BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7405

Length=761
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011083821.1|  PREDICTED: polyadenylate-binding protein RBP...    214   1e-62   Sesamum indicum [beniseed]
emb|CDP01376.1|  unnamed protein product                                211   9e-62   Coffea canephora [robusta coffee]
ref|XP_004238180.1|  PREDICTED: polyadenylate-binding protein RBP...    206   3e-59   Solanum lycopersicum
ref|XP_003634360.1|  PREDICTED: polyadenylate-binding protein RBP...    200   1e-57   Vitis vinifera
gb|KDO84283.1|  hypothetical protein CISIN_1g037458mg                   192   3e-57   Citrus sinensis [apfelsine]
ref|XP_009764865.1|  PREDICTED: polyadenylate-binding protein RBP...    198   1e-56   Nicotiana sylvestris
ref|XP_009605325.1|  PREDICTED: polyadenylate-binding protein RBP...    197   2e-56   Nicotiana tomentosiformis
ref|XP_006434825.1|  hypothetical protein CICLE_v10001214mg             193   2e-56   
gb|EYU36286.1|  hypothetical protein MIMGU_mgv1a005576mg                198   3e-56   Erythranthe guttata [common monkey flower]
ref|XP_009765294.1|  PREDICTED: polyadenylate-binding protein RBP...    197   5e-56   Nicotiana sylvestris
ref|XP_006354957.1|  PREDICTED: polyadenylate-binding protein RBP...    196   8e-56   Solanum tuberosum [potatoes]
emb|CAC69852.1|  nucleic acid binding protein                           196   8e-56   Nicotiana tabacum [American tobacco]
ref|XP_006434824.1|  hypothetical protein CICLE_v10001214mg             194   9e-56   
ref|XP_009629702.1|  PREDICTED: polyadenylate-binding protein RBP...    195   3e-55   Nicotiana tomentosiformis
ref|XP_006473363.1|  PREDICTED: polyadenylate-binding protein RBP...    194   4e-55   Citrus sinensis [apfelsine]
ref|XP_006434827.1|  hypothetical protein CICLE_v10001214mg             194   4e-55   Citrus clementina [clementine]
ref|XP_007222286.1|  hypothetical protein PRUPE_ppa005903mg             193   1e-54   Prunus persica
ref|XP_008220170.1|  PREDICTED: polyadenylate-binding protein RBP...    193   1e-54   Prunus mume [ume]
ref|XP_008220171.1|  PREDICTED: polyadenylate-binding protein RBP...    193   2e-54   Prunus mume [ume]
ref|XP_009367486.1|  PREDICTED: polyadenylate-binding protein RBP...    190   1e-53   Pyrus x bretschneideri [bai li]
ref|XP_008361011.1|  PREDICTED: polyadenylate-binding protein RBP...    190   1e-53   
ref|XP_008393835.1|  PREDICTED: polyadenylate-binding protein RBP...    190   1e-53   
ref|XP_008357395.1|  PREDICTED: polyadenylate-binding protein RBP...    187   1e-52   
ref|XP_003523906.1|  PREDICTED: polyadenylate-binding protein RBP...    186   2e-52   Glycine max [soybeans]
gb|KJB59840.1|  hypothetical protein B456_009G275200                    186   3e-52   Gossypium raimondii
ref|XP_007017334.1|  RNA-binding protein 47C isoform 6                  182   7e-52   
ref|XP_008444645.1|  PREDICTED: polyadenylate-binding protein RBP...    185   9e-52   Cucumis melo [Oriental melon]
ref|XP_004152729.1|  PREDICTED: polyadenylate-binding protein RBP47     185   9e-52   Cucumis sativus [cucumbers]
gb|KHN22302.1|  Polyadenylate-binding protein RBP47C                    184   1e-51   Glycine soja [wild soybean]
gb|KHG01821.1|  Polyadenylate-binding RBP47C -like protein              183   2e-51   Gossypium arboreum [tree cotton]
gb|KJB58433.1|  hypothetical protein B456_009G209600                    183   3e-51   Gossypium raimondii
ref|XP_007017335.1|  RNA-binding protein 47C isoform 7                  181   4e-51   
ref|XP_007017333.1|  RNA-binding protein 47C isoform 5                  182   5e-51   
ref|XP_003544447.1|  PREDICTED: polyadenylate-binding protein RBP...    183   6e-51   Glycine max [soybeans]
ref|XP_007017332.1|  RNA-binding protein 47C isoform 4                  182   7e-51   
ref|XP_007017330.1|  RNA-binding protein 47C isoform 2                  182   8e-51   
ref|XP_007136663.1|  hypothetical protein PHAVU_009G063200g             182   9e-51   Phaseolus vulgaris [French bean]
gb|EYU25396.1|  hypothetical protein MIMGU_mgv1a006186mg                183   1e-50   Erythranthe guttata [common monkey flower]
gb|KJB63806.1|  hypothetical protein B456_010G017300                    180   1e-50   Gossypium raimondii
ref|XP_002510266.1|  nuclear acid binding protein, putative             182   1e-50   Ricinus communis
gb|KEH40057.1|  polyadenylate-binding protein RBP47C                    179   1e-50   Medicago truncatula
ref|XP_009370171.1|  PREDICTED: polyadenylate-binding protein RBP...    182   2e-50   Pyrus x bretschneideri [bai li]
ref|XP_003528246.1|  PREDICTED: polyadenylate-binding protein RBP...    181   2e-50   
ref|XP_009370172.1|  PREDICTED: polyadenylate-binding protein RBP...    182   2e-50   Pyrus x bretschneideri [bai li]
gb|KJB58432.1|  hypothetical protein B456_009G209600                    182   2e-50   Gossypium raimondii
ref|XP_007017329.1|  RNA-binding protein 47C isoform 1                  181   4e-50   
ref|XP_007017331.1|  RNA-binding protein 47C isoform 3                  181   4e-50   
ref|XP_012071696.1|  PREDICTED: polyadenylate-binding protein RBP...    181   6e-50   Jatropha curcas
gb|KHN04518.1|  Polyadenylate-binding protein RBP47C                    179   6e-50   Glycine soja [wild soybean]
ref|XP_003549410.2|  PREDICTED: polyadenylate-binding protein RBP...    180   6e-50   Glycine max [soybeans]
gb|KJB63805.1|  hypothetical protein B456_010G017300                    180   9e-50   Gossypium raimondii
gb|KHG24367.1|  Polyadenylate-binding RBP47                             179   1e-49   Gossypium arboreum [tree cotton]
gb|KHG27259.1|  Polyadenylate-binding RBP47                             178   2e-49   Gossypium arboreum [tree cotton]
gb|AFK35123.1|  unknown                                                 178   5e-49   Medicago truncatula
gb|KEH40058.1|  polyadenylate-binding protein RBP47C                    178   5e-49   Medicago truncatula
ref|XP_010668311.1|  PREDICTED: polyadenylate-binding protein RBP...    178   8e-49   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS64859.1|  nucleic acid binding protein                            176   8e-49   Genlisea aurea
ref|XP_007160823.1|  hypothetical protein PHAVU_001G019600g             177   9e-49   Phaseolus vulgaris [French bean]
ref|XP_011030480.1|  PREDICTED: polyadenylate-binding protein RBP...    176   2e-48   Populus euphratica
ref|XP_011030472.1|  PREDICTED: polyadenylate-binding protein RBP...    176   2e-48   Populus euphratica
ref|XP_011030463.1|  PREDICTED: polyadenylate-binding protein RBP...    176   2e-48   Populus euphratica
ref|XP_010275610.1|  PREDICTED: polyadenylate-binding protein RBP...    176   2e-48   Nelumbo nucifera [Indian lotus]
ref|XP_011013053.1|  PREDICTED: polyadenylate-binding protein RBP...    176   2e-48   Populus euphratica
ref|XP_011017227.1|  PREDICTED: polyadenylate-binding protein RBP...    176   2e-48   Populus euphratica
ref|XP_010275609.1|  PREDICTED: polyadenylate-binding protein RBP...    176   2e-48   Nelumbo nucifera [Indian lotus]
ref|XP_010525621.1|  PREDICTED: polyadenylate-binding protein RBP...    176   3e-48   Tarenaya hassleriana [spider flower]
gb|KCW68770.1|  hypothetical protein EUGRSUZ_F02369                     175   3e-48   Eucalyptus grandis [rose gum]
gb|KCW68769.1|  hypothetical protein EUGRSUZ_F02369                     176   4e-48   Eucalyptus grandis [rose gum]
ref|XP_010098709.1|  Polyadenylate-binding protein RBP47C               175   4e-48   Morus notabilis
ref|XP_004499084.1|  PREDICTED: polyadenylate-binding protein RBP...    175   5e-48   Cicer arietinum [garbanzo]
ref|XP_010061775.1|  PREDICTED: polyadenylate-binding protein RBP...    176   6e-48   Eucalyptus grandis [rose gum]
ref|XP_004291135.1|  PREDICTED: polyadenylate-binding protein RBP...    175   8e-48   Fragaria vesca subsp. vesca
ref|XP_004501589.1|  PREDICTED: polyadenylate-binding protein RBP...    174   1e-47   Cicer arietinum [garbanzo]
ref|XP_006374988.1|  RNA-binding protein 47                             174   2e-47   
ref|XP_002302445.2|  RNA-binding protein 47                             173   3e-47   
ref|XP_010268853.1|  PREDICTED: polyadenylate-binding protein RBP...    172   8e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010268845.1|  PREDICTED: polyadenylate-binding protein RBP...    171   9e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010647773.1|  PREDICTED: polyadenylate-binding protein RBP...    169   9e-46   Vitis vinifera
ref|XP_008813039.1|  PREDICTED: polyadenylate-binding protein RBP...    166   3e-45   Phoenix dactylifera
ref|XP_008813037.1|  PREDICTED: polyadenylate-binding protein RBP...    166   3e-45   
ref|XP_010907889.1|  PREDICTED: polyadenylate-binding protein RBP47     166   8e-45   Elaeis guineensis
gb|KGN55171.1|  hypothetical protein Csa_4G639100                       165   8e-45   Cucumis sativus [cucumbers]
ref|XP_008452518.1|  PREDICTED: polyadenylate-binding protein RBP...    167   9e-45   Cucumis melo [Oriental melon]
ref|XP_008813036.1|  PREDICTED: polyadenylate-binding protein RBP...    166   1e-44   Phoenix dactylifera
ref|XP_010519119.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    165   3e-44   Tarenaya hassleriana [spider flower]
ref|XP_004141245.1|  PREDICTED: polyadenylate-binding protein RBP...    165   4e-44   Cucumis sativus [cucumbers]
gb|KEH35744.1|  polyadenylate-binding protein RBP47C                    162   4e-44   Medicago truncatula
ref|XP_006393576.1|  hypothetical protein EUTSA_v10011476mg             165   4e-44   
ref|XP_010539063.1|  PREDICTED: polyadenylate-binding protein RBP...    164   6e-44   Tarenaya hassleriana [spider flower]
ref|XP_002285031.1|  PREDICTED: polyadenylate-binding protein RBP...    164   6e-44   Vitis vinifera
emb|CBI32444.3|  unnamed protein product                                162   1e-43   Vitis vinifera
ref|XP_006660711.1|  PREDICTED: polyadenylate-binding protein RBP...    161   2e-43   Oryza brachyantha
ref|XP_011000065.1|  PREDICTED: polyadenylate-binding protein RBP47     162   5e-43   Populus euphratica
ref|NP_001063403.1|  Os09g0462700                                       162   8e-43   
ref|XP_003603009.1|  RNA-binding protein                                161   1e-42   Medicago truncatula
ref|XP_009417617.1|  PREDICTED: polyadenylate-binding protein RBP...    160   1e-42   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAL25353.1|  ACBF-like dna binding protein                          155   1e-42   Platanus x hispanica [London plane tree]
gb|ACF87959.1|  unknown                                                 160   2e-42   Zea mays [maize]
ref|XP_008782206.1|  PREDICTED: polyadenylate-binding protein RBP...    159   2e-42   
ref|XP_008782204.1|  PREDICTED: polyadenylate-binding protein RBP...    160   2e-42   Phoenix dactylifera
gb|AGV54251.1|  RNA binding post-transcriptional regulator csx1 l...    160   2e-42   Phaseolus vulgaris [French bean]
ref|NP_001144988.1|  uncharacterized protein LOC100278143               160   2e-42   Zea mays [maize]
ref|XP_003578248.1|  PREDICTED: polyadenylate-binding protein RBP...    160   2e-42   Brachypodium distachyon [annual false brome]
gb|KCW63816.1|  hypothetical protein EUGRSUZ_G01492                     160   3e-42   Eucalyptus grandis [rose gum]
ref|XP_002313840.2|  RNA-binding protein 47                             160   3e-42   Populus trichocarpa [western balsam poplar]
gb|KJB79290.1|  hypothetical protein B456_013G042300                    157   3e-42   Gossypium raimondii
ref|XP_010066047.1|  PREDICTED: polyadenylate-binding protein RBP47     160   3e-42   
ref|NP_001132004.1|  uncharacterized protein LOC100193409               159   3e-42   Zea mays [maize]
ref|XP_004957051.1|  PREDICTED: polyadenylate-binding protein RBP...    160   4e-42   Setaria italica
ref|XP_008667171.1|  PREDICTED: uncharacterized protein LOC100193...    159   5e-42   Zea mays [maize]
dbj|BAG87507.1|  unnamed protein product                                157   5e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011004995.1|  PREDICTED: polyadenylate-binding protein RBP...    158   1e-41   Populus euphratica
dbj|BAJ85879.1|  predicted protein                                      159   1e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006653468.1|  PREDICTED: polyadenylate-binding protein RBP...    157   2e-41   
ref|XP_008392304.1|  PREDICTED: polyadenylate-binding protein RBP47     158   2e-41   Malus domestica [apple tree]
gb|AFW58430.1|  nucleic acid binding protein                            153   2e-41   
ref|XP_010500273.1|  PREDICTED: polyadenylate-binding protein RBP...    157   2e-41   Camelina sativa [gold-of-pleasure]
ref|NP_001052934.2|  Os04g0449900                                       156   2e-41   
gb|ERN07615.1|  hypothetical protein AMTR_s00157p00080130               154   3e-41   Amborella trichopoda
ref|XP_003529385.1|  PREDICTED: polyadenylate-binding protein RBP...    157   3e-41   Glycine max [soybeans]
ref|XP_009358068.1|  PREDICTED: polyadenylate-binding protein RBP...    156   3e-41   Pyrus x bretschneideri [bai li]
ref|XP_009390905.1|  PREDICTED: polyadenylate-binding protein RBP...    156   3e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB79289.1|  hypothetical protein B456_013G042300                    157   3e-41   Gossypium raimondii
gb|EAY94326.1|  hypothetical protein OsI_16094                          157   4e-41   Oryza sativa Indica Group [Indian rice]
emb|CAH67097.1|  H0818E04.14                                            157   4e-41   Oryza sativa [red rice]
gb|KJB79291.1|  hypothetical protein B456_013G042300                    156   4e-41   Gossypium raimondii
ref|XP_003518846.1|  PREDICTED: polyadenylate-binding protein RBP...    157   5e-41   Glycine max [soybeans]
ref|XP_010461546.1|  PREDICTED: polyadenylate-binding protein RBP...    157   5e-41   Camelina sativa [gold-of-pleasure]
ref|XP_004952707.1|  PREDICTED: polyadenylate-binding protein RBP...    156   6e-41   Setaria italica
ref|XP_002446570.1|  hypothetical protein SORBIDRAFT_06g018280          156   8e-41   Sorghum bicolor [broomcorn]
gb|EPS57677.1|  hypothetical protein M569_17140                         155   8e-41   Genlisea aurea
ref|XP_010926371.1|  PREDICTED: leucine-rich repeat extensin-like...    159   1e-40   Elaeis guineensis
gb|KDO49120.1|  hypothetical protein CISIN_1g013061mg                   153   1e-40   Citrus sinensis [apfelsine]
ref|XP_007156542.1|  hypothetical protein PHAVU_003G294800g             154   1e-40   Phaseolus vulgaris [French bean]
ref|XP_007156541.1|  hypothetical protein PHAVU_003G294800g             154   2e-40   Phaseolus vulgaris [French bean]
gb|ACG32072.1|  nucleic acid binding protein                            154   2e-40   Zea mays [maize]
gb|KDO49118.1|  hypothetical protein CISIN_1g013061mg                   153   2e-40   Citrus sinensis [apfelsine]
emb|CDO97156.1|  unnamed protein product                                155   2e-40   Coffea canephora [robusta coffee]
gb|KDO49121.1|  hypothetical protein CISIN_1g013061mg                   153   2e-40   Citrus sinensis [apfelsine]
gb|KJB47422.1|  hypothetical protein B456_008G025400                    154   2e-40   Gossypium raimondii
sp|Q9LEB3.1|RBP47_NICPL  RecName: Full=Polyadenylate-binding prot...    155   2e-40   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009391347.1|  PREDICTED: polyadenylate-binding protein RBP...    154   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB47423.1|  hypothetical protein B456_008G025400                    154   2e-40   Gossypium raimondii
ref|XP_004230808.1|  PREDICTED: polyadenylate-binding protein RBP47     154   2e-40   Solanum lycopersicum
ref|XP_009380242.1|  PREDICTED: polyadenylate-binding protein RBP...    154   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011623994.1|  PREDICTED: polyadenylate-binding protein RBP47     154   2e-40   Amborella trichopoda
ref|NP_001275480.1|  DNA binding protein ACBF-like                      153   3e-40   Solanum tuberosum [potatoes]
ref|XP_006384437.1|  hypothetical protein POPTR_0004s15080g             154   3e-40   Populus trichocarpa [western balsam poplar]
ref|XP_008678713.1|  PREDICTED: polyadenylate-binding protein RBP...    154   3e-40   Zea mays [maize]
gb|KDO49119.1|  hypothetical protein CISIN_1g013061mg                   153   3e-40   Citrus sinensis [apfelsine]
gb|ACF85767.1|  unknown                                                 154   4e-40   Zea mays [maize]
ref|XP_006423053.1|  hypothetical protein CICLE_v10028454mg             153   4e-40   
ref|NP_001150649.1|  nucleic acid binding protein                       154   4e-40   Zea mays [maize]
ref|XP_006346456.1|  PREDICTED: polyadenylate-binding protein RBP47     154   5e-40   Solanum tuberosum [potatoes]
ref|XP_004975779.1|  PREDICTED: polyadenylate-binding protein RBP...    153   6e-40   Setaria italica
ref|XP_009590296.1|  PREDICTED: polyadenylate-binding protein RBP47     153   8e-40   Nicotiana tomentosiformis
ref|XP_008797245.1|  PREDICTED: polyadenylate-binding protein RBP...    152   8e-40   Phoenix dactylifera
ref|XP_008236618.1|  PREDICTED: polyadenylate-binding protein RBP...    153   9e-40   Prunus mume [ume]
ref|XP_008236617.1|  PREDICTED: polyadenylate-binding protein RBP...    154   9e-40   Prunus mume [ume]
ref|XP_011088289.1|  PREDICTED: polyadenylate-binding protein RBP47     153   1e-39   Sesamum indicum [beniseed]
gb|AAC49850.1|  DNA binding protein ACBF                                153   1e-39   Nicotiana tabacum [American tobacco]
ref|XP_006480131.1|  PREDICTED: polyadenylate-binding protein RBP...    153   1e-39   Citrus sinensis [apfelsine]
gb|KDO49116.1|  hypothetical protein CISIN_1g013061mg                   153   1e-39   Citrus sinensis [apfelsine]
ref|XP_006423054.1|  hypothetical protein CICLE_v10028454mg             153   1e-39   Citrus clementina [clementine]
ref|NP_973984.1|  RNA-binding protein 47C                               150   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007042377.1|  RNA-binding protein 47A                            153   1e-39   
emb|CBI19566.3|  unnamed protein product                                150   1e-39   Vitis vinifera
ref|XP_006648763.1|  PREDICTED: polyadenylate-binding protein RBP...    152   1e-39   
gb|AAB92518.1|  putative RNA binding protein                            153   2e-39   Nicotiana tabacum [American tobacco]
ref|XP_011461514.1|  PREDICTED: polyadenylate-binding protein RBP...    152   2e-39   Fragaria vesca subsp. vesca
gb|KFK31829.1|  hypothetical protein AALP_AA6G163800                    152   2e-39   Arabis alpina [alpine rockcress]
ref|XP_004294842.1|  PREDICTED: polyadenylate-binding protein RBP...    152   2e-39   Fragaria vesca subsp. vesca
gb|KFK31830.1|  hypothetical protein AALP_AA6G163800                    152   2e-39   Arabis alpina [alpine rockcress]
ref|XP_007199852.1|  hypothetical protein PRUPE_ppa005661mg             152   2e-39   Prunus persica
ref|XP_010479152.1|  PREDICTED: polyadenylate-binding protein RBP...    152   2e-39   Camelina sativa [gold-of-pleasure]
emb|CDX95176.1|  BnaC09g16940D                                          152   2e-39   
ref|XP_009794615.1|  PREDICTED: polyadenylate-binding protein RBP...    151   2e-39   Nicotiana sylvestris
ref|XP_002452313.1|  hypothetical protein SORBIDRAFT_04g023540          152   3e-39   Sorghum bicolor [broomcorn]
emb|CDY52067.1|  BnaA09g53390D                                          152   3e-39   Brassica napus [oilseed rape]
ref|XP_009356988.1|  PREDICTED: polyadenylate-binding protein RBP...    152   3e-39   Pyrus x bretschneideri [bai li]
ref|XP_003579863.1|  PREDICTED: polyadenylate-binding protein RBP...    152   3e-39   Brachypodium distachyon [annual false brome]
ref|XP_009114049.1|  PREDICTED: polyadenylate-binding protein RBP...    151   3e-39   Brassica rapa
ref|XP_009794616.1|  PREDICTED: polyadenylate-binding protein RBP...    151   4e-39   Nicotiana sylvestris
ref|XP_002518798.1|  nuclear acid binding protein, putative             151   5e-39   Ricinus communis
ref|XP_012089580.1|  PREDICTED: polyadenylate-binding protein RBP...    151   6e-39   Jatropha curcas
gb|KDP39118.1|  hypothetical protein JCGZ_00875                         150   7e-39   Jatropha curcas
ref|XP_011092727.1|  PREDICTED: polyadenylate-binding protein RBP...    150   8e-39   Sesamum indicum [beniseed]
ref|XP_004145357.2|  PREDICTED: polyadenylate-binding protein RBP47     150   8e-39   Cucumis sativus [cucumbers]
ref|XP_011092726.1|  PREDICTED: polyadenylate-binding protein RBP...    150   8e-39   Sesamum indicum [beniseed]
ref|XP_009404023.1|  PREDICTED: polyadenylate-binding protein RBP...    150   8e-39   
ref|XP_012070803.1|  PREDICTED: polyadenylate-binding protein RBP45C    150   1e-38   Jatropha curcas
gb|EYU42664.1|  hypothetical protein MIMGU_mgv1a008163mg                149   1e-38   Erythranthe guttata [common monkey flower]
ref|XP_008459212.1|  PREDICTED: polyadenylate-binding protein RBP47     150   2e-38   Cucumis melo [Oriental melon]
ref|NP_175180.1|  RNA-binding protein 47C                               149   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307520.1|  hypothetical protein CARUB_v10009143mg             149   2e-38   Capsella rubella
gb|KFK36144.1|  hypothetical protein AALP_AA4G083000                    149   3e-38   Arabis alpina [alpine rockcress]
ref|XP_002863750.1|  hypothetical protein ARALYDRAFT_331131             148   4e-38   
ref|XP_002891364.1|  ATRBP47C                                           149   5e-38   
ref|XP_004234481.1|  PREDICTED: polyadenylate-binding protein RBP...    148   6e-38   Solanum lycopersicum
ref|XP_006349627.1|  PREDICTED: polyadenylate-binding protein RBP...    148   8e-38   Solanum tuberosum [potatoes]
ref|XP_003575198.1|  PREDICTED: polyadenylate-binding protein RBP...    148   8e-38   Brachypodium distachyon [annual false brome]
ref|XP_006349628.1|  PREDICTED: polyadenylate-binding protein RBP...    148   8e-38   Solanum tuberosum [potatoes]
gb|ACN40970.1|  unknown                                                 148   8e-38   Picea sitchensis
gb|ACN39849.1|  unknown                                                 148   8e-38   Picea sitchensis
ref|XP_006343293.1|  PREDICTED: polyadenylate-binding protein RBP...    147   9e-38   Solanum tuberosum [potatoes]
ref|XP_010494212.1|  PREDICTED: polyadenylate-binding protein RBP...    147   1e-37   Camelina sativa [gold-of-pleasure]
ref|NP_001275430.1|  DNA-binding protein-like                           147   1e-37   Solanum tuberosum [potatoes]
ref|XP_002979510.1|  hypothetical protein SELMODRAFT_111082             147   1e-37   
ref|XP_002973844.1|  hypothetical protein SELMODRAFT_100454             146   1e-37   
ref|XP_010327389.1|  PREDICTED: DNA-binding protein isoform X1          147   1e-37   
ref|XP_004505196.1|  PREDICTED: polyadenylate-binding protein RBP...    147   1e-37   Cicer arietinum [garbanzo]
ref|XP_010327390.1|  PREDICTED: DNA-binding protein isoform X2          147   1e-37   Solanum lycopersicum
ref|XP_010523211.1|  PREDICTED: polyadenylate-binding protein RBP...    147   1e-37   Tarenaya hassleriana [spider flower]
ref|XP_002977811.1|  hypothetical protein SELMODRAFT_232989             147   1e-37   
ref|XP_003608019.1|  RNA Binding Protein                                147   2e-37   Medicago truncatula
ref|NP_001234487.1|  DNA-binding protein                                147   2e-37   
gb|AFK40720.1|  unknown                                                 147   2e-37   Medicago truncatula
emb|CDY16528.1|  BnaA08g02390D                                          147   2e-37   Brassica napus [oilseed rape]
ref|XP_009107272.1|  PREDICTED: polyadenylate-binding protein RBP...    147   2e-37   Brassica rapa
ref|XP_010481964.1|  PREDICTED: polyadenylate-binding protein RBP...    147   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002885294.1|  RNA-binding protein 47B                            146   3e-37   
ref|XP_009789022.1|  PREDICTED: polyadenylate-binding protein RBP...    146   3e-37   Nicotiana sylvestris
ref|XP_010540323.1|  PREDICTED: polyadenylate-binding protein RBP47B    146   3e-37   Tarenaya hassleriana [spider flower]
ref|XP_001777334.1|  predicted protein                                  145   5e-37   
ref|XP_010278713.1|  PREDICTED: polyadenylate-binding protein RBP...    143   5e-37   Nelumbo nucifera [Indian lotus]
ref|NP_175181.1|  RNA-binding protein 47C'                              145   6e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CDX92304.1|  BnaA05g21030D                                          145   6e-37   
gb|AAM67293.1|  nuclear acid binding protein, putative                  145   6e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004288602.1|  PREDICTED: polyadenylate-binding protein RBP...    145   8e-37   Fragaria vesca subsp. vesca
ref|XP_007015034.1|  RNA-binding family protein isoform 2               145   8e-37   
ref|XP_007015035.1|  RNA-binding family protein isoform 3               145   9e-37   
emb|CDY50959.1|  BnaA06g37550D                                          145   9e-37   Brassica napus [oilseed rape]
gb|EYU37704.1|  hypothetical protein MIMGU_mgv1a006826mg                145   9e-37   Erythranthe guttata [common monkey flower]
ref|XP_009147873.1|  PREDICTED: polyadenylate-binding protein RBP47A    145   9e-37   Brassica rapa
emb|CDX99265.1|  BnaC05g33800D                                          145   9e-37   
ref|NP_188544.1|  RNA-binding protein 47B                               145   9e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406534.1|  hypothetical protein EUTSA_v10020763mg             142   9e-37   
emb|CDY28101.1|  BnaC06g02820D                                          145   1e-36   Brassica napus [oilseed rape]
ref|XP_010442131.1|  PREDICTED: polyadenylate-binding protein RBP...    145   1e-36   Camelina sativa [gold-of-pleasure]
ref|NP_175383.1|  RNA-binding protein 47A                               145   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500505.1|  PREDICTED: polyadenylate-binding protein RBP...    145   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010461802.1|  PREDICTED: polyadenylate-binding protein RBP...    145   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010479396.1|  PREDICTED: polyadenylate-binding protein RBP...    145   1e-36   Camelina sativa [gold-of-pleasure]
dbj|BAB02953.1|  DNA/RNA binding protein-like                           145   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009145825.1|  PREDICTED: polyadenylate-binding protein RBP...    144   1e-36   Brassica rapa
ref|XP_010278711.1|  PREDICTED: polyadenylate-binding protein RBP...    144   2e-36   Nelumbo nucifera [Indian lotus]
ref|XP_002894197.1|  hypothetical protein ARALYDRAFT_474095             145   2e-36   
ref|XP_010673626.1|  PREDICTED: polyadenylate-binding protein RBP...    144   2e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007147735.1|  hypothetical protein PHAVU_006G150400g             144   2e-36   Phaseolus vulgaris [French bean]
ref|XP_009595795.1|  PREDICTED: polyadenylate-binding protein RBP...    144   2e-36   Nicotiana tomentosiformis
gb|AGV54881.1|  RNA-binding post-transcriptional regulator csx1-l...    144   2e-36   Phaseolus vulgaris [French bean]
ref|XP_010278708.1|  PREDICTED: polyadenylate-binding protein RBP...    144   2e-36   Nelumbo nucifera [Indian lotus]
gb|AAG13046.1|AC011807_5  Putative RNA binding protein                  144   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001784132.1|  predicted protein                                  144   3e-36   
ref|XP_009631415.1|  PREDICTED: polyadenylate-binding protein RBP...    143   3e-36   Nicotiana tomentosiformis
ref|XP_009631416.1|  PREDICTED: polyadenylate-binding protein RBP...    143   3e-36   Nicotiana tomentosiformis
ref|XP_004232721.1|  PREDICTED: polyadenylate-binding protein RBP45     143   3e-36   Solanum lycopersicum
gb|KJB09397.1|  hypothetical protein B456_001G139100                    143   3e-36   Gossypium raimondii
gb|KDO61276.1|  hypothetical protein CISIN_1g014513mg                   143   3e-36   Citrus sinensis [apfelsine]
gb|KHN46301.1|  Polyadenylate-binding protein RBP47C                    141   3e-36   Glycine soja [wild soybean]
ref|XP_009631417.1|  PREDICTED: polyadenylate-binding protein RBP...    143   3e-36   
gb|KFK39248.1|  hypothetical protein AALP_AA3G219800                    144   3e-36   Arabis alpina [alpine rockcress]
ref|XP_010545222.1|  PREDICTED: polyadenylate-binding protein RBP...    143   4e-36   Tarenaya hassleriana [spider flower]
ref|XP_010507452.1|  PREDICTED: polyadenylate-binding protein RBP...    144   4e-36   Camelina sativa [gold-of-pleasure]
gb|KFK35996.1|  hypothetical protein AALP_AA4G064500                    144   4e-36   Arabis alpina [alpine rockcress]
gb|KFK39249.1|  hypothetical protein AALP_AA3G219800                    143   4e-36   Arabis alpina [alpine rockcress]
ref|XP_010507446.1|  PREDICTED: polyadenylate-binding protein RBP...    144   4e-36   Camelina sativa [gold-of-pleasure]
ref|XP_009776437.1|  PREDICTED: polyadenylate-binding protein RBP...    143   4e-36   Nicotiana sylvestris
ref|XP_009776429.1|  PREDICTED: polyadenylate-binding protein RBP...    143   4e-36   Nicotiana sylvestris
ref|XP_006446110.1|  hypothetical protein CICLE_v10015576mg             142   4e-36   
gb|KJB09398.1|  hypothetical protein B456_001G139100                    142   4e-36   Gossypium raimondii
ref|NP_001130489.1|  uncharacterized protein LOC100191587               143   5e-36   Zea mays [maize]
emb|CDY32840.1|  BnaC08g02620D                                          143   5e-36   Brassica napus [oilseed rape]
ref|XP_009614215.1|  PREDICTED: polyadenylate-binding protein RBP...    142   5e-36   Nicotiana tomentosiformis
ref|XP_002285479.1|  PREDICTED: polyadenylate-binding protein RBP...    143   5e-36   Vitis vinifera
gb|KDO61275.1|  hypothetical protein CISIN_1g014513mg                   143   5e-36   Citrus sinensis [apfelsine]
gb|KJB09396.1|  hypothetical protein B456_001G139100                    143   6e-36   Gossypium raimondii
emb|CBI16387.3|  unnamed protein product                                143   6e-36   Vitis vinifera
ref|XP_010265752.1|  PREDICTED: polyadenylate-binding protein RBP...    143   6e-36   Nelumbo nucifera [Indian lotus]
ref|XP_006307519.1|  hypothetical protein CARUB_v10009142mg             143   6e-36   
ref|XP_010265753.1|  PREDICTED: polyadenylate-binding protein RBP...    143   6e-36   
emb|CDP04386.1|  unnamed protein product                                140   6e-36   
ref|XP_010327242.1|  PREDICTED: polyadenylate-binding protein RBP...    141   7e-36   
ref|XP_007209154.1|  hypothetical protein PRUPE_ppa005940mg             142   7e-36   
ref|XP_010276065.1|  PREDICTED: polyadenylate-binding protein RBP...    142   8e-36   
ref|XP_012089988.1|  PREDICTED: polyadenylate-binding protein RBP...    142   8e-36   
ref|XP_010276064.1|  PREDICTED: polyadenylate-binding protein RBP...    142   8e-36   
ref|XP_010466046.1|  PREDICTED: polyadenylate-binding protein RBP...    142   8e-36   
gb|KHG09232.1|  Polyadenylate-binding RBP47B' -like protein             142   9e-36   
gb|KJB81765.1|  hypothetical protein B456_013G160200                    139   1e-35   
gb|KJB32440.1|  hypothetical protein B456_005G240800                    139   1e-35   
gb|KJB32439.1|  hypothetical protein B456_005G240800                    140   1e-35   
ref|XP_011654806.1|  PREDICTED: polyadenylate-binding protein RBP...    141   1e-35   
ref|XP_002313332.2|  hypothetical protein POPTR_0009s05920g             142   1e-35   
ref|XP_003549897.1|  PREDICTED: polyadenylate-binding protein RBP...    142   1e-35   
ref|XP_011025522.1|  PREDICTED: polyadenylate-binding protein RBP...    142   1e-35   
gb|KJB21879.1|  hypothetical protein B456_004G019500                    142   1e-35   
gb|KJB21880.1|  hypothetical protein B456_004G019500                    142   1e-35   
gb|KJB32436.1|  hypothetical protein B456_005G240800                    140   1e-35   
ref|XP_006406535.1|  hypothetical protein EUTSA_v10020763mg             142   1e-35   
ref|XP_008437079.1|  PREDICTED: polyadenylate-binding protein RBP...    142   1e-35   
ref|XP_006348103.1|  PREDICTED: polyadenylate-binding protein RBP...    141   1e-35   
ref|XP_010031800.1|  PREDICTED: polyadenylate-binding protein RBP...    141   2e-35   
gb|KCW70174.1|  hypothetical protein EUGRSUZ_F03462                     138   2e-35   
ref|XP_008812246.1|  PREDICTED: polyadenylate-binding protein RBP...    142   2e-35   
ref|XP_004152401.1|  PREDICTED: polyadenylate-binding protein RBP...    141   2e-35   
ref|XP_008437078.1|  PREDICTED: polyadenylate-binding protein RBP...    141   2e-35   
ref|XP_006393234.1|  hypothetical protein EUTSA_v10011485mg             142   2e-35   
gb|KHN12758.1|  Polyadenylate-binding protein RBP47C                    139   2e-35   
gb|KHG00069.1|  Polyadenylate-binding RBP47B' -like protein             142   2e-35   
ref|XP_011654802.1|  PREDICTED: polyadenylate-binding protein RBP...    141   2e-35   
ref|XP_011654805.1|  PREDICTED: polyadenylate-binding protein RBP...    141   2e-35   
ref|XP_008437076.1|  PREDICTED: polyadenylate-binding protein RBP...    141   2e-35   
ref|XP_010327241.1|  PREDICTED: polyadenylate-binding protein RBP...    141   2e-35   
ref|XP_002513488.1|  nuclear acid binding protein, putative             141   2e-35   
ref|XP_004248403.1|  PREDICTED: polyadenylate-binding protein RBP...    141   2e-35   
gb|KGN50253.1|  hypothetical protein Csa_5G162020                       141   2e-35   
ref|XP_009145104.1|  PREDICTED: polyadenylate-binding protein RBP...    141   2e-35   
ref|XP_010052834.1|  PREDICTED: polyadenylate-binding protein RBP...    139   2e-35   
emb|CDX95462.1|  BnaC01g33540D                                          141   2e-35   
gb|AGV54456.1|  RNA-binding post-transcriptional regulator csx1-l...    140   2e-35   
emb|CDY22988.1|  BnaC03g40810D                                          141   2e-35   
ref|XP_002468416.1|  hypothetical protein SORBIDRAFT_01g045570          141   2e-35   
ref|XP_006297697.1|  hypothetical protein CARUB_v10013726mg             141   2e-35   
ref|XP_006297696.1|  hypothetical protein CARUB_v10013726mg             141   2e-35   
ref|XP_007020874.1|  RNA-binding family protein                         141   2e-35   
gb|KJB32437.1|  hypothetical protein B456_005G240800                    140   2e-35   
gb|ACR34003.1|  unknown                                                 141   3e-35   
ref|XP_007150369.1|  hypothetical protein PHAVU_005G147800g             141   3e-35   
ref|NP_001152183.1|  LOC100285821                                       140   3e-35   
gb|KJB81762.1|  hypothetical protein B456_013G160200                    139   3e-35   
ref|NP_001168324.1|  hypothetical protein                               140   3e-35   
emb|CDY29341.1|  BnaA05g16080D                                          140   3e-35   
ref|XP_008345010.1|  PREDICTED: polyadenylate-binding protein RBP...    141   3e-35   
ref|XP_010052833.1|  PREDICTED: polyadenylate-binding protein RBP...    139   3e-35   
ref|XP_006470600.1|  PREDICTED: polyadenylate-binding protein RBP...    140   3e-35   
ref|XP_009414748.1|  PREDICTED: polyadenylate-binding protein RBP...    141   3e-35   
emb|CDY18570.1|  BnaA01g26250D                                          140   3e-35   
ref|XP_009112131.1|  PREDICTED: polyadenylate-binding protein RBP...    140   4e-35   
gb|KJB81761.1|  hypothetical protein B456_013G160200                    140   4e-35   
ref|XP_009375056.1|  PREDICTED: polyadenylate-binding protein RBP...    140   4e-35   
gb|KFK27100.1|  hypothetical protein AALP_AA8G334500                    140   4e-35   
ref|XP_011010322.1|  PREDICTED: polyadenylate-binding protein RBP...    140   4e-35   
ref|XP_011010320.1|  PREDICTED: polyadenylate-binding protein RBP...    140   4e-35   
gb|KFK27101.1|  hypothetical protein AALP_AA8G334500                    140   4e-35   
gb|KJB81764.1|  hypothetical protein B456_013G160200                    140   4e-35   
gb|KJB32435.1|  hypothetical protein B456_005G240800                    140   5e-35   
ref|XP_006370698.1|  hypothetical protein POPTR_0001s45000g             140   5e-35   
ref|XP_007153936.1|  hypothetical protein PHAVU_003G077700g             140   5e-35   
gb|KJB13665.1|  hypothetical protein B456_002G088100                    140   5e-35   
ref|XP_003597428.1|  RNA-binding protein                                140   5e-35   
ref|XP_010487839.1|  PREDICTED: polyadenylate-binding protein RBP...    140   5e-35   
ref|XP_010938882.1|  PREDICTED: polyadenylate-binding protein RBP...    140   5e-35   
gb|KJB32438.1|  hypothetical protein B456_005G240800                    139   5e-35   
gb|KHG01774.1|  Polyadenylate-binding RBP45C -like protein              140   5e-35   
gb|KJB13664.1|  hypothetical protein B456_002G088100                    140   5e-35   
ref|XP_010487840.1|  PREDICTED: polyadenylate-binding protein RBP...    140   6e-35   
gb|KJB13666.1|  hypothetical protein B456_002G088100                    140   6e-35   
ref|XP_004486966.1|  PREDICTED: polyadenylate-binding protein RBP...    140   6e-35   
ref|XP_002464324.1|  hypothetical protein SORBIDRAFT_01g016170          140   6e-35   
ref|XP_009112124.1|  PREDICTED: polyadenylate-binding protein RBP...    140   6e-35   
ref|XP_006352617.1|  PREDICTED: polyadenylate-binding protein RBP...    140   6e-35   
ref|XP_006352618.1|  PREDICTED: polyadenylate-binding protein RBP...    139   7e-35   
ref|XP_009783557.1|  PREDICTED: polyadenylate-binding protein RBP...    139   7e-35   
ref|XP_006850190.1|  PREDICTED: polyadenylate-binding protein RBP...    140   8e-35   
ref|XP_009783555.1|  PREDICTED: polyadenylate-binding protein RBP...    140   8e-35   
ref|XP_011625480.1|  PREDICTED: polyadenylate-binding protein RBP...    140   8e-35   
ref|XP_010092144.1|  Polyadenylate-binding protein RBP45                140   8e-35   
ref|XP_004486967.1|  PREDICTED: polyadenylate-binding protein RBP...    139   8e-35   
ref|XP_004507695.1|  PREDICTED: polyadenylate-binding protein RBP...    139   9e-35   
ref|XP_009135617.1|  PREDICTED: polyadenylate-binding protein RBP...    139   1e-34   
ref|XP_008238181.1|  PREDICTED: polyadenylate-binding protein RBP...    139   1e-34   
gb|ABR18422.1|  unknown                                                 139   1e-34   
dbj|BAE71189.1|  putative DNA binding protein                           135   1e-34   
ref|XP_004507696.1|  PREDICTED: polyadenylate-binding protein RBP...    138   1e-34   
ref|XP_006413118.1|  hypothetical protein EUTSA_v10025342mg             139   1e-34   
gb|KHN35750.1|  Polyadenylate-binding protein RBP45                     139   1e-34   
ref|XP_010052832.1|  PREDICTED: polyadenylate-binding protein RBP...    139   2e-34   
ref|XP_003529629.1|  PREDICTED: polyadenylate-binding protein RBP45     138   2e-34   
ref|XP_006594429.1|  PREDICTED: polyadenylate-binding protein RBP...    137   2e-34   
ref|XP_003546146.1|  PREDICTED: polyadenylate-binding protein RBP...    138   2e-34   
gb|EPS64177.1|  hypothetical protein M569_10604                         139   2e-34   
ref|XP_003610418.1|  RNA-binding protein                                136   2e-34   
ref|XP_006401514.1|  hypothetical protein EUTSA_v10013710mg             138   3e-34   
gb|EMS68789.1|  Uncharacterized RNA-binding protein C23E6.01c           137   3e-34   
ref|XP_002316998.2|  RNA-binding protein 45                             138   3e-34   
ref|XP_010062999.1|  PREDICTED: polyadenylate-binding protein RBP45C    138   3e-34   
ref|XP_009376881.1|  PREDICTED: polyadenylate-binding protein RBP...    138   3e-34   
ref|XP_006401513.1|  hypothetical protein EUTSA_v10013710mg             138   3e-34   
ref|XP_003610417.1|  RNA-binding protein                                138   3e-34   
ref|XP_010923889.1|  PREDICTED: polyadenylate-binding protein RBP...    138   3e-34   
dbj|BAJ93453.1|  predicted protein                                      138   3e-34   
ref|XP_003543537.1|  PREDICTED: polyadenylate-binding protein RBP...    138   3e-34   
ref|XP_012091369.1|  PREDICTED: polyadenylate-binding protein RBP...    135   3e-34   
ref|XP_004985527.1|  PREDICTED: polyadenylate-binding protein RBP...    138   3e-34   
ref|XP_011030800.1|  PREDICTED: polyadenylate-binding protein RBP...    137   3e-34   
ref|XP_011037672.1|  PREDICTED: polyadenylate-binding protein RBP...    135   3e-34   
gb|KEH36838.1|  polyadenylate-binding protein RBP47B                    135   3e-34   
ref|XP_003543536.1|  PREDICTED: polyadenylate-binding protein RBP...    138   3e-34   
ref|XP_008349848.1|  PREDICTED: polyadenylate-binding protein RBP...    135   4e-34   
ref|XP_011096084.1|  PREDICTED: polyadenylate-binding protein RBP...    138   4e-34   
ref|XP_010108648.1|  Polyadenylate-binding protein RBP47B'              138   4e-34   
ref|XP_011096085.1|  PREDICTED: polyadenylate-binding protein RBP...    137   4e-34   
ref|XP_004982540.1|  PREDICTED: polyadenylate-binding protein RBP...    137   4e-34   
ref|XP_008365193.1|  PREDICTED: polyadenylate-binding protein RBP...    137   4e-34   
ref|XP_009406502.1|  PREDICTED: polyadenylate-binding protein RBP...    137   4e-34   
ref|XP_008377253.1|  PREDICTED: polyadenylate-binding protein RBP...    137   4e-34   
ref|XP_009628458.1|  PREDICTED: polyadenylate-binding protein RBP...    137   4e-34   
ref|XP_009406503.1|  PREDICTED: polyadenylate-binding protein RBP...    137   4e-34   
ref|XP_008226922.1|  PREDICTED: polyadenylate-binding protein RBP45C    137   5e-34   
dbj|BAE71244.1|  putative DNA binding protein                           137   5e-34   
ref|XP_011037673.1|  PREDICTED: polyadenylate-binding protein RBP...    134   5e-34   
gb|EAZ27536.1|  hypothetical protein OsJ_11491                          134   6e-34   
ref|XP_006449040.1|  hypothetical protein CICLE_v10015407mg             135   6e-34   
ref|XP_007213954.1|  hypothetical protein PRUPE_ppa006577mg             137   6e-34   
ref|XP_009372712.1|  PREDICTED: polyadenylate-binding protein RBP...    137   6e-34   
ref|XP_003542872.1|  PREDICTED: polyadenylate-binding protein RBP...    137   6e-34   
gb|AFK41944.1|  unknown                                                 137   6e-34   
gb|KHN37596.1|  Polyadenylate-binding protein RBP45B                    136   7e-34   
gb|ABK25253.1|  unknown                                                 137   7e-34   
ref|XP_012091368.1|  PREDICTED: polyadenylate-binding protein RBP...    135   8e-34   
ref|XP_009772574.1|  PREDICTED: polyadenylate-binding protein RBP...    137   8e-34   
ref|XP_009772575.1|  PREDICTED: polyadenylate-binding protein RBP...    137   8e-34   
ref|XP_009352469.1|  PREDICTED: polyadenylate-binding protein RBP...    136   9e-34   
ref|XP_010665562.1|  PREDICTED: polyadenylate-binding protein RBP...    136   9e-34   
gb|ACF83065.1|  unknown                                                 135   9e-34   
gb|KFK43438.1|  hypothetical protein AALP_AA1G125300                    136   9e-34   
gb|KDO75474.1|  hypothetical protein CISIN_1g015091mg                   134   1e-33   
ref|XP_011037671.1|  PREDICTED: polyadenylate-binding protein RBP...    135   1e-33   
ref|XP_004486120.1|  PREDICTED: polyadenylate-binding protein RBP...    136   1e-33   
ref|XP_004294372.1|  PREDICTED: polyadenylate-binding protein RBP45C    136   1e-33   
ref|XP_006649483.1|  PREDICTED: polyadenylate-binding protein RBP...    136   1e-33   
ref|XP_010675694.1|  PREDICTED: polyadenylate-binding protein RBP45     136   1e-33   
ref|XP_006452315.1|  hypothetical protein CICLE_v10008440mg             134   1e-33   
ref|XP_009420609.1|  PREDICTED: polyadenylate-binding protein RBP45     136   1e-33   
emb|CDX70874.1|  BnaC03g09580D                                          136   1e-33   
ref|XP_002518499.1|  nuclear acid binding protein, putative             136   1e-33   
ref|XP_006449038.1|  hypothetical protein CICLE_v10015407mg             136   2e-33   
ref|XP_008385660.1|  PREDICTED: polyadenylate-binding protein RBP...    135   2e-33   
ref|XP_012091367.1|  PREDICTED: polyadenylate-binding protein RBP...    136   2e-33   
emb|CDX88893.1|  BnaA03g07560D                                          136   2e-33   
gb|KDO75475.1|  hypothetical protein CISIN_1g015091mg                   134   2e-33   
ref|XP_006449039.1|  hypothetical protein CICLE_v10015407mg             135   2e-33   
gb|EEC74608.1|  hypothetical protein OsI_10216                          135   2e-33   
gb|ABF94248.1|  RNA recognition motif family protein, expressed         135   2e-33   
gb|KEH36836.1|  polyadenylate-binding protein RBP47B                    135   2e-33   
ref|XP_010930147.1|  PREDICTED: polyadenylate-binding protein RBP45     135   2e-33   
ref|XP_011097972.1|  PREDICTED: polyadenylate-binding protein RBP...    135   3e-33   
ref|XP_011037670.1|  PREDICTED: polyadenylate-binding protein RBP...    135   3e-33   
gb|EEC75600.1|  hypothetical protein OsI_12307                          135   3e-33   
gb|AAG59664.1|AC084319_22  putative RNA binding protein                 135   3e-33   
gb|ABF97193.1|  RNA recognition motif family protein, expressed         135   3e-33   
ref|NP_001049124.1|  Os03g0174100                                       135   3e-33   
ref|XP_006452313.1|  hypothetical protein CICLE_v10008440mg             135   3e-33   
ref|XP_002305583.2|  RNA-binding protein 45                             135   3e-33   
gb|KEH36837.1|  polyadenylate-binding protein RBP47B                    132   3e-33   
ref|XP_003558701.1|  PREDICTED: polyadenylate-binding protein RBP...    135   3e-33   
gb|AEW68341.1|  putative nuclear acid binding protein                   135   3e-33   
ref|XP_009412453.1|  PREDICTED: polyadenylate-binding protein RBP45     135   3e-33   
ref|XP_002280601.1|  PREDICTED: polyadenylate-binding protein RBP...    135   4e-33   
ref|XP_009137630.1|  PREDICTED: polyadenylate-binding protein RBP...    135   4e-33   
gb|KJB22074.1|  hypothetical protein B456_004G028000                    135   4e-33   
ref|XP_006452314.1|  hypothetical protein CICLE_v10008440mg             135   4e-33   
emb|CDX92786.1|  BnaC07g40440D                                          135   5e-33   
ref|XP_002979028.1|  hypothetical protein SELMODRAFT_418663             134   5e-33   
emb|CDY29263.1|  BnaC01g19150D                                          134   5e-33   
ref|XP_011628461.1|  PREDICTED: polyadenylate-binding protein RBP...    134   5e-33   
gb|KJB69302.1|  hypothetical protein B456_011G015300                    132   5e-33   
ref|XP_007015033.1|  RNA-binding family protein isoform 1               135   6e-33   
ref|XP_011628460.1|  PREDICTED: polyadenylate-binding protein RBP...    134   6e-33   
ref|XP_006468021.1|  PREDICTED: polyadenylate-binding protein RBP...    134   6e-33   
emb|CDY46671.1|  BnaA03g48370D                                          134   6e-33   
ref|NP_001050516.1|  Os03g0569900                                       134   6e-33   
ref|XP_002522953.1|  nuclear acid binding protein, putative             134   7e-33   
ref|XP_006468022.1|  PREDICTED: polyadenylate-binding protein RBP...    134   7e-33   
gb|KFK26199.1|  hypothetical protein AALP_AA8G215500                    134   8e-33   
ref|XP_008796097.1|  PREDICTED: polyadenylate-binding protein RBP45     134   8e-33   
emb|CDY68866.1|  BnaCnng60840D                                          134   8e-33   
sp|Q9LEB4.1|RBP45_NICPL  RecName: Full=Polyadenylate-binding prot...    134   8e-33   
dbj|BAD33940.1|  putative nucleic acid binding protein                  132   8e-33   
ref|XP_010495305.1|  PREDICTED: polyadenylate-binding protein RBP...    134   9e-33   
gb|KHG22988.1|  Polyadenylate-binding RBP45C -like protein              134   9e-33   
ref|XP_010454207.1|  PREDICTED: polyadenylate-binding protein RBP...    134   9e-33   
ref|XP_002871881.1|  hypothetical protein ARALYDRAFT_488820             134   9e-33   
ref|XP_009795696.1|  PREDICTED: polyadenylate-binding protein RBP45     134   9e-33   
ref|NP_001078604.1|  polyadenylate-binding protein RBP47B'              134   9e-33   
ref|XP_009600135.1|  PREDICTED: polyadenylate-binding protein RBP45     134   9e-33   
ref|NP_197436.1|  polyadenylate-binding protein RBP47B'                 134   1e-32   
gb|KJB69305.1|  hypothetical protein B456_011G015300                    131   1e-32   
ref|XP_009418782.1|  PREDICTED: polyadenylate-binding protein RBP...    134   1e-32   
gb|KJB69304.1|  hypothetical protein B456_011G015300                    131   1e-32   
ref|XP_009131734.1|  PREDICTED: polyadenylate-binding protein RBP...    134   1e-32   
ref|XP_006417333.1|  hypothetical protein EUTSA_v10007819mg             133   1e-32   
ref|XP_010536076.1|  PREDICTED: polyadenylate-binding protein RBP...    133   1e-32   
ref|XP_004145107.1|  PREDICTED: polyadenylate-binding protein RBP...    133   2e-32   
gb|ACL54800.1|  unknown                                                 131   2e-32   
emb|CDY19874.1|  BnaC09g31400D                                          133   2e-32   
ref|XP_010536077.1|  PREDICTED: polyadenylate-binding protein RBP...    133   2e-32   
gb|ERN19652.1|  hypothetical protein AMTR_s00062p00161920               133   2e-32   
gb|KFK29206.1|  hypothetical protein AALP_AA7G103000                    132   2e-32   



>ref|XP_011083821.1| PREDICTED: polyadenylate-binding protein RBP47-like [Sesamum 
indicum]
Length=432

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 123/151 (81%), Gaps = 1/151 (1%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  444
            MQYPAAA VMQH MM A      Y P++PH   + PP  Q  ++   GGSNGENRTIW+G
Sbjct  42   MQYPAAAMVMQHGMM-AAPQYVPYHPHNPHQYRYHPPPPQQSKKSNVGGSNGENRTIWVG  100

Query  445  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            DL NWMDEDYLRSCFASTGEV+SIKVIRNKQTGFSEGYGFVEF +HAAAEK LQSY+CI 
Sbjct  101  DLRNWMDEDYLRSCFASTGEVSSIKVIRNKQTGFSEGYGFVEFLTHAAAEKVLQSYSCIA  160

Query  625  MPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            MPNT QLFRLNWATFSMG+KR N GSDLSIF
Sbjct  161  MPNTVQLFRLNWATFSMGDKRSNTGSDLSIF  191



>emb|CDP01376.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   211 bits (536),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 130/159 (82%), Gaps = 8/159 (5%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGG--------SNG  420
            MQYPAAA VM H MMPA HYPPHYMPYH H LHHPPP       QQ           SNG
Sbjct  1    MQYPAAAMVMPHHMMPAPHYPPHYMPYHHHHLHHPPPPQPQGPPQQQQQQQGGGGGGSNG  60

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            ENRTIW+GDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEF+SHAAAEK 
Sbjct  61   ENRTIWVGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFFSHAAAEKV  120

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y CI+MPNT+Q FRLNWATFS G+KR NNGSDLSIF
Sbjct  121  LQAYPCIIMPNTEQPFRLNWATFSTGDKRSNNGSDLSIF  159



>ref|XP_004238180.1| PREDICTED: polyadenylate-binding protein RBP47-like [Solanum 
lycopersicum]
Length=451

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 152/217 (70%), Gaps = 11/217 (5%)
 Frame = +1

Query  82   MQTDKGPESQENKQPPSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqppwv  261
            MQ++ G ESQ+NKQPP    P  +A     A+Q     + A    V  AA A  QQ PWV
Sbjct  1    MQSNNGNESQDNKQPP---PPSSQAATSPAAQQG---VSAAAVVPVAAAAPAGAQQQPWV  54

Query  262  pMQYPAAATVMQHQMMPAT-----hypphympyhphflhhppphaqpqqqqqhGGSNGEN  426
             MQYPAAA VMQH MMPA      + P H   +H    H P   +  QQ    G +N EN
Sbjct  55   AMQYPAAAMVMQHPMMPAPHYPPHYMPFHPQHHHHLIHHPPHSPSPHQQGGGGGSNNNEN  114

Query  427  RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQ  606
            RTIW+GDLHNWMDEDYLRSCFA+T EVASIKVIRNKQTGFSEGYGFVEF++HA+AEK LQ
Sbjct  115  RTIWVGDLHNWMDEDYLRSCFATTNEVASIKVIRNKQTGFSEGYGFVEFFTHASAEKVLQ  174

Query  607  SYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            +Y+C+ MPN +Q FRLNWATFSMG+KR NNGSDLSIF
Sbjct  175  TYSCMTMPNAEQPFRLNWATFSMGDKRANNGSDLSIF  211



>ref|XP_003634360.1| PREDICTED: polyadenylate-binding protein RBP47-like [Vitis vinifera]
Length=418

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 123/151 (81%), Gaps = 2/151 (1%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  444
            MQYPAAA VMQHQMMP  HYP H++ YH     +   H Q  QQQQ  GSN +NRTIW+G
Sbjct  32   MQYPAAAMVMQHQMMPPQHYPQHFVAYHHQPHQYQHQHQQQHQQQQ--GSNADNRTIWVG  89

Query  445  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            DLHNWMDE+YL SCFA+TGE+AS+KVIRNKQTG SEGYGFVEF+SHAAAEK LQ Y  +L
Sbjct  90   DLHNWMDENYLHSCFAATGELASMKVIRNKQTGSSEGYGFVEFFSHAAAEKVLQGYAGVL  149

Query  625  MPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            MPNTDQ FRLNWATFSMG+KR +NG DLSIF
Sbjct  150  MPNTDQPFRLNWATFSMGDKRSDNGPDLSIF  180



>gb|KDO84283.1| hypothetical protein CISIN_1g037458mg, partial [Citrus sinensis]
Length=196

 Score =   192 bits (489),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 118/154 (77%), Gaps = 3/154 (2%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqh---GGSNGENRTI  435
            MQYPAAA VM HQMMP  HYP    PY P+  +        Q QQQ    G   GEN+TI
Sbjct  36   MQYPAAAMVMPHQMMPPQHYPIPPPPYMPYHQYQHHHQPHLQHQQQQQHQGSGGGENKTI  95

Query  436  WIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYT  615
            W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF++HA AEK LQSYT
Sbjct  96   WVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFTHATAEKVLQSYT  155

Query  616  CILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             ILMPNTDQ FRLNWATFS G+KR +NG DLSIF
Sbjct  156  SILMPNTDQPFRLNWATFSTGDKRSDNGPDLSIF  189



>ref|XP_009764865.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Nicotiana 
sylvestris]
Length=423

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 137/212 (65%), Gaps = 30/212 (14%)
 Frame = +1

Query  82   MQTDKGPESQENKQPPSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqppwv  261
            M+T+ GPE+ ENKQP  P  P+  A    +A     VT                 Q PWV
Sbjct  1    METNNGPETPENKQPSPP--PQQAAVSEAEANVVPVVT-----------------QQPWV  41

Query  262  pMQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWI  441
             MQYPAAA VMQH              Y P+  HH     Q QQQ + GGSN ENRTIW+
Sbjct  42   AMQYPAAAMVMQHPPH-----------YIPYHPHHHHHPPQQQQQNRGGGSNNENRTIWV  90

Query  442  GDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCI  621
            GDLHNWMDEDYLR+CFAST EVASIK+IRNK TGF EGYGFVEF SHAAAEK LQ+Y+ +
Sbjct  91   GDLHNWMDEDYLRTCFASTNEVASIKIIRNKHTGFLEGYGFVEFNSHAAAEKVLQTYSSM  150

Query  622  LMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             MPN DQ FRLNWA+FS G+KR NNGS LSIF
Sbjct  151  TMPNADQPFRLNWASFSTGDKRSNNGSGLSIF  182



>ref|XP_009605325.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Nicotiana 
tomentosiformis]
Length=422

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 139/213 (65%), Gaps = 33/213 (15%)
 Frame = +1

Query  82   MQTDKGPESQENKQP-PSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqppw  258
            M+T+ GPE+ ENKQP P P++   EAE    A     VT                 Q PW
Sbjct  1    METNNGPETPENKQPSPPPQQAVSEAE----ANVVPVVT-----------------QQPW  39

Query  259  vpMQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIW  438
            V MQYPAAA VMQH              Y P+  HH     Q QQQ + GGSN ENRTIW
Sbjct  40   VAMQYPAAAMVMQHPPH-----------YIPYHPHHHHHPPQQQQQNKGGGSNNENRTIW  88

Query  439  IGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTC  618
            +GDLHNWMDEDYLR+CFAST EVASIK+IRNK TGF EGYGFVEF SHAAAEK LQ+Y+ 
Sbjct  89   VGDLHNWMDEDYLRTCFASTNEVASIKIIRNKHTGFLEGYGFVEFNSHAAAEKVLQTYSS  148

Query  619  ILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            + MPN DQ FRLNWA+FS G+KR NNGS LSIF
Sbjct  149  MTMPNADQPFRLNWASFSTGDKRSNNGSGLSIF  181



>ref|XP_006434825.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 ref|XP_006434828.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 gb|ESR48065.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 gb|ESR48068.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
Length=289

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 118/154 (77%), Gaps = 3/154 (2%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqh---GGSNGENRTI  435
            MQYPAAA VM HQMMP  HYP    PY P+  +        Q QQQ    G   GEN+TI
Sbjct  35   MQYPAAAMVMPHQMMPPQHYPIPPPPYMPYHQYQHHHQPHLQHQQQQQHQGSGGGENKTI  94

Query  436  WIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYT  615
            W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF++HA AEK LQSYT
Sbjct  95   WVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFTHATAEKVLQSYT  154

Query  616  CILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             ILMPNTDQ FRLNWATFS G+KR +NG DLSIF
Sbjct  155  SILMPNTDQPFRLNWATFSTGDKRSDNGPDLSIF  188



>gb|EYU36286.1| hypothetical protein MIMGU_mgv1a005576mg [Erythranthe guttata]
Length=478

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 142/225 (63%), Gaps = 26/225 (12%)
 Frame = +1

Query  76   LKMQTDKGPESQENKQPPSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqpp  255
            LKMQTD G ESQ        R    E   + D       + G G   V  AAAA      
Sbjct  111  LKMQTDNGSESQ--------RTSSKENNSNND-------SGGGGNSKVAAAAAAAVPGQQ  155

Query  256  wvpMQYPAAATVMQHQMMPA-----------Thypphympyhphflhhppphaqpqqqqq  402
            WV MQYPAAA VM H M+PA            H+P H+ P  P                 
Sbjct  156  WVAMQYPAAAMVMPHGMIPAPHYASPHYMPYHHHPLHHHPPLPPSPLPQHQSGGGNGNGN  215

Query  403  hGGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
             GGSNGENRTIW+GDLHNWMDEDYL +CFASTGEV+SIK+IRNKQTGFSEGYGF+EF SH
Sbjct  216  GGGSNGENRTIWVGDLHNWMDEDYLGNCFASTGEVSSIKIIRNKQTGFSEGYGFIEFLSH  275

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AAAEK LQS++CI MP+TDQ FRLNWA FSMG+KR NNGSDLSIF
Sbjct  276  AAAEKILQSFSCIAMPSTDQPFRLNWAAFSMGDKRPNNGSDLSIF  320



>ref|XP_009765294.1| PREDICTED: polyadenylate-binding protein RBP47-like [Nicotiana 
sylvestris]
Length=456

 Score =   197 bits (500),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 155/223 (70%), Gaps = 21/223 (9%)
 Frame = +1

Query  82   MQTDKGPESQENKQPPSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqppwv  261
            MQ + G ESQENKQ P P+  +  A +     Q+Q V+ G       V      QQ PWV
Sbjct  1    MQKNNGTESQENKQQPPPQPSQPTASQ----PQQQGVSGGT------VVPVVAAQQQPWV  50

Query  262  pMQYPAAATVMQHQMMPAThypphympyhphflhhppph-----------aqpqqqqqhG  408
             MQYPAAA VMQH MMPA HYPPHYMPYHPH  HH   H            Q      + 
Sbjct  51   AMQYPAAAMVMQHPMMPAPHYPPHYMPYHPHHHHHLLHHHPPPPHSPSPHQQQGGGGSNN  110

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
             +N ENRTIW+GDL NWMDEDYLR+CFAST EVASIKVIRNKQTGFSEGYGFVEF++HAA
Sbjct  111  NNNNENRTIWVGDLLNWMDEDYLRNCFASTNEVASIKVIRNKQTGFSEGYGFVEFFTHAA  170

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AEK LQ+Y+C+ MPN DQ FRLNWATFSMG+KR NNGSDLSIF
Sbjct  171  AEKVLQTYSCMTMPNVDQPFRLNWATFSMGDKRANNGSDLSIF  213



>ref|XP_006354957.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Solanum 
tuberosum]
Length=438

 Score =   196 bits (498),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 122/156 (78%), Gaps = 5/156 (3%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAT-----hypphympyhphflhhppphaqpqqqqqhGGSNGENR  429
            MQYPAAA VMQH MMP+      + P H   +H    H P   +  QQ    G +N ENR
Sbjct  43   MQYPAAAMVMQHPMMPSPHYPPHYMPFHPQHHHHLIHHPPHSPSPHQQGGGGGSNNNENR  102

Query  430  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  609
            TIW+GDLHNWMDEDYLRSCFA+T EVASIKVIRNKQTGFSEGYGFVEF++HA+AEK LQ+
Sbjct  103  TIWVGDLHNWMDEDYLRSCFATTNEVASIKVIRNKQTGFSEGYGFVEFFTHASAEKVLQT  162

Query  610  YTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            Y+C+ MPN +Q FRLNWATFSMG+KR+NNGSDLSIF
Sbjct  163  YSCMTMPNAEQPFRLNWATFSMGDKRVNNGSDLSIF  198



>emb|CAC69852.1| nucleic acid binding protein [Nicotiana tabacum]
Length=456

 Score =   196 bits (499),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 155/223 (70%), Gaps = 21/223 (9%)
 Frame = +1

Query  82   MQTDKGPESQENKQPPSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqppwv  261
            MQ + G ESQENKQ P P+  +  A +     Q+Q V+ G       V      QQ PWV
Sbjct  1    MQKNNGTESQENKQQPPPQPSQPTASQ----PQQQGVSGGT------VVPVVAAQQQPWV  50

Query  262  pMQYPAAATVMQHQMMPAThypphympyhphflhhppph-----------aqpqqqqqhG  408
             MQYPAAA VMQH MMPA HYPPHYMPYHPH  HH   H            Q      + 
Sbjct  51   AMQYPAAAMVMQHPMMPAPHYPPHYMPYHPHHHHHLLHHHPPPPHSPSPHQQQGGGGSNN  110

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
             +N ENRTIW+GDL NWMDEDYLR+CFAST EVASIKVIRNKQTGFSEGYGFVEF++HAA
Sbjct  111  NNNNENRTIWVGDLLNWMDEDYLRNCFASTNEVASIKVIRNKQTGFSEGYGFVEFFTHAA  170

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AEK LQ+Y+C+ MPN DQ FRLNWATFSMG+KR NNGSDLSIF
Sbjct  171  AEKVLQTYSCMTMPNVDQPFRLNWATFSMGDKRANNGSDLSIF  213



>ref|XP_006434824.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 ref|XP_006434826.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 gb|ESR48064.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 gb|ESR48066.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
Length=352

 Score =   194 bits (492),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 118/154 (77%), Gaps = 3/154 (2%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqh---GGSNGENRTI  435
            MQYPAAA VM HQMMP  HYP    PY P+  +        Q QQQ    G   GEN+TI
Sbjct  35   MQYPAAAMVMPHQMMPPQHYPIPPPPYMPYHQYQHHHQPHLQHQQQQQHQGSGGGENKTI  94

Query  436  WIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYT  615
            W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF++HA AEK LQSYT
Sbjct  95   WVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFTHATAEKVLQSYT  154

Query  616  CILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             ILMPNTDQ FRLNWATFS G+KR +NG DLSIF
Sbjct  155  SILMPNTDQPFRLNWATFSTGDKRSDNGPDLSIF  188



>ref|XP_009629702.1| PREDICTED: polyadenylate-binding protein RBP47-like [Nicotiana 
tomentosiformis]
Length=456

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 153/224 (68%), Gaps = 23/224 (10%)
 Frame = +1

Query  82   MQTDKGPESQENKQPPSPREPEHEAEKHQDAEQKQAVTTGAGAKvvpvaaaaqqqqppwv  261
            MQ + G ESQENKQPP        ++      Q+Q V+ G       +      QQ PWV
Sbjct  1    MQKNNGTESQENKQPPPQPSQPTASQP-----QQQGVSGGT------IVPVVAAQQQPWV  49

Query  262  pMQYPAAATVMQHQMMPAThypphympyhphflhhppp------------haqpqqqqqh  405
            PMQYPAAA VMQH MMPA HYPPHYMPYHPH  HH                 Q      +
Sbjct  50   PMQYPAAAMVMQHPMMPAPHYPPHYMPYHPHHHHHLLHHHPPPPHSPSPHQQQGGGGSNN  109

Query  406  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  585
              +N ENRTIW+GDL NWMDEDYLR+CFAST EVASIKVIRNKQTGFSEGYGFVEF++HA
Sbjct  110  NNNNNENRTIWVGDLLNWMDEDYLRNCFASTNEVASIKVIRNKQTGFSEGYGFVEFFTHA  169

Query  586  AAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AAEK LQ+Y+C+ MPN DQ FRLNWATFSMG+KR NNGSDLSIF
Sbjct  170  AAEKVLQTYSCMTMPNVDQPFRLNWATFSMGDKRANNGSDLSIF  213



>ref|XP_006473363.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Citrus 
sinensis]
Length=433

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 118/154 (77%), Gaps = 3/154 (2%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqh---GGSNGENRTI  435
            MQYPAAA VM HQMMP  HYP    PY P+  +        Q QQQ    G   GEN+TI
Sbjct  36   MQYPAAAMVMPHQMMPPQHYPIPPPPYMPYHQYQHHHQPHLQHQQQQQHQGSGGGENKTI  95

Query  436  WIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYT  615
            W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF++HA AEK LQSYT
Sbjct  96   WVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFTHATAEKVLQSYT  155

Query  616  CILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             ILMPNTDQ FRLNWATFS G+KR +NG DLSIF
Sbjct  156  SILMPNTDQPFRLNWATFSTGDKRSDNGPDLSIF  189



>ref|XP_006434827.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 gb|ESR48067.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
Length=432

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 118/154 (77%), Gaps = 3/154 (2%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqh---GGSNGENRTI  435
            MQYPAAA VM HQMMP  HYP    PY P+  +        Q QQQ    G   GEN+TI
Sbjct  35   MQYPAAAMVMPHQMMPPQHYPIPPPPYMPYHQYQHHHQPHLQHQQQQQHQGSGGGENKTI  94

Query  436  WIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYT  615
            W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF++HA AEK LQSYT
Sbjct  95   WVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFTHATAEKVLQSYT  154

Query  616  CILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             ILMPNTDQ FRLNWATFS G+KR +NG DLSIF
Sbjct  155  SILMPNTDQPFRLNWATFSTGDKRSDNGPDLSIF  188



>ref|XP_007222286.1| hypothetical protein PRUPE_ppa005903mg [Prunus persica]
 gb|EMJ23485.1| hypothetical protein PRUPE_ppa005903mg [Prunus persica]
Length=438

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 116/156 (74%), Gaps = 5/156 (3%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNGENR  429
            MQYPAAA VMQHQMMP         PP       H       H Q  QQQQ  GS+GEN+
Sbjct  41   MQYPAAAMVMQHQMMPPQHYATPPPPPPQHYMAYHQYQQQQQHVQHLQQQQQLGSSGENK  100

Query  430  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  609
            TIW+GDLH+WMDE+YL +CFASTGE+ASIKVIRNKQT  SEGYGFVEF+SHA AEK LQ+
Sbjct  101  TIWVGDLHHWMDENYLHTCFASTGEIASIKVIRNKQTLLSEGYGFVEFFSHATAEKVLQT  160

Query  610  YTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            YT ILMPNT+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  161  YTGILMPNTEQPFRLNWATFSTGDKRSDNAPDLSIF  196



>ref|XP_008220170.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Prunus mume]
Length=442

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 116/156 (74%), Gaps = 5/156 (3%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNGENR  429
            MQYPAAA VMQHQMMP         PP       H       H Q  QQQQ  GS+GEN+
Sbjct  42   MQYPAAAMVMQHQMMPPQHYATPPPPPPQHYMAYHQYQQQQQHVQHLQQQQQLGSSGENK  101

Query  430  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  609
            TIW+GDLH+WMDE+YL +CFASTGE+ASIKVIRNKQT  SEGYGFVEF+SHA AEK LQ+
Sbjct  102  TIWVGDLHHWMDENYLHTCFASTGEIASIKVIRNKQTLLSEGYGFVEFFSHATAEKVLQT  161

Query  610  YTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            YT ILMPNT+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  162  YTGILMPNTEQPFRLNWATFSTGDKRSDNAPDLSIF  197



>ref|XP_008220171.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Prunus mume]
Length=441

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 116/156 (74%), Gaps = 5/156 (3%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNGENR  429
            MQYPAAA VMQHQMMP         PP       H       H Q  QQQQ  GS+GEN+
Sbjct  42   MQYPAAAMVMQHQMMPPQHYATPPPPPPQHYMAYHQYQQQQQHVQHLQQQQQLGSSGENK  101

Query  430  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  609
            TIW+GDLH+WMDE+YL +CFASTGE+ASIKVIRNKQT  SEGYGFVEF+SHA AEK LQ+
Sbjct  102  TIWVGDLHHWMDENYLHTCFASTGEIASIKVIRNKQTLLSEGYGFVEFFSHATAEKVLQT  161

Query  610  YTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            YT ILMPNT+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  162  YTGILMPNTEQPFRLNWATFSTGDKRSDNAPDLSIF  197



>ref|XP_009367486.1| PREDICTED: polyadenylate-binding protein RBP47-like, partial 
[Pyrus x bretschneideri]
Length=410

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 116/154 (75%), Gaps = 3/154 (2%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphy---mpyhphflhhppphaqpqqqqqhGGSNGENRTI  435
            MQYPAAA VMQHQMMP  HY         Y  +  +    H Q  QQQQ G S GEN+TI
Sbjct  11   MQYPAAAMVMQHQMMPPQHYATPPPPPQHYMAYHQYQQQQHVQHLQQQQLGSSGGENKTI  70

Query  436  WIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYT  615
            W+GDLH+WMDE+YL +CFASTGE+ASIKVIRNKQT  SEGYGFVEF+SHA AEK LQ+Y 
Sbjct  71   WVGDLHHWMDENYLHTCFASTGEIASIKVIRNKQTLLSEGYGFVEFFSHATAEKVLQNYA  130

Query  616  CILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             ILMPNT+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  131  GILMPNTEQPFRLNWATFSTGDKRSDNAPDLSIF  164



>ref|XP_008361011.1| PREDICTED: polyadenylate-binding protein RBP47-like [Malus domestica]
Length=443

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 115/153 (75%), Gaps = 2/153 (1%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphym--pyhphflhhppphaqpqqqqqhGGSNGENRTIW  438
            MQYPAAA VMQHQMMP  HY        ++  +  +         QQQ  GS+GEN+TIW
Sbjct  46   MQYPAAAMVMQHQMMPPQHYATPPPPPQHYMAYHQYQQQQHVQHLQQQQLGSSGENKTIW  105

Query  439  IGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTC  618
            +GDLH+WMDE+YL +CFASTGE+ASIKVIRNKQT  SEGYGFVEF+SHA AEK LQ+Y  
Sbjct  106  VGDLHHWMDENYLHTCFASTGEIASIKVIRNKQTLLSEGYGFVEFFSHATAEKVLQNYAG  165

Query  619  ILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            ILMPNT+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  166  ILMPNTEQPFRLNWATFSTGDKRSDNAPDLSIF  198



>ref|XP_008393835.1| PREDICTED: polyadenylate-binding protein RBP47-like [Malus domestica]
Length=444

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 115/153 (75%), Gaps = 2/153 (1%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphym--pyhphflhhppphaqpqqqqqhGGSNGENRTIW  438
            MQYPAAA VMQHQMMP  HY        ++  +  +         QQQ  GS+GEN+TIW
Sbjct  46   MQYPAAAMVMQHQMMPPQHYATPPPPPQHYMAYHQYQQQQHVQHLQQQQLGSSGENKTIW  105

Query  439  IGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTC  618
            +GDLH+WMDE+YL +CFASTGE+ASIKVIRNKQT  SEGYGFVEF+SHA AEK LQ+Y  
Sbjct  106  VGDLHHWMDENYLHTCFASTGEIASIKVIRNKQTLLSEGYGFVEFFSHATAEKVLQNYAG  165

Query  619  ILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            ILMPNT+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  166  ILMPNTEQPFRLNWATFSTGDKRSDNAPDLSIF  198



>ref|XP_008357395.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Malus domestica]
Length=444

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 113/155 (73%), Gaps = 4/155 (3%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMP----AThypphympyhphflhhppphaqpqqqqqhGGSNGENRT  432
            MQYP  A VMQHQMMP    AT  PP       H           QQQQQ G  +GEN+T
Sbjct  45   MQYPTTAMVMQHQMMPPQHYATPPPPPQHYMAYHQYQQQQHIQHLQQQQQLGSGSGENKT  104

Query  433  IWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSY  612
            IW+GDLH+WMDE+YL +CFASTGEVASIK+IRNKQT  SEGYGFVEF+SHA AEK LQ+Y
Sbjct  105  IWVGDLHHWMDENYLHTCFASTGEVASIKLIRNKQTLLSEGYGFVEFFSHATAEKVLQNY  164

Query  613  TCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
              ILMPNT+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  165  AGILMPNTEQPFRLNWATFSTGDKRSDNAPDLSIF  199



>ref|XP_003523906.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=409

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 109/151 (72%), Gaps = 6/151 (4%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  444
            MQYPAAA VMQH MMP  HY P       H      P A         GS+ EN+T+W+G
Sbjct  32   MQYPAAAMVMQHHMMPPQHYAPPQPYMAYHQYQQQVPQAHHL------GSSAENKTVWVG  85

Query  445  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            DLH+WMDE+YL  CFASTGE++SIKVIRNKQTG SEGYGFVEFYSH  A+K LQ+Y  IL
Sbjct  86   DLHHWMDENYLHRCFASTGEISSIKVIRNKQTGLSEGYGFVEFYSHGTADKVLQNYAGIL  145

Query  625  MPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            MPNT+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  146  MPNTEQPFRLNWATFSTGDKRSDNVPDLSIF  176



>gb|KJB59840.1| hypothetical protein B456_009G275200 [Gossypium raimondii]
 gb|KJB59841.1| hypothetical protein B456_009G275200 [Gossypium raimondii]
Length=419

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 114/151 (75%), Gaps = 1/151 (1%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  444
            MQYPAAA VMQHQMM    +         H++ +   H     QQ  GG +GEN+T+W+G
Sbjct  32   MQYPAAAMVMQHQMM-QPQHFVASPLPPQHYMPYHHLHLNGHAQQGSGGGSGENKTVWVG  90

Query  445  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            DL++WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF+SHA AEK LQSY+ IL
Sbjct  91   DLYHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFSHATAEKVLQSYSSIL  150

Query  625  MPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            MPNTDQ FRLNWAT S GEKR  NG DLSIF
Sbjct  151  MPNTDQPFRLNWATLSTGEKRSENGPDLSIF  181



>ref|XP_007017334.1| RNA-binding protein 47C isoform 6 [Theobroma cacao]
 gb|EOY14559.1| RNA-binding protein 47C isoform 6 [Theobroma cacao]
Length=306

 Score =   182 bits (462),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 113/159 (71%), Gaps = 8/159 (5%)
 Frame = +1

Query  265  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  420
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+T+W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFSHATAEKV  155

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y  ILMPN +Q FRLNWATFS GEKR  NG DLSIF
Sbjct  156  LQNYGGILMPNMEQPFRLNWATFSTGEKRSENGPDLSIF  194



>ref|XP_008444645.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
melo]
Length=429

 Score =   185 bits (470),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 117/153 (76%), Gaps = 2/153 (1%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhp--pphaqpqqqqqhGGSNGENRTIW  438
            MQYPAAA +MQH MMP  HY P   P++  +  +P        Q QQ H GS  EN+TIW
Sbjct  36   MQYPAAAMIMQHPMMPPQHYVPPPSPHYIPYRQYPPPHQLNGQQHQQPHQGSTSENKTIW  95

Query  439  IGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTC  618
            +GDL +WMDE+YL SCFASTGE++S+KVIRNKQTG SEGYGFVEF+SH  AEK LQ+Y+ 
Sbjct  96   VGDLQHWMDENYLHSCFASTGEISSLKVIRNKQTGISEGYGFVEFFSHTTAEKVLQNYSS  155

Query  619  ILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            ILMPNT+Q FRLNWATFS G+KR  NGSDLSIF
Sbjct  156  ILMPNTEQAFRLNWATFSTGDKRSENGSDLSIF  188



>ref|XP_004152729.1| PREDICTED: polyadenylate-binding protein RBP47 [Cucumis sativus]
 gb|KGN62542.1| hypothetical protein Csa_2G360590 [Cucumis sativus]
Length=429

 Score =   185 bits (470),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 117/153 (76%), Gaps = 2/153 (1%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhp--pphaqpqqqqqhGGSNGENRTIW  438
            MQYPAAA +MQH MMP  HY P   P++  +  +P        Q QQ H GS  EN+TIW
Sbjct  36   MQYPAAAMIMQHPMMPPQHYVPPPSPHYIPYRQYPPPHQLNGQQHQQPHQGSTSENKTIW  95

Query  439  IGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTC  618
            +GDL +WMDE+YL SCFASTGE++S+KVIRNKQTG SEGYGFVEF+SH  AEK LQ+Y+ 
Sbjct  96   VGDLQHWMDENYLHSCFASTGEISSLKVIRNKQTGISEGYGFVEFFSHTTAEKVLQNYSS  155

Query  619  ILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            ILMPNT+Q FRLNWATFS G+KR  NGSDLSIF
Sbjct  156  ILMPNTEQAFRLNWATFSTGDKRSENGSDLSIF  188



>gb|KHN22302.1| Polyadenylate-binding protein RBP47C [Glycine soja]
Length=411

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 107/151 (71%), Gaps = 1/151 (1%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  444
            MQYPAAA VMQH MMP  HY       +  + H+              GS+ EN+T+W+G
Sbjct  30   MQYPAAAMVMQHHMMPPQHYLHAPPQPYMAYHHYQQQLPHALHAHHQ-GSSAENKTVWVG  88

Query  445  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            DLH+WMDE+YL  CFAS GE++SIKVIRNKQTG SEGYGFVEFYSH  AEK LQ+Y  IL
Sbjct  89   DLHHWMDENYLHRCFASNGEISSIKVIRNKQTGLSEGYGFVEFYSHGTAEKVLQNYAGIL  148

Query  625  MPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            MPNT+Q FRLNWATF  G+KR +N  DLSIF
Sbjct  149  MPNTEQPFRLNWATFGTGDKRSDNVPDLSIF  179



>gb|KHG01821.1| Polyadenylate-binding RBP47C -like protein [Gossypium arboreum]
Length=385

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 113/151 (75%), Gaps = 1/151 (1%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  444
            MQYPAAA VMQHQMM    +         H++ +   H     QQ  GG +GEN+T+W+G
Sbjct  32   MQYPAAAMVMQHQMM-QPQHFVAPPLPPQHYMPYHHLHLNGHAQQGSGGGSGENKTVWVG  90

Query  445  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            DL++WMDE+YL SCFASTGE+ASIKVIRNKQTG  EGYGFVEF+SHA AEK LQSY+ +L
Sbjct  91   DLYHWMDENYLHSCFASTGEIASIKVIRNKQTGLPEGYGFVEFFSHATAEKVLQSYSSVL  150

Query  625  MPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            MPNTDQ FRLNWAT S GEKR  NG DLSIF
Sbjct  151  MPNTDQPFRLNWATLSTGEKRSENGPDLSIF  181



>gb|KJB58433.1| hypothetical protein B456_009G209600 [Gossypium raimondii]
Length=385

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 116/159 (73%), Gaps = 8/159 (5%)
 Frame = +1

Query  265  MQYPAAATVMQHQMM------PAThypphympyhphflhhppphaqpqqqqqhGGSN--G  420
            MQYP  A VMQHQMM           P HYMPYH H   +   H   Q  QQ  GSN  G
Sbjct  36   MQYPTTAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHHQYQHHHGNAQHAQQQQGSNDGG  95

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+TIW+GDLH+WMDE+YL SCFAS GE++SIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  96   ENKTIWVGDLHHWMDENYLHSCFASIGEISSIKVIRNKQTGLSEGYGFVEFFSHATAEKV  155

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y+ ILMPN +Q FRLNWATFSMG+K   NG DLSIF
Sbjct  156  LQNYSGILMPNMEQPFRLNWATFSMGDKHSENGPDLSIF  194



>ref|XP_007017335.1| RNA-binding protein 47C isoform 7 [Theobroma cacao]
 gb|EOY14560.1| RNA-binding protein 47C isoform 7 [Theobroma cacao]
Length=339

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 113/159 (71%), Gaps = 8/159 (5%)
 Frame = +1

Query  265  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  420
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+T+W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFSHATAEKV  155

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y  ILMPN +Q FRLNWATFS GEKR  NG DLSIF
Sbjct  156  LQNYGGILMPNMEQPFRLNWATFSTGEKRSENGPDLSIF  194



>ref|XP_007017333.1| RNA-binding protein 47C isoform 5 [Theobroma cacao]
 gb|EOY14558.1| RNA-binding protein 47C isoform 5 [Theobroma cacao]
Length=380

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 113/159 (71%), Gaps = 8/159 (5%)
 Frame = +1

Query  265  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  420
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+T+W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFSHATAEKV  155

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y  ILMPN +Q FRLNWATFS GEKR  NG DLSIF
Sbjct  156  LQNYGGILMPNMEQPFRLNWATFSTGEKRSENGPDLSIF  194



>ref|XP_003544447.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=425

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 108/160 (68%), Gaps = 9/160 (6%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMP---------AThypphympyhphflhhppphaqpqqqqqhGGSN  417
            MQYPAAA VM H M+P            +  H+   +           Q Q      GS 
Sbjct  34   MQYPAAAMVMPHHMLPPQHYAPPPYVPFHHHHHHHQYAAPHVPNQHQQQQQHHHHQNGSG  93

Query  418  GENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEK  597
            GEN+TIWIGDLH+WMDE+YL  CFASTGE++SIKVIRNKQTG SEGYGFVEFYSHA AEK
Sbjct  94   GENKTIWIGDLHHWMDENYLHRCFASTGEISSIKVIRNKQTGLSEGYGFVEFYSHATAEK  153

Query  598  ALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             LQ+Y  ILMPNT+Q FRLNWATFS G+K  +N  DLSIF
Sbjct  154  VLQNYAGILMPNTEQPFRLNWATFSTGDKGSDNVPDLSIF  193



>ref|XP_007017332.1| RNA-binding protein 47C isoform 4, partial [Theobroma cacao]
 gb|EOY14557.1| RNA-binding protein 47C isoform 4, partial [Theobroma cacao]
Length=387

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 113/159 (71%), Gaps = 8/159 (5%)
 Frame = +1

Query  265  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  420
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+T+W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFSHATAEKV  155

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y  ILMPN +Q FRLNWATFS GEKR  NG DLSIF
Sbjct  156  LQNYGGILMPNMEQPFRLNWATFSTGEKRSENGPDLSIF  194



>ref|XP_007017330.1| RNA-binding protein 47C isoform 2 [Theobroma cacao]
 gb|EOY14555.1| RNA-binding protein 47C isoform 2 [Theobroma cacao]
Length=394

 Score =   182 bits (461),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 113/159 (71%), Gaps = 8/159 (5%)
 Frame = +1

Query  265  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  420
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+T+W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFSHATAEKV  155

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y  ILMPN +Q FRLNWATFS GEKR  NG DLSIF
Sbjct  156  LQNYGGILMPNMEQPFRLNWATFSTGEKRSENGPDLSIF  194



>ref|XP_007136663.1| hypothetical protein PHAVU_009G063200g [Phaseolus vulgaris]
 gb|ESW08657.1| hypothetical protein PHAVU_009G063200g [Phaseolus vulgaris]
Length=420

 Score =   182 bits (462),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 112/152 (74%), Gaps = 1/152 (1%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqq-qqqhGGSNGENRTIWI  441
            MQYPAAA VMQH MMP  HY     P  P+  +H      P      H GS+ EN+T+W+
Sbjct  37   MQYPAAAMVMQHHMMPPQHYAAPPPPPQPYVAYHQYQQQLPHVPHAHHQGSSAENKTVWV  96

Query  442  GDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCI  621
            GDLH+WMDE+YL  CFASTGE++SIKVIRNKQTG SEGYGFVEFYSH  AEK LQ+Y  I
Sbjct  97   GDLHHWMDENYLHRCFASTGEISSIKVIRNKQTGLSEGYGFVEFYSHGTAEKVLQNYAGI  156

Query  622  LMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LMPNT+Q FRLNWA+FS G+KR +N  DLSIF
Sbjct  157  LMPNTEQPFRLNWASFSTGDKRSDNVPDLSIF  188



>gb|EYU25396.1| hypothetical protein MIMGU_mgv1a006186mg [Erythranthe guttata]
Length=454

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 93/105 (89%), Gaps = 1/105 (1%)
 Frame = +1

Query  406  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  585
            G  NGENRTIW+GDLHNWMDE YLR+CF STGEV+SIK+IRNKQTG +EGYGFVEF +HA
Sbjct  108  GNGNGENRTIWVGDLHNWMDEQYLRTCFDSTGEVSSIKLIRNKQTGSTEGYGFVEFSTHA  167

Query  586  AAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLN-NGSDLSIF  717
            AAEK LQSY+C+ MP+TDQ FRLNWATFSMG+KR N NGSD SIF
Sbjct  168  AAEKVLQSYSCMAMPSTDQFFRLNWATFSMGDKRSNMNGSDRSIF  212



>gb|KJB63806.1| hypothetical protein B456_010G017300 [Gossypium raimondii]
Length=343

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 117/159 (74%), Gaps = 8/159 (5%)
 Frame = +1

Query  265  MQYP---AAATVMQHQMM-----PAThypphympyhphflhhppphaqpqqqqqhGGSNG  420
            MQYP   AAA VMQHQMM      A   PP       H  +H   HA  QQQQQ  G  G
Sbjct  32   MQYPPTAAAAMVMQHQMMQPQHFVAPPPPPPQHYVPYHHQYHHHGHALSQQQQQGSGGGG  91

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+T+W+GDLH+WMDE+YL SCFASTGE+ SIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  92   ENKTVWVGDLHHWMDENYLHSCFASTGEIVSIKVIRNKQTGLSEGYGFVEFFSHAMAEKV  151

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y+ +LMPNT+Q FRLNWATFS GEKR  NG DLSIF
Sbjct  152  LQNYSGMLMPNTEQPFRLNWATFSTGEKRSENGPDLSIF  190



>ref|XP_002510266.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF52453.1| nuclear acid binding protein, putative [Ricinus communis]
Length=443

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 113/160 (71%), Gaps = 9/160 (6%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSN---------  417
            MQYPAAA VMQHQM+P  HY P    ++    H    H     Q Q    N         
Sbjct  46   MQYPAAAMVMQHQMLPPQHYAPPPPQHYMTAYHQYHHHHPHPHQPQQHHQNQGSSGGGGG  105

Query  418  GENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEK  597
            GENRT+WIGDLH+WMDE+YL +CFASTGE+ SIKVIRNKQTG SEGYGFVEFY+HA AEK
Sbjct  106  GENRTVWIGDLHHWMDENYLHTCFASTGEIVSIKVIRNKQTGLSEGYGFVEFYTHATAEK  165

Query  598  ALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             LQ+Y  ILMPNT+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  166  VLQNYAGILMPNTEQPFRLNWATFSTGDKRSDNAPDLSIF  205



>gb|KEH40057.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=309

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 108/156 (69%), Gaps = 5/156 (3%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNGENR  429
            MQYP AA VM H MMP        Y P++  +H        P  Q Q  Q   GSNGEN+
Sbjct  38   MQYPTAAMVMPHHMMPPQHYAPPPYVPYHHHHHQFQQPLHVPPHQHQNHQNQHGSNGENK  97

Query  430  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  609
            T+WIGDLH+WMDE YL  CFASTGE+ S+KVIRNK +G SEGYGF EF+SHA AEK LQ+
Sbjct  98   TLWIGDLHSWMDESYLHRCFASTGEITSVKVIRNKHSGISEGYGFAEFFSHATAEKVLQN  157

Query  610  YTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            Y  ILMPN DQ FRLNWATFS G+K  +N +DLSIF
Sbjct  158  YAGILMPNADQAFRLNWATFSTGDKGSDNVTDLSIF  193



>ref|XP_009370171.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Pyrus x bretschneideri]
Length=441

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 112/154 (73%), Gaps = 3/154 (2%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPA---ThypphympyhphflhhppphaqpqqqqqhGGSNGENRTI  435
            MQYP AA VMQHQMMP       PP    Y  +  +    H Q  QQQQ G  +GEN+TI
Sbjct  42   MQYPTAAMVMQHQMMPPQHYATPPPPPQHYMAYHQYQQQQHVQHLQQQQLGSGSGENKTI  101

Query  436  WIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYT  615
            W+GDLH+WMDE YL +CFASTGE+ASIK+IRNKQT  SEGYGFVEF+SHA AE  LQ+Y 
Sbjct  102  WVGDLHHWMDESYLHTCFASTGEIASIKLIRNKQTLLSEGYGFVEFFSHATAENVLQNYA  161

Query  616  CILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             ILMPNT+Q FRLNWA FS G+KR +N  DLSIF
Sbjct  162  GILMPNTEQPFRLNWAAFSTGDKRSDNAPDLSIF  195



>ref|XP_003528246.1| PREDICTED: polyadenylate-binding protein RBP47C'-like [Glycine 
max]
Length=410

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 108/151 (72%), Gaps = 1/151 (1%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  444
            MQYPAAA VMQH MMP  HY P     +  + H+              GS+ EN+T+W+G
Sbjct  25   MQYPAAAMVMQHHMMPPQHYAPPPPQPYMAYHHYQQQLPHALHAHHQ-GSSAENKTVWVG  83

Query  445  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            DLH+WMDE+YL  CFAS GE++SIKVIRNKQTG SEGYGFVEFYSH  AEK LQ+Y  IL
Sbjct  84   DLHHWMDENYLHRCFASNGEISSIKVIRNKQTGLSEGYGFVEFYSHGTAEKVLQNYAGIL  143

Query  625  MPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            MPNT+Q FRLNWATF  G+KR +N  DLSIF
Sbjct  144  MPNTEQPFRLNWATFGTGDKRSDNVPDLSIF  174



>ref|XP_009370172.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Pyrus x bretschneideri]
Length=440

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 112/154 (73%), Gaps = 3/154 (2%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPA---ThypphympyhphflhhppphaqpqqqqqhGGSNGENRTI  435
            MQYP AA VMQHQMMP       PP    Y  +  +    H Q  QQQQ G  +GEN+TI
Sbjct  42   MQYPTAAMVMQHQMMPPQHYATPPPPPQHYMAYHQYQQQQHVQHLQQQQLGSGSGENKTI  101

Query  436  WIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYT  615
            W+GDLH+WMDE YL +CFASTGE+ASIK+IRNKQT  SEGYGFVEF+SHA AE  LQ+Y 
Sbjct  102  WVGDLHHWMDESYLHTCFASTGEIASIKLIRNKQTLLSEGYGFVEFFSHATAENVLQNYA  161

Query  616  CILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             ILMPNT+Q FRLNWA FS G+KR +N  DLSIF
Sbjct  162  GILMPNTEQPFRLNWAAFSTGDKRSDNAPDLSIF  195



>gb|KJB58432.1| hypothetical protein B456_009G209600 [Gossypium raimondii]
Length=432

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 116/159 (73%), Gaps = 8/159 (5%)
 Frame = +1

Query  265  MQYPAAATVMQHQMM------PAThypphympyhphflhhppphaqpqqqqqhGGSN--G  420
            MQYP  A VMQHQMM           P HYMPYH H   +   H   Q  QQ  GSN  G
Sbjct  36   MQYPTTAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHHQYQHHHGNAQHAQQQQGSNDGG  95

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+TIW+GDLH+WMDE+YL SCFAS GE++SIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  96   ENKTIWVGDLHHWMDENYLHSCFASIGEISSIKVIRNKQTGLSEGYGFVEFFSHATAEKV  155

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y+ ILMPN +Q FRLNWATFSMG+K   NG DLSIF
Sbjct  156  LQNYSGILMPNMEQPFRLNWATFSMGDKHSENGPDLSIF  194



>ref|XP_007017329.1| RNA-binding protein 47C isoform 1 [Theobroma cacao]
 gb|EOY14554.1| RNA-binding protein 47C isoform 1 [Theobroma cacao]
Length=435

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 113/159 (71%), Gaps = 8/159 (5%)
 Frame = +1

Query  265  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  420
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+T+W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFSHATAEKV  155

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y  ILMPN +Q FRLNWATFS GEKR  NG DLSIF
Sbjct  156  LQNYGGILMPNMEQPFRLNWATFSTGEKRSENGPDLSIF  194



>ref|XP_007017331.1| RNA-binding protein 47C isoform 3 [Theobroma cacao]
 gb|EOY14556.1| RNA-binding protein 47C isoform 3 [Theobroma cacao]
Length=436

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 113/159 (71%), Gaps = 8/159 (5%)
 Frame = +1

Query  265  MQYPAAATVMQHQMM--------PAThypphympyhphflhhppphaqpqqqqqhGGSNG  420
            MQYPAAA VMQHQMM        P          +H     H   H Q  QQQQ  G  G
Sbjct  36   MQYPAAAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHQQYQHHHGHVQHSQQQQGSGGGG  95

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+T+W+GDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFFSHATAEKV  155

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y  ILMPN +Q FRLNWATFS GEKR  NG DLSIF
Sbjct  156  LQNYGGILMPNMEQPFRLNWATFSTGEKRSENGPDLSIF  194



>ref|XP_012071696.1| PREDICTED: polyadenylate-binding protein RBP47-like [Jatropha 
curcas]
 gb|KDP38389.1| hypothetical protein JCGZ_04314 [Jatropha curcas]
Length=437

 Score =   181 bits (458),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 117/156 (75%), Gaps = 5/156 (3%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypph-----ympyhphflhhppphaqpqqqqqhGGSNGENR  429
            MQYPAAA VMQHQM+P  HY P         YH +  HHP     PQQ       + EN+
Sbjct  42   MQYPAAAMVMQHQMIPPQHYAPPPPQHYMAAYHQYHHHHPHLQHTPQQHHHQNQGSSENK  101

Query  430  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  609
            T+WIGDLH+WMDE+YL +CFASTGE+AS+KVIRNKQTG SEGYGFVEF++HA AEK LQ+
Sbjct  102  TVWIGDLHHWMDENYLHTCFASTGEIASLKVIRNKQTGLSEGYGFVEFFTHATAEKVLQN  161

Query  610  YTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            Y+ ILMPNT+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  162  YSGILMPNTEQPFRLNWATFSTGDKRSDNAPDLSIF  197



>gb|KHN04518.1| Polyadenylate-binding protein RBP47C, partial [Glycine soja]
Length=376

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 104/148 (70%), Gaps = 5/148 (3%)
 Frame = +1

Query  274  PAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIGDLH  453
            PAAA VMQH MMP  HY P       H                  GS+ EN+T+W+GDLH
Sbjct  1    PAAAMVMQHHMMPPQHYAPPQPYMAYHQYQQQQVPQAHHL-----GSSAENKTVWVGDLH  55

Query  454  NWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCILMPN  633
            +WMDE+YL  CFASTGE++SIKVIRNKQTG SEGYGFVEFYSH  A+K LQ+Y  ILMPN
Sbjct  56   HWMDENYLHRCFASTGEISSIKVIRNKQTGLSEGYGFVEFYSHGTADKVLQNYAGILMPN  115

Query  634  TDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            T+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  116  TEQPFRLNWATFSTGDKRSDNVPDLSIF  143



>ref|XP_003549410.2| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=413

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 109/152 (72%), Gaps = 7/152 (5%)
 Frame = +1

Query  265  MQYPAAAT-VMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWI  441
            MQYPAAA  VM H M+P            P ++ +   +A   Q Q   GS GEN+TIWI
Sbjct  36   MQYPAAAAMVMPHHMLPP------QHYAPPPYVPYHHQYAAQPQHQHQNGSGGENKTIWI  89

Query  442  GDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCI  621
            GDLH+WMDE+YL  CFASTGE++SIKVIRNKQTG SEGYGFVEFYSHA AEK LQ+Y  I
Sbjct  90   GDLHHWMDENYLHRCFASTGEISSIKVIRNKQTGLSEGYGFVEFYSHATAEKVLQNYAGI  149

Query  622  LMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LMPN +Q FRLNWATFS G+K  +N  DLSIF
Sbjct  150  LMPNAEQPFRLNWATFSTGDKGSDNVPDLSIF  181



>gb|KJB63805.1| hypothetical protein B456_010G017300 [Gossypium raimondii]
Length=431

 Score =   180 bits (456),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 117/159 (74%), Gaps = 8/159 (5%)
 Frame = +1

Query  265  MQYP---AAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNG  420
            MQYP   AAA VMQHQMM      A   PP       H  +H   HA  QQQQQ  G  G
Sbjct  32   MQYPPTAAAAMVMQHQMMQPQHFVAPPPPPPQHYVPYHHQYHHHGHALSQQQQQGSGGGG  91

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+T+W+GDLH+WMDE+YL SCFASTGE+ SIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  92   ENKTVWVGDLHHWMDENYLHSCFASTGEIVSIKVIRNKQTGLSEGYGFVEFFSHAMAEKV  151

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y+ +LMPNT+Q FRLNWATFS GEKR  NG DLSIF
Sbjct  152  LQNYSGMLMPNTEQPFRLNWATFSTGEKRSENGPDLSIF  190



>gb|KHG24367.1| Polyadenylate-binding RBP47 [Gossypium arboreum]
Length=382

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 112/159 (70%), Gaps = 8/159 (5%)
 Frame = +1

Query  265  MQYPAAATVMQHQMM-------PAThypphympyhphflhhppphaqpqqqqqhGGSNG-  420
            MQYP  A VMQHQMM       P      +   +H H  +          QQQ G ++G 
Sbjct  36   MQYPTTAMVMQHQMMQPQHFVAPPPPPQHYMPYHHHHHQYQHHHGNAQHTQQQQGSNDGC  95

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+T+W+GDLH+WMDE+YL SCFAS GE++SIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  96   ENKTVWVGDLHHWMDENYLHSCFASIGEISSIKVIRNKQTGLSEGYGFVEFFSHATAEKV  155

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y+ ILMPN +Q FRLNWATFSMG+K   NG DLSIF
Sbjct  156  LQNYSGILMPNMEQPFRLNWATFSMGDKHSENGPDLSIF  194



>gb|KHG27259.1| Polyadenylate-binding RBP47 [Gossypium arboreum]
Length=384

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 116/159 (73%), Gaps = 8/159 (5%)
 Frame = +1

Query  265  MQYP---AAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNG  420
            MQYP   AAA VMQHQMM      A   PP       H  +H   HA  QQQQQ  G  G
Sbjct  33   MQYPPTAAAAMVMQHQMMQPQHFVAPPPPPPQHYVPYHHQYHHQGHAPSQQQQQGSGGGG  92

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+T+W+GDLH+WMDE+YL SCFASTGE+ SIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  93   ENKTVWVGDLHHWMDENYLHSCFASTGEIVSIKVIRNKQTGLSEGYGFVEFFSHATAEKV  152

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y+ + MPNT+Q FRLNWATFS GEKR  NG DLSIF
Sbjct  153  LQNYSGMFMPNTEQPFRLNWATFSTGEKRSENGPDLSIF  191



>gb|AFK35123.1| unknown [Medicago truncatula]
Length=425

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 108/156 (69%), Gaps = 5/156 (3%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNGENR  429
            MQYP AA VM H MMP        Y P++  +H        P  Q Q  Q   GSNGEN+
Sbjct  38   MQYPTAAMVMPHHMMPPQHYAPPPYVPYHHHHHQFQQPLHVPPHQHQNHQNQHGSNGENK  97

Query  430  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  609
            T+WIGDLH+WMDE YL  CFASTGE+ S+KVIRNK +G SEGYGF EF+SHA AEK LQ+
Sbjct  98   TLWIGDLHSWMDESYLHRCFASTGEITSVKVIRNKHSGISEGYGFAEFFSHATAEKVLQN  157

Query  610  YTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            Y  ILMPN DQ FRLNWATFS G+K  +N +DLSIF
Sbjct  158  YAGILMPNADQAFRLNWATFSTGDKGSDNVTDLSIF  193



>gb|KEH40058.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=425

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 108/156 (69%), Gaps = 5/156 (3%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMP-----AThypphympyhphflhhppphaqpqqqqqhGGSNGENR  429
            MQYP AA VM H MMP        Y P++  +H        P  Q Q  Q   GSNGEN+
Sbjct  38   MQYPTAAMVMPHHMMPPQHYAPPPYVPYHHHHHQFQQPLHVPPHQHQNHQNQHGSNGENK  97

Query  430  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  609
            T+WIGDLH+WMDE YL  CFASTGE+ S+KVIRNK +G SEGYGF EF+SHA AEK LQ+
Sbjct  98   TLWIGDLHSWMDESYLHRCFASTGEITSVKVIRNKHSGISEGYGFAEFFSHATAEKVLQN  157

Query  610  YTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            Y  ILMPN DQ FRLNWATFS G+K  +N +DLSIF
Sbjct  158  YAGILMPNADQAFRLNWATFSTGDKGSDNVTDLSIF  193



>ref|XP_010668311.1| PREDICTED: polyadenylate-binding protein RBP47-like [Beta vulgaris 
subsp. vulgaris]
Length=476

 Score =   178 bits (452),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            GS+GEN+TIW+GDLH+WMDE YL SCF S GE+ S+KVIRNKQTG SEGYGFVEF++HA 
Sbjct  136  GSSGENKTIWVGDLHHWMDEIYLSSCFGSAGEIVSVKVIRNKQTGASEGYGFVEFFTHAI  195

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AEK LQSYT ++MPN +Q FRLNWATFSMG+KR +NGSDLSIF
Sbjct  196  AEKVLQSYTGLMMPNAEQPFRLNWATFSMGDKRTDNGSDLSIF  238



>gb|EPS64859.1| nucleic acid binding protein, partial [Genlisea aurea]
Length=377

 Score =   176 bits (446),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 116/157 (74%), Gaps = 6/157 (4%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMP------AThypphympyhphflhhppphaqpqqqqqhGGSNGEN  426
            MQYP AA VMQH MMP         YP H++ +H      PPP  Q       GGS+G+N
Sbjct  8    MQYPTAAVVMQHGMMPHYAPPHYIPYPLHHIHHHLPSSPAPPPQQQVGSSNNGGGSSGDN  67

Query  427  RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQ  606
            RT+W+GDL+NWMDEDYLR+CF ST  V S+KVIRNKQTGFSEGYGFVEF SHA AEK L+
Sbjct  68   RTLWVGDLYNWMDEDYLRNCFDSTRGVTSVKVIRNKQTGFSEGYGFVEFSSHATAEKVLK  127

Query  607  SYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            SY+ I+MPN+DQ FRLNWA+FSMG++R N  SDLSIF
Sbjct  128  SYSSIVMPNSDQAFRLNWASFSMGDRRTNGCSDLSIF  164



>ref|XP_007160823.1| hypothetical protein PHAVU_001G019600g [Phaseolus vulgaris]
 gb|ESW32817.1| hypothetical protein PHAVU_001G019600g [Phaseolus vulgaris]
Length=415

 Score =   177 bits (449),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 105/151 (70%), Gaps = 6/151 (4%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  444
            MQYP A  VM H M+P       +        HH          Q   GS+GEN+T+WIG
Sbjct  39   MQYPTA-MVMPHHMLPP-----QHYAPPYVPFHHHQYAPPHVPHQHQNGSSGENKTVWIG  92

Query  445  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            DLH+WMDE+YL  CFASTGE++SIKVIRNKQTG SEGYGFVEFYSHA AEK LQ+Y  IL
Sbjct  93   DLHHWMDENYLHRCFASTGEISSIKVIRNKQTGLSEGYGFVEFYSHATAEKVLQNYAGIL  152

Query  625  MPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            MPNT+Q FRLNWA+FS G+K  +N  DLSIF
Sbjct  153  MPNTEQAFRLNWASFSTGDKGSDNVPDLSIF  183



>ref|XP_011030480.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X3 
[Populus euphratica]
Length=427

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 113/156 (72%), Gaps = 7/156 (4%)
 Frame = +1

Query  271  YPAAATVMQHQMMPAThypphympyhphflhhppph-------aqpqqqqqhGGSNGENR  429
            YPAAA VMQHQ++P  HY P    ++    +H            Q   Q+Q    +GEN+
Sbjct  33   YPAAAMVMQHQIIPPQHYGPPPPQHYLAAAYHQYQPHHHHLPHVQQHTQKQQREGSGENK  92

Query  430  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  609
            TIWIGDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF +HA AEK LQ+
Sbjct  93   TIWIGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFLTHATAEKVLQN  152

Query  610  YTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            Y  ILMPNT+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  153  YGGILMPNTEQPFRLNWATFSTGDKRSDNAPDLSIF  188



>ref|XP_011030472.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Populus euphratica]
Length=428

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 113/156 (72%), Gaps = 7/156 (4%)
 Frame = +1

Query  271  YPAAATVMQHQMMPAThypphympyhphflhhppph-------aqpqqqqqhGGSNGENR  429
            YPAAA VMQHQ++P  HY P    ++    +H            Q   Q+Q    +GEN+
Sbjct  34   YPAAAMVMQHQIIPPQHYGPPPPQHYLAAAYHQYQPHHHHLPHVQQHTQKQQREGSGENK  93

Query  430  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  609
            TIWIGDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF +HA AEK LQ+
Sbjct  94   TIWIGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFLTHATAEKVLQN  153

Query  610  YTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            Y  ILMPNT+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  154  YGGILMPNTEQPFRLNWATFSTGDKRSDNAPDLSIF  189



>ref|XP_011030463.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Populus euphratica]
Length=428

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 113/156 (72%), Gaps = 7/156 (4%)
 Frame = +1

Query  271  YPAAATVMQHQMMPAThypphympyhphflhhppph-------aqpqqqqqhGGSNGENR  429
            YPAAA VMQHQ++P  HY P    ++    +H            Q   Q+Q    +GEN+
Sbjct  34   YPAAAMVMQHQIIPPQHYGPPPPQHYLAAAYHQYQPHHHHLPHVQQHTQKQQREGSGENK  93

Query  430  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  609
            TIWIGDLH+WMDE+YL SCFASTGE+ASIKVIRNKQTG SEGYGFVEF +HA AEK LQ+
Sbjct  94   TIWIGDLHHWMDENYLHSCFASTGEIASIKVIRNKQTGLSEGYGFVEFLTHATAEKVLQN  153

Query  610  YTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            Y  ILMPNT+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  154  YGGILMPNTEQPFRLNWATFSTGDKRSDNAPDLSIF  189



>ref|XP_010275610.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Nelumbo nucifera]
Length=413

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 110/151 (73%), Gaps = 4/151 (3%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  444
            MQYPAA  VMQHQMMP      +   Y P+  H    H Q QQQQQ  GS  +N+TIW+G
Sbjct  26   MQYPAATMVMQHQMMP----QHYPAHYMPYHHHQQQQHTQQQQQQQQQGSMEDNKTIWVG  81

Query  445  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            DLH WMDE YL SCFA TGEV SIKVIRNKQTG SEGYGFVEF+SHAAAEK LQ+Y    
Sbjct  82   DLHYWMDESYLHSCFAHTGEVVSIKVIRNKQTGQSEGYGFVEFFSHAAAEKVLQNYNGTA  141

Query  625  MPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            MPNTD  FRLNWA+FS GE+R + GSD SIF
Sbjct  142  MPNTDHPFRLNWASFSTGERRSDAGSDRSIF  172



>ref|XP_011013053.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=427

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            GS+G+N+TIWIGDLH+WMDE+YL +CFASTGE+ASIKVIR+KQTG SEGYGFVEF++HA 
Sbjct  88   GSSGDNKTIWIGDLHHWMDENYLHTCFASTGEIASIKVIRSKQTGLSEGYGFVEFFTHAT  147

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AEK LQ+Y  ILMPNT+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  148  AEKVLQNYGGILMPNTEQPFRLNWATFSTGDKRSDNTPDLSIF  190



>ref|XP_011017227.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=427

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            GS+G+N+TIWIGDLH+WMDE+YL +CFASTGE+ASIKVIR+KQTG SEGYGFVEF++HA 
Sbjct  88   GSSGDNKTIWIGDLHHWMDENYLHTCFASTGEIASIKVIRSKQTGLSEGYGFVEFFTHAT  147

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AEK LQ+Y  ILMPNT+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  148  AEKVLQNYGGILMPNTEQPFRLNWATFSTGDKRSDNTPDLSIF  190



>ref|XP_010275609.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Nelumbo nucifera]
Length=418

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 110/151 (73%), Gaps = 4/151 (3%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  444
            MQYPAA  VMQHQMMP      +   Y P+  H    H Q QQQQQ  GS  +N+TIW+G
Sbjct  26   MQYPAATMVMQHQMMP----QHYPAHYMPYHHHQQQQHTQQQQQQQQQGSMEDNKTIWVG  81

Query  445  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            DLH WMDE YL SCFA TGEV SIKVIRNKQTG SEGYGFVEF+SHAAAEK LQ+Y    
Sbjct  82   DLHYWMDESYLHSCFAHTGEVVSIKVIRNKQTGQSEGYGFVEFFSHAAAEKVLQNYNGTA  141

Query  625  MPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            MPNTD  FRLNWA+FS GE+R + GSD SIF
Sbjct  142  MPNTDHPFRLNWASFSTGERRSDAGSDRSIF  172



>ref|XP_010525621.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Tarenaya 
hassleriana]
Length=434

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 108/152 (71%), Gaps = 5/152 (3%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  444
            M+YP AA VM HQMM    +       +  +  + P H Q +  +   GSNGEN+TIWIG
Sbjct  53   MRYPPAAAVMPHQMM----FAAAAAAPYSPYHQYQPHHYQSRGNKHFNGSNGENKTIWIG  108

Query  445  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            DLH+WMDE+YL SCFAS GE++S+KVIRNK TG SEGYGFVEF SH  AEK LQ+Y  + 
Sbjct  109  DLHHWMDENYLNSCFASAGEISSVKVIRNKHTGLSEGYGFVEFLSHEIAEKVLQNYNGVA  168

Query  625  MPN-TDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            MPN  DQ FRLNWA+FS GEKRL +G DLSIF
Sbjct  169  MPNAVDQTFRLNWASFSTGEKRLESGPDLSIF  200



>gb|KCW68770.1| hypothetical protein EUGRSUZ_F02369 [Eucalyptus grandis]
Length=399

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  415  NGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAE  594
            NGENRT+W+GDLH+WMDE+YL SCF STGE+ASIKVIRNKQTG SEGYGFVEF++H  AE
Sbjct  56   NGENRTVWVGDLHHWMDENYLHSCFVSTGEIASIKVIRNKQTGLSEGYGFVEFFTHGTAE  115

Query  595  KALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            K LQ+Y+ I+MPNT+Q FRLNWATFS G+KR  N  DLSIF
Sbjct  116  KVLQNYSGIMMPNTEQPFRLNWATFSTGDKRSENAPDLSIF  156



>gb|KCW68769.1| hypothetical protein EUGRSUZ_F02369 [Eucalyptus grandis]
Length=428

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  415  NGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAE  594
            NGENRT+W+GDLH+WMDE+YL SCF STGE+ASIKVIRNKQTG SEGYGFVEF++H  AE
Sbjct  109  NGENRTVWVGDLHHWMDENYLHSCFVSTGEIASIKVIRNKQTGLSEGYGFVEFFTHGTAE  168

Query  595  KALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            K LQ+Y+ I+MPNT+Q FRLNWATFS G+KR  N  DLSIF
Sbjct  169  KVLQNYSGIMMPNTEQPFRLNWATFSTGDKRSENAPDLSIF  209



>ref|XP_010098709.1| Polyadenylate-binding protein RBP47C [Morus notabilis]
 gb|EXB75612.1| Polyadenylate-binding protein RBP47C [Morus notabilis]
Length=423

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 112/159 (70%), Gaps = 8/159 (5%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphymp-------yhphflhhppphaqpqqqqqhGGSNGE  423
            MQYPA A VMQHQMMP   +  HY             + H      Q QQQQ   G   +
Sbjct  29   MQYPATAMVMQHQMMPPPPHHQHYAAPPPPQHYMAAAYHHPYHHGHQQQQQQTGSGGGAD  88

Query  424  NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKAL  603
            N+T+W+GDLH+WMDE+YL SCFA+TGE+ASIK+IRNKQTG SEGYGFVEF+SHA A+  L
Sbjct  89   NKTLWVGDLHHWMDENYLHSCFANTGEIASIKIIRNKQTGLSEGYGFVEFFSHATADTVL  148

Query  604  QSYTCILMPNTDQLFRLNWATFSMGEKRL-NNGSDLSIF  717
            QSY+ + MPN DQ FRLNWA+FS GEKR  NN SDLSIF
Sbjct  149  QSYSAMPMPNIDQPFRLNWASFSTGEKRSDNNASDLSIF  187



>ref|XP_004499084.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cicer arietinum]
Length=426

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 106/154 (69%), Gaps = 4/154 (3%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMP---AThypphympyhphflhhppphaqpqqqqqhGGSNGENRTI  435
            MQYP A  VM H MMP       P    P+H  +          Q   Q  GSNGEN+T+
Sbjct  42   MQYPTA-MVMPHHMMPPQHYAPPPYVPYPHHHQYQQPLHVPHHHQHHHQQHGSNGENKTL  100

Query  436  WIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYT  615
            WIGDLHNWMDE+YL  CFASTGE++SIKVIRNK  G SEGYGFVEF+SHA A+K LQ+Y 
Sbjct  101  WIGDLHNWMDENYLHRCFASTGEISSIKVIRNKHNGISEGYGFVEFFSHATADKVLQNYA  160

Query  616  CILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             ILMPN DQ FRLNWATFS G+K  +N +DLSIF
Sbjct  161  GILMPNADQHFRLNWATFSTGDKGSDNVTDLSIF  194



>ref|XP_010061775.1| PREDICTED: polyadenylate-binding protein RBP47-like [Eucalyptus 
grandis]
 gb|KCW68768.1| hypothetical protein EUGRSUZ_F02369 [Eucalyptus grandis]
Length=452

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  415  NGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAE  594
            NGENRT+W+GDLH+WMDE+YL SCF STGE+ASIKVIRNKQTG SEGYGFVEF++H  AE
Sbjct  109  NGENRTVWVGDLHHWMDENYLHSCFVSTGEIASIKVIRNKQTGLSEGYGFVEFFTHGTAE  168

Query  595  KALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            K LQ+Y+ I+MPNT+Q FRLNWATFS G+KR  N  DLSIF
Sbjct  169  KVLQNYSGIMMPNTEQPFRLNWATFSTGDKRSENAPDLSIF  209



>ref|XP_004291135.1| PREDICTED: polyadenylate-binding protein RBP47-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score =   175 bits (443),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 107/160 (67%), Gaps = 9/160 (6%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAT---------hypphympyhphflhhppphaqpqqqqqhGGSN  417
            MQYPAAA VMQHQMMP                Y       L               GG +
Sbjct  44   MQYPAAAMVMQHQMMPPQHYAPPPPHYMAYHQYQQQPQQHLQQQQQPQMGSGGGGGGGGS  103

Query  418  GENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEK  597
            GEN+TIW+GDLH+WMDE+YL +CFAS GE+ASIKVIRNKQT  SEGYGFVEF+SHA AEK
Sbjct  104  GENKTIWVGDLHHWMDENYLHNCFASAGEIASIKVIRNKQTLLSEGYGFVEFFSHATAEK  163

Query  598  ALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             +Q+Y  ILMPNT+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  164  VIQNYAAILMPNTEQPFRLNWATFSTGDKRSDNAPDLSIF  203



>ref|XP_004501589.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cicer arietinum]
Length=413

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 109/151 (72%), Gaps = 5/151 (3%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  444
            MQYPAAA VMQH M+P  HY P    ++  + H+        Q+     S+ +N+TIW+G
Sbjct  35   MQYPAAAMVMQHHMLPPQHYAPPSPHHYIPYHHYQHQITHVHQR-----SSADNKTIWVG  89

Query  445  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            DLH+WMDE+YL  CFAST E+ SIKVIRNK TG SEGYGFVEF+SH  AEK LQ++  +L
Sbjct  90   DLHHWMDENYLHCCFASTAEIFSIKVIRNKHTGQSEGYGFVEFHSHGTAEKVLQNFAGVL  149

Query  625  MPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            MPNTDQ FRLNWATFS G+KR +N  DLSIF
Sbjct  150  MPNTDQPFRLNWATFSTGDKRSDNVPDLSIF  180



>ref|XP_006374988.1| RNA-binding protein 47 [Populus trichocarpa]
 gb|ERP52785.1| RNA-binding protein 47 [Populus trichocarpa]
Length=429

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  415  NGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAE  594
            +GEN+TIWIGDLH+WMDE+YL SCF STGE+ASIKVIRNKQTG SEGYGFVEF +HA AE
Sbjct  89   SGENKTIWIGDLHHWMDENYLHSCFVSTGEIASIKVIRNKQTGLSEGYGFVEFLTHATAE  148

Query  595  KALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            K LQ+Y  ILMPNT+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  149  KVLQNYGGILMPNTEQPFRLNWATFSTGDKRSDNAPDLSIF  189



>ref|XP_002302445.2| RNA-binding protein 47 [Populus trichocarpa]
 gb|EEE81718.2| RNA-binding protein 47 [Populus trichocarpa]
Length=429

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 116/154 (75%), Gaps = 5/154 (3%)
 Frame = +1

Query  271  YPAAATVMQHQ-----MMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTI  435
            YPAAA VMQH       +P   +      YH +  HH  PH Q QQQQQ  GS+G+N+TI
Sbjct  39   YPAAAMVMQHMPPQHYGLPPPQHYMAATAYHQYQHHHHLPHVQQQQQQQREGSSGDNKTI  98

Query  436  WIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYT  615
             IGDLH+WMDE+YL +CFASTGE+ASIKVIR+KQTG SEGYGFVEF++HA AEK LQ+Y 
Sbjct  99   CIGDLHHWMDENYLHTCFASTGEIASIKVIRSKQTGLSEGYGFVEFFTHATAEKVLQNYG  158

Query  616  CILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             ILMPNT+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  159  GILMPNTEQPFRLNWATFSTGDKRSDNTPDLSIF  192



>ref|XP_010268853.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X2 [Nelumbo 
nucifera]
Length=408

 Score =   172 bits (435),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 101/151 (67%), Gaps = 10/151 (7%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  444
            MQYPAA  VMQHQMMP  +  P+   +H                        EN+TIW+G
Sbjct  26   MQYPAATLVMQHQMMPQHYPQPYMPYHHHQQQPQSQQQGSSD----------ENKTIWVG  75

Query  445  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            DLH WMDE YL +CFA TGEV SIKVIRNKQTG SEGYGFVEF+SHAAAEK L +Y    
Sbjct  76   DLHYWMDESYLHNCFAHTGEVVSIKVIRNKQTGQSEGYGFVEFFSHAAAEKVLHNYNGTA  135

Query  625  MPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            MPNT+  FRLNWA+FSMGE+R + GSD SIF
Sbjct  136  MPNTEHPFRLNWASFSMGERRSDAGSDHSIF  166



>ref|XP_010268845.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X1 [Nelumbo 
nucifera]
Length=413

 Score =   171 bits (434),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 101/151 (67%), Gaps = 10/151 (7%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  444
            MQYPAA  VMQHQMMP  +  P+   +H                        EN+TIW+G
Sbjct  26   MQYPAATLVMQHQMMPQHYPQPYMPYHHHQQQPQSQQQGSSD----------ENKTIWVG  75

Query  445  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            DLH WMDE YL +CFA TGEV SIKVIRNKQTG SEGYGFVEF+SHAAAEK L +Y    
Sbjct  76   DLHYWMDESYLHNCFAHTGEVVSIKVIRNKQTGQSEGYGFVEFFSHAAAEKVLHNYNGTA  135

Query  625  MPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            MPNT+  FRLNWA+FSMGE+R + GSD SIF
Sbjct  136  MPNTEHPFRLNWASFSMGERRSDAGSDHSIF  166



>ref|XP_010647773.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Vitis vinifera]
Length=414

 Score =   169 bits (428),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 108/149 (72%), Gaps = 6/149 (4%)
 Frame = +1

Query  271  YPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIGDL  450
            YPAAA VMQHQMM   HY P++ P  P    + PP  Q        GS  E +T+W+GDL
Sbjct  35   YPAAAMVMQHQMMYPQHYMPYHHPQPPQQYQNQPPQHQMH------GSTDEIKTLWVGDL  88

Query  451  HNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCILMP  630
            H WMD++YLR+CF  TGEV+SIK+IRNKQTG SEGYGFVEF+S A AEK L SY   LMP
Sbjct  89   HQWMDDNYLRTCFGHTGEVSSIKIIRNKQTGQSEGYGFVEFFSRATAEKILHSYNGTLMP  148

Query  631  NTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            NT+Q FRLNWATFS G++R + GSDLSIF
Sbjct  149  NTEQPFRLNWATFSTGDRRTDAGSDLSIF  177



>ref|XP_008813039.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X3 
[Phoenix dactylifera]
Length=350

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 106/152 (70%), Gaps = 1/152 (1%)
 Frame = +1

Query  265  MQYP-AAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWI  441
            MQYP AAA VM HQM+ A   PP          +H PP  Q  Q Q       EN+TIW+
Sbjct  21   MQYPPAAAMVMPHQMVAAVPPPPPPQYSQHFLSYHQPPPPQHHQHQAGAAGGEENKTIWV  80

Query  442  GDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCI  621
            GDLH WM+E+YL SCF  TGEV SIKVIRNKQTG SEGYGFVEFY+ AAAEK LQ++   
Sbjct  81   GDLHYWMEENYLHSCFGHTGEVVSIKVIRNKQTGQSEGYGFVEFYTRAAAEKVLQNFVGH  140

Query  622  LMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            +MPNTDQ FRLNWA+FSMG++R +  SD SIF
Sbjct  141  IMPNTDQPFRLNWASFSMGDRRSDVASDHSIF  172



>ref|XP_008813037.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Phoenix dactylifera]
Length=355

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 106/152 (70%), Gaps = 1/152 (1%)
 Frame = +1

Query  265  MQYP-AAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWI  441
            MQYP AAA VM HQM+ A   PP          +H PP  Q  Q Q       EN+TIW+
Sbjct  21   MQYPPAAAMVMPHQMVAAVPPPPPPQYSQHFLSYHQPPPPQHHQHQAGAAGGEENKTIWV  80

Query  442  GDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCI  621
            GDLH WM+E+YL SCF  TGEV SIKVIRNKQTG SEGYGFVEFY+ AAAEK LQ++   
Sbjct  81   GDLHYWMEENYLHSCFGHTGEVVSIKVIRNKQTGQSEGYGFVEFYTRAAAEKVLQNFVGH  140

Query  622  LMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            +MPNTDQ FRLNWA+FSMG++R +  SD SIF
Sbjct  141  IMPNTDQPFRLNWASFSMGDRRSDVASDHSIF  172



>ref|XP_010907889.1| PREDICTED: polyadenylate-binding protein RBP47 [Elaeis guineensis]
Length=402

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 106/152 (70%), Gaps = 1/152 (1%)
 Frame = +1

Query  265  MQYP-AAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWI  441
            MQYP AAA VM HQM+ A   PP          +H PP  Q  Q Q       EN+TIW+
Sbjct  25   MQYPPAAAMVMPHQMVAAVPPPPPPQYAQHFLPYHQPPPPQHHQHQAGAAGGEENKTIWV  84

Query  442  GDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCI  621
            GDLH WM+E+YL SCF  TGEV SIKVIRNKQTG SEGYGFVEFY+ AAAEK LQS+   
Sbjct  85   GDLHYWMEENYLHSCFGHTGEVVSIKVIRNKQTGQSEGYGFVEFYTRAAAEKVLQSFAGH  144

Query  622  LMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            +MPNTDQ FRLNWA+FSMG++R +  SD SIF
Sbjct  145  IMPNTDQPFRLNWASFSMGDRRSDVASDHSIF  176



>gb|KGN55171.1| hypothetical protein Csa_4G639100 [Cucumis sativus]
Length=366

 Score =   165 bits (418),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            GS  EN+TIW+GDLH+WMDE YL SCF+S GE++S+KVIRNKQTG SEGYGFVEF SH  
Sbjct  78   GSGSENKTIWVGDLHHWMDESYLHSCFSSVGEISSMKVIRNKQTGLSEGYGFVEFLSHTT  137

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AEK LQ+Y+ + MP+T+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  138  AEKVLQNYSGMFMPSTEQTFRLNWATFSTGDKRSDNDPDLSIF  180



>ref|XP_008452518.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
melo]
Length=426

 Score =   167 bits (422),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            GS  EN+TIW+GDLH+WMDE YL SCF+S GE++S+KVIRNKQTG SEGYGFVEF SHA 
Sbjct  78   GSGSENKTIWVGDLHHWMDESYLHSCFSSVGEISSMKVIRNKQTGLSEGYGFVEFLSHAT  137

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AEK LQ+Y+ + MP+T+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  138  AEKVLQNYSGMFMPSTEQTFRLNWATFSTGDKRSDNDPDLSIF  180



>ref|XP_008813036.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Phoenix dactylifera]
Length=398

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 106/152 (70%), Gaps = 1/152 (1%)
 Frame = +1

Query  265  MQYP-AAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWI  441
            MQYP AAA VM HQM+ A   PP          +H PP  Q  Q Q       EN+TIW+
Sbjct  21   MQYPPAAAMVMPHQMVAAVPPPPPPQYSQHFLSYHQPPPPQHHQHQAGAAGGEENKTIWV  80

Query  442  GDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCI  621
            GDLH WM+E+YL SCF  TGEV SIKVIRNKQTG SEGYGFVEFY+ AAAEK LQ++   
Sbjct  81   GDLHYWMEENYLHSCFGHTGEVVSIKVIRNKQTGQSEGYGFVEFYTRAAAEKVLQNFVGH  140

Query  622  LMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            +MPNTDQ FRLNWA+FSMG++R +  SD SIF
Sbjct  141  IMPNTDQPFRLNWASFSMGDRRSDVASDHSIF  172



>ref|XP_010519119.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
RBP47C-like [Tarenaya hassleriana]
Length=424

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 86/103 (83%), Gaps = 1/103 (1%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            SNGEN++IW+GDLH+WMDE+YL SCFAS+GE+AS+KVIRNK +G SEGYGFVEF SH  A
Sbjct  89   SNGENKSIWVGDLHHWMDENYLNSCFASSGEIASVKVIRNKHSGLSEGYGFVEFVSHEIA  148

Query  592  EKALQSYTCILMPNT-DQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK L+ Y+   MPN  DQ FRLNWA+FS GEKRL NG DLSIF
Sbjct  149  EKVLEDYSGTSMPNAGDQTFRLNWASFSTGEKRLENGPDLSIF  191



>ref|XP_004141245.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
sativus]
Length=426

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            GS  EN+TIW+GDLH+WMDE YL SCF+S GE++S+KVIRNKQTG SEGYGFVEF SH  
Sbjct  78   GSGSENKTIWVGDLHHWMDESYLHSCFSSVGEISSMKVIRNKQTGLSEGYGFVEFLSHTT  137

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AEK LQ+Y+ + MP+T+Q FRLNWATFS G+KR +N  DLSIF
Sbjct  138  AEKVLQNYSGMFMPSTEQTFRLNWATFSTGDKRSDNDPDLSIF  180



>gb|KEH35744.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=300

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 104/152 (68%), Gaps = 6/152 (4%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  444
            MQYP AA VM H M+     PP + P  PH       +        HG S  +N+T+W+G
Sbjct  44   MQYPPAAMVMPHHML-----PPQHYPPPPHHYMAYHHYLHHVPHVHHGSSAADNKTLWVG  98

Query  445  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            DLH+WMDE+YL  CFASTGE+ SIKVIRNKQT  +EGYGFVEF SH  AEK LQ+Y  +L
Sbjct  99   DLHHWMDENYLHRCFASTGEIFSIKVIRNKQTCQTEGYGFVEFTSHGTAEKVLQTYAGML  158

Query  625  MPNTDQLFRLNWATFSMGE-KRLNNGSDLSIF  717
            MPNT+Q FRLNWATFS G+ KR +N  DLSIF
Sbjct  159  MPNTEQPFRLNWATFSTGDHKRSDNVPDLSIF  190



>ref|XP_006393576.1| hypothetical protein EUTSA_v10011476mg [Eutrema salsugineum]
 gb|ESQ30862.1| hypothetical protein EUTSA_v10011476mg [Eutrema salsugineum]
Length=447

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 104/152 (68%), Gaps = 2/152 (1%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  444
            M+YP A  VM HQMM A   PP     +  F  H   H Q +  +    SNGEN+TIWIG
Sbjct  62   MRYPPA-VVMPHQMMYAPAPPPSPYSPYHQFPSHHHQHHQSRGNKYQNASNGENKTIWIG  120

Query  445  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            DLH+WMDE YL S FAS GE+ S+KVIRNK TG SEGYGFVEF SH  A+K LQ +    
Sbjct  121  DLHHWMDESYLNSSFASAGEMVSVKVIRNKHTGLSEGYGFVEFLSHDIADKVLQEFNGTT  180

Query  625  MPNTDQLFRLNWATFSMGEKRL-NNGSDLSIF  717
            MPNT+Q FRLNWA+FS GEKRL NNG DLSIF
Sbjct  181  MPNTEQPFRLNWASFSTGEKRLENNGPDLSIF  212



>ref|XP_010539063.1| PREDICTED: polyadenylate-binding protein RBP47C-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010539064.1| PREDICTED: polyadenylate-binding protein RBP47C-like isoform 
X2 [Tarenaya hassleriana]
Length=426

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 101/152 (66%), Gaps = 9/152 (6%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  444
            M +P AA VM HQMM A      Y  Y PH+        Q         SNGEN+TIW+G
Sbjct  48   MHFPPAA-VMPHQMMFAPPPHSAYHQYQPHYFPSRGNKHQSS-------SNGENKTIWVG  99

Query  445  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            DLH+WMDE+YL SCFAS GE+ S+KVIRNK  G SEGYGFVEF SH  A+K LQ+Y    
Sbjct  100  DLHHWMDENYLNSCFASAGEIVSVKVIRNKYNGLSEGYGFVEFISHGIADKVLQNYNGAS  159

Query  625  MPN-TDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            MPN  DQ FRLNWA+FS GEKRL NG DLSIF
Sbjct  160  MPNAVDQTFRLNWASFSTGEKRLENGPDLSIF  191



>ref|XP_002285031.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Vitis vinifera]
Length=416

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 108/151 (72%), Gaps = 8/151 (5%)
 Frame = +1

Query  271  YPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIGDL  450
            YPAAA VMQHQMM   HY P++ P  P    + PP  Q        GS  E +T+W+GDL
Sbjct  35   YPAAAMVMQHQMMYPQHYMPYHHPQPPQQYQNQPPQHQMH------GSTDEIKTLWVGDL  88

Query  451  HNWMDEDYLRSCFASTGEV--ASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            H WMD++YLR+CF  TGEV  +SIK+IRNKQTG SEGYGFVEF+S A AEK L SY   L
Sbjct  89   HQWMDDNYLRTCFGHTGEVKVSSIKIIRNKQTGQSEGYGFVEFFSRATAEKILHSYNGTL  148

Query  625  MPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            MPNT+Q FRLNWATFS G++R + GSDLSIF
Sbjct  149  MPNTEQPFRLNWATFSTGDRRTDAGSDLSIF  179



>emb|CBI32444.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            GS  E +T+W+GDLH WMD++YLR+CF  TGEV+SIK+IRNKQTG SEGYGFVEF+S A 
Sbjct  3    GSTDEIKTLWVGDLHQWMDDNYLRTCFGHTGEVSSIKIIRNKQTGQSEGYGFVEFFSRAT  62

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AEK L SY   LMPNT+Q FRLNWATFS G++R + GSDLSIF
Sbjct  63   AEKILHSYNGTLMPNTEQPFRLNWATFSTGDRRTDAGSDLSIF  105



>ref|XP_006660711.1| PREDICTED: polyadenylate-binding protein RBP47-like [Oryza brachyantha]
Length=344

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +1

Query  406  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  585
            GG   EN+TIW+GDLH WMDE+YL SCF  TGEV +IKVIRNKQTG SEGYGFVEFYSHA
Sbjct  10   GGGQEENKTIWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHA  69

Query  586  AAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AAEK L+ +   +MPNTDQ FR+NWA+FSMG++R +  SD SIF
Sbjct  70   AAEKVLEGFAGHIMPNTDQPFRINWASFSMGDRRSDIASDHSIF  113



>ref|XP_011000065.1| PREDICTED: polyadenylate-binding protein RBP47 [Populus euphratica]
Length=436

 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 88/103 (85%), Gaps = 1/103 (1%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            GSN E +TIW+GDL +WMDE YL +CF+ TGEV+S+K+IRNKQTG  EGYGFVEFYS AA
Sbjct  98   GSNEEAKTIWVGDLLHWMDETYLHNCFSHTGEVSSVKIIRNKQTGQLEGYGFVEFYSRAA  157

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AEK LQSY+C +MPNTDQ FRLNWA+F+ GE+R + GSDLSIF
Sbjct  158  AEKVLQSYSCSMMPNTDQPFRLNWASFA-GERRADAGSDLSIF  199



>ref|NP_001063403.1| Os09g0462700 [Oryza sativa Japonica Group]
 dbj|BAF25317.1| Os09g0462700, partial [Oryza sativa Japonica Group]
Length=441

 Score =   162 bits (409),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +1

Query  406  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  585
            GG   EN+TIW+GDLH WMDE+YL SCF  TGEV +IKVIRNKQTG SEGYGFVEFYSHA
Sbjct  108  GGGQEENKTIWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHA  167

Query  586  AAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AAEK L+ +   +MPNTDQ FR+NWA+FSMG++R +  SD SIF
Sbjct  168  AAEKVLEGFAGHIMPNTDQPFRINWASFSMGDRRSDIASDHSIF  211



>ref|XP_003603009.1| RNA-binding protein [Medicago truncatula]
 gb|AES73260.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=420

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 104/152 (68%), Gaps = 6/152 (4%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  444
            MQYP AA VM H M+     PP + P  PH       +        HG S  +N+T+W+G
Sbjct  44   MQYPPAAMVMPHHML-----PPQHYPPPPHHYMAYHHYLHHVPHVHHGSSAADNKTLWVG  98

Query  445  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            DLH+WMDE+YL  CFASTGE+ SIKVIRNKQT  +EGYGFVEF SH  AEK LQ+Y  +L
Sbjct  99   DLHHWMDENYLHRCFASTGEIFSIKVIRNKQTCQTEGYGFVEFTSHGTAEKVLQTYAGML  158

Query  625  MPNTDQLFRLNWATFSMGE-KRLNNGSDLSIF  717
            MPNT+Q FRLNWATFS G+ KR +N  DLSIF
Sbjct  159  MPNTEQPFRLNWATFSTGDHKRSDNVPDLSIF  190



>ref|XP_009417617.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Musa acuminata 
subsp. malaccensis]
Length=399

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+TIW+GDLH WMDE+YL +CF  TGEV SIKVIRNKQTG SEGYGFVEFY+HAAAEK 
Sbjct  75   ENKTIWVGDLHYWMDENYLHNCFGHTGEVVSIKVIRNKQTGQSEGYGFVEFYTHAAAEKV  134

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ++    MPNTDQ FRLNWA+FSMG++R +  SD SIF
Sbjct  135  LQNFGGHTMPNTDQPFRLNWASFSMGDRRSDASSDYSIF  173



>emb|CAL25353.1| ACBF-like dna binding protein [Platanus x acerifolia]
Length=216

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+TIW+GDLH WMD +YL +CFA TGEV SIKVIRNKQTG SEGYGFVEF+S  AAEK 
Sbjct  27   ENKTIWVGDLHYWMDGNYLNNCFAHTGEVISIKVIRNKQTGQSEGYGFVEFFSREAAEKV  86

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y    MPNT+Q FRLNWA+FSMGE+R   GSD SIF
Sbjct  87   LQNYNGTAMPNTEQPFRLNWASFSMGERRSEAGSDHSIF  125



>gb|ACF87959.1| unknown [Zea mays]
 tpg|DAA61808.1| TPA: hypothetical protein ZEAMMB73_995180 [Zea mays]
Length=433

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+++W+GDLH WMDE+YL SCF  TGEV +IKVIRNKQTG SEGYGFVEFYSHAAAEK 
Sbjct  101  ENKSVWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKV  160

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            L+ ++  +MPNTDQ FRLNWA+FSMG++R ++ SD SIF
Sbjct  161  LEGFSGHIMPNTDQPFRLNWASFSMGDRRSDSASDHSIF  199



>ref|XP_008782206.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Phoenix dactylifera]
Length=385

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 109/156 (70%), Gaps = 6/156 (4%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGG-----SNGENR  429
            +QYPAA   MQHQMM A   P +   + P+  H  PP   P QQ    G     ++ EN+
Sbjct  25   VQYPAA-MAMQHQMMGAVPPPQYAQLFLPYPQHCLPPPPPPNQQHHQQGWAAALASDENK  83

Query  430  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  609
            TIW+GDLH WMDE Y+ SCF  TGEV SIKVIRNK+TG SEGYGFVEF+SHAAAEK LQ+
Sbjct  84   TIWVGDLHYWMDESYIHSCFGHTGEVVSIKVIRNKKTGQSEGYGFVEFFSHAAAEKVLQN  143

Query  610  YTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            +    MPNT+Q FRLNWA+FSMG+KR +  SD SIF
Sbjct  144  FCGYAMPNTEQPFRLNWASFSMGDKRSDAASDHSIF  179



>ref|XP_008782204.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Phoenix dactylifera]
Length=409

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 109/156 (70%), Gaps = 6/156 (4%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGG-----SNGENR  429
            +QYPAA   MQHQMM A   P +   + P+  H  PP   P QQ    G     ++ EN+
Sbjct  25   VQYPAA-MAMQHQMMGAVPPPQYAQLFLPYPQHCLPPPPPPNQQHHQQGWAAALASDENK  83

Query  430  TIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQS  609
            TIW+GDLH WMDE Y+ SCF  TGEV SIKVIRNK+TG SEGYGFVEF+SHAAAEK LQ+
Sbjct  84   TIWVGDLHYWMDESYIHSCFGHTGEVVSIKVIRNKKTGQSEGYGFVEFFSHAAAEKVLQN  143

Query  610  YTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            +    MPNT+Q FRLNWA+FSMG+KR +  SD SIF
Sbjct  144  FCGYAMPNTEQPFRLNWASFSMGDKRSDAASDHSIF  179



>gb|AGV54251.1| RNA binding post-transcriptional regulator csx1 like protein 
[Phaseolus vulgaris]
Length=416

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 101/151 (67%), Gaps = 5/151 (3%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  444
            MQYP A  VM H M+P      HY P +  F HH         QQ   GS+GEN+T+WIG
Sbjct  39   MQYPTA-MVMPHHMLPP----QHYAPPYVPFHHHQYAPPHVPHQQHQNGSSGENKTVWIG  93

Query  445  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            DLH+WMDE+YL  CFASTGE++SIKVIRNKQTG SEGYGFVEFYSHA AEK LQ Y  IL
Sbjct  94   DLHHWMDENYLHRCFASTGEISSIKVIRNKQTGLSEGYGFVEFYSHATAEKILQKYAGIL  153

Query  625  MPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             P   Q FRLN   FS G+K  NN  DL IF
Sbjct  154  RPKKKQAFRLNGVPFSKGKKGSNNVPDLFIF  184



>ref|NP_001144988.1| uncharacterized protein LOC100278143 [Zea mays]
 gb|ACG44236.1| hypothetical protein [Zea mays]
Length=436

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+++W+GDLH WMDE+YL SCF  TGEV +IKVIRNKQTG SEGYGFVEFYSHAAAEK 
Sbjct  104  ENKSVWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKV  163

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            L+ ++  +MPNTDQ FRLNWA+FSMG++R +  SD SIF
Sbjct  164  LEGFSGHIMPNTDQPFRLNWASFSMGDRRSDAASDHSIF  202



>ref|XP_003578248.1| PREDICTED: polyadenylate-binding protein RBP47-like [Brachypodium 
distachyon]
Length=431

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            G   EN+TIW+GDLH WMDE+YL SCF  TGEV +IKVIRNKQTG SEGYGFVEFYSHAA
Sbjct  98   GGQEENKTIWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAA  157

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AEK L  +   +MPNTDQ FR+NWA+FSMG++R +  SD SIF
Sbjct  158  AEKVLDGFAGHIMPNTDQPFRINWASFSMGDRRSDIASDHSIF  200



>gb|KCW63816.1| hypothetical protein EUGRSUZ_G01492 [Eucalyptus grandis]
Length=432

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  427  RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQ  606
            +TIWIGDLH+WMDE YL +CF+ TGEV+S+KVIRNKQTG SEGYGFVEF SHA AEK LQ
Sbjct  99   KTIWIGDLHHWMDETYLHNCFSHTGEVSSVKVIRNKQTGQSEGYGFVEFSSHATAEKVLQ  158

Query  607  SYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            SY    MPNT+Q FRLNWA FS G+KRL+ GSDLSIF
Sbjct  159  SYNGTSMPNTEQPFRLNWAMFSSGDKRLDMGSDLSIF  195



>ref|XP_002313840.2| RNA-binding protein 47 [Populus trichocarpa]
 gb|EEE87795.2| RNA-binding protein 47 [Populus trichocarpa]
Length=435

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 88/103 (85%), Gaps = 1/103 (1%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            GSN E +T+W+GDL +WMDE YL +CF+ TGEV+S+K+IRNKQTG  EGYGFVEFYSHAA
Sbjct  97   GSNEEAKTVWVGDLLHWMDETYLHNCFSHTGEVSSVKIIRNKQTGQLEGYGFVEFYSHAA  156

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AEK LQSY+  +MPNTDQ FRLNWA+F+ GE+R + GSDLSIF
Sbjct  157  AEKVLQSYSGSMMPNTDQPFRLNWASFA-GERRADAGSDLSIF  198



>gb|KJB79290.1| hypothetical protein B456_013G042300 [Gossypium raimondii]
Length=294

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +1

Query  406  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  585
            G ++ E +TIW+GDL +WMDE YL SCF+ TGEV+S+K+IRNKQTG SEGYGFVEFYS  
Sbjct  95   GSNSDEVKTIWVGDLVHWMDESYLHSCFSHTGEVSSVKIIRNKQTGQSEGYGFVEFYSRE  154

Query  586  AAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AAEK LQSY   LMPNT+Q FRLNWA+FS+ E+R ++GSDLSIF
Sbjct  155  AAEKVLQSYNGSLMPNTEQPFRLNWASFSVNERRPDSGSDLSIF  198



>ref|XP_010066047.1| PREDICTED: polyadenylate-binding protein RBP47 [Eucalyptus grandis]
Length=445

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  427  RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQ  606
            +TIWIGDLH+WMDE YL +CF+ TGEV+S+KVIRNKQTG SEGYGFVEF SHA AEK LQ
Sbjct  112  KTIWIGDLHHWMDETYLHNCFSHTGEVSSVKVIRNKQTGQSEGYGFVEFSSHATAEKVLQ  171

Query  607  SYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            SY    MPNT+Q FRLNWA FS G+KRL+ GSDLSIF
Sbjct  172  SYNGTSMPNTEQPFRLNWAMFSSGDKRLDMGSDLSIF  208



>ref|NP_001132004.1| uncharacterized protein LOC100193409 [Zea mays]
 gb|ACF80669.1| unknown [Zea mays]
Length=422

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+TIW+GDLH WMDE+YL +CF  TGEV +IKVIRNKQTG SEGYGFVEFYSHAAAE+ 
Sbjct  90   ENKTIWVGDLHFWMDENYLHNCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAERV  149

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            L+ ++  +MPNTDQ FRLNWA+FSMG++R +  SD SIF
Sbjct  150  LEGFSGHIMPNTDQPFRLNWASFSMGDRRSDVASDHSIF  188



>ref|XP_004957051.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Setaria 
italica]
Length=437

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+T+W+GDLH WMDE+YL SCF  TGEV +IKVIRNKQTG SEGYGFVEFYSH AAEK 
Sbjct  107  ENKTVWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHGAAEKV  166

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            L+ ++  +MPNTDQ FRLNWA+FSMG++R +  SD SIF
Sbjct  167  LEGFSGHIMPNTDQPFRLNWASFSMGDRRSDVASDHSIF  205



>ref|XP_008667171.1| PREDICTED: uncharacterized protein LOC100193409 isoform X1 [Zea 
mays]
 tpg|DAA40260.1| TPA: hypothetical protein ZEAMMB73_589753 [Zea mays]
Length=424

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+TIW+GDLH WMDE+YL +CF  TGEV +IKVIRNKQTG SEGYGFVEFYSHAAAE+ 
Sbjct  90   ENKTIWVGDLHFWMDENYLHNCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAERV  149

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            L+ ++  +MPNTDQ FRLNWA+FSMG++R +  SD SIF
Sbjct  150  LEGFSGHIMPNTDQPFRLNWASFSMGDRRSDVASDHSIF  188



>dbj|BAG87507.1| unnamed protein product [Oryza sativa Japonica Group]
Length=345

 Score =   157 bits (398),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +1

Query  424  NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKAL  603
            N+TIW+GDLH WMDE+YL SCF  TGEV +IKVIRNKQTG SEGYGFVEFYSHAAAEK L
Sbjct  18   NKTIWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKVL  77

Query  604  QSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            + +   +MPNTDQ FR+NWA+FSMG++R +  SD SIF
Sbjct  78   EGFAGHIMPNTDQPFRINWASFSMGDRRSDIASDHSIF  115



>ref|XP_011004995.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=434

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 87/103 (84%), Gaps = 1/103 (1%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            GSN E +TIW+GDL +WMDE YL +CF+ TGEV+S+K+IRNKQTG  EGYGFVEFYS AA
Sbjct  96   GSNEEAKTIWVGDLLHWMDEAYLHNCFSHTGEVSSVKIIRNKQTGQLEGYGFVEFYSRAA  155

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AEK LQSY+C +MPNTDQ FRLNWA+F+ GE+R + GSD SIF
Sbjct  156  AEKVLQSYSCSMMPNTDQPFRLNWASFA-GERRADPGSDPSIF  197



>dbj|BAJ85879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+TIW+GDLH WMDE+YL +CF  TGEV +IKVIRNKQTG SEGYGFVEFYSHAAAEK 
Sbjct  151  ENKTIWVGDLHYWMDENYLHTCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKV  210

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            L  +   +MPNTDQ FR+NWA+FSMG++R +  SD SIF
Sbjct  211  LDGFAGHIMPNTDQPFRINWASFSMGDRRSDIASDHSIF  249



>ref|XP_006653468.1| PREDICTED: polyadenylate-binding protein RBP47-like [Oryza brachyantha]
Length=409

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 87/105 (83%), Gaps = 2/105 (2%)
 Frame = +1

Query  409  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            G NG  EN+TIW+GDL  WMDE+YL SCF ++GEV +IKVIRN+QTG SEGYGFVEFYSH
Sbjct  79   GGNGCEENKTIWVGDLQYWMDENYLHSCFGTSGEVVTIKVIRNRQTGQSEGYGFVEFYSH  138

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             +AEKALQ++T  +MPNTD+ F+LNWA++SMGEKR    SD SIF
Sbjct  139  GSAEKALQNFTGHVMPNTDRPFKLNWASYSMGEKRSEVASDYSIF  183


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 49/88 (56%), Gaps = 10/88 (11%)
 Frame = +1

Query  406  GGSNGE--NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYS  579
            G S+G+  NRT+++G L   + ED LR  FA  G+VAS+K+   KQ       GFV+F S
Sbjct  272  GHSDGDFTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQC------GFVQFVS  325

Query  580  HAAAEKALQSYTCILMPNTDQLFRLNWA  663
               AE+ALQ     ++    Q  RL+W 
Sbjct  326  RTDAEEALQGLNGSVI--GKQAVRLSWG  351



>ref|XP_008392304.1| PREDICTED: polyadenylate-binding protein RBP47 [Malus domestica]
Length=443

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            G N E RTIW+GDLH+WMDE YL  CFA TG+V+SIKVIRNKQTG SEGYGFVEFYS  A
Sbjct  103  GPNDEVRTIWVGDLHHWMDETYLHGCFAHTGQVSSIKVIRNKQTGQSEGYGFVEFYSREA  162

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AE+ LQ+Y    MPNT+Q FRLNWATFS G++R +  +DLSIF
Sbjct  163  AEEVLQNYNGTAMPNTEQPFRLNWATFSAGDRRADTSADLSIF  205



>gb|AFW58430.1| nucleic acid binding protein, partial [Zea mays]
Length=241

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 87/105 (83%), Gaps = 2/105 (2%)
 Frame = +1

Query  409  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            G NG  EN+TIW+GDL  WMDE+YL +CF  +GEV +IKVIRN+QTG SEGYGFVEF+SH
Sbjct  91   GGNGCEENKTIWVGDLQYWMDENYLHNCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFFSH  150

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            A+AEKALQ++T  +MPNTD+ F+LNWA++SMGEKR    SD SIF
Sbjct  151  ASAEKALQNFTGHVMPNTDRPFKLNWASYSMGEKRSEVASDHSIF  195



>ref|XP_010500273.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=444

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 81/103 (79%), Gaps = 1/103 (1%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            SNGEN+TIW+GDL+ WMDE YL S F STGE+ S+KVIRNK  G+SEGYGFVEF SH  A
Sbjct  107  SNGENKTIWVGDLYQWMDEPYLNSSFGSTGEIVSVKVIRNKHNGYSEGYGFVEFESHDVA  166

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRL-NNGSDLSIF  717
            EK LQ +    MP T+Q FRLNWA+FS GEKRL NNG DLSIF
Sbjct  167  EKVLQKFNGATMPTTEQPFRLNWASFSTGEKRLENNGPDLSIF  209



>ref|NP_001052934.2| Os04g0449900 [Oryza sativa Japonica Group]
 dbj|BAF14848.2| Os04g0449900 [Oryza sativa Japonica Group]
Length=387

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 86/105 (82%), Gaps = 2/105 (2%)
 Frame = +1

Query  409  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            G NG  EN+TIW+GDL  WMDE+YL SCF  +GEV +IKVIRN+QTG SEGYGFVEFYSH
Sbjct  57   GGNGCEENKTIWVGDLQYWMDENYLHSCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFYSH  116

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             +AEKALQ++T  +MPNTD+ F+LNWA++SMGEKR    SD SIF
Sbjct  117  GSAEKALQNFTGHVMPNTDRPFKLNWASYSMGEKRSEVASDYSIF  161


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 11/102 (11%)
 Frame = +1

Query  406  GGSNGE--NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYS  579
            G S+G+  NRT+++G L   + ED LR  FA  G+VAS+K+   KQ       GFV+F S
Sbjct  250  GHSDGDSTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQC------GFVQFVS  303

Query  580  HAAAEKALQSYTCILMPNTDQLFRLNWA-TFSMGEKRLNNGS  702
               AE+ALQ     ++    Q  RL+W  + S  + R ++GS
Sbjct  304  RTDAEEALQGLNGSVI--GKQAVRLSWGRSPSHKQSRADSGS  343



>gb|ERN07615.1| hypothetical protein AMTR_s00157p00080130 [Amborella trichopoda]
Length=291

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            S+ EN+++W+GDL  WMDE+YL SCF  TGEV S+KVIRNKQTG SEGYGFVEF S AAA
Sbjct  74   SSEENKSLWVGDLQYWMDENYLNSCFGHTGEVVSLKVIRNKQTGQSEGYGFVEFVSRAAA  133

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQ+Y   +MP+TDQ FRLNWATFSMG++R + GSD SIF
Sbjct  134  EKILQNYNGGMMPSTDQAFRLNWATFSMGDRRSDMGSDHSIF  175



>ref|XP_003529385.1| PREDICTED: polyadenylate-binding protein RBP47-like [Glycine 
max]
Length=431

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 83/100 (83%), Gaps = 1/100 (1%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            E RT+W+GDLH+WMDE+YL +CFA TGEV S KVIRNKQTG SEGYGFVEFYS A AEK 
Sbjct  99   EIRTVWLGDLHHWMDENYLHNCFAHTGEVVSAKVIRNKQTGQSEGYGFVEFYSRATAEKV  158

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNG-SDLSIF  717
            LQ+Y   +MPNTDQ FRLNWATFS GE+R ++  SDLSIF
Sbjct  159  LQNYNGTMMPNTDQAFRLNWATFSAGERRSSDATSDLSIF  198



>ref|XP_009358068.1| PREDICTED: polyadenylate-binding protein RBP47-like [Pyrus x 
bretschneideri]
Length=390

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            G N E RTIW+GDLH+WMDE YL  CFA TG+V+SIKVIRNKQTG SEGYGFVEFYS  A
Sbjct  50   GPNDEVRTIWVGDLHHWMDETYLHGCFAHTGQVSSIKVIRNKQTGQSEGYGFVEFYSREA  109

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AE+ LQ+Y    MPNT+Q FRLNWATFS  +KR +  +DLSIF
Sbjct  110  AEEVLQNYNGTAMPNTEQPFRLNWATFSASDKRADTSADLSIF  152



>ref|XP_009390905.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=403

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 99/154 (64%), Gaps = 3/154 (2%)
 Frame = +1

Query  265  MQYPAAATVMQHQMM---PAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTI  435
            ++YPA A VMQH MM   P  H    Y          PP  +    Q     +  E RTI
Sbjct  21   VRYPAPAMVMQHPMMAPPPYGHPFVAYHQTPTPPPPPPPLKSIRLHQAVDAAAEDEKRTI  80

Query  436  WIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYT  615
            W+GDLH WMDE+YL SCF  +GEV SIKVIRNKQTG SEGYGFVEF+SHA AE  LQS+ 
Sbjct  81   WVGDLHYWMDENYLHSCFGHSGEVVSIKVIRNKQTGQSEGYGFVEFHSHATAENILQSFG  140

Query  616  CILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
              LMPNT+  +RLNWA+FSMG+K  +  SD SIF
Sbjct  141  SHLMPNTNHPYRLNWASFSMGDKHSDLASDHSIF  174



>gb|KJB79289.1| hypothetical protein B456_013G042300 [Gossypium raimondii]
Length=438

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +1

Query  406  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  585
            G ++ E +TIW+GDL +WMDE YL SCF+ TGEV+S+K+IRNKQTG SEGYGFVEFYS  
Sbjct  95   GSNSDEVKTIWVGDLVHWMDESYLHSCFSHTGEVSSVKIIRNKQTGQSEGYGFVEFYSRE  154

Query  586  AAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AAEK LQSY   LMPNT+Q FRLNWA+FS+ E+R ++GSDLSIF
Sbjct  155  AAEKVLQSYNGSLMPNTEQPFRLNWASFSVNERRPDSGSDLSIF  198



>gb|EAY94326.1| hypothetical protein OsI_16094 [Oryza sativa Indica Group]
Length=426

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 86/105 (82%), Gaps = 2/105 (2%)
 Frame = +1

Query  409  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            G NG  EN+TIW+GDL  WMDE+YL SCF  +GEV +IKVIRN+QTG SEGYGFVEFYSH
Sbjct  96   GGNGCEENKTIWVGDLQYWMDENYLHSCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFYSH  155

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             +AEKALQ++T  +MPNTD+ F+LNWA++SMGEKR    SD SIF
Sbjct  156  GSAEKALQNFTGHVMPNTDRPFKLNWASYSMGEKRSEVASDYSIF  200


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 11/102 (11%)
 Frame = +1

Query  406  GGSNGE--NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYS  579
            G S+G+  NRT+++G L   + ED LR  FA  G+VAS+K+   KQ       GFV+F S
Sbjct  289  GHSDGDSTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQC------GFVQFVS  342

Query  580  HAAAEKALQSYTCILMPNTDQLFRLNWA-TFSMGEKRLNNGS  702
               AE+ALQ     ++    Q  RL+W  + S  + R ++GS
Sbjct  343  RTDAEEALQGLNGSVI--GKQAVRLSWGRSPSHKQSRADSGS  382



>emb|CAH67097.1| H0818E04.14 [Oryza sativa Indica Group]
Length=426

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 86/105 (82%), Gaps = 2/105 (2%)
 Frame = +1

Query  409  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            G NG  EN+TIW+GDL  WMDE+YL SCF  +GEV +IKVIRN+QTG SEGYGFVEFYSH
Sbjct  96   GGNGCEENKTIWVGDLQYWMDENYLHSCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFYSH  155

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             +AEKALQ++T  +MPNTD+ F+LNWA++SMGEKR    SD SIF
Sbjct  156  GSAEKALQNFTGHVMPNTDRPFKLNWASYSMGEKRSEVASDYSIF  200


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 11/102 (11%)
 Frame = +1

Query  406  GGSNGE--NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYS  579
            G S+G+  NRT+++G L   + ED LR  FA  G+VAS+K+   KQ       GFV+F S
Sbjct  289  GHSDGDSTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQC------GFVQFVS  342

Query  580  HAAAEKALQSYTCILMPNTDQLFRLNWA-TFSMGEKRLNNGS  702
               AE+ALQ     ++    Q  RL+W  + S  + R ++GS
Sbjct  343  RTDAEEALQGLNGSVI--GKQAVRLSWGRSPSHKQSRADSGS  382



>gb|KJB79291.1| hypothetical protein B456_013G042300 [Gossypium raimondii]
Length=415

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +1

Query  406  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  585
            G ++ E +TIW+GDL +WMDE YL SCF+ TGEV+S+K+IRNKQTG SEGYGFVEFYS  
Sbjct  95   GSNSDEVKTIWVGDLVHWMDESYLHSCFSHTGEVSSVKIIRNKQTGQSEGYGFVEFYSRE  154

Query  586  AAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AAEK LQSY   LMPNT+Q FRLNWA+FS+ E+R ++GSDLSIF
Sbjct  155  AAEKVLQSYNGSLMPNTEQPFRLNWASFSVNERRPDSGSDLSIF  198



>ref|XP_003518846.1| PREDICTED: polyadenylate-binding protein RBP47-like [Glycine 
max]
Length=431

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 84/103 (82%), Gaps = 1/103 (1%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            S+ E RT+W+GDLH+WMDE+YL +CFA TGEV S KVIRNKQTG SEGYGFVEFYS   A
Sbjct  95   SSDEIRTVWLGDLHHWMDENYLHNCFAHTGEVVSAKVIRNKQTGQSEGYGFVEFYSRGTA  154

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNG-SDLSIF  717
            EK LQ+Y   +MPNTDQ FRLNWATFS GE+R ++  SDLSIF
Sbjct  155  EKVLQNYNGTMMPNTDQAFRLNWATFSAGERRSSDATSDLSIF  197



>ref|XP_010461546.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=446

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 81/103 (79%), Gaps = 1/103 (1%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            SNGEN+TIW+GDLH+WMDE YL S F S GE+ S+KVIRNK  G+SEGYGFVEF SH  A
Sbjct  109  SNGENKTIWVGDLHHWMDEPYLNSSFGSAGEIVSVKVIRNKHNGYSEGYGFVEFESHDVA  168

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRL-NNGSDLSIF  717
            +K LQ +    MP T+Q FRLNWA+FS GEKRL NNG DLSIF
Sbjct  169  DKVLQKFNGATMPTTEQPFRLNWASFSTGEKRLENNGPDLSIF  211



>ref|XP_004952707.1| PREDICTED: polyadenylate-binding protein RBP47C'-like [Setaria 
italica]
Length=428

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 87/105 (83%), Gaps = 1/105 (1%)
 Frame = +1

Query  406  GGSNGE-NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            GG+ GE NRTIW+GDL  WMDE+YL SCF  +GEV +IKVIRN+ +G SEGYGFVEFYSH
Sbjct  96   GGNGGEDNRTIWVGDLQYWMDENYLHSCFGPSGEVVTIKVIRNRHSGVSEGYGFVEFYSH  155

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            A+AEKALQ+++  +MPNTD+ F+LNWA++SMGEKR    SD SIF
Sbjct  156  ASAEKALQNFSGHVMPNTDRAFKLNWASYSMGEKRSELASDHSIF  200


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 44/80 (55%), Gaps = 8/80 (10%)
 Frame = +1

Query  424  NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKAL  603
            NRT+++G L   + E+ LR  FA  G++AS+K+   KQ       GFV+F + A AE+AL
Sbjct  297  NRTVYVGGLDPNVSEEELRKAFAKYGDLASVKIPVGKQC------GFVQFVNRADAEEAL  350

Query  604  QSYTCILMPNTDQLFRLNWA  663
            Q      +    Q  RL+W 
Sbjct  351  QGLNGSTI--GKQAVRLSWG  368



>ref|XP_002446570.1| hypothetical protein SORBIDRAFT_06g018280 [Sorghum bicolor]
 gb|EES10898.1| hypothetical protein SORBIDRAFT_06g018280 [Sorghum bicolor]
Length=423

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 87/105 (83%), Gaps = 2/105 (2%)
 Frame = +1

Query  409  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            G NG  EN+TIW+GDL  WMDE+YL SCF  +GEV +IKVIRN+QTG SEGYGFVEF+SH
Sbjct  93   GGNGCEENKTIWVGDLQYWMDENYLHSCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFFSH  152

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            A+AEKALQ++T  +MPNTD+ F+LNWA++SMGEKR    SD SIF
Sbjct  153  ASAEKALQNFTGHVMPNTDRAFKLNWASYSMGEKRSEVASDHSIF  197


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 49/88 (56%), Gaps = 10/88 (11%)
 Frame = +1

Query  406  GGSNGE--NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYS  579
            G S+G+  NRT+++G L   + ED LR  FA  G++AS+K+   KQ       GFV+F S
Sbjct  286  GHSDGDSSNRTVYVGGLDPNVSEDELRKAFAKYGDLASVKIPLGKQC------GFVQFAS  339

Query  580  HAAAEKALQSYTCILMPNTDQLFRLNWA  663
               AE+ALQ     L+    Q  RL+W 
Sbjct  340  RTDAEEALQGLNGSLI--GKQAVRLSWG  365



>gb|EPS57677.1| hypothetical protein M569_17140 [Genlisea aurea]
Length=414

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +N+TIWIGDL  WMDE+YL SCF+ TGEV S+KVIRNKQTG SE YGFVEF SH AAEK 
Sbjct  90   DNKTIWIGDLQQWMDENYLHSCFSQTGEVVSVKVIRNKQTGQSEKYGFVEFISHGAAEKV  149

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQSY    MPNTDQ FRLNWA+FS G++  ++GSDLSIF
Sbjct  150  LQSYNGSTMPNTDQQFRLNWASFSTGDRLPDSGSDLSIF  188



>ref|XP_010926371.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Elaeis 
guineensis]
Length=791

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+TIW+GDLH WMDE YL SCF  TGEV SIKVIRNK+TG SEGYGFVEF+SHAAAEK 
Sbjct  420  ENKTIWVGDLHYWMDESYLHSCFGHTGEVVSIKVIRNKKTGQSEGYGFVEFFSHAAAEKV  479

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ++    MPNT+QLFRLNWA+FSMG+KR +  SD S+F
Sbjct  480  LQNFNGYAMPNTEQLFRLNWASFSMGDKRSDASSDHSLF  518



>gb|KDO49120.1| hypothetical protein CISIN_1g013061mg [Citrus sinensis]
Length=307

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            +N E +TIWIGDL +WMDE +L +CF+ TG+V ++KVIRNKQTG SEGYGFVEFYS AAA
Sbjct  111  TNDETKTIWIGDLFHWMDETFLHNCFSHTGQVVNVKVIRNKQTGQSEGYGFVEFYSRAAA  170

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQSY+  LMPNTDQ FRLNWATFS  ++R    SDLSIF
Sbjct  171  EKVLQSYSGSLMPNTDQPFRLNWATFSGSDRRTEACSDLSIF  212



>ref|XP_007156542.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
 gb|ESW28536.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
Length=367

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 84/103 (82%), Gaps = 1/103 (1%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            S+ E RTIW+GDLH+WMDE+YL +CFA TGEV S KVIRNKQTG SEGYGFVEFY+   A
Sbjct  29   SSDEIRTIWLGDLHHWMDENYLHNCFAHTGEVLSAKVIRNKQTGQSEGYGFVEFYTRPTA  88

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNG-SDLSIF  717
            EK LQ+Y   +MPNTDQ FRLNWATFS G++R ++  SDLSIF
Sbjct  89   EKVLQNYNGTMMPNTDQAFRLNWATFSAGDRRSSDATSDLSIF  131



>ref|XP_007156541.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
 gb|ESW28535.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
Length=363

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 84/103 (82%), Gaps = 1/103 (1%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            S+ E RTIW+GDLH+WMDE+YL +CFA TGEV S KVIRNKQTG SEGYGFVEFY+   A
Sbjct  29   SSDEIRTIWLGDLHHWMDENYLHNCFAHTGEVLSAKVIRNKQTGQSEGYGFVEFYTRPTA  88

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNG-SDLSIF  717
            EK LQ+Y   +MPNTDQ FRLNWATFS G++R ++  SDLSIF
Sbjct  89   EKVLQNYNGTMMPNTDQAFRLNWATFSAGDRRSSDATSDLSIF  131



>gb|ACG32072.1| nucleic acid binding protein [Zea mays]
 gb|ACG34530.1| nucleic acid binding protein [Zea mays]
 gb|AFW58432.2| hypothetical protein ZEAMMB73_000058 [Zea mays]
Length=369

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 87/105 (83%), Gaps = 2/105 (2%)
 Frame = +1

Query  409  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            G NG  EN+TIW+GDL  WMDE+YL +CF  +GEV +IKVIRN+QTG SEGYGFVEF+SH
Sbjct  40   GGNGCEENKTIWVGDLQYWMDENYLHNCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFFSH  99

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            A+AEKALQ++T  +MPNTD+ F+LNWA++SMGEKR    SD SIF
Sbjct  100  ASAEKALQNFTGHVMPNTDRPFKLNWASYSMGEKRSEVASDHSIF  144



>gb|KDO49118.1| hypothetical protein CISIN_1g013061mg [Citrus sinensis]
Length=341

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            +N E +TIWIGDL +WMDE +L +CF+ TG+V ++KVIRNKQTG SEGYGFVEFYS AAA
Sbjct  111  TNDETKTIWIGDLFHWMDETFLHNCFSHTGQVVNVKVIRNKQTGQSEGYGFVEFYSRAAA  170

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQSY+  LMPNTDQ FRLNWATFS  ++R    SDLSIF
Sbjct  171  EKVLQSYSGSLMPNTDQPFRLNWATFSGSDRRTEACSDLSIF  212



>emb|CDO97156.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 108/158 (68%), Gaps = 9/158 (6%)
 Frame = +1

Query  265  MQYPAAATVMQHQMM------PAThypphympyhphflhhppphaqpqqqqqhGGSNGEN  426
            MQYPAAA VMQ QMM      PA  Y  H +    H L+ P P  + Q Q Q+  S+ EN
Sbjct  42   MQYPAAAMVMQQQMMYDRQYVPAAAYYHHQLYQQQHQLYQPQPQHKQQSQIQN--SSEEN  99

Query  427  RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQ  606
            RTIWIGDL  WMDE YL SCF+   E+ S+KVIRNKQTG SE YGFVEF SHAAA+K LQ
Sbjct  100  RTIWIGDLQQWMDEAYLLSCFSQASELISVKVIRNKQTGQSERYGFVEFSSHAAADKVLQ  159

Query  607  SYTCILMPNTDQLFRLNWATFSMGEKRLNNGS-DLSIF  717
            SY  + MPNT+Q+F LNWA FSMG +R   G+ DLSIF
Sbjct  160  SYNGLPMPNTEQVFHLNWAAFSMGNRRQEAGAVDLSIF  197



>gb|KDO49121.1| hypothetical protein CISIN_1g013061mg [Citrus sinensis]
Length=349

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            +N E +TIWIGDL +WMDE +L +CF+ TG+V ++KVIRNKQTG SEGYGFVEFYS AAA
Sbjct  111  TNDETKTIWIGDLFHWMDETFLHNCFSHTGQVVNVKVIRNKQTGQSEGYGFVEFYSRAAA  170

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQSY+  LMPNTDQ FRLNWATFS  ++R    SDLSIF
Sbjct  171  EKVLQSYSGSLMPNTDQPFRLNWATFSGSDRRTEACSDLSIF  212



>gb|KJB47422.1| hypothetical protein B456_008G025400 [Gossypium raimondii]
Length=393

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +1

Query  406  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  585
            G ++ E +TIW+GDL +WMDE YL  CF+ TGEV+S+K+IRNKQTG SEGYGFVEFYS A
Sbjct  91   GCNSDEVKTIWVGDLVHWMDETYLHGCFSHTGEVSSVKIIRNKQTGQSEGYGFVEFYSRA  150

Query  586  AAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             AEK LQSY   LMPNT+Q FRLNWA+FS+ E+R + GSDLSIF
Sbjct  151  TAEKVLQSYNGSLMPNTEQTFRLNWASFSVNERRPDAGSDLSIF  194



>sp|Q9LEB3.1|RBP47_NICPL RecName: Full=Polyadenylate-binding protein RBP47; Short=Poly(A)-binding 
protein RBP47; AltName: Full=RNA-binding protein 
47; Short=NplRBP47 [Nicotiana plumbaginifolia]
 emb|CAC01238.1| RNA Binding Protein 47 [Nicotiana plumbaginifolia]
Length=428

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +N+TIWIGDL  WMDE YL SCF+  GEV S+K+IRNKQTG SE YGFVEF +HAAAEK 
Sbjct  82   DNKTIWIGDLQQWMDESYLHSCFSQAGEVISVKIIRNKQTGQSERYGFVEFNTHAAAEKV  141

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQSY   +MPNT+Q FRLNWA FS GEKR   GSD SIF
Sbjct  142  LQSYNGTMMPNTEQPFRLNWAGFSTGEKRAETGSDFSIF  180



>ref|XP_009391347.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +N+TIW+GDLH WMDE+YL +CF  TGEV SIKVIRNKQTG SEGYGFVEFY+H AA+  
Sbjct  78   DNKTIWVGDLHYWMDENYLHNCFGRTGEVISIKVIRNKQTGQSEGYGFVEFYTHEAAKNV  137

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQS+   +MPNTDQ FRLNWA+FS G++R +  SD SIF
Sbjct  138  LQSFVGHMMPNTDQPFRLNWASFSTGDRRSDASSDYSIF  176



>gb|KJB47423.1| hypothetical protein B456_008G025400 [Gossypium raimondii]
Length=394

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +1

Query  406  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  585
            G ++ E +TIW+GDL +WMDE YL  CF+ TGEV+S+K+IRNKQTG SEGYGFVEFYS A
Sbjct  91   GCNSDEVKTIWVGDLVHWMDETYLHGCFSHTGEVSSVKIIRNKQTGQSEGYGFVEFYSRA  150

Query  586  AAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             AEK LQSY   LMPNT+Q FRLNWA+FS+ E+R + GSDLSIF
Sbjct  151  TAEKVLQSYNGSLMPNTEQTFRLNWASFSVNERRPDAGSDLSIF  194



>ref|XP_004230808.1| PREDICTED: polyadenylate-binding protein RBP47 [Solanum lycopersicum]
Length=413

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            S+ +N+TIWIGDL  WMDE YL SCF+  GEV S+K+IRNKQTG SE YGFVEF SHAAA
Sbjct  71   SSEDNKTIWIGDLQQWMDESYLHSCFSHAGEVISVKIIRNKQTGQSERYGFVEFNSHAAA  130

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQSY   +MPN +Q FRLNWA FS GEKR   GSD SIF
Sbjct  131  EKVLQSYNGTMMPNAEQPFRLNWAAFSAGEKRAETGSDFSIF  172



>ref|XP_009380242.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=404

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            E RTIW+GDL  WMDE+YL SCF  TGEV SIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  78   ERRTIWVGDLQYWMDENYLHSCFGHTGEVISIKVIRNKQTGQSEGYGFVEFHSHATAEKV  137

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+++   MPNTDQ FRLNWA+FSMG+KR +  SD SIF
Sbjct  138  LQNFSNHPMPNTDQPFRLNWASFSMGDKRSDLASDHSIF  176



>ref|XP_011623994.1| PREDICTED: polyadenylate-binding protein RBP47 [Amborella trichopoda]
Length=409

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            S+ EN+++W+GDL  WMDE+YL SCF  TGEV S+KVIRNKQTG SEGYGFVEF S AAA
Sbjct  74   SSEENKSLWVGDLQYWMDENYLNSCFGHTGEVVSLKVIRNKQTGQSEGYGFVEFVSRAAA  133

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQ+Y   +MP+TDQ FRLNWATFSMG++R + GSD SIF
Sbjct  134  EKILQNYNGGMMPSTDQAFRLNWATFSMGDRRSDMGSDHSIF  175


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 8/80 (10%)
 Frame = +1

Query  424  NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKAL  603
            N TI++G L + + ED LR  F+  G++AS+K+  NK      G GFV+F + + AE+AL
Sbjct  280  NTTIFVGGLDSSVTEDDLREAFSKYGDIASVKIPVNK------GCGFVQFANRSNAEEAL  333

Query  604  QSYTCILMPNTDQLFRLNWA  663
            Q     ++       RL+W 
Sbjct  334  QGLNGTVIGKV--TIRLSWG  351



>ref|NP_001275480.1| DNA binding protein ACBF-like [Solanum tuberosum]
 gb|ABB86267.1| DNA binding protein ACBF-like [Solanum tuberosum]
Length=372

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            S+ +N+TIWIGDL  WMDE+YL SCF+  GEV S+K+IRNKQTG SE YGFVEF +HAAA
Sbjct  28   SSEDNKTIWIGDLQQWMDENYLHSCFSHAGEVISVKIIRNKQTGQSERYGFVEFNTHAAA  87

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQSY   +MPN +Q FRLNWA FS GEKR   GSD SIF
Sbjct  88   EKVLQSYNGTMMPNAEQPFRLNWAAFSAGEKRAETGSDFSIF  129



>ref|XP_006384437.1| hypothetical protein POPTR_0004s15080g [Populus trichocarpa]
 gb|ERP62234.1| hypothetical protein POPTR_0004s15080g [Populus trichocarpa]
Length=435

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 87/103 (84%), Gaps = 1/103 (1%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            GSN E +TIW+GDL +WMDE YL +CF+ TGEV+S+K+IRNKQTG  EGYGFVEFYS AA
Sbjct  97   GSNEEAKTIWVGDLLHWMDEAYLHNCFSHTGEVSSVKIIRNKQTGQLEGYGFVEFYSRAA  156

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AEK LQSY+  +MPNT+Q FRLNWA+F+ GE+R + GSDLSIF
Sbjct  157  AEKVLQSYSGSMMPNTEQPFRLNWASFA-GERRADPGSDLSIF  198



>ref|XP_008678713.1| PREDICTED: polyadenylate-binding protein RBP47-like [Zea mays]
 gb|AFW62691.1| hypothetical protein ZEAMMB73_026342 [Zea mays]
Length=430

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 87/105 (83%), Gaps = 1/105 (1%)
 Frame = +1

Query  406  GGSNGE-NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            GG+ GE NRTIW+GDL  WMDE+YL SCF S+GEV +IKVIRN+ +G SEGYGF+EFY+H
Sbjct  96   GGNGGEDNRTIWVGDLQYWMDENYLHSCFGSSGEVVNIKVIRNRHSGVSEGYGFIEFYTH  155

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             +AEKALQ+++  +MPNTD+ F+LNWA++SMGEKR    SD SIF
Sbjct  156  VSAEKALQNFSGHVMPNTDRAFKLNWASYSMGEKRSEISSDHSIF  200



>gb|KDO49119.1| hypothetical protein CISIN_1g013061mg [Citrus sinensis]
Length=376

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            +N E +TIWIGDL +WMDE +L +CF+ TG+V ++KVIRNKQTG SEGYGFVEFYS AAA
Sbjct  111  TNDETKTIWIGDLFHWMDETFLHNCFSHTGQVVNVKVIRNKQTGQSEGYGFVEFYSRAAA  170

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQSY+  LMPNTDQ FRLNWATFS  ++R    SDLSIF
Sbjct  171  EKVLQSYSGSLMPNTDQPFRLNWATFSGSDRRTEACSDLSIF  212



>gb|ACF85767.1| unknown [Zea mays]
 gb|AFW58431.2| hypothetical protein ZEAMMB73_000058 [Zea mays]
Length=420

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 87/105 (83%), Gaps = 2/105 (2%)
 Frame = +1

Query  409  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            G NG  EN+TIW+GDL  WMDE+YL +CF  +GEV +IKVIRN+QTG SEGYGFVEF+SH
Sbjct  91   GGNGCEENKTIWVGDLQYWMDENYLHNCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFFSH  150

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            A+AEKALQ++T  +MPNTD+ F+LNWA++SMGEKR    SD SIF
Sbjct  151  ASAEKALQNFTGHVMPNTDRPFKLNWASYSMGEKRSEVASDHSIF  195



>ref|XP_006423053.1| hypothetical protein CICLE_v10028454mg [Citrus clementina]
 gb|ESR36293.1| hypothetical protein CICLE_v10028454mg [Citrus clementina]
Length=372

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            +N E +TIWIGDL +WMDE +L +CF+ TG+V ++KVIRNKQTG SEGYGFVEFYS AAA
Sbjct  107  TNDETKTIWIGDLFHWMDETFLHNCFSHTGQVVNVKVIRNKQTGQSEGYGFVEFYSRAAA  166

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQSY+  LMPNTDQ FRLNWATFS  ++R    SDLSIF
Sbjct  167  EKVLQSYSGSLMPNTDQPFRLNWATFSGNDRRTEACSDLSIF  208



>ref|NP_001150649.1| nucleic acid binding protein [Zea mays]
 gb|ACG39896.1| nucleic acid binding protein [Zea mays]
Length=420

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 87/105 (83%), Gaps = 2/105 (2%)
 Frame = +1

Query  409  GSNG--ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            G NG  EN+TIW+GDL  WMDE+YL +CF  +GEV +IKVIRN+QTG SEGYGFVEF+SH
Sbjct  91   GGNGCEENKTIWVGDLQYWMDENYLHNCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFFSH  150

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            A+AEKALQ++T  +MPNTD+ F+LNWA++SMGEKR    SD SIF
Sbjct  151  ASAEKALQNFTGHVMPNTDRPFKLNWASYSMGEKRSEVASDHSIF  195



>ref|XP_006346456.1| PREDICTED: polyadenylate-binding protein RBP47 [Solanum tuberosum]
Length=420

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +N+TIWIGDL  WMDE+YL SCF+  GEV S+K+IRNKQTG SE YGFVEF +HAAAEK 
Sbjct  81   DNKTIWIGDLQQWMDENYLHSCFSHAGEVISVKIIRNKQTGQSERYGFVEFNTHAAAEKV  140

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQSY   +MPN +Q FRLNWA FS GEKR   GSD SIF
Sbjct  141  LQSYNGTMMPNAEQPFRLNWAAFSAGEKRAETGSDFSIF  179



>ref|XP_004975779.1| PREDICTED: polyadenylate-binding protein RBP47-like [Setaria 
italica]
Length=420

 Score =   153 bits (387),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+TIW+GDL  WMDE+YL SCF  +GEV +IKVIRN+QTG SEGYGFVEF+SH +AEKA
Sbjct  96   ENKTIWVGDLQYWMDENYLHSCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFFSHGSAEKA  155

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ++T  +MPNTD+ F+LNWA++SMGEKR    SD SIF
Sbjct  156  LQNFTGHVMPNTDRAFKLNWASYSMGEKRSEVASDHSIF  194


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 49/88 (56%), Gaps = 10/88 (11%)
 Frame = +1

Query  406  GGSNGE--NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYS  579
            G S+G+  NRT+++G L   + ED LR  FA  G++AS+K+   KQ       GFV+F S
Sbjct  283  GHSDGDSSNRTVYVGGLDPNVSEDELRKAFAKYGDLASVKIPLGKQC------GFVQFVS  336

Query  580  HAAAEKALQSYTCILMPNTDQLFRLNWA  663
               AE+ALQ     ++    Q  RL+W 
Sbjct  337  RTDAEEALQGLNGSVI--GKQAVRLSWG  362



>ref|XP_009590296.1| PREDICTED: polyadenylate-binding protein RBP47 [Nicotiana tomentosiformis]
Length=430

 Score =   153 bits (387),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +N+TIWIGDL  WMDE YL SCF+  GEV S+K+IRNKQTG SE YGFVEF +HAAAEK 
Sbjct  84   DNKTIWIGDLQQWMDESYLHSCFSQAGEVISVKIIRNKQTGQSERYGFVEFNTHAAAEKV  143

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQSY   +MPN +Q FRLNWA FS GEKR   GSD SIF
Sbjct  144  LQSYNGTMMPNAEQPFRLNWAGFSTGEKRAETGSDFSIF  182



>ref|XP_008797245.1| PREDICTED: polyadenylate-binding protein RBP47-like [Phoenix 
dactylifera]
Length=393

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 108/153 (71%), Gaps = 5/153 (3%)
 Frame = +1

Query  265  MQYP--AAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIW  438
            MQYP  AAA +M+HQM+P    P +   + P+    PP + Q Q     G    EN+TIW
Sbjct  18   MQYPPPAAAMMMRHQMVPPPPQPQYAQQFLPYHPLPPPQNHQHQAGTAAG---EENKTIW  74

Query  439  IGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTC  618
            +GDLH WM+E+YL SCF  TGEV SIKVIRNKQTG SEGYGFVEFY+ AAAEK +QS+  
Sbjct  75   VGDLHYWMEENYLHSCFGHTGEVVSIKVIRNKQTGQSEGYGFVEFYTRAAAEKVIQSFVG  134

Query  619  ILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             +MPNTDQ FRLNWA+FSMG++R +   D SIF
Sbjct  135  HIMPNTDQPFRLNWASFSMGDRRADVAPDHSIF  167


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 48/88 (55%), Gaps = 10/88 (11%)
 Frame = +1

Query  406  GGSNGE--NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYS  579
            G S+G+  N T+++G L   + ED LR  F+  GE+AS+K+   KQ       GFV+F  
Sbjct  256  GQSHGDSTNTTVFVGGLDTNVSEDDLRQVFSQYGEIASVKIPSGKQC------GFVQFVQ  309

Query  580  HAAAEKALQSYTCILMPNTDQLFRLNWA  663
               AE+ALQ+    ++    Q  RL+W 
Sbjct  310  RNNAEEALQALNGTVI--GKQPVRLSWG  335



>ref|XP_008236618.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Prunus mume]
Length=446

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            G   E RTIW+GDLH+WMDE YL  CFA TG+V+++KVIRNKQT  SEGYGFVEF+S  A
Sbjct  110  GPTDEIRTIWVGDLHHWMDETYLHGCFAHTGQVSTVKVIRNKQTAQSEGYGFVEFFSREA  169

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AE+ LQSY    MPNT+Q FRLNWATFS+G++R +  SDLSIF
Sbjct  170  AEEVLQSYNGAAMPNTEQPFRLNWATFSVGDRRADTSSDLSIF  212



>ref|XP_008236617.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Prunus mume]
Length=450

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            G   E RTIW+GDLH+WMDE YL  CFA TG+V+++KVIRNKQT  SEGYGFVEF+S  A
Sbjct  110  GPTDEIRTIWVGDLHHWMDETYLHGCFAHTGQVSTVKVIRNKQTAQSEGYGFVEFFSREA  169

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AE+ LQSY    MPNT+Q FRLNWATFS+G++R +  SDLSIF
Sbjct  170  AEEVLQSYNGAAMPNTEQPFRLNWATFSVGDRRADTSSDLSIF  212



>ref|XP_011088289.1| PREDICTED: polyadenylate-binding protein RBP47 [Sesamum indicum]
Length=423

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = +1

Query  412  SNGE-NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            S+GE N+TIWIGDL  WMDE YL+SCF+ TGEV S+K+IRNKQTG SE YGF+EF SH A
Sbjct  86   SSGEDNKTIWIGDLQQWMDEGYLQSCFSQTGEVVSVKIIRNKQTGQSERYGFIEFNSHLA  145

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AEK LQSY   +MPNT+Q FRLNWA FS G++R   GSDLSIF
Sbjct  146  AEKVLQSYNGTVMPNTEQPFRLNWAAFSSGDRRPEAGSDLSIF  188



>gb|AAC49850.1| DNA binding protein ACBF [Nicotiana tabacum]
Length=428

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +N+TIWIGDL  WMDE YL SCF+  GEV S+K+IRNKQTG SE YGFVEF +HAAAEK 
Sbjct  82   DNKTIWIGDLQQWMDESYLHSCFSQAGEVISVKIIRNKQTGQSERYGFVEFNTHAAAEKV  141

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQSY   +MPN +Q FRLNWA FS GEKR   GSD SIF
Sbjct  142  LQSYNGTMMPNAEQPFRLNWAGFSTGEKRAETGSDFSIF  180



>ref|XP_006480131.1| PREDICTED: polyadenylate-binding protein RBP47B-like [Citrus 
sinensis]
 gb|KDO49117.1| hypothetical protein CISIN_1g013061mg [Citrus sinensis]
Length=449

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            +N E +TIWIGDL +WMDE +L +CF+ TG+V ++KVIRNKQTG SEGYGFVEFYS AAA
Sbjct  111  TNDETKTIWIGDLFHWMDETFLHNCFSHTGQVVNVKVIRNKQTGQSEGYGFVEFYSRAAA  170

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQSY+  LMPNTDQ FRLNWATFS  ++R    SDLSIF
Sbjct  171  EKVLQSYSGSLMPNTDQPFRLNWATFSGSDRRTEACSDLSIF  212



>gb|KDO49116.1| hypothetical protein CISIN_1g013061mg [Citrus sinensis]
Length=450

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            +N E +TIWIGDL +WMDE +L +CF+ TG+V ++KVIRNKQTG SEGYGFVEFYS AAA
Sbjct  111  TNDETKTIWIGDLFHWMDETFLHNCFSHTGQVVNVKVIRNKQTGQSEGYGFVEFYSRAAA  170

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQSY+  LMPNTDQ FRLNWATFS  ++R    SDLSIF
Sbjct  171  EKVLQSYSGSLMPNTDQPFRLNWATFSGSDRRTEACSDLSIF  212



>ref|XP_006423054.1| hypothetical protein CICLE_v10028454mg [Citrus clementina]
 gb|ESR36294.1| hypothetical protein CICLE_v10028454mg [Citrus clementina]
Length=445

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            +N E +TIWIGDL +WMDE +L +CF+ TG+V ++KVIRNKQTG SEGYGFVEFYS AAA
Sbjct  107  TNDETKTIWIGDLFHWMDETFLHNCFSHTGQVVNVKVIRNKQTGQSEGYGFVEFYSRAAA  166

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQSY+  LMPNTDQ FRLNWATFS  ++R    SDLSIF
Sbjct  167  EKVLQSYSGSLMPNTDQPFRLNWATFSGNDRRTEACSDLSIF  208



>ref|NP_973984.1| RNA-binding protein 47C [Arabidopsis thaliana]
 gb|AEE32173.1| RNA-binding protein 47C [Arabidopsis thaliana]
Length=310

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 80/104 (77%), Gaps = 3/104 (3%)
 Frame = +1

Query  415  NGENRTIWIGDLHNWMDEDYLRSCFASTGE--VASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            NGEN+TIW+GDLH+WMDE YL S FAS  E  + S+KVIRNK  G SEGYGFVEF SH  
Sbjct  97   NGENKTIWVGDLHHWMDEAYLNSSFASGDEREIVSVKVIRNKNNGLSEGYGFVEFESHDV  156

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRL-NNGSDLSIF  717
            A+K L+ +    MPNTDQ FRLNWA+FS GEKRL NNG DLSIF
Sbjct  157  ADKVLREFNGTTMPNTDQPFRLNWASFSTGEKRLENNGPDLSIF  200



>ref|XP_007042377.1| RNA-binding protein 47A [Theobroma cacao]
 gb|EOX98208.1| RNA-binding protein 47A [Theobroma cacao]
Length=436

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            E +TIW+GDL +WMDE YL  CF+ TGEV+S+K+IRNKQTG SEGYGF+EFYS AAAEK 
Sbjct  99   EVKTIWVGDLVHWMDETYLHGCFSHTGEVSSVKIIRNKQTGQSEGYGFIEFYSRAAAEKV  158

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQS+   LMPNT+Q FRLNWA+FS+ E+R + GSDLSIF
Sbjct  159  LQSFNGSLMPNTEQPFRLNWASFSVTERRSDAGSDLSIF  197



>emb|CBI19566.3| unnamed protein product [Vitis vinifera]
Length=324

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  460  MDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCILMPNTD  639
            MDE+YL SCFA+TGE+AS+KVIRNKQTG SEGYGFVEF+SHAAAEK LQ Y  +LMPNTD
Sbjct  1    MDENYLHSCFAATGELASMKVIRNKQTGSSEGYGFVEFFSHAAAEKVLQGYAGVLMPNTD  60

Query  640  QLFRLNWATFSMGEKRLNNGSDLSIF  717
            Q FRLNWATFSMG+KR +NG DLSIF
Sbjct  61   QPFRLNWATFSMGDKRSDNGPDLSIF  86



>ref|XP_006648763.1| PREDICTED: polyadenylate-binding protein RBP47-like [Oryza brachyantha]
Length=378

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            ENRTIW+GDL  WMDE+YL +CF S GEV +IKVIRN+ +G SEGYGFVEF SHA+AEKA
Sbjct  53   ENRTIWVGDLQYWMDENYLHNCFGSGGEVVTIKVIRNRHSGVSEGYGFVEFCSHASAEKA  112

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+++  LMPNTD+ F++NWA++SMGEKR    SD SIF
Sbjct  113  LQNFSGHLMPNTDRAFKINWASYSMGEKRSELASDYSIF  151


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 43/80 (54%), Gaps = 8/80 (10%)
 Frame = +1

Query  424  NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKAL  603
            NRTI++G L   + ED LR  FA  G++AS+K+   KQ       GFV+F +   AE+AL
Sbjct  248  NRTIYVGGLDPNVTEDELRKAFAKYGDLASVKIPVGKQC------GFVQFVNRPDAEEAL  301

Query  604  QSYTCILMPNTDQLFRLNWA  663
            Q      +    Q  RL+W 
Sbjct  302  QGLNGSTI--GKQAVRLSWG  319



>gb|AAB92518.1| putative RNA binding protein [Nicotiana tabacum]
Length=482

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +N+TIWIGDL  WMDE YL SCF+  GEV S+K+IRNKQTG SE YGFVEF +HAAAEK 
Sbjct  136  DNKTIWIGDLQQWMDESYLHSCFSQAGEVISVKIIRNKQTGQSERYGFVEFNTHAAAEKV  195

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQSY   +MPN +Q FRLNWA FS GEKR   GSD SIF
Sbjct  196  LQSYNGTMMPNAEQPFRLNWAGFSTGEKRAETGSDFSIF  234



>ref|XP_011461514.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=448

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            G   E RTIW GDLH+WMDE YL  CFA TG+V+S+KVIRNKQTG +EGYGFVEFYS  A
Sbjct  113  GPTDEVRTIWAGDLHHWMDEAYLHGCFAYTGQVSSVKVIRNKQTGQTEGYGFVEFYSREA  172

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AE+ LQ+Y    MPNT+Q FRLNWATFS G++R +  SDLSIF
Sbjct  173  AEEVLQTYNGTPMPNTEQPFRLNWATFSAGDRRADTSSDLSIF  215



>gb|KFK31829.1| hypothetical protein AALP_AA6G163800 [Arabis alpina]
Length=410

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            SN EN+TIW+GDL +WMDE+YL S F++ GE++S+KVIRNK TG SEGYGFVEF SH  A
Sbjct  80   SNLENKTIWVGDLLHWMDENYLNSSFSNAGEISSVKVIRNKHTGLSEGYGFVEFVSHDVA  139

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK L+ +    M NTDQ FRLNWA+FS GEKRL NG DLSIF
Sbjct  140  EKVLEEFNGETMLNTDQPFRLNWASFSTGEKRLENGPDLSIF  181



>ref|XP_004294842.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=454

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            G   E RTIW GDLH+WMDE YL  CFA TG+V+S+KVIRNKQTG +EGYGFVEFYS  A
Sbjct  113  GPTDEVRTIWAGDLHHWMDEAYLHGCFAYTGQVSSVKVIRNKQTGQTEGYGFVEFYSREA  172

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AE+ LQ+Y    MPNT+Q FRLNWATFS G++R +  SDLSIF
Sbjct  173  AEEVLQTYNGTPMPNTEQPFRLNWATFSAGDRRADTSSDLSIF  215



>gb|KFK31830.1| hypothetical protein AALP_AA6G163800 [Arabis alpina]
Length=409

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            SN EN+TIW+GDL +WMDE+YL S F++ GE++S+KVIRNK TG SEGYGFVEF SH  A
Sbjct  80   SNLENKTIWVGDLLHWMDENYLNSSFSNAGEISSVKVIRNKHTGLSEGYGFVEFVSHDVA  139

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK L+ +    M NTDQ FRLNWA+FS GEKRL NG DLSIF
Sbjct  140  EKVLEEFNGETMLNTDQPFRLNWASFSTGEKRLENGPDLSIF  181



>ref|XP_007199852.1| hypothetical protein PRUPE_ppa005661mg [Prunus persica]
 gb|EMJ01051.1| hypothetical protein PRUPE_ppa005661mg [Prunus persica]
Length=449

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            G   E RTIW+GDLH+WMDE YL  CFA TG+V+++KVIRNKQT  SEGYGFVEF+S  A
Sbjct  109  GPTDEIRTIWVGDLHHWMDETYLHGCFAHTGQVSTVKVIRNKQTAQSEGYGFVEFFSREA  168

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AE+ LQSY    MPNT+Q FRLNWATFS G++R +  SDLSIF
Sbjct  169  AEEVLQSYNGAAMPNTEQPFRLNWATFSAGDRRADTSSDLSIF  211



>ref|XP_010479152.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=446

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            SNGEN+T+W+GDL++WMDE YL S F S GE+ S+KVIRNK  G SEGYGFVEF SH  A
Sbjct  109  SNGENKTVWVGDLYHWMDESYLNSSFGSAGEIVSVKVIRNKHNGHSEGYGFVEFESHDVA  168

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRL-NNGSDLSIF  717
            +K LQ +    MP T+Q FRLNWA+FS GEKRL NNG DLSIF
Sbjct  169  DKVLQKFNGATMPTTEQPFRLNWASFSTGEKRLENNGPDLSIF  211



>emb|CDX95176.1| BnaC09g16940D [Brassica napus]
Length=419

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            SN EN+TIWIGDL +WMDE+YL SCFA  GE+AS+KVIRNK TG SEGYGFVEF SH  A
Sbjct  84   SNAENKTIWIGDLLHWMDENYLNSCFAPAGEMASVKVIRNKHTGLSEGYGFVEFDSHDVA  143

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQ +  + M  +DQ +RLNWA+FS GEKRL NG D SIF
Sbjct  144  EKVLQDFNGVTMLQSDQPYRLNWASFSTGEKRLENGPDHSIF  185



>ref|XP_009794615.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X1 [Nicotiana 
sylvestris]
Length=402

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +N+TIWIGDL  WMDE YL SCF+  GEV S+K+IRNKQTG SE YGFVEF +HAAAEK 
Sbjct  56   DNKTIWIGDLQQWMDESYLHSCFSQAGEVISVKIIRNKQTGQSERYGFVEFNTHAAAEKV  115

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQSY   +MP+ +Q FRLNWA FS GEKR   GSD SIF
Sbjct  116  LQSYNGTMMPSAEQPFRLNWAGFSTGEKRAETGSDFSIF  154



>ref|XP_002452313.1| hypothetical protein SORBIDRAFT_04g023540 [Sorghum bicolor]
 gb|EES05289.1| hypothetical protein SORBIDRAFT_04g023540 [Sorghum bicolor]
Length=435

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +NRTIW+GDL  WMDE+YL SCF  +GEV +IKVIRN+ +G SEGYGFVEFYSH +AEKA
Sbjct  107  DNRTIWVGDLQYWMDENYLHSCFGPSGEVVNIKVIRNRHSGVSEGYGFVEFYSHVSAEKA  166

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+++  +MPNTD+ F+LNWA++SMGEKR    SD SIF
Sbjct  167  LQNFSGHVMPNTDRAFKLNWASYSMGEKRTELSSDHSIF  205


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 44/80 (55%), Gaps = 8/80 (10%)
 Frame = +1

Query  424  NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKAL  603
            NRT+++G L   + ED LR  FA  G++AS+K+   KQ       GFV+F + A AE+AL
Sbjct  302  NRTVYVGGLDPNVSEDELRKAFAKYGDLASVKIPFGKQC------GFVQFVNRADAEEAL  355

Query  604  QSYTCILMPNTDQLFRLNWA  663
            Q      +    Q  RL+W 
Sbjct  356  QGLNGATI--GKQAVRLSWG  373



>emb|CDY52067.1| BnaA09g53390D [Brassica napus]
Length=419

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            SN EN+TIWIGDL +WMDE+YL SCFA  GE+AS+KVIRNK TG SEGYGFVEF SH  A
Sbjct  84   SNAENKTIWIGDLLHWMDENYLNSCFAPAGEMASVKVIRNKHTGLSEGYGFVEFDSHDIA  143

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQ +  + M  +DQ +RLNWA+FS GEKRL NG D SIF
Sbjct  144  EKVLQDFNGVTMLQSDQPYRLNWASFSTGEKRLENGPDHSIF  185



>ref|XP_009356988.1| PREDICTED: polyadenylate-binding protein RBP47-like [Pyrus x 
bretschneideri]
Length=445

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            G   E RTIW+GDLH+WMDE YL  CFA TG+V+S+KVIRNKQTG SEGYGFVEFYS   
Sbjct  106  GPTDEVRTIWVGDLHHWMDETYLHGCFAHTGQVSSVKVIRNKQTGQSEGYGFVEFYSREV  165

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AE+ LQ+   + MPNT+Q FRLNWATFS G++R +  SDLSIF
Sbjct  166  AEEVLQNCNGVPMPNTEQPFRLNWATFSAGDRRADPSSDLSIF  208



>ref|XP_003579863.1| PREDICTED: polyadenylate-binding protein RBP47-like [Brachypodium 
distachyon]
Length=428

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            EN+TIW+GDL  WMDE+YL SCF  +GEV +IKVIRN+QTG +EGYGFVEFYSHA+A+KA
Sbjct  102  ENKTIWVGDLQYWMDENYLHSCFGPSGEVVTIKVIRNRQTGQTEGYGFVEFYSHASADKA  161

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ++T   MPNTD+ F+LNWA++SMGEKR    SD SIF
Sbjct  162  LQNFTGHAMPNTDRPFKLNWASYSMGEKRSEVVSDHSIF  200


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 10/88 (11%)
 Frame = +1

Query  406  GGSNGE--NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYS  579
            G S+G+  NRT+++G L   + ED LR  FA  G+VAS+K+ + KQ       GFV++ +
Sbjct  289  GHSDGDSTNRTVYVGGLDPNVSEDELRKSFAKYGDVASVKIPQGKQC------GFVQYVN  342

Query  580  HAAAEKALQSYTCILMPNTDQLFRLNWA  663
               AE+ALQ     ++    Q  RL+W 
Sbjct  343  RTDAEEALQGLNGSVI--GKQAVRLSWG  368



>ref|XP_009114049.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Brassica 
rapa]
Length=419

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            SN EN+TIWIGDL +WMDE+YL SCFA  GE+AS+KVIRNK TG SEGYGFVEF SH  A
Sbjct  84   SNAENKTIWIGDLLHWMDENYLNSCFAPAGEMASVKVIRNKHTGLSEGYGFVEFDSHDIA  143

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQ +  + M  +DQ +RLNWA+FS GEKRL NG D SIF
Sbjct  144  EKVLQDFNGVTMLQSDQPYRLNWASFSTGEKRLENGPDHSIF  185



>ref|XP_009794616.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X2 [Nicotiana 
sylvestris]
Length=431

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +N+TIWIGDL  WMDE YL SCF+  GEV S+K+IRNKQTG SE YGFVEF +HAAAEK 
Sbjct  85   DNKTIWIGDLQQWMDESYLHSCFSQAGEVISVKIIRNKQTGQSERYGFVEFNTHAAAEKV  144

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQSY   +MP+ +Q FRLNWA FS GEKR   GSD SIF
Sbjct  145  LQSYNGTMMPSAEQPFRLNWAGFSTGEKRAETGSDFSIF  183



>ref|XP_002518798.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF43723.1| nuclear acid binding protein, putative [Ricinus communis]
Length=438

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +++TIW+GDL +WMDE YL SCF+ TGEV S+KVIRNKQTG  EGYGF+EFYSHA AEK 
Sbjct  104  DSKTIWVGDLLHWMDETYLHSCFSHTGEVTSVKVIRNKQTGQPEGYGFIEFYSHATAEKV  163

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y   +MPN DQ FRLNWA+F+ GE+R   GSDLSIF
Sbjct  164  LQNYNGSMMPNADQPFRLNWASFA-GERRTETGSDLSIF  201



>ref|XP_012089580.1| PREDICTED: polyadenylate-binding protein RBP47-like [Jatropha 
curcas]
 gb|KDP23018.1| hypothetical protein JCGZ_01681 [Jatropha curcas]
Length=429

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = +1

Query  427  RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQ  606
            +TIWIGDL NWMDE YL +CF+ TGEV+++KVIRNKQTG SEGYGFVEF+SHA AEK LQ
Sbjct  97   KTIWIGDLLNWMDEPYLHNCFSHTGEVSTVKVIRNKQTGQSEGYGFVEFHSHATAEKVLQ  156

Query  607  SYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            +Y   +MPNT+Q FRLNWA+F+ G++R ++GSDLSIF
Sbjct  157  NYNGSVMPNTEQPFRLNWASFA-GDRRADSGSDLSIF  192



>gb|KDP39118.1| hypothetical protein JCGZ_00875 [Jatropha curcas]
Length=407

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            G + E +++WIGDL  WMDE+YL S F+STGEV S KVIRNKQTG  EGYGF+EF S AA
Sbjct  64   GDSAEIKSLWIGDLQQWMDENYLLSIFSSTGEVVSAKVIRNKQTGLPEGYGFIEFVSRAA  123

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AE+ LQ+Y   LMPNTDQ FRLNWAT + GE+R ++G D +IF
Sbjct  124  AERILQTYNGALMPNTDQTFRLNWATLAAGERRQDDGPDFTIF  166



>ref|XP_011092727.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Sesamum indicum]
Length=387

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +N+TIWIGDL  WMDE YL +CF+ TGEV S+K+IRNKQTG SE YGFVEF +H AAE  
Sbjct  79   DNKTIWIGDLQQWMDEGYLHACFSQTGEVVSVKIIRNKQTGQSERYGFVEFNTHLAAENV  138

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQSY   +MPN DQ FRLNWA FS G++R   GSDLSIF
Sbjct  139  LQSYNGTMMPNADQPFRLNWAAFSTGDRRPEAGSDLSIF  177



>ref|XP_004145357.2| PREDICTED: polyadenylate-binding protein RBP47 [Cucumis sativus]
Length=437

 Score =   150 bits (380),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            GS  E +T+WIGDL  WMDE YL +CFA TGEV+S+KVI NKQTG SEGYGFVEF+SH  
Sbjct  94   GSTDEVKTLWIGDLQPWMDETYLNNCFAHTGEVSSVKVICNKQTGQSEGYGFVEFFSHTT  153

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AEK LQ+Y   +MPNT+  FRLNWATFS  ++R + GSDLSIF
Sbjct  154  AEKVLQNYNGTIMPNTELPFRLNWATFSANDRRPDTGSDLSIF  196



>ref|XP_011092726.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Sesamum indicum]
Length=403

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +N+TIWIGDL  WMDE YL +CF+ TGEV S+K+IRNKQTG SE YGFVEF +H AAE  
Sbjct  79   DNKTIWIGDLQQWMDEGYLHACFSQTGEVVSVKIIRNKQTGQSERYGFVEFNTHLAAENV  138

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQSY   +MPN DQ FRLNWA FS G++R   GSDLSIF
Sbjct  139  LQSYNGTMMPNADQPFRLNWAAFSTGDRRPEAGSDLSIF  177



>ref|XP_009404023.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=403

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            E RTIW+GDL  WMDE+YL SCF  TGEV SIKVIRNKQTG SEGYGFVEF+SHA AEK 
Sbjct  78   EKRTIWVGDLQYWMDENYLLSCFVHTGEVVSIKVIRNKQTGQSEGYGFVEFHSHATAEKI  137

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQS++  LMP TD  FRLNWA+FSMG KR +   D SIF
Sbjct  138  LQSFSGHLMPTTDLPFRLNWASFSMGNKRSDLSFDHSIF  176



>ref|XP_012070803.1| PREDICTED: polyadenylate-binding protein RBP45C [Jatropha curcas]
Length=394

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            G + E +++WIGDL  WMDE+YL S F+STGEV S KVIRNKQTG  EGYGF+EF S AA
Sbjct  51   GDSAEIKSLWIGDLQQWMDENYLLSIFSSTGEVVSAKVIRNKQTGLPEGYGFIEFVSRAA  110

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AE+ LQ+Y   LMPNTDQ FRLNWAT + GE+R ++G D +IF
Sbjct  111  AERILQTYNGALMPNTDQTFRLNWATLAAGERRQDDGPDFTIF  153



>gb|EYU42664.1| hypothetical protein MIMGU_mgv1a008163mg [Erythranthe guttata]
Length=383

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +N+TIWIGDL  WMDE YL++CF+ +GEV S+K+IRNK TG SE YGF+EF SH+ AEKA
Sbjct  77   DNKTIWIGDLQQWMDEGYLQTCFSPSGEVHSVKIIRNKHTGQSERYGFIEFVSHSVAEKA  136

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQSY    MPN+DQ FRLNWA FS G++R  +GSDLS+F
Sbjct  137  LQSYNGTAMPNSDQFFRLNWAAFSAGDRRPESGSDLSVF  175



>ref|XP_008459212.1| PREDICTED: polyadenylate-binding protein RBP47 [Cucumis melo]
Length=439

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            GS  E +T+WIGDL  WMDE YL +CFA TGEV+S+KVI NKQTG SEGYGFVEF+SH  
Sbjct  94   GSTDEVKTLWIGDLQPWMDETYLNNCFAHTGEVSSVKVICNKQTGQSEGYGFVEFFSHTT  153

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            AEK LQ+Y   +MPNT+  FRLNWATFS  ++R + GSDLSIF
Sbjct  154  AEKVLQNYNGTIMPNTELPFRLNWATFSANDRRPDTGSDLSIF  196



>ref|NP_175180.1| RNA-binding protein 47C [Arabidopsis thaliana]
 sp|Q9SX79.1|RB47C_ARATH RecName: Full=Polyadenylate-binding protein RBP47C; Short=Poly(A)-binding 
protein RBP47C; AltName: Full=RNA-binding protein 
47C; Short=AtRBP47C [Arabidopsis thaliana]
 gb|AAD46038.1|AC007519_23 Contains 3 PF|00076 RNA recognition motif domains. ESTs gb|R30092, 
gb|R30093, gb|AA394338, gb|N65719 and gb|AA597577 come 
from this gene [Arabidopsis thaliana]
 gb|AAK06876.1|AF344325_1 putative DNA binding protein [Arabidopsis thaliana]
 gb|AAK59684.1| putative DNA binding protein [Arabidopsis thaliana]
 gb|AAL33806.1| putative DNA binding protein [Arabidopsis thaliana]
 gb|AEE32174.1| RNA-binding protein 47C [Arabidopsis thaliana]
Length=432

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 80/104 (77%), Gaps = 3/104 (3%)
 Frame = +1

Query  415  NGENRTIWIGDLHNWMDEDYLRSCFASTGE--VASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            NGEN+TIW+GDLH+WMDE YL S FAS  E  + S+KVIRNK  G SEGYGFVEF SH  
Sbjct  97   NGENKTIWVGDLHHWMDEAYLNSSFASGDEREIVSVKVIRNKNNGLSEGYGFVEFESHDV  156

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRL-NNGSDLSIF  717
            A+K L+ +    MPNTDQ FRLNWA+FS GEKRL NNG DLSIF
Sbjct  157  ADKVLREFNGTTMPNTDQPFRLNWASFSTGEKRLENNGPDLSIF  200



>ref|XP_006307520.1| hypothetical protein CARUB_v10009143mg [Capsella rubella]
 gb|EOA40418.1| hypothetical protein CARUB_v10009143mg [Capsella rubella]
Length=443

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 80/105 (76%), Gaps = 3/105 (3%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEV--ASIKVIRNKQTGFSEGYGFVEFYSHA  585
            SNGEN+TIW+GDLH+WMDE YL S F S GEV   S+KVIRNK TG SEGYGFVEF SH 
Sbjct  104  SNGENKTIWVGDLHHWMDEAYLNSSFGSAGEVPIVSVKVIRNKHTGLSEGYGFVEFESHD  163

Query  586  AAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRL-NNGSDLSIF  717
             A+K LQ +    M  T+Q FRLNWA+FS GEKRL NNG DLSIF
Sbjct  164  VADKVLQKFNGTTMLRTEQPFRLNWASFSTGEKRLENNGPDLSIF  208



>gb|KFK36144.1| hypothetical protein AALP_AA4G083000 [Arabis alpina]
Length=426

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 103/152 (68%), Gaps = 5/152 (3%)
 Frame = +1

Query  265  MQYPAAATVMQHQMMPAThypphympyhphflhhppphaqpqqqqqhGGSNGENRTIWIG  444
            M+YP A  VM HQMM A   PP Y PY  H  +         + Q    +NGEN+TIW+G
Sbjct  44   MRYPPA-VVMPHQMMFAPPPPPPYSPYPHHHQYQNHHRGGNNKYQN--ANNGENKTIWVG  100

Query  445  DLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQSYTCIL  624
            DLH+WMDE+YL S FAS  E+ S+KVIRNK TG SEGYGFVEF SH  A+K L+ +    
Sbjct  101  DLHHWMDENYLNSSFASA-EITSVKVIRNKHTGLSEGYGFVEFGSHDIADKVLEEFNGTT  159

Query  625  MPNTDQLFRLNWATFSMGEKRL-NNGSDLSIF  717
            M NT+Q FRLNWA+FS GEKRL NNG DLSIF
Sbjct  160  MLNTEQPFRLNWASFSTGEKRLENNGPDLSIF  191



>ref|XP_002863750.1| hypothetical protein ARALYDRAFT_331131 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40009.1| hypothetical protein ARALYDRAFT_331131 [Arabidopsis lyrata subsp. 
lyrata]
Length=400

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            SN EN+TIW+GDL +WMDE+YL S F+S GE++S+KVIRNK TG +EGYGFVEF SH  A
Sbjct  86   SNTENKTIWVGDLLHWMDENYLNSSFSSAGEISSVKVIRNKHTGLTEGYGFVEFVSHDVA  145

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQ      M N +Q FRLNWA+FS GEKRL NG DLSIF
Sbjct  146  EKVLQELNGEAMLNAEQPFRLNWASFSTGEKRLENGPDLSIF  187



>ref|XP_002891364.1| ATRBP47C [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67623.1| ATRBP47C [Arabidopsis lyrata subsp. lyrata]
Length=443

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 81/106 (76%), Gaps = 4/106 (4%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTG---EVASIKVIRNKQTGFSEGYGFVEFYSH  582
            SNGEN+TIW+GDLH+WMDE YL S FAS     ++ S+KVIRNK  G SEGYGFVEF SH
Sbjct  103  SNGENKTIWVGDLHHWMDETYLNSSFASADGEIQIVSVKVIRNKHNGLSEGYGFVEFDSH  162

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRL-NNGSDLSIF  717
              A+K LQ +    MP+T+Q FRLNWA+FS GEKRL NNG DLSIF
Sbjct  163  DVADKVLQEFNGTTMPDTEQPFRLNWASFSTGEKRLENNGPDLSIF  208



>ref|XP_004234481.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
lycopersicum]
Length=405

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            S+ E R++WIGDL  WMDE Y+++CFA TGEVAS+KVIRNKQ+G SEGYGFVEF SHAAA
Sbjct  67   SSDEIRSLWIGDLQFWMDEQYIQNCFAHTGEVASVKVIRNKQSGQSEGYGFVEFISHAAA  126

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            E+ LQ+Y   +MPN++Q FRLNWA+   GEKR +NG + +IF
Sbjct  127  ERNLQTYNGSMMPNSEQPFRLNWASLGSGEKRSDNGPEYTIF  168



>ref|XP_006349627.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X1 [Solanum 
tuberosum]
Length=428

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 79/105 (75%), Gaps = 6/105 (6%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +NRTIWIGDL  WMDE YL +CFA  GEV S+KVIRNKQTG SE YGF+EF +H AAEK 
Sbjct  77   DNRTIWIGDLQQWMDEGYLHTCFAQAGEVISVKVIRNKQTGQSERYGFIEFNTHEAAEKV  136

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLN------NGSDLSIF  717
            LQSY   +MPN +Q FRLNW+ FS GEKR +      +GSDLSIF
Sbjct  137  LQSYNGTMMPNAEQPFRLNWSAFSTGEKRADVGAAAGSGSDLSIF  181



>ref|XP_003575198.1| PREDICTED: polyadenylate-binding protein RBP47C'-like [Brachypodium 
distachyon]
Length=421

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  427  RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKALQ  606
            RTIW+GDL  WMDE+YL SCF  +GEV +IKVIRN+ +G SEGYGFVEFYSHA+AEKALQ
Sbjct  99   RTIWVGDLQYWMDENYLHSCFGPSGEVVTIKVIRNRHSGVSEGYGFVEFYSHASAEKALQ  158

Query  607  SYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            ++   +MPNTD+ F+LNWA++S+GEKR    SD SIF
Sbjct  159  NFAGHVMPNTDRAFKLNWASYSVGEKRSELASDHSIF  195


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (58%), Gaps = 8/80 (10%)
 Frame = +1

Query  424  NRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKAL  603
            NRT+++G L   + ED LR  FA  G+VAS+K+   KQ       GFV+F + A AE+AL
Sbjct  292  NRTVYVGGLDPNVSEDELRKTFAKYGDVASVKIPVGKQC------GFVQFVNRADAEEAL  345

Query  604  QSYTCILMPNTDQLFRLNWA  663
            Q+ +   +    Q  RL+W 
Sbjct  346  QALSGSTI--GKQAVRLSWG  363



>ref|XP_006349628.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X2 [Solanum 
tuberosum]
Length=424

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 79/105 (75%), Gaps = 6/105 (6%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +NRTIWIGDL  WMDE YL +CFA  GEV S+KVIRNKQTG SE YGF+EF +H AAEK 
Sbjct  77   DNRTIWIGDLQQWMDEGYLHTCFAQAGEVISVKVIRNKQTGQSERYGFIEFNTHEAAEKV  136

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLN------NGSDLSIF  717
            LQSY   +MPN +Q FRLNW+ FS GEKR +      +GSDLSIF
Sbjct  137  LQSYNGTMMPNAEQPFRLNWSAFSTGEKRADVGAAAGSGSDLSIF  181



>gb|ACN40970.1| unknown [Picea sitchensis]
Length=430

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            S+ E +T+W+GDL  WMDE YL +CF+ TGE+ S K+IRNK TG SEGYGF+EF +  AA
Sbjct  87   SSDEVKTLWVGDLQFWMDEGYLHTCFSHTGELVSAKIIRNKYTGQSEGYGFMEFITRTAA  146

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK +Q+Y   LMPNT+Q+FR+NWATFSMGE+RL+ G D SIF
Sbjct  147  EKIMQTYNGTLMPNTEQVFRMNWATFSMGERRLDGGPDFSIF  188



>gb|ACN39849.1| unknown [Picea sitchensis]
Length=429

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            S+ E +T+W+GDL  WMDE YL +CF+ TGE+ S K+IRNK TG SEGYGF+EF +  AA
Sbjct  87   SSDEVKTLWVGDLQFWMDEGYLHTCFSHTGELVSAKIIRNKYTGQSEGYGFMEFITRTAA  146

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK +Q+Y   LMPNT+Q+FR+NWATFSMGE+RL+ G D SIF
Sbjct  147  EKIMQTYNGTLMPNTEQVFRMNWATFSMGERRLDGGPDFSIF  188



>ref|XP_006343293.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
tuberosum]
Length=411

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            S+ E R++WIGDL  WMDE Y+++CFA TGEVAS+KVIRNKQ+G SEGYGFVEF SHAAA
Sbjct  73   SSDEIRSLWIGDLQFWMDEPYIQNCFAHTGEVASVKVIRNKQSGQSEGYGFVEFISHAAA  132

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            E+ LQ+Y   +MPN++Q FRLNWA+   GEKR +NG + +IF
Sbjct  133  ERNLQTYNGSMMPNSEQPFRLNWASLGSGEKRSDNGPEYTIF  174



>ref|XP_010494212.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=428

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            SN EN+TIW+GDL +WMDE+YL S F+S+GE++S+KVIRNK TG SEGYGFVEF SH  A
Sbjct  90   SNTENKTIWVGDLLHWMDENYLNSAFSSSGEISSVKVIRNKHTGRSEGYGFVEFVSHDVA  149

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQ +    M N +Q FRLNWA+FS GEKRL +G DLSIF
Sbjct  150  EKVLQEFNGETMINAEQPFRLNWASFSTGEKRLESGPDLSIF  191



>ref|NP_001275430.1| DNA-binding protein-like [Solanum tuberosum]
 gb|ABB86246.1| DNA-binding protein-like [Solanum tuberosum]
Length=423

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 79/105 (75%), Gaps = 6/105 (6%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +NRTIWIGDL  WMDE YL +CFA  GEV S+KVIRNKQTG SE YGF+EF +H AAEK 
Sbjct  77   DNRTIWIGDLQQWMDEGYLHTCFAQAGEVISVKVIRNKQTGQSERYGFIEFNTHEAAEKV  136

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLN------NGSDLSIF  717
            LQSY   +MPN +Q FRLNW+ FS GEKR +      +GSDLSIF
Sbjct  137  LQSYNGTMMPNAEQPFRLNWSAFSTGEKRADVGAAAGSGSDLSIF  181



>ref|XP_002979510.1| hypothetical protein SELMODRAFT_111082 [Selaginella moellendorffii]
 gb|EFJ19399.1| hypothetical protein SELMODRAFT_111082 [Selaginella moellendorffii]
Length=432

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            E RT+WIGDL  WMDE+YLR+ FA TGEV S KVIRNKQTG+ EGYGF+EF SH AAE+ 
Sbjct  26   EVRTLWIGDLQYWMDENYLRNLFAHTGEVLSAKVIRNKQTGYPEGYGFIEFNSHPAAERV  85

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            L +Y    MP T+Q FRLNWA+F MGEKR++ G +LSIF
Sbjct  86   LLAYNGTQMPQTEQAFRLNWASFGMGEKRMDGGPELSIF  124



>ref|XP_002973844.1| hypothetical protein SELMODRAFT_100454 [Selaginella moellendorffii]
 ref|XP_002983548.1| hypothetical protein SELMODRAFT_118305 [Selaginella moellendorffii]
 gb|EFJ15449.1| hypothetical protein SELMODRAFT_118305 [Selaginella moellendorffii]
 gb|EFJ24799.1| hypothetical protein SELMODRAFT_100454 [Selaginella moellendorffii]
Length=350

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +1

Query  406  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  585
            G +NGE +T+W+GDL  WMDE YL SCFA T EV   KVIRNKQTG+SEGYGFVEF +H+
Sbjct  14   GHANGELKTLWVGDLQYWMDEGYLYSCFAHTSEVQVAKVIRNKQTGYSEGYGFVEFTNHS  73

Query  586  AAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
             AEK LQS+    MP+TD  FRLNWA F +GE+R + G D SIF
Sbjct  74   TAEKVLQSFNGTQMPSTDIAFRLNWACFGIGERRPDQGPDFSIF  117



>ref|XP_010327389.1| PREDICTED: DNA-binding protein isoform X1 [Solanum lycopersicum]
Length=424

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 79/105 (75%), Gaps = 6/105 (6%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +NRTIWIGDL  WMDE YL +CFA  GEV S+KVIRNKQTG SE YGF+EF +H AAEK 
Sbjct  77   DNRTIWIGDLQQWMDEGYLHTCFAQAGEVISVKVIRNKQTGQSERYGFIEFNTHEAAEKV  136

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLN------NGSDLSIF  717
            LQSY   +MPN +Q FRLNW+ FS GEKR +      +GSDLSIF
Sbjct  137  LQSYNGTMMPNAEQPFRLNWSAFSSGEKRADVGAGAGSGSDLSIF  181



>ref|XP_004505196.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cicer arietinum]
Length=442

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 82/102 (80%), Gaps = 3/102 (3%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            E +TIW+GDLH+WMDE +L +CFA TGEV S KVIRNKQTG SEGYGF+EFYS A AEK 
Sbjct  102  EIKTIWLGDLHHWMDETFLHNCFAHTGEVVSAKVIRNKQTGQSEGYGFIEFYSRATAEKV  161

Query  601  LQSYTCILMPNTDQLFRLNWATFSM--GEKRLNNG-SDLSIF  717
            LQ+Y   +MPNTDQ FRLNWA+FS   GE+R ++  SDLSIF
Sbjct  162  LQNYNGTMMPNTDQAFRLNWASFSAGGGERRSSDATSDLSIF  203



>ref|XP_010327390.1| PREDICTED: DNA-binding protein isoform X2 [Solanum lycopersicum]
Length=423

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 79/105 (75%), Gaps = 6/105 (6%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +NRTIWIGDL  WMDE YL +CFA  GEV S+KVIRNKQTG SE YGF+EF +H AAEK 
Sbjct  77   DNRTIWIGDLQQWMDEGYLHTCFAQAGEVISVKVIRNKQTGQSERYGFIEFNTHEAAEKV  136

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLN------NGSDLSIF  717
            LQSY   +MPN +Q FRLNW+ FS GEKR +      +GSDLSIF
Sbjct  137  LQSYNGTMMPNAEQPFRLNWSAFSSGEKRADVGAGAGSGSDLSIF  181



>ref|XP_010523211.1| PREDICTED: polyadenylate-binding protein RBP47B-like [Tarenaya 
hassleriana]
Length=449

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            GS  + +T+W+GDL +WMDE YL SCF+ +GEV+S+KVIRNKQT  SEGYGFVEF+S AA
Sbjct  108  GSGDDVKTLWVGDLLHWMDETYLHSCFSHSGEVSSVKVIRNKQTCQSEGYGFVEFFSRAA  167

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLN-NGSDLSIF  717
            AE+ LQ+Y    MPN DQ FRLNWA+FS GEKR + NGSDLSIF
Sbjct  168  AEEVLQNYNGSPMPNADQPFRLNWASFSTGEKRASENGSDLSIF  211



>ref|XP_002977811.1| hypothetical protein SELMODRAFT_232989 [Selaginella moellendorffii]
 gb|EFJ21149.1| hypothetical protein SELMODRAFT_232989 [Selaginella moellendorffii]
Length=455

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            E RT+WIGDL  WMDE+YLR+ FA TGEV S KVIRNKQTG+ EGYGF+EF SH AAE+ 
Sbjct  26   EVRTLWIGDLQYWMDENYLRNLFAHTGEVLSAKVIRNKQTGYPEGYGFIEFNSHPAAERV  85

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            L +Y    MP T+Q FRLNWA+F MGEKR++ G +LSIF
Sbjct  86   LLAYNGTQMPQTEQAFRLNWASFGMGEKRMDGGPELSIF  124



>ref|XP_003608019.1| RNA Binding Protein [Medicago truncatula]
 gb|AES90216.1| polyadenylate-binding protein RBP47B [Medicago truncatula]
Length=454

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 82/104 (79%), Gaps = 5/104 (5%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            E RTIW+GDLH+WMDE +L +CFA TGEVAS KVIRNKQTG SEGYGFVEFY+ A AEK 
Sbjct  114  EIRTIWLGDLHHWMDETFLHNCFAHTGEVASAKVIRNKQTGQSEGYGFVEFYTRAMAEKV  173

Query  601  LQSYTCILMPNTDQLFRLNWATFSM----GEKRLNNG-SDLSIF  717
            LQ++   +MPNTDQ FRLNWATFS     GE+R +   SDLS+F
Sbjct  174  LQNFNGTMMPNTDQAFRLNWATFSAAGGGGERRSSEATSDLSVF  217



>ref|NP_001234487.1| DNA-binding protein [Solanum lycopersicum]
 gb|AAR91698.1| DNA-binding protein [Solanum lycopersicum]
Length=428

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 79/105 (75%), Gaps = 6/105 (6%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +NRTIWIGDL  WMDE YL +CFA  GEV S+KVIRNKQTG SE YGF+EF +H AAEK 
Sbjct  77   DNRTIWIGDLQQWMDEGYLHTCFAQAGEVISVKVIRNKQTGQSERYGFIEFNTHEAAEKV  136

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLN------NGSDLSIF  717
            LQSY   +MPN +Q FRLNW+ FS GEKR +      +GSDLSIF
Sbjct  137  LQSYNGTMMPNAEQPFRLNWSAFSSGEKRADVGAGAGSGSDLSIF  181



>gb|AFK40720.1| unknown [Medicago truncatula]
Length=454

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 82/104 (79%), Gaps = 5/104 (5%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            E RTIW+GDLH+WMDE +L +CFA TGEVAS KVIRNKQTG SEGYGFVEFY+ A AEK 
Sbjct  114  EIRTIWLGDLHHWMDETFLHNCFAHTGEVASAKVIRNKQTGQSEGYGFVEFYTRAMAEKV  173

Query  601  LQSYTCILMPNTDQLFRLNWATFSM----GEKRLNNG-SDLSIF  717
            LQ++   +MPNTDQ FRLNWATFS     GE+R +   SDLS+F
Sbjct  174  LQNFNGTMMPNTDQAFRLNWATFSAAGGGGERRSSEATSDLSVF  217



>emb|CDY16528.1| BnaA08g02390D [Brassica napus]
Length=424

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 85/107 (79%), Gaps = 3/107 (3%)
 Frame = +1

Query  406  GGSNGEN-RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            GGS G++ +T+W+GDL +WMDE YL +CF+ T EV+S+KVIRNKQT  SEGYGFVEF S 
Sbjct  90   GGSGGDDVKTLWVGDLLHWMDETYLHTCFSHTNEVSSVKVIRNKQTNQSEGYGFVEFLSR  149

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRL--NNGSDLSIF  717
            +AAE+ LQSY+ + MPN DQ FRLNWA+FS GEKR   N G DLSIF
Sbjct  150  SAAEEVLQSYSGVTMPNADQPFRLNWASFSTGEKRASENGGPDLSIF  196



>ref|XP_009107272.1| PREDICTED: polyadenylate-binding protein RBP47A-like [Brassica 
rapa]
Length=424

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 85/107 (79%), Gaps = 3/107 (3%)
 Frame = +1

Query  406  GGSNGEN-RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            GGS G++ +T+W+GDL +WMDE YL +CF+ T EV+S+KVIRNKQT  SEGYGFVEF S 
Sbjct  90   GGSGGDDVKTLWVGDLLHWMDETYLHTCFSHTNEVSSVKVIRNKQTNQSEGYGFVEFLSR  149

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRL--NNGSDLSIF  717
            +AAE+ LQSY+ + MPN DQ FRLNWA+FS GEKR   N G DLSIF
Sbjct  150  SAAEEVLQSYSGVTMPNADQPFRLNWASFSTGEKRASENGGPDLSIF  196



>ref|XP_010481964.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=434

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            SN EN+TIW+GDL +WMDE+YL S F+S+GE++S+KVIRNK  G SEGYGFVEF SH  A
Sbjct  96   SNTENKTIWVGDLLHWMDENYLNSAFSSSGEISSVKVIRNKHHGLSEGYGFVEFVSHDVA  155

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQ +    M N +Q FRLNWA+FS GEKRL +G DLSIF
Sbjct  156  EKVLQEFNGETMINAEQPFRLNWASFSTGEKRLESGPDLSIF  197



>ref|XP_002885294.1| RNA-binding protein 47B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61553.1| RNA-binding protein 47B [Arabidopsis lyrata subsp. lyrata]
Length=435

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            GS  + +T+W+GDL +WMDE YL SCF+ TGEV+S+KVIRNK T  SEGYGF+EF S AA
Sbjct  102  GSGDDVKTLWVGDLLHWMDETYLHSCFSHTGEVSSVKVIRNKLTSQSEGYGFIEFLSRAA  161

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKR-LNNGSDLSIF  717
            AE+ LQ+Y+  LMPN+DQ FR+NWA+FS GEKR + NG DLSIF
Sbjct  162  AEEVLQNYSGSLMPNSDQPFRINWASFSTGEKRAVENGPDLSIF  205



>ref|XP_009789022.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nicotiana 
sylvestris]
Length=413

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            E R++WIGDL  WMDE Y+ +CFA TGEV S+KVIRNKQTG SEGYGF+EF SHAAAEK 
Sbjct  74   EIRSLWIGDLQFWMDEQYIHNCFAHTGEVVSVKVIRNKQTGQSEGYGFIEFISHAAAEKN  133

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y   LMPN +Q FRLNWA+   GEKR +NG + SIF
Sbjct  134  LQTYNGTLMPNIEQPFRLNWASPGSGEKRSDNGPEYSIF  172



>ref|XP_010540323.1| PREDICTED: polyadenylate-binding protein RBP47B [Tarenaya hassleriana]
Length=410

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            GS  + +T+W+GDL +WMD+ YL SCF+ TGEV+S+KVIRNKQT  SEGYGFVEF S AA
Sbjct  74   GSGDDVKTLWVGDLLHWMDDTYLHSCFSHTGEVSSVKVIRNKQTCQSEGYGFVEFSSRAA  133

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLN-NGSDLSIF  717
            AE+ LQ+Y    MPN DQ FRLNWA+FS GEKR++ NGSDLSIF
Sbjct  134  AEEVLQNYNGSPMPNADQPFRLNWASFSTGEKRVSENGSDLSIF  177



>ref|XP_001777334.1| predicted protein [Physcomitrella patens]
 ref|XP_001782740.1| predicted protein, partial [Physcomitrella patens]
 gb|EDQ52446.1| predicted protein, partial [Physcomitrella patens]
 gb|EDQ57864.1| predicted protein, partial [Physcomitrella patens]
Length=416

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            S+ E +T+W+GDL  WMDE+YL + F  TGEV S+K+IRNKQTG+SEGYGFVEF SHAAA
Sbjct  3    SHEEVKTLWVGDLQYWMDENYLHTAFVHTGEVQSVKIIRNKQTGYSEGYGFVEFVSHAAA  62

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQ+Y    MPNT+Q FRLNWA+F +GE+R   G + SIF
Sbjct  63   EKILQAYNGTQMPNTEQPFRLNWASFGIGERRPEAGPEHSIF  104



>ref|XP_010278713.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nelumbo 
nucifera]
Length=310

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            S  E RT+WIGDL  WM+E Y+ SCFA TGEVAS+KVIRNKQTG SEGYGF+EF +  AA
Sbjct  92   SADEVRTLWIGDLQYWMEESYIHSCFAHTGEVASVKVIRNKQTGQSEGYGFIEFVTRPAA  151

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            E+ LQ+Y   LMPN +Q FRLNWA+F +GE+R ++ +D +IF
Sbjct  152  ERILQTYNGTLMPNAEQNFRLNWASFGLGERRPDDSADFTIF  193



>ref|NP_175181.1| RNA-binding protein 47C' [Arabidopsis thaliana]
 sp|Q9SX80.1|R47CP_ARATH RecName: Full=Polyadenylate-binding protein RBP47C'; Short=Poly(A)-binding 
protein RBP47C'; AltName: Full=RNA-binding protein 
47C'; Short=AtRBP47C prime; Short=AtRBP47C' [Arabidopsis 
thaliana]
 gb|AAD46037.1|AC007519_22 Contains 3 PF|00076 RNA recognition motif domains. EST gb|T20424 
comes from this gene [Arabidopsis thaliana]
 dbj|BAE99410.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABN04767.1| At1g47500 [Arabidopsis thaliana]
 gb|AEE32178.1| RNA-binding protein 47C' [Arabidopsis thaliana]
Length=434

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 78/104 (75%), Gaps = 3/104 (3%)
 Frame = +1

Query  415  NGENRTIWIGDLHNWMDEDYLRSCFAST--GEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            NGEN+TIW+GDL NWMDE YL S F S    E+ S+KVIRNK  G SEGYGFVEF SH  
Sbjct  99   NGENKTIWVGDLQNWMDEAYLNSAFTSAEEREIVSLKVIRNKHNGSSEGYGFVEFESHDV  158

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKRL-NNGSDLSIF  717
            A+K LQ +    MPNTDQ FRLNWA+FS GEKRL NNG DLSIF
Sbjct  159  ADKVLQEFNGAPMPNTDQPFRLNWASFSTGEKRLENNGPDLSIF  202



>emb|CDX92304.1| BnaA05g21030D [Brassica napus]
Length=424

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 86/105 (82%), Gaps = 1/105 (1%)
 Frame = +1

Query  406  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  585
            GGS  + +T+W+GDL +WMDE YL +CF+ TGEV+S+KVIRNKQT  SEGYGFVEF + A
Sbjct  96   GGSGEDVKTLWVGDLLHWMDETYLHTCFSHTGEVSSVKVIRNKQTLQSEGYGFVEFLTRA  155

Query  586  AAEKALQSYTCILMPNTDQLFRLNWATFSMGEKR-LNNGSDLSIF  717
            AAE+ LQS++  +MPN++Q FRLNWA+FS GEKR + NG +LSIF
Sbjct  156  AAEEVLQSFSGSIMPNSEQAFRLNWASFSTGEKRAVENGPELSIF  200



>gb|AAM67293.1| nuclear acid binding protein, putative [Arabidopsis thaliana]
Length=392

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            GS  + +T+W+GDL +WMDE YL SCF+ TGEV+S+KVIRNK T  SEGYGFVEF S AA
Sbjct  59   GSGDDVKTLWVGDLLHWMDETYLHSCFSHTGEVSSVKVIRNKLTSQSEGYGFVEFLSRAA  118

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKR-LNNGSDLSIF  717
            AE+ LQ+Y+  +MPN+DQ FR+NWA+FS GEKR + NG DLS+F
Sbjct  119  AEEVLQNYSGSVMPNSDQPFRINWASFSTGEKRAVENGPDLSVF  162



>ref|XP_004288602.1| PREDICTED: polyadenylate-binding protein RBP47B' [Fragaria vesca 
subsp. vesca]
Length=412

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            E RT+WIGDL  W+DE+YL SCFA TGEV SIK+IRNK TG  EGYGFVEF SHAAAE+ 
Sbjct  10   EVRTLWIGDLQYWVDENYLTSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  69

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            L +Y    MP TDQ FRLNWA+F +GE+R + G D SIF
Sbjct  70   LHAYNATQMPGTDQTFRLNWASFGIGERRPDAGPDHSIF  108



>ref|XP_007015034.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOY32653.1| RNA-binding family protein isoform 2 [Theobroma cacao]
Length=423

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            E RT+WIGDL  W+DE YL SCFA TGE+ SIK+IRNK TG  EGYGFVEF SHAAAE+ 
Sbjct  18   EVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGQPEGYGFVEFVSHAAAERI  77

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y    MP TDQ+FRLNWA+F +GE+R + G + SIF
Sbjct  78   LQTYNGTPMPGTDQMFRLNWASFGIGERRTDPGPEHSIF  116



>ref|XP_007015035.1| RNA-binding family protein isoform 3 [Theobroma cacao]
 gb|EOY32654.1| RNA-binding family protein isoform 3 [Theobroma cacao]
Length=423

 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            E RT+WIGDL  W+DE YL SCFA TGE+ SIK+IRNK TG  EGYGFVEF SHAAAE+ 
Sbjct  18   EVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGQPEGYGFVEFVSHAAAERI  77

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y    MP TDQ+FRLNWA+F +GE+R + G + SIF
Sbjct  78   LQTYNGTPMPGTDQMFRLNWASFGIGERRTDPGPEHSIF  116



>emb|CDY50959.1| BnaA06g37550D [Brassica napus]
Length=430

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 85/107 (79%), Gaps = 3/107 (3%)
 Frame = +1

Query  406  GGSNGEN-RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            GGS G++ +T+W+GDL +WMDE YL +CF+ T EV+S+KVIRNKQT  SEGYGFVEF S 
Sbjct  95   GGSGGDDVKTLWVGDLLHWMDETYLHTCFSHTNEVSSVKVIRNKQTSQSEGYGFVEFLSR  154

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRL--NNGSDLSIF  717
            +AAE+ LQSY+ + MPN +Q FRLNWA+FS GEKR   N G DLSIF
Sbjct  155  SAAEEVLQSYSGVTMPNAEQPFRLNWASFSTGEKRASENGGPDLSIF  201



>gb|EYU37704.1| hypothetical protein MIMGU_mgv1a006826mg [Erythranthe guttata]
Length=430

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 80/106 (75%), Gaps = 7/106 (7%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            +N+TIWIGDL  WMD+ YL+SCFA +GEV S+K+IRNKQTG SE YGF+EF SHAAAEK 
Sbjct  92   DNKTIWIGDLQQWMDDGYLQSCFAQSGEVVSVKIIRNKQTGQSERYGFIEFNSHAAAEKV  151

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKR-------LNNGSDLSIF  717
            LQSY   +M NT+Q FRLNWA FS G++R          GSDLSIF
Sbjct  152  LQSYNGTMMLNTEQPFRLNWAAFSAGDRRPDIIPPPTTPGSDLSIF  197



>ref|XP_009147873.1| PREDICTED: polyadenylate-binding protein RBP47A [Brassica rapa]
Length=431

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 85/107 (79%), Gaps = 3/107 (3%)
 Frame = +1

Query  406  GGSNGEN-RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            GGS G++ +T+W+GDL +WMDE YL +CF+ T EV+S+KVIRNKQT  SEGYGFVEF S 
Sbjct  96   GGSGGDDVKTLWVGDLLHWMDETYLHTCFSHTNEVSSVKVIRNKQTSQSEGYGFVEFLSR  155

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRL--NNGSDLSIF  717
            +AAE+ LQSY+ + MPN +Q FRLNWA+FS GEKR   N G DLSIF
Sbjct  156  SAAEEVLQSYSGVTMPNAEQPFRLNWASFSTGEKRASENGGPDLSIF  202



>emb|CDX99265.1| BnaC05g33800D [Brassica napus]
Length=424

 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 86/105 (82%), Gaps = 1/105 (1%)
 Frame = +1

Query  406  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  585
            GGS  + +T+W+GDL +WMDE YL +CF+ TGEV+S+KVIRNKQT  SEGYGFVEF + A
Sbjct  96   GGSGEDVKTLWVGDLLHWMDETYLHTCFSHTGEVSSVKVIRNKQTLQSEGYGFVEFLTRA  155

Query  586  AAEKALQSYTCILMPNTDQLFRLNWATFSMGEKR-LNNGSDLSIF  717
            AAE+ LQS++  +MPN++Q FRLNWA+FS GEKR + NG +LSIF
Sbjct  156  AAEEVLQSFSGSIMPNSEQAFRLNWASFSTGEKRAVENGPELSIF  200



>ref|NP_188544.1| RNA-binding protein 47B [Arabidopsis thaliana]
 sp|Q0WW84.1|RB47B_ARATH RecName: Full=Polyadenylate-binding protein RBP47B; Short=Poly(A)-binding 
protein RBP47B; AltName: Full=RNA-binding protein 
47B; Short=AtRBP47B [Arabidopsis thaliana]
 dbj|BAE98614.1| putative nuclear acid binding protein [Arabidopsis thaliana]
 gb|ABH04596.1| At3g19130 [Arabidopsis thaliana]
 gb|AEE76196.1| RNA-binding protein 47B [Arabidopsis thaliana]
Length=435

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            GS  + +T+W+GDL +WMDE YL SCF+ TGEV+S+KVIRNK T  SEGYGFVEF S AA
Sbjct  102  GSGDDVKTLWVGDLLHWMDETYLHSCFSHTGEVSSVKVIRNKLTSQSEGYGFVEFLSRAA  161

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKR-LNNGSDLSIF  717
            AE+ LQ+Y+  +MPN+DQ FR+NWA+FS GEKR + NG DLS+F
Sbjct  162  AEEVLQNYSGSVMPNSDQPFRINWASFSTGEKRAVENGPDLSVF  205



>ref|XP_006406534.1| hypothetical protein EUTSA_v10020763mg [Eutrema salsugineum]
 gb|ESQ47987.1| hypothetical protein EUTSA_v10020763mg [Eutrema salsugineum]
Length=311

 Score =   142 bits (359),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            GS  + +T+W+GDL +WMDE YL SCF+ TGEV+S+KVIRNK T  SEGYGFVEF S AA
Sbjct  104  GSGEDVKTLWVGDLLHWMDETYLHSCFSHTGEVSSVKVIRNKLTCQSEGYGFVEFLSRAA  163

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKR-LNNGSDLSIF  717
            AE+ LQ+Y+  +MPN++Q FRLNWA+FS GEKR + NG +LSIF
Sbjct  164  AEEVLQNYSGSVMPNSEQPFRLNWASFSTGEKRAVENGPELSIF  207



>emb|CDY28101.1| BnaC06g02820D [Brassica napus]
Length=429

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 85/107 (79%), Gaps = 3/107 (3%)
 Frame = +1

Query  406  GGSNGEN-RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            GGS G++ +T+W+GDL +WMDE YL +CF+ T EV+S+KVIRNKQT  SEGYGFVEF S 
Sbjct  94   GGSGGDDVKTLWVGDLLHWMDETYLHTCFSHTNEVSSVKVIRNKQTSQSEGYGFVEFLSR  153

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRL--NNGSDLSIF  717
            +AAE+ LQSY+ + MPN +Q FRLNWA+FS GEKR   N G DLSIF
Sbjct  154  SAAEEVLQSYSGVTMPNAEQPFRLNWASFSTGEKRASENGGPDLSIF  200



>ref|XP_010442131.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=432

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            SN EN+TIW+GDL  WMDE+YL S F+S+GE++S+KVIRNK  G SEGYGFVEF SH  A
Sbjct  94   SNTENKTIWVGDLLYWMDENYLNSAFSSSGEISSVKVIRNKHNGSSEGYGFVEFVSHDVA  153

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQ +    M N +Q FRLNWA+FS GEKRL +G DLSIF
Sbjct  154  EKVLQEFNGETMINAEQPFRLNWASFSTGEKRLESGPDLSIF  195



>ref|NP_175383.1| RNA-binding protein 47A [Arabidopsis thaliana]
 sp|F4I3B3.1|RB47A_ARATH RecName: Full=Polyadenylate-binding protein RBP47A; Short=Poly(A)-binding 
protein RBP47A; AltName: Full=RNA-binding protein 
47A; Short=AtRBP47A [Arabidopsis thaliana]
 gb|AEE32448.1| RNA-binding protein 47A [Arabidopsis thaliana]
Length=445

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 87/106 (82%), Gaps = 2/106 (2%)
 Frame = +1

Query  406  GGSNGEN-RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            GGS G++ +T+W+GDL +WMDE YL +CF+ T EV+S+KVIRNKQT  SEGYGFVEF S 
Sbjct  111  GGSGGDDVKTLWVGDLLHWMDETYLHTCFSHTNEVSSVKVIRNKQTCQSEGYGFVEFLSR  170

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLN-NGSDLSIF  717
            +AAE+ALQS++ + MPN +Q FRLNWA+FS GEKR + NG DLSIF
Sbjct  171  SAAEEALQSFSGVTMPNAEQPFRLNWASFSTGEKRASENGPDLSIF  216



>ref|XP_010500505.1| PREDICTED: polyadenylate-binding protein RBP47A-like [Camelina 
sativa]
Length=447

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 87/106 (82%), Gaps = 2/106 (2%)
 Frame = +1

Query  406  GGSNGEN-RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            GGS G++ +T+W+GDL +WMDE YL +CF+ T EV+S+KVIRNKQT  SEGYGFVEF S 
Sbjct  113  GGSGGDDVKTLWVGDLLHWMDEAYLHTCFSHTNEVSSVKVIRNKQTCQSEGYGFVEFLSR  172

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLN-NGSDLSIF  717
            +AAE+ALQS++ + MPN +Q FRLNWA+FS GEKR + NG DLSIF
Sbjct  173  SAAEEALQSFSGVTMPNAEQPFRLNWASFSTGEKRASENGPDLSIF  218



>ref|XP_010461802.1| PREDICTED: polyadenylate-binding protein RBP47A-like isoform 
X1 [Camelina sativa]
 ref|XP_010461803.1| PREDICTED: polyadenylate-binding protein RBP47A-like isoform 
X2 [Camelina sativa]
Length=455

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 87/106 (82%), Gaps = 2/106 (2%)
 Frame = +1

Query  406  GGSNGEN-RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            GGS G++ +T+W+GDL +WMDE YL +CF+ T EV+S+KVIRNKQT  SEGYGFVEF S 
Sbjct  121  GGSGGDDVKTLWVGDLLHWMDEAYLHTCFSHTNEVSSVKVIRNKQTCQSEGYGFVEFLSR  180

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLN-NGSDLSIF  717
            +AAE+ALQS++ + MPN +Q FRLNWA+FS GEKR + NG DLSIF
Sbjct  181  SAAEEALQSFSGVTMPNAEQPFRLNWASFSTGEKRASENGPDLSIF  226



>ref|XP_010479396.1| PREDICTED: polyadenylate-binding protein RBP47A isoform X1 [Camelina 
sativa]
 ref|XP_010479397.1| PREDICTED: polyadenylate-binding protein RBP47A isoform X2 [Camelina 
sativa]
Length=454

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 87/106 (82%), Gaps = 2/106 (2%)
 Frame = +1

Query  406  GGSNGEN-RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            GGS G++ +T+W+GDL +WMDE YL +CF+ T EV+S+KVIRNKQT  SEGYGFVEF S 
Sbjct  120  GGSGGDDVKTLWVGDLLHWMDEAYLHTCFSHTNEVSSVKVIRNKQTCQSEGYGFVEFLSR  179

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLN-NGSDLSIF  717
            +AAE+ALQS++ + MPN +Q FRLNWA+FS GEKR + NG DLSIF
Sbjct  180  SAAEEALQSFSGVTMPNAEQPFRLNWASFSTGEKRASENGPDLSIF  225



>dbj|BAB02953.1| DNA/RNA binding protein-like [Arabidopsis thaliana]
Length=489

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +1

Query  409  GSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAA  588
            GS  + +T+W+GDL +WMDE YL SCF+ TGEV+S+KVIRNK T  SEGYGFVEF S AA
Sbjct  102  GSGDDVKTLWVGDLLHWMDETYLHSCFSHTGEVSSVKVIRNKLTSQSEGYGFVEFLSRAA  161

Query  589  AEKALQSYTCILMPNTDQLFRLNWATFSMGEKR-LNNGSDLSIF  717
            AE+ LQ+Y+  +MPN+DQ FR+NWA+FS GEKR + NG DLS+F
Sbjct  162  AEEVLQNYSGSVMPNSDQPFRINWASFSTGEKRAVENGPDLSVF  205



>ref|XP_009145825.1| PREDICTED: polyadenylate-binding protein RBP47B-like [Brassica 
rapa]
Length=426

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 86/105 (82%), Gaps = 1/105 (1%)
 Frame = +1

Query  406  GGSNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHA  585
            GGS  + +T+W+GDL +WMDE YL +CF+ TGEV+S+KVIRNKQT  SEGYGFVEF + A
Sbjct  98   GGSGEDVKTLWVGDLLHWMDETYLHTCFSHTGEVSSVKVIRNKQTLQSEGYGFVEFLTRA  157

Query  586  AAEKALQSYTCILMPNTDQLFRLNWATFSMGEKR-LNNGSDLSIF  717
            AAE+ LQS++  +MPN++Q FRLNWA+FS GEKR + NG +LSIF
Sbjct  158  AAEEVLQSFSGSIMPNSEQAFRLNWASFSTGEKRAVENGPELSIF  202



>ref|XP_010278711.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X3 
[Nelumbo nucifera]
 ref|XP_010278712.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X4 
[Nelumbo nucifera]
Length=423

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            E RT+WIGDL  WM+E Y+ SCFA TGEVAS+KVIRNKQTG SEGYGF+EF +  AAE+ 
Sbjct  95   EVRTLWIGDLQYWMEESYIHSCFAHTGEVASVKVIRNKQTGQSEGYGFIEFVTRPAAERI  154

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y   LMPN +Q FRLNWA+F +GE+R ++ +D +IF
Sbjct  155  LQTYNGTLMPNAEQNFRLNWASFGLGERRPDDSADFTIF  193



>ref|XP_002894197.1| hypothetical protein ARALYDRAFT_474095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70456.1| hypothetical protein ARALYDRAFT_474095 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 87/106 (82%), Gaps = 2/106 (2%)
 Frame = +1

Query  406  GGSNGEN-RTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSH  582
            GGS G++ +T+W+GDL +WMDE YL +CF+ T EV+S+KVIRNKQT  SEGYGFVEF S 
Sbjct  116  GGSGGDDVKTLWVGDLLHWMDETYLHTCFSHTNEVSSVKVIRNKQTCQSEGYGFVEFLSR  175

Query  583  AAAEKALQSYTCILMPNTDQLFRLNWATFSMGEKRLN-NGSDLSIF  717
            +AAE+ALQS++ + MPN +Q FRLNWA+FS GEKR + NG DLSIF
Sbjct  176  SAAEEALQSFSGVTMPNAEQPFRLNWASFSTGEKRASENGPDLSIF  221



>ref|XP_010673626.1| PREDICTED: polyadenylate-binding protein RBP47B' [Beta vulgaris 
subsp. vulgaris]
Length=429

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            E RT+WIGDL  W+DE Y+ SCFA TGEV S+KVIRNK TG  EGYGFVEF SHAAAE+ 
Sbjct  14   EVRTLWIGDLQIWVDESYIHSCFAQTGEVISVKVIRNKITGHPEGYGFVEFVSHAAAERV  73

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQSY    MP T+Q FRLNWA+F +GE+R + G + SIF
Sbjct  74   LQSYNGTPMPGTEQPFRLNWASFGIGERRPDAGPEHSIF  112



>ref|XP_007147735.1| hypothetical protein PHAVU_006G150400g [Phaseolus vulgaris]
 gb|ESW19729.1| hypothetical protein PHAVU_006G150400g [Phaseolus vulgaris]
Length=399

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  421  ENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAAEKA  600
            E RT+WIGDL  WMDE+YL +CFASTGEV S+KVIRNKQT  SEGYGF+EF S AAAE+ 
Sbjct  63   EVRTLWIGDLQYWMDENYLYTCFASTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAAAERI  122

Query  601  LQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            LQ+Y   +MPN  Q FRLNWA+FS GE+R ++  D +IF
Sbjct  123  LQTYNGAIMPNGGQSFRLNWASFSAGERRHDDSPDYTIF  161



>ref|XP_009595795.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nicotiana 
tomentosiformis]
Length=409

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = +1

Query  412  SNGENRTIWIGDLHNWMDEDYLRSCFASTGEVASIKVIRNKQTGFSEGYGFVEFYSHAAA  591
            S  E R++WIGDL  WMDE Y+ +CFA TGEV S+KVIRNKQTG SEGYGF+EF SHAAA
Sbjct  69   SADELRSLWIGDLQFWMDEQYIHNCFAHTGEVVSVKVIRNKQTGQSEGYGFIEFISHAAA  128

Query  592  EKALQSYTCILMPNTDQLFRLNWATFSMGEKRLNNGSDLSIF  717
            EK LQ+Y   LMPN +Q FRLNWA+   GEKR + G + SIF
Sbjct  129  EKNLQAYNGTLMPNIEQPFRLNWASPGSGEKRSDTGPEYSIF  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1483248998725