIMGU_mgv1a026901mg [Erythranthe guttata]
Length=561

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 106/167 (63%), Gaps = 29/167 (17%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLK-------EPADmvapppgaepeaavvveveddysddemd  379
            M +F++MGF ++LD FL+P +       +P D        + +                 
Sbjct  1    MGIFEEMGFSDNLD-FLSPREVEITPEVDPVDEDYSDEELDVDELE--------------  45

Query  380  meeleRRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYM  559
                 RRMW+D+M LKRLKE  ++K   G     R    SQEQARRKKMSRAQDGILKYM
Sbjct  46   -----RRMWKDRMLLKRLKEQQQNKTNGGGVA--RPHRNSQEQARRKKMSRAQDGILKYM  98

Query  560  LKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            LKMMEVCKAQGFVYGIIPE GKPV+GASDNLR WWK++VRFD NGPA
Sbjct  99   LKMMEVCKAQGFVYGIIPENGKPVTGASDNLRAWWKERVRFDRNGPA  145



>ref|XP_010557481.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
 ref|XP_010557482.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
 ref|XP_010557483.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
Length=570

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 89/102 (87%), Gaps = 3/102 (3%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RR+WRDK++LKRLKE S+SKEG      +R+    QEQ+RRKKMSRAQDGILKYMLKMME
Sbjct  45   RRVWRDKLRLKRLKEQSRSKEGVDSFKQRRQ---PQEQSRRKKMSRAQDGILKYMLKMME  101

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGII EKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  102  VCKAQGFVYGIILEKGKPVTGASDNLREWWKDKVRFDRNGPA  143



>gb|EPS63662.1| hypothetical protein M569_11122 [Genlisea aurea]
Length=563

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 87/103 (84%), Gaps = 1/103 (1%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemsks-kegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMM  571
            RR+WR KM++K+ KEMS S  +  G      +  +SQEQARRKKMSRAQDGILKYMLKMM
Sbjct  67   RRVWRYKMRIKKAKEMSSSRSKDGGAVVDTAKQRQSQEQARRKKMSRAQDGILKYMLKMM  126

Query  572  EVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            EVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFD NGPA
Sbjct  127  EVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDRNGPA  169



>gb|AAY45886.1| EIN3-like protein [Citrullus lanatus]
Length=241

 Score =   141 bits (355),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 85/102 (83%), Gaps = 4/102 (4%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRDKM+LKRLKE SK KEG        +  +SQ+QARRKKMSRA DGILKYMLK+ME
Sbjct  3    RRMWRDKMRLKRLKEQSKVKEGIDIV----KQRQSQDQARRKKMSRAHDGILKYMLKIME  58

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VC AQGFVYGIIPEKGKPV+GASDN REWWKDKVRFD N PA
Sbjct  59   VCNAQGFVYGIIPEKGKPVTGASDNPREWWKDKVRFDRNEPA  100



>ref|XP_002980161.1| hypothetical protein SELMODRAFT_112063, partial [Selaginella 
moellendorffii]
 ref|XP_002992899.1| hypothetical protein SELMODRAFT_136229, partial [Selaginella 
moellendorffii]
 gb|EFJ05988.1| hypothetical protein SELMODRAFT_136229, partial [Selaginella 
moellendorffii]
 gb|EFJ19031.1| hypothetical protein SELMODRAFT_112063, partial [Selaginella 
moellendorffii]
Length=250

 Score =   141 bits (355),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 85/102 (83%), Gaps = 4/102 (4%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            +R+W D+++LKR+K+  K++          +  +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  8    KRIWNDRLRLKRIKDKQKARNLGNLP----KHKQSQEQARRKKMSRAQDGILKYMLKMME  63

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPEKGKPVSGASDN+R WWK+KVRFD NGPA
Sbjct  64   VCKAQGFVYGIIPEKGKPVSGASDNIRAWWKEKVRFDRNGPA  105



>ref|XP_009384965.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Musa acuminata 
subsp. malaccensis]
Length=592

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 87/101 (86%), Gaps = 3/101 (3%)
 Frame = +2

Query  398  RMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEV  577
            RMWRD+++LKRLKE  +SK     D A+++   SQ+QA RKKMSRAQDGILKYMLKMMEV
Sbjct  73   RMWRDQLRLKRLKEKQQSKNKVQTDAARQQ---SQKQACRKKMSRAQDGILKYMLKMMEV  129

Query  578  CKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            CKAQGFVYGIIPEKGKPVSGASDNLR WWKDKVRFD NGPA
Sbjct  130  CKAQGFVYGIIPEKGKPVSGASDNLRGWWKDKVRFDQNGPA  170



>ref|NP_001234546.1| EIL3 protein [Solanum lycopersicum]
 gb|AAK58859.1|AF328786_1 EIL3 [Solanum lycopersicum]
Length=601

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 85/102 (83%), Gaps = 4/102 (4%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD+M L+RLKE +K+K        +    +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  51   RRMWRDRMLLRRLKEKNKNKVVGDGAKQR----QSQEQARRKKMSRAQDGILKYMLKMME  106

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VC AQGFVYGIIPEKGKPV+GASDNLR WWK+KVRFD NGPA
Sbjct  107  VCNAQGFVYGIIPEKGKPVTGASDNLRAWWKEKVRFDRNGPA  148



>ref|XP_010544311.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
 ref|XP_010544312.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
Length=632

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 121/161 (75%), Gaps = 11/161 (7%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLA-PLKEPADmvapppgaepeaavvveveddysddemdmeeleR  397
            MMMF++MG   ++D F + PL E             +A     VEDD++++E+D++ELER
Sbjct  1    MMMFNEMGMRGNMDFFSSGPLAE------VDLCPARQAGTESFVEDDFTEEEIDVDELER  54

Query  398  RMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEV  577
            R+WRDK++LK LKE SKSKEG      +    +SQE ARRKKMSRAQDGILKYMLKMMEV
Sbjct  55   RVWRDKLRLKCLKEQSKSKEGVDSAKQR----QSQELARRKKMSRAQDGILKYMLKMMEV  110

Query  578  CKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            CKAQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct  111  CKAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA  151



>ref|XP_002463411.1| hypothetical protein SORBIDRAFT_02g043350 [Sorghum bicolor]
 gb|EER99932.1| hypothetical protein SORBIDRAFT_02g043350 [Sorghum bicolor]
Length=612

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 84/104 (81%), Gaps = 2/104 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRET--NKSQEQARRKKMSRAQDGILKYMLKM  568
            RRMWRD+++L+RLKE  + +  +     K+E      QEQARRKKMSRAQDGILKYMLKM
Sbjct  74   RRMWRDRVRLRRLKEQQQQQISDRPSAVKQEARGGSRQEQARRKKMSRAQDGILKYMLKM  133

Query  569  MEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MEVC AQGFVYGIIPE GKPV+GASDNLR WWK+KVRFD NGPA
Sbjct  134  MEVCNAQGFVYGIIPENGKPVTGASDNLRAWWKEKVRFDRNGPA  177



>ref|XP_009609268.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like, partial [Nicotiana 
tomentosiformis]
Length=218

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/68 (97%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  497  SQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKV  676
            SQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPV GASDNLREWWKDKV
Sbjct  1    SQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVGGASDNLREWWKDKV  60

Query  677  RFDXNGPA  700
            RFD NGPA
Sbjct  61   RFDRNGPA  68



>ref|XP_009389151.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
 ref|XP_009389152.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
Length=604

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD+M+LKRLKE  ++K  E  D +K+   +S EQARRKKMSRAQDGILKYMLKMME
Sbjct  76   RRMWRDRMRLKRLKEQHQNKNKEQGDASKQY--QSLEQARRKKMSRAQDGILKYMLKMME  133

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VC AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGP 
Sbjct  134  VCNAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPV  175



>ref|XP_006347695.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Solanum tuberosum]
Length=604

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 86/102 (84%), Gaps = 4/102 (4%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRD+M L+RLKE +K+KE         +  +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  54   RRMWRDRMLLRRLKEKNKNKEVGDGV----KQRQSQEQARRKKMSRAQDGILKYMLKMME  109

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VC AQGFVYGIIPEKGKPV+GASDNLR WWK+KVRFD NGPA
Sbjct  110  VCNAQGFVYGIIPEKGKPVTGASDNLRAWWKEKVRFDRNGPA  151



>ref|XP_008653495.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Zea mays]
 tpg|DAA64176.1| TPA: hypothetical protein ZEAMMB73_182677 [Zea mays]
 gb|AIB05505.1| EIL transcription factor, partial [Zea mays]
Length=586

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 83/105 (79%), Gaps = 3/105 (3%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNK---SQEQARRKKMSRAQDGILKYMLK  565
            RRMWRD+++L+RLKE  +          +   ++   SQEQARRKKMSRAQDGILKYMLK
Sbjct  73   RRMWRDRVRLRRLKEQQQQSGRPSGGKHEASRSRQRQSQEQARRKKMSRAQDGILKYMLK  132

Query  566  MMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            MMEVC AQGFVYGIIPE GKPV+GASDNLR WWK+KVRFD NGPA
Sbjct  133  MMEVCNAQGFVYGIIPENGKPVTGASDNLRAWWKEKVRFDRNGPA  177



>ref|XP_009406830.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
Length=615

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            +RMWRD+M+LKRLKE  +SK  E  D  K+   +S EQARRKKMSRAQDGILKYMLKMME
Sbjct  76   QRMWRDRMRLKRLKEHQQSKSREQGDAFKQ--CQSLEQARRKKMSRAQDGILKYMLKMME  133

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VC AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  134  VCNAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA  175



>gb|KHN33326.1| ETHYLENE INSENSITIVE 3-like 3 protein [Glycine soja]
Length=468

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMW+D++KLKRLKE  K +  +  +   ++  +S +QARRKKMSRAQDGILKYMLK+ME
Sbjct  42   RRMWKDRIKLKRLKEKQKLEAQQAAEK--QKPRQSSDQARRKKMSRAQDGILKYMLKLME  99

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKA+GFVYGIIPEKGKPVSG+SDN+R WWK+KVRFD NGPA
Sbjct  100  VCKARGFVYGIIPEKGKPVSGSSDNIRAWWKEKVRFDKNGPA  141



>gb|AAP04001.1| EIL5 [Nicotiana tabacum]
Length=608

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 106/160 (66%), Gaps = 9/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGF  + +    PL    D+                 E+   D+        RR
Sbjct  1    MMMFEEMGFPGNFEFMSDPLGCGGDVAQEVEHKPTGVEENYSDEEMDVDELE------RR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWR +M  +RLKE +K+KE  G+   +R+   SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWRYRMLWRRLKEKNKNKEVGGDGAKQRQ---SQEQARRKKMSRAQDGILKYMLKMMEVC  111

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
             AQGFVYGIIPEKGKPV+GASDNLR WWK+KVRFD NGPA
Sbjct  112  NAQGFVYGIIPEKGKPVTGASDNLRAWWKEKVRFDRNGPA  151



>ref|XP_009759370.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
Length=608

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 106/160 (66%), Gaps = 9/160 (6%)
 Frame = +2

Query  221  MMMFDDMGFCNDLDSFLAPLKEPADmvapppgaepeaavvveveddysddemdmeeleRR  400
            MMMF++MGF  + +    PL    D+                 E+   D+        RR
Sbjct  1    MMMFEEMGFPGNFEFMSDPLGCGGDVAQEVEHKPTGVEENYSDEEMDVDELE------RR  54

Query  401  MWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC  580
            MWR +M  +RLKE +K+KE  G+   +R+   SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct  55   MWRYRMLWRRLKEKNKNKEVGGDGAKQRQ---SQEQARRKKMSRAQDGILKYMLKMMEVC  111

Query  581  KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
             AQGFVYGIIPEKGKPV+GASDNLR WWK+KVRFD NGPA
Sbjct  112  NAQGFVYGIIPEKGKPVTGASDNLRAWWKEKVRFDRNGPA  151



>ref|XP_002445904.1| hypothetical protein SORBIDRAFT_07g027790 [Sorghum bicolor]
 gb|EES15399.1| hypothetical protein SORBIDRAFT_07g027790 [Sorghum bicolor]
Length=618

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMW+DK+KLKR++E  +    +  +  K +T K  +QA RKKM+RAQDGILKYMLK+ME
Sbjct  43   RRMWKDKVKLKRIRERQQKLALQRLELEKSKTKKISDQALRKKMTRAQDGILKYMLKLME  102

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VC A+GFVYGIIPEKGKPVSGASDN+REWWK+KV+FD NGPA
Sbjct  103  VCNARGFVYGIIPEKGKPVSGASDNIREWWKEKVKFDKNGPA  144



>ref|XP_002299248.2| ETHYLENE-INSENSITIVE3-like 3 family protein [Populus trichocarpa]
 gb|EEE84053.2| ETHYLENE-INSENSITIVE3-like 3 family protein [Populus trichocarpa]
Length=596

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 86/102 (84%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMW+D++KLKRLKE  K    +  +   ++  ++ +QARRKKMSRAQDGILKYMLK+ME
Sbjct  42   RRMWKDRIKLKRLKEKQKLAAQQAAEK--QKPKQTSDQARRKKMSRAQDGILKYMLKLME  99

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKA+GFVYGIIPEKGKPVSGASDN+R WWK+KVRFD NGPA
Sbjct  100  VCKARGFVYGIIPEKGKPVSGASDNIRAWWKEKVRFDKNGPA  141



>ref|XP_011037881.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein [Populus euphratica]
Length=596

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 86/102 (84%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMW+D++KLKRLKE  K    +  +   ++  ++ +QARRKKMSRAQDGILKYMLK+ME
Sbjct  42   RRMWKDRIKLKRLKEKQKLAAQQAAEK--QKPKQTSDQARRKKMSRAQDGILKYMLKLME  99

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKA+GFVYGIIPEKGKPVSGASDN+R WWK+KVRFD NGPA
Sbjct  100  VCKARGFVYGIIPEKGKPVSGASDNIRAWWKEKVRFDKNGPA  141



>gb|ACR38732.1| unknown [Zea mays]
 tpg|DAA47967.1| TPA: hypothetical protein ZEAMMB73_482363 [Zea mays]
Length=632

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMW+DK+KLKR++E  +    +  +  K +T K  +QA RKKM+RAQDGILKYMLK+ME
Sbjct  44   RRMWKDKVKLKRIRERQQKLALQRLELEKTKTKKISDQALRKKMTRAQDGILKYMLKLME  103

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VC A+GFVYGIIPEKGKPVSGASDN+R WWKDKV+FD NGPA
Sbjct  104  VCNARGFVYGIIPEKGKPVSGASDNIRAWWKDKVKFDKNGPA  145



>ref|NP_001060678.1| Os07g0685700 [Oryza sativa Japonica Group]
 dbj|BAC10338.1| putative transcription factor OsEIL2 [Oryza sativa Japonica Group]
 dbj|BAB78463.2| ethylene-insensitive-3-like protein [Oryza sativa Japonica Group]
 dbj|BAF22592.1| Os07g0685700 [Oryza sativa Japonica Group]
 dbj|BAG87565.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67841.1| hypothetical protein OsJ_25629 [Oryza sativa Japonica Group]
 gb|ADX60245.1| EIL transcription factor [Oryza sativa Japonica Group]
Length=593

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 85/107 (79%), Gaps = 5/107 (5%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETN-----KSQEQARRKKMSRAQDGILKYM  559
            RRMWRD+++ KRLKE+ +S+ G                +SQEQARRKKMSRAQDGILKYM
Sbjct  85   RRMWRDRVRHKRLKELQQSRAGRESRAGDAGGGGRQQRQSQEQARRKKMSRAQDGILKYM  144

Query  560  LKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            LKMMEVC AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  145  LKMMEVCNAQGFVYGIIPEKGKPVSGASDNLRSWWKEKVRFDRNGPA  191



>gb|EEC82710.1| hypothetical protein OsI_27382 [Oryza sativa Indica Group]
Length=592

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 85/107 (79%), Gaps = 5/107 (5%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETN-----KSQEQARRKKMSRAQDGILKYM  559
            RRMWRD+++ KRLKE+ +S+ G                +SQEQARRKKMSRAQDGILKYM
Sbjct  84   RRMWRDRVRHKRLKELQQSRAGRESRAGDAGGGGRQQRQSQEQARRKKMSRAQDGILKYM  143

Query  560  LKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            LKMMEVC AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct  144  LKMMEVCNAQGFVYGIIPEKGKPVSGASDNLRSWWKEKVRFDRNGPA  190



>emb|CDP16004.1| unnamed protein product [Coffea canephora]
Length=608

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 85/102 (83%), Gaps = 3/102 (3%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMWRDKM L++LK   K KEG  +     + ++SQEQARRKKMSRAQDGILKYMLKMME
Sbjct  49   RRMWRDKMLLRKLKGQKKIKEGVDDGM---KQHQSQEQARRKKMSRAQDGILKYMLKMME  105

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKAQGFVYGIIPE GKPV+GASDNLR WWK+KVRFD N PA
Sbjct  106  VCKAQGFVYGIIPENGKPVTGASDNLRAWWKEKVRFDRNAPA  147



>ref|XP_006597241.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein-like [Glycine 
max]
Length=590

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMW+D++KLKRLKE  K +  +  +   ++  +S +QARRKKMSRAQDGILKYMLK+ME
Sbjct  42   RRMWKDRIKLKRLKEKQKLEAQQAAEK--QKPRQSSDQARRKKMSRAQDGILKYMLKLME  99

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKA+GFVYGIIPEKGKPVSG+SDN+R WWK+KVRFD NGPA
Sbjct  100  VCKARGFVYGIIPEKGKPVSGSSDNIRAWWKEKVRFDKNGPA  141



>gb|KHN30114.1| ETHYLENE INSENSITIVE 3-like 3 protein [Glycine soja]
Length=591

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMW+D++KLKRLKE  K +  +  +   ++  +S +QARRKKMSRAQDGILKYMLK+ME
Sbjct  42   RRMWKDRIKLKRLKEKQKLEAQQAAEK--QKPRQSSDQARRKKMSRAQDGILKYMLKLME  99

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKA+GFVYGIIPEKGKPVSG+SDN+R WWK+KVRFD NGPA
Sbjct  100  VCKARGFVYGIIPEKGKPVSGSSDNIRAWWKEKVRFDKNGPA  141



>ref|XP_003543551.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein-like isoform 
X1 [Glycine max]
 ref|XP_006595052.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein-like isoform 
X2 [Glycine max]
Length=591

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMW+D++KLKRLKE  K +  +  +   ++  +S +QARRKKMSRAQDGILKYMLK+ME
Sbjct  42   RRMWKDRIKLKRLKEKQKLEAQQAAEK--QKPRQSSDQARRKKMSRAQDGILKYMLKLME  99

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKA+GFVYGIIPEKGKPVSG+SDN+R WWK+KVRFD NGPA
Sbjct  100  VCKARGFVYGIIPEKGKPVSGSSDNIRAWWKEKVRFDKNGPA  141



>ref|XP_004958734.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein-like [Setaria 
italica]
Length=624

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 84/103 (82%), Gaps = 1/103 (1%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedg-akRETNKSQEQARRKKMSRAQDGILKYMLKMM  571
            RR+WRD+++L+RLKE    ++  G  G       +SQEQARRKKMSRAQDGILKYMLKMM
Sbjct  74   RRIWRDRVRLRRLKEQQLQQQRGGGRGKEVPRARQSQEQARRKKMSRAQDGILKYMLKMM  133

Query  572  EVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            EVC AQGFVYGIIPE GKPV+GASDNLR WWK+KVRFD NGPA
Sbjct  134  EVCSAQGFVYGIIPENGKPVTGASDNLRAWWKEKVRFDRNGPA  176



>ref|XP_009788578.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X2 [Nicotiana 
sylvestris]
Length=659

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 86/102 (84%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMW+D++KLKRLKE  K    +  D   ++  ++ +QARRKKMSRAQDGILKYMLK+ME
Sbjct  42   RRMWKDRVKLKRLKERQKLAAQQAADK--QKNKQTTDQARRKKMSRAQDGILKYMLKLME  99

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKA+GFVYGIIPEKGKPVSGASDN+R WWK+KV+FD NGPA
Sbjct  100  VCKARGFVYGIIPEKGKPVSGASDNIRAWWKEKVKFDKNGPA  141



>ref|XP_009788577.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X1 [Nicotiana 
sylvestris]
Length=661

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 86/102 (84%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMW+D++KLKRLKE  K    +  D   ++  ++ +QARRKKMSRAQDGILKYMLK+ME
Sbjct  44   RRMWKDRVKLKRLKERQKLAAQQAADK--QKNKQTTDQARRKKMSRAQDGILKYMLKLME  101

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKA+GFVYGIIPEKGKPVSGASDN+R WWK+KV+FD NGPA
Sbjct  102  VCKARGFVYGIIPEKGKPVSGASDNIRAWWKEKVKFDKNGPA  143



>ref|XP_009602832.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X2 [Nicotiana 
tomentosiformis]
Length=663

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 86/102 (84%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMW+D++KLKRLKE  K    +  D   ++  ++ +QARRKKMSRAQDGILKYMLK+ME
Sbjct  42   RRMWKDRVKLKRLKERQKLAAQQAADK--QKNKQTTDQARRKKMSRAQDGILKYMLKLME  99

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKA+GFVYGIIPEKGKPVSGASDN+R WWK+KV+FD NGPA
Sbjct  100  VCKARGFVYGIIPEKGKPVSGASDNIRAWWKEKVKFDKNGPA  141



>ref|XP_009602831.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X1 [Nicotiana 
tomentosiformis]
Length=665

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 86/102 (84%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMW+D++KLKRLKE  K    +  D   ++  ++ +QARRKKMSRAQDGILKYMLK+ME
Sbjct  44   RRMWKDRVKLKRLKERQKLAAQQAADK--QKNKQTTDQARRKKMSRAQDGILKYMLKLME  101

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKA+GFVYGIIPEKGKPVSGASDN+R WWK+KV+FD NGPA
Sbjct  102  VCKARGFVYGIIPEKGKPVSGASDNIRAWWKEKVKFDKNGPA  143



>ref|XP_009364709.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein [Pyrus x bretschneideri]
 ref|XP_009364710.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein [Pyrus x bretschneideri]
 ref|XP_009364711.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein [Pyrus x bretschneideri]
 ref|XP_009364712.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein [Pyrus x bretschneideri]
Length=607

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMW+D++KLKRLKE  K +  +  +   ++  ++ +QARRKKMSRAQDGILKYMLK+ME
Sbjct  41   RRMWKDRIKLKRLKERQKLEAQQAAEK--QKPKQTTDQARRKKMSRAQDGILKYMLKLME  98

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKA+GFVYGIIPEKGKPVSGASDN+R WWK+KV+FD NGPA
Sbjct  99   VCKARGFVYGIIPEKGKPVSGASDNIRAWWKEKVKFDKNGPA  140



>ref|XP_009364731.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein [Pyrus x bretschneideri]
 ref|XP_009364732.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein [Pyrus x bretschneideri]
 ref|XP_009364733.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein [Pyrus x bretschneideri]
 ref|XP_009364734.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein [Pyrus x bretschneideri]
Length=607

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMW+D++KLKRLKE  K +  +  +   ++  ++ +QARRKKMSRAQDGILKYMLK+ME
Sbjct  41   RRMWKDRIKLKRLKERQKLEAQQAAEK--QKPKQTTDQARRKKMSRAQDGILKYMLKLME  98

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKA+GFVYGIIPEKGKPVSGASDN+R WWK+KV+FD NGPA
Sbjct  99   VCKARGFVYGIIPEKGKPVSGASDNIRAWWKEKVKFDKNGPA  140



>ref|XP_007150399.1| hypothetical protein PHAVU_005G150100g [Phaseolus vulgaris]
 gb|ESW22393.1| hypothetical protein PHAVU_005G150100g [Phaseolus vulgaris]
Length=592

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 86/102 (84%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMW+D++KLKRLKE  K    +  +   ++  +S +QARRKKMSRAQDGILKYMLK+ME
Sbjct  42   RRMWKDRIKLKRLKERQKLAIQQAAEK--QKPRQSSDQARRKKMSRAQDGILKYMLKLME  99

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKA+GFVYGIIPEKGKPVSG+SDN+R WWK+KV+FD NGPA
Sbjct  100  VCKARGFVYGIIPEKGKPVSGSSDNIRAWWKEKVKFDKNGPA  141



>ref|XP_004295232.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein [Fragaria vesca 
subsp. vesca]
Length=593

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 86/102 (84%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMW+D++KLKR+KE  K +     +   ++  +S +QARRKKMSRAQDGILKYMLK+ME
Sbjct  41   RRMWKDRIKLKRIKEKQKLEAQMAAEK--QKPKQSSDQARRKKMSRAQDGILKYMLKLME  98

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKA+GFVYGIIPEKGKPVSGASDN+R WWK+KV+FD NGPA
Sbjct  99   VCKARGFVYGIIPEKGKPVSGASDNIRAWWKEKVKFDKNGPA  140



>ref|XP_008384462.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein [Malus domestica]
 ref|XP_008384463.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein [Malus domestica]
Length=606

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = +2

Query  395  RRMWRDKMKLKRLkemskskegegedgakRETNKSQEQARRKKMSRAQDGILKYMLKMME  574
            RRMW+D++KLKRLKE  K +  +  +   ++  ++ +QARRKKMSRAQDGILKYMLK+ME
Sbjct  41   RRMWKDRIKLKRLKERQKLEAQQAAEK--QKPKQTTDQARRKKMSRAQDGILKYMLKLME  98

Query  575  VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA  700
            VCKA+GFVYGIIPEKGKPVSGASDN+R WWK+KV+FD NGPA
Sbjct  99   VCKARGFVYGIIPEKGKPVSGASDNIRAWWKEKVKFDKNGPA  140



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1225614785648