BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7400

Length=791
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP11965.1|  unnamed protein product                                307   2e-97   Coffea canephora [robusta coffee]
emb|CBI18938.3|  unnamed protein product                                299   5e-96   Vitis vinifera
ref|XP_008381725.1|  PREDICTED: TOM1-like protein 2                     293   8e-96   
ref|XP_009602520.1|  PREDICTED: TOM1-like protein 2                     303   8e-96   Nicotiana tomentosiformis
ref|XP_004237704.1|  PREDICTED: target of Myb protein 1                 301   6e-95   Solanum lycopersicum
ref|XP_006356339.1|  PREDICTED: TOM1-like protein 1-like isoform X1     300   8e-95   Solanum tuberosum [potatoes]
gb|KDO83508.1|  hypothetical protein CISIN_1g0101501mg                  289   2e-94   Citrus sinensis [apfelsine]
ref|XP_009346369.1|  PREDICTED: target of Myb protein 1-like            299   2e-94   
ref|XP_009366814.1|  PREDICTED: target of Myb protein 1-like            299   2e-94   Pyrus x bretschneideri [bai li]
ref|XP_002285894.1|  PREDICTED: target of Myb protein 1-like            298   3e-94   Vitis vinifera
ref|XP_009342857.1|  PREDICTED: target of Myb protein 1-like            298   5e-94   Pyrus x bretschneideri [bai li]
ref|XP_009360664.1|  PREDICTED: target of Myb protein 1-like            298   6e-94   Pyrus x bretschneideri [bai li]
ref|XP_008237773.1|  PREDICTED: target of Myb protein 1                 295   7e-93   Prunus mume [ume]
ref|XP_007201782.1|  hypothetical protein PRUPE_ppa004229mg             295   8e-93   Prunus persica
ref|XP_007137502.1|  hypothetical protein PHAVU_009G132300g             294   2e-92   Phaseolus vulgaris [French bean]
ref|XP_012078346.1|  PREDICTED: TOM1-like protein 2                     293   3e-92   Jatropha curcas
ref|XP_010260421.1|  PREDICTED: target of Myb protein 1                 293   4e-92   Nelumbo nucifera [Indian lotus]
ref|XP_002520270.1|  protein transporter, putative                      292   1e-91   Ricinus communis
ref|XP_006472885.1|  PREDICTED: target of Myb protein 1-like isof...    291   2e-91   Citrus sinensis [apfelsine]
ref|XP_007019271.1|  Target of Myb protein 1 isoform 1                  291   2e-91   
ref|XP_004502552.1|  PREDICTED: ADP-ribosylation factor-binding p...    290   3e-91   Cicer arietinum [garbanzo]
ref|XP_006434325.1|  hypothetical protein CICLE_v10000887mg             290   8e-91   Citrus clementina [clementine]
ref|XP_003523415.1|  PREDICTED: TOM1-like protein 2-like isoform X1     290   9e-91   Glycine max [soybeans]
ref|XP_002300956.1|  VHS domain-containing family protein               289   1e-90   Populus trichocarpa [western balsam poplar]
ref|XP_011027423.1|  PREDICTED: target of Myb protein 1                 288   2e-90   Populus euphratica
ref|XP_002307466.1|  VHS domain-containing family protein               288   3e-90   
ref|XP_008447823.1|  PREDICTED: TOM1-like protein 2                     287   3e-90   Cucumis melo [Oriental melon]
gb|KEH35378.1|  ENTH/VHS/GAT family protein                             286   1e-89   Medicago truncatula
ref|XP_011006301.1|  PREDICTED: target of Myb protein 1-like            286   2e-89   Populus euphratica
ref|XP_004139800.1|  PREDICTED: TOM1-like protein 2                     285   3e-89   Cucumis sativus [cucumbers]
ref|XP_003526661.1|  PREDICTED: TOM1-like protein 2-like                284   1e-88   Glycine max [soybeans]
gb|KJB59348.1|  hypothetical protein B456_009G250700                    284   1e-88   Gossypium raimondii
gb|KHG12036.1|  Target of Myb 1                                         284   1e-88   Gossypium arboreum [tree cotton]
gb|KHN46964.1|  TOM1-like protein 2                                     283   2e-88   Glycine soja [wild soybean]
ref|XP_011102017.1|  PREDICTED: LOW QUALITY PROTEIN: ADP-ribosyla...    280   3e-87   
ref|XP_004290725.1|  PREDICTED: target of Myb protein 1-like            279   1e-86   Fragaria vesca subsp. vesca
gb|AFK38032.1|  unknown                                                 267   4e-86   Lotus japonicus
ref|XP_010679291.1|  PREDICTED: TOM1-like protein 2                     276   2e-85   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010062194.1|  PREDICTED: TOM1-like protein 2                     274   8e-85   Eucalyptus grandis [rose gum]
ref|XP_003541937.1|  PREDICTED: hepatocyte growth factor-regulate...    274   9e-85   Glycine max [soybeans]
gb|EYU32476.1|  hypothetical protein MIMGU_mgv1a005006mg                271   9e-84   Erythranthe guttata [common monkey flower]
ref|XP_010112024.1|  TOM1-like protein 2                                270   2e-83   Morus notabilis
dbj|BAI66420.1|  seed protein B32E                                      271   7e-83   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ89779.1|  predicted protein                                      270   9e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010270344.1|  PREDICTED: TOM1-like protein 2 isoform X2          269   1e-82   Nelumbo nucifera [Indian lotus]
ref|XP_010270342.1|  PREDICTED: probable ADP-ribosylation factor-...    269   2e-82   Nelumbo nucifera [Indian lotus]
ref|XP_009796996.1|  PREDICTED: TOM1-like protein 2                     254   6e-82   Nicotiana sylvestris
ref|XP_003577738.1|  PREDICTED: TOM1-like protein 2 isoform X1          268   1e-81   Brachypodium distachyon [annual false brome]
gb|EPS66239.1|  hypothetical protein M569_08540                         263   6e-81   Genlisea aurea
ref|XP_008799068.1|  PREDICTED: target of Myb protein 1-like            264   8e-81   Phoenix dactylifera
gb|KHG20885.1|  TOM1-like protein 2                                     263   1e-80   Gossypium arboreum [tree cotton]
gb|KJB59968.1|  hypothetical protein B456_009G284400                    263   1e-80   Gossypium raimondii
ref|XP_006662807.1|  PREDICTED: TOM1-like protein 2-like                265   2e-80   Oryza brachyantha
ref|XP_010539704.1|  PREDICTED: TOM1-like protein 2                     262   2e-80   Tarenaya hassleriana [spider flower]
ref|XP_009401114.1|  PREDICTED: target of Myb protein 1-like isof...    262   3e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001067438.1|  Os11g0199700                                       264   3e-80   
ref|XP_004978930.1|  PREDICTED: TOM1-like protein 2-like                264   4e-80   Setaria italica
ref|XP_010912582.1|  PREDICTED: target of Myb protein 1-like            262   5e-80   Elaeis guineensis
ref|XP_009421173.1|  PREDICTED: target of Myb protein 1-like            262   5e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002893160.1|  VHS domain-containing protein                      260   1e-79   
ref|XP_006304594.1|  hypothetical protein CARUB_v10011646mg             260   1e-79   Capsella rubella
ref|XP_006416309.1|  hypothetical protein EUTSA_v10007405mg             260   2e-79   Eutrema salsugineum [saltwater cress]
ref|XP_009149655.1|  PREDICTED: TOM1-like protein 2                     259   2e-79   Brassica rapa
emb|CDY50235.1|  BnaA06g15120D                                          259   2e-79   Brassica napus [oilseed rape]
ref|XP_006593776.1|  PREDICTED: hepatocyte growth factor-regulate...    260   3e-79   Glycine max [soybeans]
ref|NP_564138.1|  Target of Myb protein 1                               259   3e-79   Arabidopsis thaliana [mouse-ear cress]
gb|EEC67842.1|  hypothetical protein OsI_35454                          262   4e-79   Oryza sativa Indica Group [Indian rice]
ref|XP_006301355.1|  hypothetical protein CARUB_v10021765mg             258   4e-79   Capsella rubella
emb|CDY61061.1|  BnaA07g37280D                                          258   5e-79   Brassica napus [oilseed rape]
ref|XP_009103295.1|  PREDICTED: TOM1-like protein 2                     258   6e-79   Brassica rapa
emb|CDX87552.1|  BnaA07g33210D                                          256   1e-78   
ref|XP_002450494.1|  hypothetical protein SORBIDRAFT_05g006160          260   1e-78   Sorghum bicolor [broomcorn]
emb|CDX88333.1|  BnaC06g37770D                                          256   1e-78   
emb|CDY00376.1|  BnaC07g14500D                                          257   1e-78   
ref|XP_002889114.1|  VHS domain-containing protein                      255   2e-78   
ref|XP_010477399.1|  PREDICTED: target of Myb protein 1-like            256   5e-78   Camelina sativa [gold-of-pleasure]
ref|NP_177823.2|  Target of Myb protein 1                               254   5e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010459845.1|  PREDICTED: TOM1-like protein 2                     256   8e-78   Camelina sativa [gold-of-pleasure]
ref|XP_009106360.1|  PREDICTED: TOM1-like protein 2                     253   1e-77   Brassica rapa
ref|XP_010498591.1|  PREDICTED: TOM1-like protein 2                     255   1e-77   Camelina sativa [gold-of-pleasure]
gb|ACR38743.1|  unknown                                                 257   2e-77   Zea mays [maize]
emb|CDY04626.1|  BnaC05g16640D                                          254   2e-77   
ref|NP_001148113.1|  LOC100281721                                       257   2e-77   
gb|AFW60668.1|  putative VHS/GAT domain containing family protein       256   2e-77   
ref|XP_009404857.1|  PREDICTED: target of Myb protein 1                 254   3e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010525669.1|  PREDICTED: TOM1-like protein 2 isoform X1          253   5e-77   Tarenaya hassleriana [spider flower]
gb|EMS53515.1|  TOM1-like protein 2                                     256   6e-77   Triticum urartu
ref|XP_006390135.1|  hypothetical protein EUTSA_v10019577mg             252   6e-77   Eutrema salsugineum [saltwater cress]
emb|CDY65111.1|  BnaUnng01020D                                          251   3e-76   Brassica napus [oilseed rape]
gb|EMT28552.1|  TOM1-like protein 2                                     254   4e-76   
gb|KCW71188.1|  hypothetical protein EUGRSUZ_F04281                     250   6e-76   Eucalyptus grandis [rose gum]
gb|KCW71189.1|  hypothetical protein EUGRSUZ_F04281                     250   7e-76   Eucalyptus grandis [rose gum]
ref|NP_001182882.1|  putative VHS/GAT domain containing family pr...    253   7e-76   Zea mays [maize]
ref|XP_010063905.1|  PREDICTED: LOW QUALITY PROTEIN: target of My...    250   1e-75   Eucalyptus grandis [rose gum]
ref|XP_006855126.1|  PREDICTED: TOM1-like protein 2                     243   8e-73   Amborella trichopoda
ref|XP_010537308.1|  PREDICTED: TOM1-like protein 2 isoform X2          236   2e-70   Tarenaya hassleriana [spider flower]
ref|XP_010537307.1|  PREDICTED: target of Myb protein 1-like isof...    235   7e-70   Tarenaya hassleriana [spider flower]
emb|CDX68071.1|  BnaA07g21110D                                          222   9e-68   
ref|XP_010925873.1|  PREDICTED: target of Myb protein 1-like isof...    230   2e-66   Elaeis guineensis
ref|XP_010048112.1|  PREDICTED: target of Myb protein 1-like            227   2e-65   Eucalyptus grandis [rose gum]
ref|XP_002284083.2|  PREDICTED: target of Myb protein 1                 226   3e-65   Vitis vinifera
ref|XP_008800580.1|  PREDICTED: target of Myb protein 1-like isof...    225   1e-64   Phoenix dactylifera
ref|XP_008775805.1|  PREDICTED: TOM1-like protein 1 isoform X1          224   3e-64   Phoenix dactylifera
gb|AFW70949.1|  putative VHS/GAT domain containing family protein       211   6e-64   
emb|CDX79179.1|  BnaC06g21240D                                          215   6e-64   
ref|XP_007161403.1|  hypothetical protein PHAVU_001G065700g             219   7e-64   Phaseolus vulgaris [French bean]
ref|XP_009389963.1|  PREDICTED: target of Myb protein 1-like            223   1e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008441590.1|  PREDICTED: target of Myb protein 1 isoform X2      217   3e-63   
ref|XP_010915838.1|  PREDICTED: TOM1-like protein 1 isoform X2          221   3e-63   Elaeis guineensis
ref|XP_003544671.1|  PREDICTED: TOM1-like protein 2-like                221   3e-63   Glycine max [soybeans]
ref|XP_009104642.1|  PREDICTED: LOW QUALITY PROTEIN: target of My...    211   5e-63   
ref|NP_001237269.1|  VHS and GAT domain protein                         220   7e-63   Glycine max [soybeans]
gb|KJB07514.1|  hypothetical protein B456_001G027900                    216   7e-63   Gossypium raimondii
ref|XP_004144251.2|  PREDICTED: TOM1-like protein 2 isoform X2          216   9e-63   Cucumis sativus [cucumbers]
gb|KEH40293.1|  ENTH/VHS/GAT family protein                             219   1e-62   Medicago truncatula
ref|XP_004498477.1|  PREDICTED: TOM1-like protein 1-like                219   2e-62   Cicer arietinum [garbanzo]
gb|KHG12147.1|  TOM1-like protein 2                                     219   2e-62   Gossypium arboreum [tree cotton]
ref|XP_010264484.1|  PREDICTED: TOM1-like protein 2 isoform X1          217   4e-62   Nelumbo nucifera [Indian lotus]
ref|XP_012077432.1|  PREDICTED: TOM1-like protein 2                     217   7e-62   Jatropha curcas
gb|KJB07512.1|  hypothetical protein B456_001G027900                    217   8e-62   Gossypium raimondii
gb|KJB07516.1|  hypothetical protein B456_001G027900                    217   9e-62   Gossypium raimondii
ref|XP_008441585.1|  PREDICTED: target of Myb protein 1 isoform X1      213   2e-61   
ref|XP_004501181.1|  PREDICTED: TOM1-like protein 2-like                216   2e-61   Cicer arietinum [garbanzo]
ref|XP_002309556.2|  hypothetical protein POPTR_0006s25770g             216   2e-61   
ref|XP_011019641.1|  PREDICTED: TOM1-like protein 2 isoform X2          215   4e-61   Populus euphratica
ref|XP_007012073.1|  ENTH/VHS/GAT family protein                        215   4e-61   Theobroma cacao [chocolate]
gb|KDO79744.1|  hypothetical protein CISIN_1g005810mg                   211   4e-61   Citrus sinensis [apfelsine]
ref|XP_011657324.1|  PREDICTED: target of Myb protein 1 isoform X1      211   5e-61   Cucumis sativus [cucumbers]
ref|XP_011081815.1|  PREDICTED: TOM1-like protein 2                     214   7e-61   Sesamum indicum [beniseed]
ref|XP_009631039.1|  PREDICTED: target of Myb protein 1-like            214   7e-61   Nicotiana tomentosiformis
ref|XP_009421202.1|  PREDICTED: TOM1-like protein 1                     214   9e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011026602.1|  PREDICTED: TOM1-like protein 2                     214   1e-60   Populus euphratica
ref|XP_008367799.1|  PREDICTED: target of Myb protein 1-like            209   1e-60   
ref|XP_010526178.1|  PREDICTED: TOM1-like protein 2                     213   2e-60   Tarenaya hassleriana [spider flower]
ref|XP_009768540.1|  PREDICTED: target of Myb protein 1-like isof...    213   2e-60   Nicotiana sylvestris
ref|XP_003526479.1|  PREDICTED: ADP-ribosylation factor-binding p...    213   2e-60   Glycine max [soybeans]
ref|XP_006450645.1|  hypothetical protein CICLE_v10007656mg             213   2e-60   Citrus clementina [clementine]
ref|XP_006476080.1|  PREDICTED: ADP-ribosylation factor-binding p...    213   2e-60   Citrus sinensis [apfelsine]
gb|KDO79743.1|  hypothetical protein CISIN_1g005810mg                   213   3e-60   Citrus sinensis [apfelsine]
ref|XP_002516559.1|  protein transporter, putative                      213   3e-60   Ricinus communis
ref|XP_008378101.1|  PREDICTED: TOM1-like protein 1                     213   3e-60   
ref|XP_002324811.2|  hypothetical protein POPTR_0018s00620g             213   3e-60   Populus trichocarpa [western balsam poplar]
ref|XP_006647153.1|  PREDICTED: target of Myb protein 1-like            211   7e-60   Oryza brachyantha
ref|XP_004150282.2|  PREDICTED: target of Myb protein 1                 212   7e-60   Cucumis sativus [cucumbers]
ref|XP_008445032.1|  PREDICTED: ADP-ribosylation factor-binding p...    212   7e-60   Cucumis melo [Oriental melon]
ref|XP_006578217.1|  PREDICTED: ADP-ribosylation factor-binding p...    207   7e-60   
ref|XP_006366215.1|  PREDICTED: TOM1-like protein 2-like                212   9e-60   Solanum tuberosum [potatoes]
ref|XP_004967413.1|  PREDICTED: signal transducing adapter molecu...    212   9e-60   Setaria italica
ref|XP_009367903.1|  PREDICTED: target of Myb protein 1                 212   1e-59   Pyrus x bretschneideri [bai li]
ref|XP_006578216.1|  PREDICTED: ADP-ribosylation factor-binding p...    207   1e-59   
ref|XP_004245269.1|  PREDICTED: target of Myb protein 1                 211   1e-59   Solanum lycopersicum
ref|XP_004967412.1|  PREDICTED: signal transducing adapter molecu...    212   1e-59   
gb|KEH36032.1|  ENTH/VHS/GAT family protein                             207   1e-59   Medicago truncatula
emb|CDX72371.1|  BnaC07g43930D                                          211   1e-59   
emb|CDY13501.1|  BnaA03g52190D                                          211   2e-59   Brassica napus [oilseed rape]
ref|XP_009138141.1|  PREDICTED: TOM1-like protein 2 isoform X1          211   2e-59   Brassica rapa
ref|XP_009138142.1|  PREDICTED: TOM1-like protein 2 isoform X2          211   2e-59   Brassica rapa
ref|XP_011019640.1|  PREDICTED: TOM1-like protein 2 isoform X1          210   2e-59   Populus euphratica
ref|XP_006412434.1|  hypothetical protein EUTSA_v10024602mg             210   2e-59   Eutrema salsugineum [saltwater cress]
ref|XP_006283262.1|  hypothetical protein CARUB_v10004294mg             211   2e-59   Capsella rubella
ref|NP_001147567.1|  VHS and GAT domain protein                         210   2e-59   Zea mays [maize]
ref|XP_011459005.1|  PREDICTED: target of Myb protein 1                 211   3e-59   Fragaria vesca subsp. vesca
ref|NP_195002.2|  ENTH/VHS/GAT family protein                           210   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190892.1|  ENTH/VHS/GAT family protein                        210   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432670.1|  PREDICTED: TOM1-like protein 2 isoform X2          210   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010432669.1|  PREDICTED: TOM1-like protein 2 isoform X1          210   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_002869247.1|  protein transporter                                210   3e-59   
ref|XP_010447346.1|  PREDICTED: TOM1-like protein 2 isoform X1          210   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010437859.1|  PREDICTED: TOM1-like protein 2 isoform X2          210   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010447347.1|  PREDICTED: TOM1-like protein 2 isoform X2          210   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010437858.1|  PREDICTED: TOM1-like protein 2 isoform X1          210   4e-59   Camelina sativa [gold-of-pleasure]
ref|XP_002457079.1|  hypothetical protein SORBIDRAFT_03g000910          209   5e-59   
ref|XP_008672286.1|  PREDICTED: uncharacterized protein LOC100217...    209   5e-59   
tpg|DAA52772.1|  TPA: putative VHS/GAT domain containing family p...    208   7e-59   
ref|XP_010256973.1|  PREDICTED: target of Myb protein 1-like isof...    208   1e-58   Nelumbo nucifera [Indian lotus]
gb|KFK29873.1|  hypothetical protein AALP_AA7G190000                    209   1e-58   Arabis alpina [alpine rockcress]
gb|KFK29872.1|  hypothetical protein AALP_AA7G190000                    209   1e-58   Arabis alpina [alpine rockcress]
emb|CDY49322.1|  BnaC03g66920D                                          208   1e-58   Brassica napus [oilseed rape]
ref|XP_009108832.1|  PREDICTED: TOM1-like protein 2 isoform X1          208   1e-58   Brassica rapa
ref|XP_009796168.1|  PREDICTED: ADP-ribosylation factor-binding p...    208   2e-58   Nicotiana sylvestris
ref|XP_009796167.1|  PREDICTED: ADP-ribosylation factor-binding p...    208   2e-58   Nicotiana sylvestris
ref|XP_008793055.1|  PREDICTED: TOM1-like protein 1 isoform X1          208   2e-58   Phoenix dactylifera
emb|CDY45016.1|  BnaA08g12030D                                          208   2e-58   Brassica napus [oilseed rape]
gb|KHN10222.1|  TOM1-like protein 2                                     208   2e-58   Glycine soja [wild soybean]
ref|XP_003522697.1|  PREDICTED: ADP-ribosylation factor-binding p...    208   2e-58   
ref|XP_003636408.1|  Hepatocyte growth factor-regulated tyrosine ...    207   3e-58   
gb|EEE56715.1|  hypothetical protein OsJ_06216                          206   3e-58   Oryza sativa Japonica Group [Japonica rice]
gb|ERM98612.1|  hypothetical protein AMTR_s00109p00078110               207   3e-58   Amborella trichopoda
ref|XP_010100264.1|  Protein PEROXIN-4                                  209   3e-58   
gb|EYU20455.1|  hypothetical protein MIMGU_mgv1a002579mg                207   4e-58   Erythranthe guttata [common monkey flower]
ref|XP_003572401.1|  PREDICTED: target of Myb protein 1                 207   4e-58   Brachypodium distachyon [annual false brome]
ref|XP_008337081.1|  PREDICTED: TOM1-like protein 1                     207   4e-58   
ref|NP_001046532.1|  Os02g0273700                                       206   4e-58   
ref|XP_004952188.1|  PREDICTED: target of Myb protein 1-like            206   5e-58   Setaria italica
ref|XP_010668103.1|  PREDICTED: target of Myb protein 1 isoform X1      207   6e-58   
ref|XP_011620554.1|  PREDICTED: target of Myb protein 1                 206   8e-58   Amborella trichopoda
ref|XP_007225177.1|  hypothetical protein PRUPE_ppa002235mg             206   1e-57   Prunus persica
ref|XP_010249685.1|  PREDICTED: TOM1-like protein 2 isoform X2          206   1e-57   Nelumbo nucifera [Indian lotus]
ref|XP_008220049.1|  PREDICTED: target of Myb protein 1                 206   1e-57   Prunus mume [ume]
gb|AEK78080.1|  VHS                                                     196   1e-57   Triticum aestivum [Canadian hard winter wheat]
gb|EAY73130.1|  hypothetical protein OsI_01005                          206   2e-57   Oryza sativa Indica Group [Indian rice]
ref|NP_001042484.1|  Os01g0229200                                       206   2e-57   
gb|KJB54840.1|  hypothetical protein B456_009G051300                    206   2e-57   Gossypium raimondii
ref|XP_010249684.1|  PREDICTED: TOM1-like protein 2 isoform X1          204   4e-57   Nelumbo nucifera [Indian lotus]
ref|XP_007137187.1|  hypothetical protein PHAVU_009G107100g             204   4e-57   Phaseolus vulgaris [French bean]
ref|XP_007161372.1|  hypothetical protein PHAVU_001G063400g             204   5e-57   Phaseolus vulgaris [French bean]
ref|XP_010924586.1|  PREDICTED: target of Myb protein 1-like            204   7e-57   Elaeis guineensis
ref|XP_006366880.1|  PREDICTED: TOM1-like protein 2-like                203   2e-56   Solanum tuberosum [potatoes]
ref|XP_004246315.1|  PREDICTED: target of Myb protein 1                 203   2e-56   Solanum lycopersicum
ref|XP_008654770.1|  PREDICTED: uncharacterized protein LOC100279...    203   2e-56   
ref|XP_010256972.1|  PREDICTED: target of Myb protein 1-like isof...    202   2e-56   Nelumbo nucifera [Indian lotus]
ref|XP_008799838.1|  PREDICTED: target of Myb protein 1-like isof...    202   2e-56   Phoenix dactylifera
ref|XP_008782607.1|  PREDICTED: ADP-ribosylation factor-binding p...    201   4e-56   Phoenix dactylifera
ref|XP_010922673.1|  PREDICTED: target of Myb protein 1-like isof...    201   7e-56   Elaeis guineensis
ref|XP_009623810.1|  PREDICTED: target of Myb protein 1-like isof...    201   7e-56   Nicotiana tomentosiformis
ref|XP_009766354.1|  PREDICTED: target of Myb protein 1-like            201   9e-56   Nicotiana sylvestris
ref|XP_009623811.1|  PREDICTED: target of Myb protein 1-like isof...    201   9e-56   
gb|EMS50126.1|  TOM1-like protein 2                                     200   2e-55   Triticum urartu
ref|XP_006374041.1|  hypothetical protein POPTR_0016s13940g             200   2e-55   
ref|XP_004137684.1|  PREDICTED: TOM1-like protein 2                     199   3e-55   Cucumis sativus [cucumbers]
ref|XP_010921084.1|  PREDICTED: probable ADP-ribosylation factor-...    198   5e-55   Elaeis guineensis
ref|XP_008442341.1|  PREDICTED: TOM1-like protein 2                     198   7e-55   Cucumis melo [Oriental melon]
ref|XP_008466043.1|  PREDICTED: target of Myb protein 1-like isof...    198   9e-55   
gb|KGN60332.1|  hypothetical protein Csa_3G895780                       197   1e-54   Cucumis sativus [cucumbers]
ref|XP_004136216.1|  PREDICTED: target of Myb protein 1-like            197   1e-54   Cucumis sativus [cucumbers]
ref|XP_002267147.1|  PREDICTED: TOM1-like protein 2                     196   2e-54   Vitis vinifera
ref|XP_011003578.1|  PREDICTED: target of Myb protein 1-like            197   2e-54   Populus euphratica
gb|ABR17546.1|  unknown                                                 196   2e-54   Picea sitchensis
gb|EYU29271.1|  hypothetical protein MIMGU_mgv1a004368mg                194   4e-54   Erythranthe guttata [common monkey flower]
ref|XP_010227670.1|  PREDICTED: TOM1-like protein 2 isoform X2          192   6e-54   
ref|XP_006593778.1|  PREDICTED: hepatocyte growth factor-regulate...    192   7e-54   Glycine max [soybeans]
ref|XP_010091105.1|  TOM1-like protein 2                                195   1e-53   Morus notabilis
gb|EMT25957.1|  TOM1-like protein 2                                     195   1e-53   
dbj|BAK05686.1|  predicted protein                                      194   2e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010254072.1|  PREDICTED: target of Myb protein 1-like isof...    194   2e-53   Nelumbo nucifera [Indian lotus]
ref|XP_008789328.1|  PREDICTED: hepatocyte growth factor-regulate...    194   2e-53   Phoenix dactylifera
ref|XP_012089726.1|  PREDICTED: target of Myb protein 1-like            194   2e-53   
gb|EMT09634.1|  Target of Myb protein 1                                 194   2e-53   
gb|EMT01224.1|  TOM1-like protein 2                                     194   3e-53   
emb|CDX75282.1|  BnaA01g04200D                                          193   3e-53   
ref|XP_002533826.1|  protein transporter, putative                      194   3e-53   Ricinus communis
emb|CDX68888.1|  BnaC01g05650D                                          193   4e-53   
ref|XP_002308242.2|  VHS domain-containing family protein               193   4e-53   
ref|XP_010920465.1|  PREDICTED: TOM1-like protein 2                     193   4e-53   Elaeis guineensis
ref|XP_004965472.1|  PREDICTED: target of Myb protein 1-like            193   5e-53   Setaria italica
ref|XP_009125501.1|  PREDICTED: TOM1-like protein 2 isoform X2          193   5e-53   Brassica rapa
ref|XP_009125493.1|  PREDICTED: TOM1-like protein 2 isoform X1          193   5e-53   Brassica rapa
ref|XP_002437041.1|  hypothetical protein SORBIDRAFT_10g019670          192   7e-53   
ref|XP_003563837.1|  PREDICTED: ADP-ribosylation factor-binding p...    192   7e-53   Brachypodium distachyon [annual false brome]
ref|XP_011090403.1|  PREDICTED: TOM1-like protein 2                     192   9e-53   Sesamum indicum [beniseed]
ref|XP_006429533.1|  hypothetical protein CICLE_v10011304mg             191   1e-52   Citrus clementina [clementine]
ref|XP_006656045.1|  PREDICTED: target of Myb protein 1-like            192   1e-52   Oryza brachyantha
gb|KCW71191.1|  hypothetical protein EUGRSUZ_F04281                     188   2e-52   Eucalyptus grandis [rose gum]
ref|XP_010040082.1|  PREDICTED: target of Myb protein 1                 190   3e-52   Eucalyptus grandis [rose gum]
ref|XP_002990208.1|  hypothetical protein SELMODRAFT_44205              185   4e-52   
gb|AAV32188.1|  unknown protein                                         189   4e-52   Oryza sativa Japonica Group [Japonica rice]
gb|EAY97588.1|  hypothetical protein OsI_19514                          189   6e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_007033604.1|  ENTH/VHS/GAT family protein                        190   6e-52   
ref|XP_004302539.1|  PREDICTED: TOM1-like protein 2                     189   7e-52   Fragaria vesca subsp. vesca
ref|XP_003551594.1|  PREDICTED: ADP-ribosylation factor-binding p...    190   7e-52   Glycine max [soybeans]
ref|XP_009401119.1|  PREDICTED: target of Myb protein 1-like isof...    187   7e-52   
ref|XP_006843695.1|  PREDICTED: ADP-ribosylation factor-binding p...    190   7e-52   Amborella trichopoda
ref|XP_006643942.1|  PREDICTED: TOM1-like protein 1-like                190   7e-52   Oryza brachyantha
ref|XP_002440893.1|  hypothetical protein SORBIDRAFT_09g015260          189   8e-52   Sorghum bicolor [broomcorn]
gb|KHN18194.1|  TOM1-like protein 2                                     190   9e-52   Glycine soja [wild soybean]
gb|AFW86618.1|  LOW QUALITY PROTEIN: putative VHS/GAT domain cont...    189   9e-52   
gb|EEC80523.1|  hypothetical protein OsI_22803                          190   9e-52   Oryza sativa Indica Group [Indian rice]
ref|NP_001057544.1|  Os06g0332400                                       189   9e-52   
ref|NP_001151446.1|  VHS and GAT domain protein                         189   9e-52   Zea mays [maize]
gb|AFW86617.1|  putative VHS/GAT domain containing family protein       189   1e-51   
ref|XP_003565953.1|  PREDICTED: TOM1-like protein 2                     189   1e-51   Brachypodium distachyon [annual false brome]
emb|CDM82374.1|  unnamed protein product                                189   1e-51   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004492527.1|  PREDICTED: ADP-ribosylation factor-binding p...    189   1e-51   Cicer arietinum [garbanzo]
gb|KJB27733.1|  hypothetical protein B456_005G006700                    189   2e-51   Gossypium raimondii
ref|XP_009400790.1|  PREDICTED: TOM1-like protein 1                     187   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008799840.1|  PREDICTED: target of Myb protein 1-like isof...    188   2e-51   
ref|XP_006340263.1|  PREDICTED: target of Myb protein 1-like isof...    188   2e-51   Solanum tuberosum [potatoes]
ref|XP_006588349.1|  PREDICTED: TOM1-like protein 2-like                186   3e-51   
ref|XP_007140152.1|  hypothetical protein PHAVU_008G088200g             189   3e-51   Phaseolus vulgaris [French bean]
ref|XP_006340264.1|  PREDICTED: target of Myb protein 1-like isof...    188   3e-51   
ref|XP_004251172.1|  PREDICTED: target of Myb protein 1-like            188   3e-51   
ref|XP_004962422.1|  PREDICTED: TOM1-like protein 2-like                187   3e-51   
ref|XP_009399847.1|  PREDICTED: target of Myb protein 1-like            188   3e-51   
ref|XP_011095099.1|  PREDICTED: TOM1-like protein 2 isoform X1          187   3e-51   
gb|EYU41986.1|  hypothetical protein MIMGU_mgv1a003310mg                187   4e-51   
gb|KFK36730.1|  hypothetical protein AALP_AA4G162100                    187   8e-51   
ref|XP_006411053.1|  hypothetical protein EUTSA_v10016346mg             186   1e-50   
ref|XP_003623549.1|  Class E vacuolar protein-sorting machinery p...    187   1e-50   
ref|XP_009417712.1|  PREDICTED: target of Myb protein 1-like            186   2e-50   
ref|XP_002458696.1|  hypothetical protein SORBIDRAFT_03g038450          185   2e-50   
ref|XP_008370224.1|  PREDICTED: target of Myb protein 1-like            185   3e-50   
ref|XP_009373120.1|  PREDICTED: TOM1-like protein 2                     185   3e-50   
gb|KHN29536.1|  TOM1-like protein 2                                     186   3e-50   
ref|XP_009417967.1|  PREDICTED: target of Myb protein 1-like            184   4e-50   
ref|XP_008674876.1|  PREDICTED: target of Myb protein 1-like            184   5e-50   
ref|XP_004970409.1|  PREDICTED: TOM1-like protein 2-like                184   8e-50   
ref|XP_009371972.1|  PREDICTED: TOM1-like protein 2 isoform X1          184   8e-50   
ref|XP_010464493.1|  PREDICTED: TOM1-like protein 2 isoform X1          184   9e-50   
gb|KFK38269.1|  hypothetical protein AALP_AA3G092500                    183   1e-49   
ref|XP_009123827.1|  PREDICTED: TOM1-like protein 2 isoform X1          183   2e-49   
ref|XP_009123832.1|  PREDICTED: target of Myb protein 1 isoform X2      182   2e-49   
ref|XP_003564510.1|  PREDICTED: target of Myb protein 1-like            182   2e-49   
ref|XP_006654272.1|  PREDICTED: TOM1-like protein 2-like                182   2e-49   
ref|XP_002882583.1|  VHS domain-containing protein                      182   3e-49   
ref|XP_010486425.1|  PREDICTED: TOM1-like protein 2                     182   3e-49   
ref|XP_003568250.1|  PREDICTED: TOM1-like protein 2                     181   5e-49   
dbj|BAJ93569.1|  predicted protein                                      181   5e-49   
emb|CDY61534.1|  BnaC04g53430D                                          181   6e-49   
ref|XP_006299627.1|  hypothetical protein CARUB_v10015806mg             181   7e-49   
ref|NP_001044671.1|  Os01g0825700                                       181   7e-49   
gb|KHG18963.1|  TOM1-like protein 2                                     181   9e-49   
emb|CDY58652.1|  BnaA01g32270D                                          181   9e-49   
emb|CDY22169.1|  BnaC01g39320D                                          181   9e-49   
ref|XP_010465480.1|  PREDICTED: uncharacterized protein LOC104745...    184   1e-48   
ref|NP_187491.1|  ENTH/VHS/GAT family protein                           180   1e-48   
gb|AFW77795.1|  putative VHS/GAT domain containing family protein       179   2e-48   
ref|XP_009391690.1|  PREDICTED: TOM1-like protein 2                     180   2e-48   
ref|NP_001168794.1|  uncharacterized protein LOC100382593               179   2e-48   
emb|CDY54459.1|  BnaAnng13250D                                          179   2e-48   
ref|XP_008648085.1|  PREDICTED: uncharacterized protein LOC100382...    179   5e-48   
ref|XP_009143393.1|  PREDICTED: class E vacuolar protein-sorting ...    179   5e-48   
ref|XP_006655406.1|  PREDICTED: TOM1-like protein 2-like                179   5e-48   
ref|XP_010915839.1|  PREDICTED: TOM1-like protein 2 isoform X3          178   1e-47   
ref|XP_010915837.1|  PREDICTED: target of Myb protein 1-like isof...    178   1e-47   
ref|XP_006830255.1|  PREDICTED: target of Myb protein 1                 177   1e-47   
ref|XP_007208024.1|  hypothetical protein PRUPE_ppa003104mg             177   2e-47   
gb|KJB27315.1|  hypothetical protein B456_004G290500                    177   2e-47   
ref|XP_010683565.1|  PREDICTED: target of Myb protein 1                 177   3e-47   
ref|XP_008245296.1|  PREDICTED: TOM1-like protein 2                     177   4e-47   
ref|XP_004961761.1|  PREDICTED: class E vacuolar protein-sorting ...    176   4e-47   
ref|XP_008649752.1|  PREDICTED: TOM1-like protein 2 isoform X2          172   4e-47   
ref|NP_001055830.1|  Os05g0475300                                       176   4e-47   
gb|AAX96736.1|  VHS domain                                              163   6e-47   
dbj|BAK00946.1|  predicted protein                                      175   9e-47   
ref|XP_011019039.1|  PREDICTED: target of Myb protein 1-like            175   1e-46   
gb|EMT04863.1|  TOM1-like protein 2                                     167   1e-46   
emb|CDM84797.1|  unnamed protein product                                174   4e-46   
gb|KGN62829.1|  hypothetical protein Csa_2G375200                       173   7e-46   
ref|XP_006646440.1|  PREDICTED: target of Myb protein 1-like            172   7e-46   
ref|NP_001151587.1|  protein transporter                                172   7e-46   
gb|AFW78365.1|  putative VHS/GAT domain containing family protein       172   7e-46   
gb|EMS54369.1|  TOM1-like protein 2                                     173   1e-45   
ref|XP_010065116.1|  PREDICTED: target of Myb protein 1-like            169   4e-45   
ref|XP_002881591.1|  predicted protein                                  171   5e-45   
ref|XP_010925874.1|  PREDICTED: target of Myb protein 1-like isof...    171   5e-45   
ref|XP_010517134.1|  PREDICTED: TOM1-like protein 2                     170   6e-45   
ref|XP_008649753.1|  PREDICTED: TOM1-like protein 2 isoform X3          167   6e-45   
ref|XP_008649754.1|  PREDICTED: TOM1-like protein 2 isoform X4          166   6e-45   
ref|XP_008649751.1|  PREDICTED: TOM1-like protein 2 isoform X1          166   7e-45   
emb|CBI18074.3|  unnamed protein product                                169   8e-45   
ref|NP_181375.1|  VHS and GAT domain-containing protein                 169   2e-44   
ref|XP_010505463.1|  PREDICTED: TOM1-like protein 2                     169   2e-44   
ref|XP_010541654.1|  PREDICTED: TOM1-like protein 2                     168   3e-44   
emb|CDP16170.1|  unnamed protein product                                168   3e-44   
ref|XP_006600247.1|  PREDICTED: VHS and GAT domain protein isofor...    168   4e-44   
ref|XP_006293789.1|  hypothetical protein CARUB_v10022769mg             168   5e-44   
ref|XP_006581426.1|  PREDICTED: ADP-ribosylation factor-binding p...    167   9e-44   
ref|XP_010509179.1|  PREDICTED: TOM1-like protein 2                     165   4e-43   
ref|XP_006407741.1|  hypothetical protein EUTSA_v10022036mg             163   1e-42   
ref|XP_008648086.1|  PREDICTED: uncharacterized protein LOC100382...    163   2e-42   
ref|XP_006578215.1|  PREDICTED: ADP-ribosylation factor-binding p...    163   2e-42   
ref|XP_010553207.1|  PREDICTED: TOM1-like protein 2                     163   2e-42   
ref|XP_006858485.1|  PREDICTED: TOM1-like protein 2 isoform X2          159   2e-41   
ref|XP_011628573.1|  PREDICTED: TOM1-like protein 2 isoform X1          159   2e-41   
ref|XP_010553134.1|  PREDICTED: target of Myb protein 1-like isof...    159   5e-41   
gb|EMT33053.1|  TOM1-like protein 2                                     159   6e-41   
ref|XP_010558400.1|  PREDICTED: target of Myb protein 1-like            157   2e-40   
gb|KDO49626.1|  hypothetical protein CISIN_1g0070671mg                  156   3e-40   
gb|KDO49625.1|  hypothetical protein CISIN_1g0070671mg                  156   3e-40   
ref|XP_008798998.1|  PREDICTED: TOM1-like protein 2                     149   4e-40   
gb|EEC71726.1|  hypothetical protein OsI_04270                          156   5e-40   
ref|XP_006398583.1|  hypothetical protein EUTSA_v10015861mg             154   2e-39   
emb|CAA18585.1|  putative protein                                       154   9e-39   
ref|XP_006289888.1|  hypothetical protein CARUB_v10003503mg             150   5e-38   
gb|EMS53520.1|  TOM1-like protein 2                                     149   1e-37   
gb|KHG08198.1|  Target of Myb 1                                         147   2e-37   
ref|NP_195796.2|  ENTH/VHS/GAT family protein                           148   3e-37   
ref|XP_006394253.1|  hypothetical protein EUTSA_v10004212mg             146   5e-37   
ref|XP_009414599.1|  PREDICTED: TOM1-like protein 2                     145   6e-37   
ref|XP_002865647.1|  hypothetical protein ARALYDRAFT_494915             147   8e-37   
emb|CDY41526.1|  BnaA06g22790D                                          145   9e-37   
gb|KGN54491.1|  hypothetical protein Csa_4G338950                       141   9e-37   
ref|XP_009150417.1|  PREDICTED: TOM1-like protein 2                     145   9e-37   
ref|XP_004517231.1|  PREDICTED: hepatocyte growth factor-regulate...    139   1e-36   
ref|XP_003525151.1|  PREDICTED: TOM1-like protein 2-like                144   1e-36   
ref|XP_010911855.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    145   1e-36   
ref|XP_007049967.1|  ENTH/VHS/GAT family protein isoform 1              144   2e-36   
ref|XP_007159912.1|  hypothetical protein PHAVU_002G278000g             144   2e-36   
ref|XP_010423991.1|  PREDICTED: target of Myb protein 1-like isof...    145   3e-36   
ref|XP_010423990.1|  PREDICTED: uncharacterized protein LOC104709...    145   3e-36   
ref|XP_010451938.1|  PREDICTED: target of Myb protein 1-like            145   4e-36   
gb|EMS53164.1|  Hepatocyte growth factor-regulated tyrosine kinas...    137   4e-36   
gb|AFW74255.1|  putative VHS/GAT domain containing family protein       140   4e-36   
gb|KJB40531.1|  hypothetical protein B456_007G068300                    143   5e-36   
ref|XP_001753543.1|  predicted protein                                  134   6e-36   
ref|XP_009615446.1|  PREDICTED: TOM1-like protein 2 isoform X2          142   6e-36   
ref|XP_010490511.1|  PREDICTED: target of Myb protein 1-like isof...    144   6e-36   
ref|NP_201169.1|  ENTH/VHS/GAT family protein                           143   7e-36   
ref|XP_002966385.1|  hypothetical protein SELMODRAFT_39145              134   7e-36   
ref|XP_010244847.1|  PREDICTED: target of Myb protein 1                 142   8e-36   
ref|XP_009615443.1|  PREDICTED: TOM1-like protein 2 isoform X1          142   8e-36   
ref|XP_009787213.1|  PREDICTED: TOM1-like protein 2 isoform X2          142   8e-36   
ref|XP_009787211.1|  PREDICTED: TOM1-like protein 2 isoform X1          142   9e-36   
gb|EYU20564.1|  hypothetical protein MIMGU_mgv1a005942mg                142   1e-35   
ref|XP_006280449.1|  hypothetical protein CARUB_v10026381mg             142   1e-35   
ref|XP_008449359.1|  PREDICTED: LOW QUALITY PROTEIN: TOM1-like pr...    142   2e-35   
ref|XP_004249875.1|  PREDICTED: TOM1-like protein 2                     141   2e-35   
ref|XP_003532376.1|  PREDICTED: TOM1-like protein 2-like                141   2e-35   
ref|XP_002872995.1|  hypothetical protein ARALYDRAFT_486890             143   2e-35   
ref|XP_004288475.1|  PREDICTED: TOM1-like protein 2                     141   2e-35   
ref|XP_010553136.1|  PREDICTED: target of Myb protein 1-like isof...    143   2e-35   
ref|XP_006351013.1|  PREDICTED: TOM1-like protein 2-like                141   2e-35   
emb|CDY31358.1|  BnaA02g33830D                                          142   2e-35   
ref|XP_009130265.1|  PREDICTED: TOM1-like protein 2                     142   2e-35   
ref|XP_010444279.1|  PREDICTED: TOM1-like protein 2                     142   2e-35   
ref|XP_010546287.1|  PREDICTED: target of Myb protein 1-like isof...    142   2e-35   
ref|NP_001148780.1|  protein transporter                                141   2e-35   
ref|XP_010460837.1|  PREDICTED: TOM1-like protein 2                     142   2e-35   
ref|XP_010546288.1|  PREDICTED: target of Myb protein 1-like isof...    142   3e-35   
gb|EYU20565.1|  hypothetical protein MIMGU_mgv1a005942mg                141   3e-35   
ref|XP_011100131.1|  PREDICTED: TOM1-like protein 2                     141   3e-35   
ref|XP_001761602.1|  predicted protein                                  132   4e-35   
emb|CDX80751.1|  BnaC03g00050D                                          142   4e-35   
ref|XP_010521439.1|  PREDICTED: TOM1-like protein 2 isoform X3          140   4e-35   
ref|NP_001149290.1|  LOC100282912                                       140   5e-35   
emb|CDY39857.1|  BnaC02g42610D                                          140   6e-35   
ref|XP_002325737.2|  hypothetical protein POPTR_0019s00820g             140   6e-35   
ref|XP_012073991.1|  PREDICTED: TOM1-like protein 2                     140   7e-35   
ref|XP_010521433.1|  PREDICTED: TOM1-like protein 2 isoform X1          140   7e-35   
ref|XP_010521437.1|  PREDICTED: TOM1-like protein 2 isoform X2          140   7e-35   
ref|XP_009130628.1|  PREDICTED: target of Myb protein 1 isoform X2      141   8e-35   
ref|XP_010096423.1|  TOM1-like protein 2                                139   9e-35   
ref|XP_004142659.1|  PREDICTED: target of Myb protein 1 isoform X1      140   9e-35   
ref|XP_009130627.1|  PREDICTED: target of Myb protein 1 isoform X1      141   1e-34   
ref|XP_010484118.1|  PREDICTED: TOM1-like protein 2                     140   1e-34   
gb|EPS66284.1|  hypothetical protein M569_08493                         140   1e-34   
gb|EPS70776.1|  hypothetical protein M569_03981                         137   1e-34   
ref|XP_002864859.1|  VHS domain-containing protein                      139   2e-34   
ref|XP_011001257.1|  PREDICTED: TOM1-like protein 2                     139   2e-34   
gb|KFK24673.1|  hypothetical protein AALP_AA8G010100                    140   2e-34   
gb|EAZ05339.1|  hypothetical protein OsI_27544                          138   3e-34   
ref|NP_001060807.1|  Os08g0109000                                       138   3e-34   
ref|XP_006659035.1|  PREDICTED: target of Myb protein 1-like            137   4e-34   
ref|XP_006384387.1|  hypothetical protein POPTR_0004s14580g             137   4e-34   
emb|CDX84429.1|  BnaC03g50710D                                          138   5e-34   
emb|CAB82746.1|  putative protein                                       139   5e-34   
ref|XP_002453673.1|  hypothetical protein SORBIDRAFT_04g010220          139   6e-34   
ref|XP_004503010.1|  PREDICTED: target of Myb protein 1-like            137   7e-34   
ref|XP_010027478.1|  PREDICTED: TOM1-like protein 2 isoform X2          137   8e-34   
ref|XP_010653000.1|  PREDICTED: TOM1-like protein 2 isoform X1          137   8e-34   
ref|XP_007212267.1|  hypothetical protein PRUPE_ppa006676mg             137   8e-34   
ref|XP_010027464.1|  PREDICTED: TOM1-like protein 2 isoform X1          137   8e-34   
ref|XP_008227682.1|  PREDICTED: class E vacuolar protein-sorting ...    137   8e-34   
ref|XP_010490510.1|  PREDICTED: target of Myb protein 1-like isof...    138   8e-34   
gb|KDO83509.1|  hypothetical protein CISIN_1g0101501mg                  129   1e-33   
emb|CDY11180.1|  BnaA03g00160D                                          137   1e-33   
gb|KDO58721.1|  hypothetical protein CISIN_1g0143901mg                  137   1e-33   
gb|KEH35652.1|  ENTH/VHS/GAT family protein                             137   1e-33   
ref|XP_004972456.1|  PREDICTED: target of Myb protein 1-like            136   2e-33   
emb|CDP18690.1|  unnamed protein product                                136   2e-33   
ref|XP_006466191.1|  PREDICTED: TOM1-like protein 2-like                136   2e-33   
ref|XP_006384388.1|  VHS domain-containing family protein               136   2e-33   
gb|KHN31212.1|  TOM1-like protein 2                                     136   2e-33   
ref|XP_007137811.1|  hypothetical protein PHAVU_009G157500g             136   2e-33   
ref|XP_010675157.1|  PREDICTED: target of Myb protein 1                 136   3e-33   
gb|EMS68590.1|  TOM1-like protein 2                                     135   3e-33   
ref|XP_002513254.1|  Hepatocyte growth factor-regulated tyrosine ...    135   4e-33   
gb|AET04887.2|  ENTH/VHS/GAT family protein                             134   8e-33   
ref|XP_003630411.1|  Vacuolar protein-sorting machinery protein         134   8e-33   
dbj|BAJ91795.1|  predicted protein                                      135   8e-33   
ref|XP_010040038.1|  PREDICTED: TOM1-like protein 2                     134   1e-32   
ref|XP_006581807.1|  PREDICTED: target of Myb protein 1-like isof...    134   2e-32   
ref|XP_011009978.1|  PREDICTED: class E vacuolar protein-sorting ...    133   2e-32   
ref|XP_008775806.1|  PREDICTED: ADP-ribosylation factor-binding p...    134   3e-32   
gb|EMT28075.1|  TOM1-like protein 2                                     134   4e-32   
ref|XP_009379537.1|  PREDICTED: target of Myb protein 1                 132   6e-32   
ref|XP_009410695.1|  PREDICTED: TOM1-like protein 2                     131   9e-32   
ref|XP_008394208.1|  PREDICTED: uncharacterized protein LOC103456295    131   1e-31   
ref|XP_010915840.1|  PREDICTED: ADP-ribosylation factor-binding p...    132   1e-31   
gb|KHN09670.1|  Target of Myb protein 1                                 130   2e-31   
ref|XP_003573273.1|  PREDICTED: TOM1-like protein 2                     130   3e-31   
ref|XP_004517233.1|  PREDICTED: hepatocyte growth factor-regulate...    121   4e-30   
ref|XP_008337080.1|  PREDICTED: uncharacterized protein LOC103400192    130   6e-30   
ref|XP_004502554.1|  PREDICTED: ADP-ribosylation factor-binding p...    126   8e-30   
ref|XP_008782608.1|  PREDICTED: putative uncharacterized protein ...    126   1e-29   
ref|NP_001055241.2|  Os05g0339000                                       119   2e-29   
ref|XP_008672288.1|  PREDICTED: uncharacterized protein LOC100217...    126   2e-29   
ref|XP_003630412.1|  Vacuolar protein-sorting machinery protein         122   9e-29   
gb|EMT26996.1|  Hepatocyte growth factor-regulated tyrosine kinas...    125   2e-28   
ref|XP_006426426.1|  hypothetical protein CICLE_v100273311mg            119   2e-28   
ref|XP_010921085.1|  PREDICTED: ADP-ribosylation factor-binding p...    123   3e-28   
ref|XP_008466046.1|  PREDICTED: probable ADP-ribosylation factor-...    123   3e-28   
ref|XP_010237854.1|  PREDICTED: uncharacterized protein LOC100820...    121   4e-28   
ref|XP_008793056.1|  PREDICTED: ADP-ribosylation factor-binding p...    122   7e-28   
emb|CDP06410.1|  unnamed protein product                                115   7e-28   
gb|EPS72882.1|  hypothetical protein M569_01871                         120   8e-28   
ref|XP_008782609.1|  PREDICTED: putative uncharacterized protein ...    121   1e-27   
ref|XP_010921086.1|  PREDICTED: putative uncharacterized protein ...    120   2e-27   
ref|XP_009361159.1|  PREDICTED: TOM1-like protein 2 isoform X1          119   2e-27   
ref|XP_009361163.1|  PREDICTED: TOM1-like protein 2 isoform X2          119   3e-27   



>emb|CDP11965.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERATS+MLIGPDWA+NIELCDIIN NPGQAKDALKILKKRLG+KNPKIQLL
Sbjct  1    MANNAAACAERATSEMLIGPDWAINIELCDIINSNPGQAKDALKILKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
             LFVLETLSKNCGEN+FQQIVERD+LHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR
Sbjct  61   TLFVLETLSKNCGENLFQQIVERDVLHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQYHAAYNELK+ GVEFPPRE+NSVPLFTPP
Sbjct  121  GRFPQYHAAYNELKSAGVEFPPREDNSVPLFTPP  154



>emb|CBI18938.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAAC ERATSDMLIGPDWA+NIELCDIIN++PGQAKDALKILKKRLG+KNPKIQLL
Sbjct  1    MANNAAACVERATSDMLIGPDWAINIELCDIINMDPGQAKDALKILKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALFVLETLSKNCGEN+FQQIVERDILH+MVKIVKKKPDLNVREKILILIDTWQEA GGPR
Sbjct  61   ALFVLETLSKNCGENVFQQIVERDILHEMVKIVKKKPDLNVREKILILIDTWQEAFGGPR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY+AAYNEL + GVEFPPR ENSVPLFTPP
Sbjct  121  GRYPQYYAAYNELTSAGVEFPPRAENSVPLFTPP  154



>ref|XP_008381725.1| PREDICTED: TOM1-like protein 2 [Malus domestica]
Length=244

 Score =   293 bits (751),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MA + AACAERATSDMLIGPDWA+NIELCDIINI+PGQAK+ALKILKKRLG+KNPKIQLL
Sbjct  1    MAGNGAACAERATSDMLIGPDWAINIELCDIINIDPGQAKEALKILKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALF LET+SKNCGEN+FQQIVERDILH+MVKIVKKKPDLNVREKILILIDTWQEA GGPR
Sbjct  61   ALFALETVSKNCGENVFQQIVERDILHEMVKIVKKKPDLNVREKILILIDTWQEAFGGPR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQY+AAYNEL++ GVEFPPREENSVP+FTPP
Sbjct  121  GRFPQYYAAYNELRSAGVEFPPREENSVPIFTPP  154



>ref|XP_009602520.1| PREDICTED: TOM1-like protein 2 [Nicotiana tomentosiformis]
 ref|XP_009602521.1| PREDICTED: TOM1-like protein 2 [Nicotiana tomentosiformis]
 ref|XP_009602522.1| PREDICTED: TOM1-like protein 2 [Nicotiana tomentosiformis]
Length=522

 Score =   303 bits (775),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERATSDMLIGPDWA+NIELCDIIN+NPGQAKDALKI+KKRLG+KNPKIQLL
Sbjct  1    MANNAAACAERATSDMLIGPDWAINIELCDIINMNPGQAKDALKIIKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
             LFVLETLSKNCGEN+FQQIVERDIL DMVKIVKKKPDLNVREKILILID+WQEALGGP 
Sbjct  61   TLFVLETLSKNCGENVFQQIVERDILKDMVKIVKKKPDLNVREKILILIDSWQEALGGPG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFP Y+AAYNELKA+GVEFPPREENSVPLFTPP
Sbjct  121  GRFPHYYAAYNELKAYGVEFPPREENSVPLFTPP  154



>ref|XP_004237704.1| PREDICTED: target of Myb protein 1 [Solanum lycopersicum]
 ref|XP_010320006.1| PREDICTED: target of Myb protein 1 [Solanum lycopersicum]
 ref|XP_010320007.1| PREDICTED: target of Myb protein 1 [Solanum lycopersicum]
Length=529

 Score =   301 bits (770),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERATSDMLIGPDWA+NIELCDIIN+NPGQAKDALKI+KKRLG+KNPKIQLL
Sbjct  1    MANNAAACAERATSDMLIGPDWAINIELCDIINMNPGQAKDALKIIKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
             LFVLETLSKNCGEN+FQQIVER+IL DMVKIVKKKPDLNVREKILILID+WQEALGGP 
Sbjct  61   TLFVLETLSKNCGENVFQQIVEREILRDMVKIVKKKPDLNVREKILILIDSWQEALGGPG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQY+AAYNELKA GVEFPPREENSVPLFTPP
Sbjct  121  GRFPQYYAAYNELKAAGVEFPPREENSVPLFTPP  154



>ref|XP_006356339.1| PREDICTED: TOM1-like protein 1-like isoform X1 [Solanum tuberosum]
 ref|XP_006356340.1| PREDICTED: TOM1-like protein 1-like isoform X2 [Solanum tuberosum]
Length=529

 Score =   300 bits (769),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERATSDMLIGPDWA+NIELCDIIN+NPGQAKDALKI+KKRLG+KNPKIQLL
Sbjct  1    MANNAAACAERATSDMLIGPDWAINIELCDIINMNPGQAKDALKIIKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
             LFVLETLSKNCGEN+FQQIVER+IL DMVKIVKKKPDLNVREKILILID+WQEALGGP 
Sbjct  61   TLFVLETLSKNCGENVFQQIVEREILRDMVKIVKKKPDLNVREKILILIDSWQEALGGPG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQY+AAYNELKA GVEFPPREENSVPLFTPP
Sbjct  121  GRFPQYYAAYNELKAAGVEFPPREENSVPLFTPP  154



>gb|KDO83508.1| hypothetical protein CISIN_1g0101501mg, partial [Citrus sinensis]
Length=210

 Score =   289 bits (739),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERAT+DMLIGPDWA+NIELCD+IN++PGQAKDALKILKKRLG+KNPK+QLL
Sbjct  1    MANNAAACAERATNDMLIGPDWAINIELCDVINMDPGQAKDALKILKKRLGSKNPKVQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALF LET+SKNCG+++FQQI+ERDILH+MVKIVKKKPDLNVREKILILIDTWQEA GGPR
Sbjct  61   ALFALETISKNCGDSVFQQIIERDILHEMVKIVKKKPDLNVREKILILIDTWQEAFGGPR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY+AAYNEL++ GVEFPPR ENSVP FTPP
Sbjct  121  GRYPQYYAAYNELRSAGVEFPPRAENSVPFFTPP  154



>ref|XP_009346369.1| PREDICTED: target of Myb protein 1-like [Pyrus x bretschneideri]
 ref|XP_009346370.1| PREDICTED: target of Myb protein 1-like [Pyrus x bretschneideri]
 ref|XP_009346371.1| PREDICTED: target of Myb protein 1-like [Pyrus x bretschneideri]
 ref|XP_009346375.1| PREDICTED: target of Myb protein 1-like [Pyrus x bretschneideri]
 ref|XP_009346376.1| PREDICTED: target of Myb protein 1-like [Pyrus x bretschneideri]
 ref|XP_009346377.1| PREDICTED: target of Myb protein 1-like [Pyrus x bretschneideri]
Length=523

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MA +AAACAERATSDMLIGPDWA+NIELCDIIN+ PGQAKDALKILKKRLG+KNPKIQLL
Sbjct  1    MAGNAAACAERATSDMLIGPDWAINIELCDIINMEPGQAKDALKILKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALF LET+SKNCGE++FQQIVERDILH+MVKIVKKKPDLNVREKILILIDTWQEA GGPR
Sbjct  61   ALFALETVSKNCGESVFQQIVERDILHEMVKIVKKKPDLNVREKILILIDTWQEAFGGPR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQYHAAYNEL+A GVEFPPREENSVP+FTPP
Sbjct  121  GRFPQYHAAYNELRAAGVEFPPREENSVPIFTPP  154



>ref|XP_009366814.1| PREDICTED: target of Myb protein 1-like [Pyrus x bretschneideri]
Length=523

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MA +AAACAERATSDMLIGPDWA+NIELCDIIN+ PGQAKDALKILKKRLG+KNPKIQLL
Sbjct  1    MAGNAAACAERATSDMLIGPDWAINIELCDIINMEPGQAKDALKILKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALF LET+SKNCGE++FQQIVERDILH+MVKIVKKKPDLNVREKILILIDTWQEA GGPR
Sbjct  61   ALFALETVSKNCGESVFQQIVERDILHEMVKIVKKKPDLNVREKILILIDTWQEAFGGPR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQYHAAYNEL+A GVEFPPREENSVP+FTPP
Sbjct  121  GRFPQYHAAYNELRAAGVEFPPREENSVPIFTPP  154



>ref|XP_002285894.1| PREDICTED: target of Myb protein 1-like [Vitis vinifera]
 ref|XP_010664147.1| PREDICTED: target of Myb protein 1-like [Vitis vinifera]
Length=514

 Score =   298 bits (764),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAAC ERATSDMLIGPDWA+NIELCDIIN++PGQAKDALKILKKRLG+KNPKIQLL
Sbjct  1    MANNAAACVERATSDMLIGPDWAINIELCDIINMDPGQAKDALKILKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALFVLETLSKNCGEN+FQQIVERDILH+MVKIVKKKPDLNVREKILILIDTWQEA GGPR
Sbjct  61   ALFVLETLSKNCGENVFQQIVERDILHEMVKIVKKKPDLNVREKILILIDTWQEAFGGPR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY+AAYNEL + GVEFPPR ENSVPLFTPP
Sbjct  121  GRYPQYYAAYNELTSAGVEFPPRAENSVPLFTPP  154



>ref|XP_009342857.1| PREDICTED: target of Myb protein 1-like [Pyrus x bretschneideri]
Length=520

 Score =   298 bits (763),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MA +AAACAERATSDMLIGPDWA+NIELCDIIN++PGQAK+ALKILKKRLG+KNPKIQLL
Sbjct  1    MAGNAAACAERATSDMLIGPDWAINIELCDIINMDPGQAKEALKILKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALF LET+SKNCGEN+FQQIVERDILH+MVKIVKKKPDLNVREKILILIDTWQEA GGPR
Sbjct  61   ALFALETVSKNCGENVFQQIVERDILHEMVKIVKKKPDLNVREKILILIDTWQEAFGGPR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQY+AAYNEL++ GVEFPPREENSVP+FTPP
Sbjct  121  GRFPQYYAAYNELRSAGVEFPPREENSVPIFTPP  154



>ref|XP_009360664.1| PREDICTED: target of Myb protein 1-like [Pyrus x bretschneideri]
Length=520

 Score =   298 bits (762),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MA +AAACAERATSDMLIGPDWA+NIELCDIIN++PGQAK+ALKILKKRLG+KNPKIQLL
Sbjct  1    MAGNAAACAERATSDMLIGPDWAINIELCDIINMDPGQAKEALKILKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALF LET+SKNCGEN+FQQIVERDILH+MVKIVKKKPDLNVREKILILIDTWQEA GGPR
Sbjct  61   ALFALETVSKNCGENVFQQIVERDILHEMVKIVKKKPDLNVREKILILIDTWQEAFGGPR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQY+AAYNEL++ GVEFPPREENSVP+FTPP
Sbjct  121  GRFPQYYAAYNELRSAGVEFPPREENSVPIFTPP  154



>ref|XP_008237773.1| PREDICTED: target of Myb protein 1 [Prunus mume]
Length=522

 Score =   295 bits (755),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MA +AAACAERATSDMLIGPDWA+NIELCDIIN+ PGQAKDALKILKKRLG+KNPKIQLL
Sbjct  1    MAGNAAACAERATSDMLIGPDWAINIELCDIINMEPGQAKDALKILKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALF LET+SKNCGEN+FQQIVERDILH+MVKIVKKKPDLNVREKILILIDTWQEA GG R
Sbjct  61   ALFALETVSKNCGENVFQQIVERDILHEMVKIVKKKPDLNVREKILILIDTWQEAFGGAR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY+AAYNEL++ GVEFPPREENSVPLFTPP
Sbjct  121  GRYPQYYAAYNELRSAGVEFPPREENSVPLFTPP  154



>ref|XP_007201782.1| hypothetical protein PRUPE_ppa004229mg [Prunus persica]
 gb|EMJ02981.1| hypothetical protein PRUPE_ppa004229mg [Prunus persica]
Length=522

 Score =   295 bits (755),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MA +AAACAERATSDMLIGPDWA+NIELCDIIN+ PGQAKDALKILKKRLG+KNPKIQLL
Sbjct  1    MAGNAAACAERATSDMLIGPDWAINIELCDIINMEPGQAKDALKILKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALF LET+SKNCGEN+FQQIVERDILH+MVKIVKKKPDLNVREKILILIDTWQEA GG R
Sbjct  61   ALFALETVSKNCGENVFQQIVERDILHEMVKIVKKKPDLNVREKILILIDTWQEAFGGAR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY+AAYNEL++ GVEFPPREENSVPLFTPP
Sbjct  121  GRYPQYYAAYNELRSAGVEFPPREENSVPLFTPP  154



>ref|XP_007137502.1| hypothetical protein PHAVU_009G132300g [Phaseolus vulgaris]
 gb|ESW09496.1| hypothetical protein PHAVU_009G132300g [Phaseolus vulgaris]
Length=505

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACA+RATSDMLIGPDWAVNIELCDIIN++PGQAKDALKILKKRLG+KNPKIQLL
Sbjct  1    MANNAAACADRATSDMLIGPDWAVNIELCDIINMDPGQAKDALKILKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALFVLETLSKNCGE++FQQI+ERDILH+MVKIVKKKPDLNVREKILILIDTWQEA GG  
Sbjct  61   ALFVLETLSKNCGESVFQQIIERDILHEMVKIVKKKPDLNVREKILILIDTWQEAFGGST  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            G +PQYHAAYNELK+ GVEFPPR+ENSVP FTPP
Sbjct  121  GVYPQYHAAYNELKSAGVEFPPRDENSVPFFTPP  154



>ref|XP_012078346.1| PREDICTED: TOM1-like protein 2 [Jatropha curcas]
 gb|KDP32899.1| hypothetical protein JCGZ_12191 [Jatropha curcas]
Length=520

 Score =   293 bits (751),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERATSDMLIGPDWA+NIELCDIIN++PG AKDALK+LKKRLG+K+PKIQLL
Sbjct  1    MANNAAACAERATSDMLIGPDWAINIELCDIINMDPGHAKDALKVLKKRLGSKSPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALF LET+SKNCGEN+FQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEA GG R
Sbjct  61   ALFALETVSKNCGENVFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEAFGGQR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQY+AAYNEL+A GVEFPPR ENSVPLFTPP
Sbjct  121  GRFPQYYAAYNELRAAGVEFPPRAENSVPLFTPP  154



>ref|XP_010260421.1| PREDICTED: target of Myb protein 1 [Nelumbo nucifera]
Length=530

 Score =   293 bits (751),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAAC ERATSDMLIGPDWA+NIE+CDIIN +PGQAKDALK LKKRLG+KNPKIQLL
Sbjct  1    MANNAAACVERATSDMLIGPDWAINIEICDIINTDPGQAKDALKTLKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALFVLETLSKNCG+N++QQIVERDILH+MVKIVKKKPDLNVREKILILIDTWQEA GGP 
Sbjct  61   ALFVLETLSKNCGDNVYQQIVERDILHEMVKIVKKKPDLNVREKILILIDTWQEAFGGPG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY+AAYNELK+ GVEFPPR+ENSVPLFTPP
Sbjct  121  GRYPQYYAAYNELKSVGVEFPPRDENSVPLFTPP  154



>ref|XP_002520270.1| protein transporter, putative [Ricinus communis]
 gb|EEF42056.1| protein transporter, putative [Ricinus communis]
Length=520

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AA+CAERATSDMLIGPDWA+NIELCD+IN++PGQAK+ALK+LKKRLG+KNPKIQLL
Sbjct  1    MANNAASCAERATSDMLIGPDWAINIELCDVINMDPGQAKEALKVLKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALF LET+SKNCGEN+F QI+ERDILHDMVKIVKKKPDLNVREKILILIDTWQEA GGPR
Sbjct  61   ALFALETVSKNCGENVFLQIIERDILHDMVKIVKKKPDLNVREKILILIDTWQEAFGGPR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            G++PQY+AAYNEL+A GVEFPPR ENSVPLFTPP
Sbjct  121  GKYPQYYAAYNELRAAGVEFPPRAENSVPLFTPP  154



>ref|XP_006472885.1| PREDICTED: target of Myb protein 1-like isoform X1 [Citrus sinensis]
 ref|XP_006472886.1| PREDICTED: target of Myb protein 1-like isoform X2 [Citrus sinensis]
Length=516

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERAT+DMLIGPDWA+NIELCD+IN++PGQAKDALKILKKRLG+KNPK+QLL
Sbjct  1    MANNAAACAERATNDMLIGPDWAINIELCDVINMDPGQAKDALKILKKRLGSKNPKVQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALF LET+SKNCG+++FQQI+ERDILH+MVKIVKKKPDLNVREKILILIDTWQEA GGPR
Sbjct  61   ALFALETISKNCGDSVFQQIIERDILHEMVKIVKKKPDLNVREKILILIDTWQEAFGGPR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY+AAYNEL++ GVEFPPR ENSVP FTPP
Sbjct  121  GRYPQYYAAYNELRSAGVEFPPRAENSVPFFTPP  154



>ref|XP_007019271.1| Target of Myb protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007019272.1| Target of Myb protein 1 isoform 1 [Theobroma cacao]
 gb|EOY16496.1| Target of Myb protein 1 isoform 1 [Theobroma cacao]
 gb|EOY16497.1| Target of Myb protein 1 isoform 1 [Theobroma cacao]
Length=521

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERATSDMLIGPDWAV +ELCD+IN++PGQAKDALK+LKKRLG+KNPKIQLL
Sbjct  1    MANNAAACAERATSDMLIGPDWAVTMELCDVINMDPGQAKDALKVLKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            +LFVL++LSKNCGE++FQQIVERDILH+MVKIVKKKPDLNVREKILILIDTWQEA GG R
Sbjct  61   SLFVLDSLSKNCGEHVFQQIVERDILHEMVKIVKKKPDLNVREKILILIDTWQEAFGGSR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY AAYNEL+A GVEFPPREENSVPLFTPP
Sbjct  121  GRYPQYFAAYNELRAAGVEFPPREENSVPLFTPP  154



>ref|XP_004502552.1| PREDICTED: ADP-ribosylation factor-binding protein GGA3-like 
isoform X1 [Cicer arietinum]
 ref|XP_004502553.1| PREDICTED: ADP-ribosylation factor-binding protein GGA3-like 
isoform X2 [Cicer arietinum]
Length=513

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERATSDMLIGPDWA+NIELCDIIN++P QAKDALKILKKRLG+KNPKIQLL
Sbjct  1    MANNAAACAERATSDMLIGPDWAINIELCDIINMDPRQAKDALKILKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALFVLETLSKNCGE++FQQI+ERDILH+MVKIVKKKPDL+VREKILILID WQEA GGP 
Sbjct  61   ALFVLETLSKNCGESVFQQIIERDILHEMVKIVKKKPDLSVREKILILIDAWQEAFGGPT  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            G FPQY+AAYNELKA GVEFPPREENSVP FTPP
Sbjct  121  GVFPQYYAAYNELKAAGVEFPPREENSVPFFTPP  154



>ref|XP_006434325.1| hypothetical protein CICLE_v10000887mg [Citrus clementina]
 gb|ESR47565.1| hypothetical protein CICLE_v10000887mg [Citrus clementina]
Length=516

 Score =   290 bits (741),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERAT+DMLIGPDWA+NIELCD+IN++PGQAKDALKILKKRLG+KNPK+QLL
Sbjct  1    MANNAAACAERATNDMLIGPDWAINIELCDVINMDPGQAKDALKILKKRLGSKNPKVQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALF LET+SKNCG+++FQQI+ERDILH+MVKIVKKKPDLNVREKILILIDTWQEA GGPR
Sbjct  61   ALFALETISKNCGDSVFQQIIERDILHEMVKIVKKKPDLNVREKILILIDTWQEAFGGPR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            G++PQY+AAYNEL++ GVEFPPR ENSVP FTPP
Sbjct  121  GKYPQYYAAYNELRSAGVEFPPRAENSVPFFTPP  154



>ref|XP_003523415.1| PREDICTED: TOM1-like protein 2-like isoform X1 [Glycine max]
 ref|XP_006578948.1| PREDICTED: TOM1-like protein 2-like isoform X2 [Glycine max]
 gb|KHN44282.1| TOM1-like protein 2 [Glycine soja]
Length=514

 Score =   290 bits (741),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERATSDMLIGPDWA+NIELCDIIN++PGQAKDALKILKKRL +KNPKIQLL
Sbjct  1    MANNAAACAERATSDMLIGPDWAINIELCDIINMDPGQAKDALKILKKRLASKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALFVLETLSKNCGE++FQQI+ERDILH+MVKIVKKKPDLNVREKILILIDTWQEA GGP 
Sbjct  61   ALFVLETLSKNCGESVFQQIIERDILHEMVKIVKKKPDLNVREKILILIDTWQEAFGGPT  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTP  788
            G +PQY+AAYNELK+ GVEFPPR+ENSVP FTP
Sbjct  121  GVYPQYYAAYNELKSAGVEFPPRDENSVPFFTP  153



>ref|XP_002300956.1| VHS domain-containing family protein [Populus trichocarpa]
 gb|EEE80229.1| VHS domain-containing family protein [Populus trichocarpa]
Length=520

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN AAACAERAT+DMLIGPDWAVNIELCDIIN++PGQAKDALKILKKRLG+KNPKIQLL
Sbjct  1    MANTAAACAERATNDMLIGPDWAVNIELCDIINMDPGQAKDALKILKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALF LETLSKNCG+++FQQI+ERDILHDMVKIVKKKPDLNVREKIL+LID WQEA  GPR
Sbjct  61   ALFALETLSKNCGDSVFQQIIERDILHDMVKIVKKKPDLNVREKILLLIDAWQEAFEGPR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQYHAAYNEL++ GVEFPPR ENSVP FTPP
Sbjct  121  GRYPQYHAAYNELRSAGVEFPPRAENSVPFFTPP  154



>ref|XP_011027423.1| PREDICTED: target of Myb protein 1 [Populus euphratica]
Length=520

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN AAACAERAT+DMLIGPDWAVNIELCDIIN++PGQAKDALKILKKRLG+KNPK QLL
Sbjct  1    MANTAAACAERATNDMLIGPDWAVNIELCDIINMDPGQAKDALKILKKRLGSKNPKTQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALF LETLSKNCG+++FQQI+ERDILHDMVKIVKKKPDLNVREKIL+LID WQEA GGPR
Sbjct  61   ALFALETLSKNCGDSVFQQIIERDILHDMVKIVKKKPDLNVREKILLLIDAWQEAFGGPR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY+AAYNEL++ GVEFPPR ENSVP FTPP
Sbjct  121  GRYPQYYAAYNELRSAGVEFPPRAENSVPFFTPP  154



>ref|XP_002307466.1| VHS domain-containing family protein [Populus trichocarpa]
 gb|EEE94462.1| VHS domain-containing family protein [Populus trichocarpa]
Length=493

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN AAACAERATSDMLIGPDWAVNIELCDIIN++P QAKDALKILKKRLG+KNPKIQLL
Sbjct  1    MANTAAACAERATSDMLIGPDWAVNIELCDIINMDPRQAKDALKILKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALF LETLSKNCG+++FQQI+ERDILHDMVKIVKKKPDLNVREKILILIDTWQEA GG R
Sbjct  61   ALFALETLSKNCGDSVFQQIIERDILHDMVKIVKKKPDLNVREKILILIDTWQEAFGGQR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY+AAYNEL+A GVEFPP+ ENSVP FTPP
Sbjct  121  GRYPQYYAAYNELRASGVEFPPQAENSVPFFTPP  154



>ref|XP_008447823.1| PREDICTED: TOM1-like protein 2 [Cucumis melo]
 ref|XP_008447824.1| PREDICTED: TOM1-like protein 2 [Cucumis melo]
Length=488

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MA++AAACAERAT+DMLIGPDWA+NIELCDIIN++PGQAK+ALKILKKRL NKNPKIQ+L
Sbjct  1    MASNAAACAERATNDMLIGPDWAINIELCDIINMDPGQAKEALKILKKRLTNKNPKIQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL VLETLSKNCGEN+FQQIVERDILHDMVKIVKKKPDL+VREKIL+LIDTWQEA GGPR
Sbjct  61   ALVVLETLSKNCGENVFQQIVERDILHDMVKIVKKKPDLSVREKILVLIDTWQEAFGGPR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQ +AAYNELK  GVEFPPREENSVP FTPP
Sbjct  121  GRYPQCYAAYNELKNAGVEFPPREENSVPFFTPP  154



>gb|KEH35378.1| ENTH/VHS/GAT family protein [Medicago truncatula]
Length=507

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERATSD+LIGPDWA+NIELCDIIN++P QAKDALKI+KKRLG+KNPKIQLL
Sbjct  1    MANNAAACAERATSDLLIGPDWAINIELCDIINMDPRQAKDALKIIKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALFVLETL+KNCGE++FQQI+ERDILH+MVKIVKK+PDL+VREKILILID WQEA GGP 
Sbjct  61   ALFVLETLTKNCGESVFQQIIERDILHEMVKIVKKRPDLSVREKILILIDAWQEAFGGPS  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            G FPQY+AAYNELKA GVEFPPREENSVP FTPP
Sbjct  121  GVFPQYYAAYNELKAAGVEFPPREENSVPFFTPP  154



>ref|XP_011006301.1| PREDICTED: target of Myb protein 1-like [Populus euphratica]
Length=517

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN AAACAERATSDMLIGPDWAVNIELCDIIN++P QAKDALKILKKRLG+KNPK QLL
Sbjct  1    MANTAAACAERATSDMLIGPDWAVNIELCDIINMDPRQAKDALKILKKRLGSKNPKTQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALF LETLSKNCG+++FQQI+ERDILHDMVKIVKKKPDLNVREKILILIDTWQEA GG R
Sbjct  61   ALFALETLSKNCGDSVFQQIIERDILHDMVKIVKKKPDLNVREKILILIDTWQEAFGGQR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY+AAYNEL+A GVEFPP+ ENSVP FTPP
Sbjct  121  GRYPQYYAAYNELRASGVEFPPQAENSVPFFTPP  154



>ref|XP_004139800.1| PREDICTED: TOM1-like protein 2 [Cucumis sativus]
 ref|XP_011658998.1| PREDICTED: TOM1-like protein 2 [Cucumis sativus]
 gb|KGN44196.1| hypothetical protein Csa_7G219810 [Cucumis sativus]
Length=490

 Score =   285 bits (729),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MA++AAACAERAT+DMLIGPDWA+NIELCDIIN++PGQAK+ALKILKKRL NKNPKIQ+L
Sbjct  1    MASNAAACAERATNDMLIGPDWAINIELCDIINMDPGQAKEALKILKKRLTNKNPKIQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL VLETLSKNCGEN+FQQI+ERDILHDMVKIVKKKPDL+VREKIL+LIDTWQEA GGPR
Sbjct  61   ALVVLETLSKNCGENVFQQIIERDILHDMVKIVKKKPDLSVREKILVLIDTWQEAFGGPR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQ +AAYNELK  GVEFPPREE+SVP FTPP
Sbjct  121  GRYPQCYAAYNELKNAGVEFPPREEHSVPFFTPP  154



>ref|XP_003526661.1| PREDICTED: TOM1-like protein 2-like [Glycine max]
Length=512

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 147/153 (96%), Gaps = 1/153 (1%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERATSDMLIGPDWA+NI+LCDIIN++PGQAKDALKILKKRLG+KNPKIQLL
Sbjct  1    MANNAAACAERATSDMLIGPDWAINIDLCDIINMDPGQAKDALKILKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALFVLETLSKNCGE++FQQIVERDILH+MVKIVKKKPDLNVREKILILIDTWQEA GG  
Sbjct  61   ALFVLETLSKNCGESVFQQIVERDILHEMVKIVKKKPDLNVREKILILIDTWQEAFGG-Y  119

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTP  788
            G +PQY+AAYNELK+ GVEFPPR+ENSVP FTP
Sbjct  120  GVYPQYYAAYNELKSAGVEFPPRDENSVPFFTP  152



>gb|KJB59348.1| hypothetical protein B456_009G250700 [Gossypium raimondii]
 gb|KJB59349.1| hypothetical protein B456_009G250700 [Gossypium raimondii]
Length=507

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MA+ AAACAERAT+DMLIGPDWA+NIELCDIIN++PGQAKDALKI+KKRLG+KNPKIQLL
Sbjct  1    MAHTAAACAERATNDMLIGPDWALNIELCDIINMDPGQAKDALKIIKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALFVL++LSKNCGE++FQQIVERDIL +MVKIVKKKPDLNVREKILILIDTWQEALGG  
Sbjct  61   ALFVLDSLSKNCGEHVFQQIVERDILREMVKIVKKKPDLNVREKILILIDTWQEALGGSS  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY AAYNEL+A GVEFPPREEN+VPLFTPP
Sbjct  121  GRYPQYFAAYNELQAAGVEFPPREENTVPLFTPP  154



>gb|KHG12036.1| Target of Myb 1 [Gossypium arboreum]
Length=508

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MA+ AAACAERAT+DMLIGPDWA+NIELCDIIN++PGQAKDALKI+KKRLG+KNPKIQLL
Sbjct  1    MAHTAAACAERATNDMLIGPDWALNIELCDIINMDPGQAKDALKIIKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALFVL++LSKNCGE++FQQIVERDIL +MVKIVKKKPDLNVREKILILIDTWQEALGG  
Sbjct  61   ALFVLDSLSKNCGEHVFQQIVERDILREMVKIVKKKPDLNVREKILILIDTWQEALGGSS  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY AAYNEL+A GVEFPPREEN+VPLFTPP
Sbjct  121  GRYPQYFAAYNELQAAGVEFPPREENTVPLFTPP  154



>gb|KHN46964.1| TOM1-like protein 2 [Glycine soja]
Length=512

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 147/153 (96%), Gaps = 1/153 (1%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERATSDMLIGPDWA+NI+LCDIIN++PGQAKDALKILKKRLG+KNPKIQLL
Sbjct  1    MANNAAACAERATSDMLIGPDWAINIDLCDIINMDPGQAKDALKILKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALFVLETLSKNCGE++FQQIVERDILH+MVKIVKKKPDLNVREKILILIDTWQEA GG  
Sbjct  61   ALFVLETLSKNCGESVFQQIVERDILHEMVKIVKKKPDLNVREKILILIDTWQEAFGG-Y  119

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTP  788
            G +PQY+AAYNELK+ GVEFPPR+ENSVP FTP
Sbjct  120  GVYPQYYAAYNELKSAGVEFPPRDENSVPFFTP  152



>ref|XP_011102017.1| PREDICTED: LOW QUALITY PROTEIN: ADP-ribosylation factor-binding 
protein GGA3 [Sesamum indicum]
Length=517

 Score =   280 bits (717),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +3

Query  366  TSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLSKNC  545
            TSDMLIGPDWAVNIELCDIIN+ PGQAKDALKILKK+LGNK+PKIQ+LALFVLETLSKNC
Sbjct  12   TSDMLIGPDWAVNIELCDIINMEPGQAKDALKILKKKLGNKSPKIQILALFVLETLSKNC  71

Query  546  GENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAAYNE  725
            GEN+FQQI ERDILH+MVKIVKKKPDLNVREKIL+LIDTWQEALGGPRGRFPQY+AAYNE
Sbjct  72   GENVFQQIAERDILHEMVKIVKKKPDLNVREKILVLIDTWQEALGGPRGRFPQYYAAYNE  131

Query  726  LKAFGVEFPPREENSVPLFTPP  791
            LKA G+EFPPREENSVPLFTPP
Sbjct  132  LKAAGIEFPPREENSVPLFTPP  153



>ref|XP_004290725.1| PREDICTED: target of Myb protein 1-like [Fragaria vesca subsp. 
vesca]
Length=526

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 143/152 (94%), Gaps = 1/152 (1%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MA  AA+CAERATSDMLIGPDWA+NIELCDIIN++PGQAKDALKILKKRLG+KNPKIQLL
Sbjct  1    MAGGAASCAERATSDMLIGPDWAINIELCDIINMDPGQAKDALKILKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALF LET+SKNCGE+IF+ IVERDILHDMVKIVKKKPDLNVREKILILIDTWQEA GG  
Sbjct  61   ALFALETVSKNCGESIFRHIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEAFGGSS  120

Query  690  G-RFPQYHAAYNELKAFGVEFPPREENSVPLF  782
            G RFPQY+AAYNEL++ GVEFPPREENSVPLF
Sbjct  121  GSRFPQYYAAYNELRSAGVEFPPREENSVPLF  152



>gb|AFK38032.1| unknown [Lotus japonicus]
Length=192

 Score =   267 bits (682),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAA  ERATSD L GPDWAVNIELCDIIN++P QAKDALKILKKRLG+K+PK QLL
Sbjct  1    MANNAAAFVERATSDALTGPDWAVNIELCDIINMDPRQAKDALKILKKRLGSKSPKTQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALFVLETLSKNCGEN+FQQI+ERDIL  MVKIVKKKPDLNVREKILILIDTWQEA GG  
Sbjct  61   ALFVLETLSKNCGENVFQQIIERDILKGMVKIVKKKPDLNVREKILILIDTWQEAFGGQS  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTP  788
            G FPQY+AAYNELK+ GVEFPPR E+SVPLFTP
Sbjct  121  GVFPQYYAAYNELKSAGVEFPPRGEDSVPLFTP  153



>ref|XP_010679291.1| PREDICTED: TOM1-like protein 2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679294.1| PREDICTED: TOM1-like protein 2 [Beta vulgaris subsp. vulgaris]
Length=529

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            M+N+ AA AERATSD+LIGPDWAVN+ELCDIIN++PGQAKD+LKI+KKRLGN++ K+QLL
Sbjct  1    MSNNGAAVAERATSDLLIGPDWAVNMELCDIINMDPGQAKDSLKIIKKRLGNRSSKVQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL VL+TL KNCGE IFQQIVERDILH+MVKIVKKKPDL VRE+ILILIDTWQEALGGPR
Sbjct  61   ALSVLDTLGKNCGERIFQQIVERDILHEMVKIVKKKPDLGVRERILILIDTWQEALGGPR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            G++PQ+HAAYNELK+ G+ FPPREENSVPLFTPP
Sbjct  121  GKYPQFHAAYNELKSAGISFPPREENSVPLFTPP  154



>ref|XP_010062194.1| PREDICTED: TOM1-like protein 2 [Eucalyptus grandis]
 ref|XP_010062195.1| PREDICTED: TOM1-like protein 2 [Eucalyptus grandis]
 gb|KCW69277.1| hypothetical protein EUGRSUZ_F02773 [Eucalyptus grandis]
Length=508

 Score =   274 bits (700),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+A ACAERATSD L GPDWA+N++LCDIIN++P Q+KDALK+LKKRL +K+PKIQ+L
Sbjct  1    MANNAVACAERATSDSLSGPDWAINMDLCDIINMDPRQSKDALKVLKKRLTSKHPKIQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALF LE LSKNCGEN+FQ IVERDILHDMVKIVKKKPDL+VREKILILIDTWQEALGGP 
Sbjct  61   ALFALEALSKNCGENVFQLIVERDILHDMVKIVKKKPDLSVREKILILIDTWQEALGGPG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY+AAYNEL+A GVEFPPREEN+VPLFTPP
Sbjct  121  GRYPQYYAAYNELRAAGVEFPPREENAVPLFTPP  154



>ref|XP_003541937.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase 
substrate-like isoform X1 [Glycine max]
Length=508

 Score =   274 bits (700),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 143/154 (93%), Gaps = 1/154 (1%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERATSDMLIGPDWA+NIELCDIIN++P QAKDA+KILKKRL +KNP+IQLL
Sbjct  1    MANNAAACAERATSDMLIGPDWAINIELCDIINMDPRQAKDAIKILKKRLSSKNPQIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            ALF LETLSKNCG+++FQQI+E+DILH+MVKIV KKPDL VREKILILIDTWQEA GGP 
Sbjct  61   ALFALETLSKNCGDSVFQQIIEQDILHEMVKIV-KKPDLRVREKILILIDTWQEAFGGPS  119

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            G++PQY AAYNELK+ GVEFPPREENS P FTPP
Sbjct  120  GKYPQYLAAYNELKSAGVEFPPREENSAPFFTPP  153



>gb|EYU32476.1| hypothetical protein MIMGU_mgv1a005006mg [Erythranthe guttata]
Length=501

 Score =   271 bits (693),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +3

Query  366  TSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLSKNC  545
            TSDMLIGPDWAVN+ELCD+IN++PGQ KDALKILKK+LGNK+PKIQLLALFVLETLSKNC
Sbjct  12   TSDMLIGPDWAVNLELCDMINMDPGQTKDALKILKKKLGNKSPKIQLLALFVLETLSKNC  71

Query  546  GENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAAYNE  725
            GEN+FQQIVERDILHDMVKIVKKKPDLNVREKIL+LIDTWQ A GG RG+FPQY+AAYNE
Sbjct  72   GENVFQQIVERDILHDMVKIVKKKPDLNVREKILVLIDTWQVAFGGARGKFPQYYAAYNE  131

Query  726  LKAFGVEFPPREENSVPLFTPP  791
            L++ GVEFPPREENSVP+FTPP
Sbjct  132  LRSAGVEFPPREENSVPIFTPP  153



>ref|XP_010112024.1| TOM1-like protein 2 [Morus notabilis]
 gb|EXC32443.1| TOM1-like protein 2 [Morus notabilis]
Length=513

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATSDMLIGPDWAVNIELCDIIN++PGQAKDALK LKKRL +KNPKIQLLALF LET+S
Sbjct  10   ERATSDMLIGPDWAVNIELCDIINMDPGQAKDALKTLKKRLASKNPKIQLLALFALETVS  69

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCGEN+FQ I+ERDILH+MVKIVKKKPDLNVREKILILIDTWQEA GGP GR+PQYHAA
Sbjct  70   KNCGENVFQLIIERDILHEMVKIVKKKPDLNVREKILILIDTWQEAFGGPTGRYPQYHAA  129

Query  717  YNELKAFGVEFPPREENSVPLF  782
            YNEL+A GVEFPPREENSVP F
Sbjct  130  YNELRAAGVEFPPREENSVPFF  151



>dbj|BAI66420.1| seed protein B32E [Triticum aestivum]
Length=576

 Score =   271 bits (692),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A ACAERATSDMLIGPDWAVNIELCDIIN++PGQAKDALK+LKKRLGNKN K+Q+LAL+V
Sbjct  4    AVACAERATSDMLIGPDWAVNIELCDIINMDPGQAKDALKLLKKRLGNKNSKVQILALYV  63

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LETLSKNCG+ ++QQI+ERDIL +MVKIVKKKPDLNVREKIL LIDTWQ A GGP GR+P
Sbjct  64   LETLSKNCGDIVYQQIIERDILSEMVKIVKKKPDLNVREKILSLIDTWQVAFGGPSGRYP  123

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QYH AY EL+A GV+FPPREEN+VPLFTPP
Sbjct  124  QYHTAYQELRAAGVDFPPREENTVPLFTPP  153



>dbj|BAJ89779.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99321.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=579

 Score =   270 bits (691),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A ACAERATSDMLIGPDWAVNIELCDIIN++PGQAKDALK+LKKRLGNKN K+Q+LAL+V
Sbjct  4    AVACAERATSDMLIGPDWAVNIELCDIINMDPGQAKDALKLLKKRLGNKNSKVQILALYV  63

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LETLSKNCG+ ++QQI+ERDIL +MVKIVKKKPDLNVREKIL LIDTWQ A GGP GR+P
Sbjct  64   LETLSKNCGDIVYQQIIERDILSEMVKIVKKKPDLNVREKILSLIDTWQVAFGGPSGRYP  123

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QYH AY EL+A GV+FPPREEN+VPLFTPP
Sbjct  124  QYHTAYQELRAAGVDFPPREENTVPLFTPP  153



>ref|XP_010270344.1| PREDICTED: TOM1-like protein 2 isoform X2 [Nelumbo nucifera]
 ref|XP_010270345.1| PREDICTED: TOM1-like protein 2 isoform X2 [Nelumbo nucifera]
Length=529

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAAC ERATSDMLIGPDWA+NIELCDIIN++PGQAKDALKILKKRLG+KNPKIQLL
Sbjct  1    MANNAAACVERATSDMLIGPDWAINIELCDIINMDPGQAKDALKILKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL VLE LSKNCG N+FQQIVERDILH+MVKIVKKKPDL+VREKILILID WQEA  GP 
Sbjct  61   ALLVLEMLSKNCGHNVFQQIVERDILHEMVKIVKKKPDLSVREKILILIDAWQEAFEGPG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY+AAYNELK+ GVEFPPREENSVPLFTPP
Sbjct  121  GRYPQYYAAYNELKSAGVEFPPREENSVPLFTPP  154



>ref|XP_010270342.1| PREDICTED: probable ADP-ribosylation factor-binding protein C25H2.16c 
isoform X1 [Nelumbo nucifera]
Length=551

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAAC ERATSDMLIGPDWA+NIELCDIIN++PGQAKDALKILKKRLG+KNPKIQLL
Sbjct  23   MANNAAACVERATSDMLIGPDWAINIELCDIINMDPGQAKDALKILKKRLGSKNPKIQLL  82

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL VLE LSKNCG N+FQQIVERDILH+MVKIVKKKPDL+VREKILILID WQEA  GP 
Sbjct  83   ALLVLEMLSKNCGHNVFQQIVERDILHEMVKIVKKKPDLSVREKILILIDAWQEAFEGPG  142

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY+AAYNELK+ GVEFPPREENSVPLFTPP
Sbjct  143  GRYPQYYAAYNELKSAGVEFPPREENSVPLFTPP  176



>ref|XP_009796996.1| PREDICTED: TOM1-like protein 2 [Nicotiana sylvestris]
 ref|XP_009797003.1| PREDICTED: TOM1-like protein 2 [Nicotiana sylvestris]
 ref|XP_009797011.1| PREDICTED: TOM1-like protein 2 [Nicotiana sylvestris]
 ref|XP_009797017.1| PREDICTED: TOM1-like protein 2 [Nicotiana sylvestris]
Length=144

 Score =   254 bits (650),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERATSDMLIGPDWA+NIELCDIIN+NPGQAKDALKI+KKRLG+KNPKIQLL
Sbjct  1    MANNAAACAERATSDMLIGPDWAINIELCDIINMNPGQAKDALKIIKKRLGSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
             LFVLETLSKNCGEN+FQQIVERDIL DMVKIVKKKPDLNVREKILILID+WQEALGGP 
Sbjct  61   TLFVLETLSKNCGENVFQQIVERDILKDMVKIVKKKPDLNVREKILILIDSWQEALGGPG  120

Query  690  GRFPQYHAAYNELKAF  737
            G+FPQY+AAYNELK  
Sbjct  121  GKFPQYYAAYNELKVI  136



>ref|XP_003577738.1| PREDICTED: TOM1-like protein 2 isoform X1 [Brachypodium distachyon]
Length=579

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A ACAERATSDMLIGPDWAVNIELCDIIN++PGQAKD LK+LKKRLGNKN K+Q+LAL+V
Sbjct  4    AVACAERATSDMLIGPDWAVNIELCDIINMDPGQAKDTLKLLKKRLGNKNSKVQILALYV  63

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LETLSKNCG+ ++QQI+ERDIL +MVKIVKKKPDLNVREKIL LIDTWQ A GGP GR+P
Sbjct  64   LETLSKNCGDVVYQQIIERDILSEMVKIVKKKPDLNVREKILSLIDTWQVAFGGPSGRYP  123

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QYH AY EL+  GV+FPPREEN+VPLFTPP
Sbjct  124  QYHTAYQELRTAGVDFPPREENTVPLFTPP  153



>gb|EPS66239.1| hypothetical protein M569_08540, partial [Genlisea aurea]
Length=486

 Score =   263 bits (672),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +3

Query  366  TSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLSKNC  545
            TSDMLIGPDW++NIELCD++N +PGQAKDALKILKK+LGNKNPK+QLLALFVLETLSKNC
Sbjct  12   TSDMLIGPDWSINIELCDVVNSDPGQAKDALKILKKKLGNKNPKVQLLALFVLETLSKNC  71

Query  546  GENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAAYNE  725
             E IFQQI ERDILHDMVKIVKKKPDL+VREKIL+LIDTWQEALGGP GRFPQY+AAY E
Sbjct  72   AEYIFQQITERDILHDMVKIVKKKPDLSVREKILVLIDTWQEALGGPSGRFPQYYAAYRE  131

Query  726  LKAFGVEFPPREENSVPLFTPP  791
            L + GV FPPR ENSVPLFTPP
Sbjct  132  LLSAGVNFPPRAENSVPLFTPP  153



>ref|XP_008799068.1| PREDICTED: target of Myb protein 1-like [Phoenix dactylifera]
Length=527

 Score =   264 bits (675),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +3

Query  366  TSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLSKNC  545
            TSDMLIGPDWAVNIELCDI+N++PGQAKDALKILKKRLG+KNPKIQLLALFVLET+SKNC
Sbjct  12   TSDMLIGPDWAVNIELCDILNMDPGQAKDALKILKKRLGSKNPKIQLLALFVLETVSKNC  71

Query  546  GENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAAYNE  725
            G+ I QQI ERDILH+MVK+VKKKPDLNVREKILILIDTWQ+A GG  GR+PQYHAAY E
Sbjct  72   GDYIHQQIAERDILHEMVKVVKKKPDLNVREKILILIDTWQDAFGGAGGRYPQYHAAYQE  131

Query  726  LKAFGVEFPPREENSVPLFTPP  791
            L+A+GVEFPPR ENS PLFTPP
Sbjct  132  LRAYGVEFPPRTENSAPLFTPP  153



>gb|KHG20885.1| TOM1-like protein 2 [Gossypium arboreum]
Length=482

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN AAACAERAT DMLIGPDWAVNIELCDIIN +P QAKDALK+LKK+LGNKNPK+QLL
Sbjct  1    MANSAAACAERATHDMLIGPDWAVNIELCDIINTDPRQAKDALKVLKKQLGNKNPKVQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL VL++LSKNCGE++FQQIVE DIL++MVKIV KKPDLNVREK+L  IDTWQ A GGP 
Sbjct  61   ALNVLDSLSKNCGEHVFQQIVECDILNEMVKIVMKKPDLNVREKVLTFIDTWQVAFGGPG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY AAY EL+  GV FPPRE+NSVPLFTPP
Sbjct  121  GRYPQYFAAYKELRVAGVAFPPREKNSVPLFTPP  154



>gb|KJB59968.1| hypothetical protein B456_009G284400 [Gossypium raimondii]
Length=518

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN AAACAERAT DMLIGPDWAVNIELCDIIN +P QAKDALK+LKK+LGNKNPK+QLL
Sbjct  1    MANSAAACAERATHDMLIGPDWAVNIELCDIINTDPRQAKDALKVLKKQLGNKNPKVQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL VL++LSKNCGE++FQQIVE DIL++MVKIV KKPDLNVREK+L  IDTWQ A GGP 
Sbjct  61   ALNVLDSLSKNCGEHVFQQIVECDILNEMVKIVTKKPDLNVREKVLTFIDTWQVAFGGPG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY AAY EL+  GV FPPRE+NSVPLFTPP
Sbjct  121  GRYPQYFAAYKELRVAGVAFPPREKNSVPLFTPP  154



>ref|XP_006662807.1| PREDICTED: TOM1-like protein 2-like [Oryza brachyantha]
Length=590

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A ACAERAT+DMLIGPDWAVNIELCDIIN++PGQAKD LK+LKKRLGNKN K+Q+L L+V
Sbjct  4    AVACAERATNDMLIGPDWAVNIELCDIINMDPGQAKDTLKLLKKRLGNKNLKVQILTLYV  63

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LETLSKNCG+ ++QQI+ERDIL +MVKIVKKKPDLNVREKIL LIDTWQ A GGP GR+P
Sbjct  64   LETLSKNCGDVVYQQIIERDILSEMVKIVKKKPDLNVREKILSLIDTWQVAFGGPSGRYP  123

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QYHAAY EL+  GV+FPPREEN+VPLFTPP
Sbjct  124  QYHAAYQELRNAGVDFPPREENTVPLFTPP  153



>ref|XP_010539704.1| PREDICTED: TOM1-like protein 2 [Tarenaya hassleriana]
 ref|XP_010539706.1| PREDICTED: TOM1-like protein 2 [Tarenaya hassleriana]
Length=484

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+ A+CAERAT+DMLIGPDWA+NIELCDIIN++P QAK+ALK+LKKRLG+KNPK+QLL
Sbjct  1    MANNGASCAERATNDMLIGPDWAINIELCDIINMDPSQAKEALKVLKKRLGSKNPKVQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LET+SKNCGEN++Q I++RDILHDMVKIVKKKPDLNV+EKIL L+D WQEA GG  
Sbjct  61   ALYALETVSKNCGENVYQLIIDRDILHDMVKIVKKKPDLNVKEKILGLLDAWQEAFGGRG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY+ AYNEL++ GV+FPPR E+S+P FTPP
Sbjct  121  GRYPQYYNAYNELRSAGVDFPPRAESSIPFFTPP  154



>ref|XP_009401114.1| PREDICTED: target of Myb protein 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401115.1| PREDICTED: target of Myb protein 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401116.1| PREDICTED: target of Myb protein 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401117.1| PREDICTED: target of Myb protein 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=516

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            AAA A+RATSD LIGPDWA+NIELCDIIN++PGQ KDALKILKKRLG+KNPKIQLLALFV
Sbjct  4    AAAFADRATSDALIGPDWAINIELCDIINMDPGQGKDALKILKKRLGSKNPKIQLLALFV  63

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LETLSKNCG+N+ QQIV+RDILH+MVKIVKKKPDLNVREKIL+LIDTWQEA GG  G++ 
Sbjct  64   LETLSKNCGDNVHQQIVKRDILHEMVKIVKKKPDLNVREKILVLIDTWQEAFGGAGGKYT  123

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTP  788
            QYHAAY EL+A GVEFPPR EN+  +FTP
Sbjct  124  QYHAAYQELRATGVEFPPRTENTAAIFTP  152



>ref|NP_001067438.1| Os11g0199700 [Oryza sativa Japonica Group]
 gb|ABA91945.2| VHS domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27801.1| Os11g0199700 [Oryza sativa Japonica Group]
 dbj|BAG93654.1| unnamed protein product [Oryza sativa Japonica Group]
Length=588

 Score =   264 bits (675),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A ACAERATSDMLIGPDWAVNIELCDIIN++PGQAKD LK+LKKRLGNKN K+Q+L L+V
Sbjct  4    AVACAERATSDMLIGPDWAVNIELCDIINMDPGQAKDTLKLLKKRLGNKNSKVQILTLYV  63

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LETLSKNCG+ ++QQI+ERDIL +MVKIVKKKPDLNVREKIL LIDTWQ A GG  GR+P
Sbjct  64   LETLSKNCGDVVYQQIIERDILSEMVKIVKKKPDLNVREKILSLIDTWQVAFGGASGRYP  123

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QYHAAY EL+  GV+FPPREEN+VPLFTPP
Sbjct  124  QYHAAYQELRNAGVDFPPREENTVPLFTPP  153



>ref|XP_004978930.1| PREDICTED: TOM1-like protein 2-like [Setaria italica]
Length=583

 Score =   264 bits (674),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A ACAERAT+DMLIGPDWAVNIELCDIIN++PGQAKD +K+LKKRLG+KN K+Q+L L+V
Sbjct  4    AVACAERATNDMLIGPDWAVNIELCDIINMDPGQAKDTIKLLKKRLGSKNSKVQILTLYV  63

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LETLSKNCG+ + Q IVERDIL +MVKIVKKKPDLNVREKIL LIDTWQ A GGP GR+P
Sbjct  64   LETLSKNCGDVVHQLIVERDILSEMVKIVKKKPDLNVREKILSLIDTWQVAFGGPSGRYP  123

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QYHAAY EL+A GV+FPPREENSVPLFTPP
Sbjct  124  QYHAAYQELRAAGVDFPPREENSVPLFTPP  153



>ref|XP_010912582.1| PREDICTED: target of Myb protein 1-like [Elaeis guineensis]
Length=526

 Score =   262 bits (669),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +3

Query  366  TSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLSKNC  545
            TSDMLIGPDWA+NIELCDI+N +PGQAKDALKILKKRLG+KNPKIQLLALFVLETLSKNC
Sbjct  12   TSDMLIGPDWAINIELCDILNADPGQAKDALKILKKRLGSKNPKIQLLALFVLETLSKNC  71

Query  546  GENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAAYNE  725
            G+ I QQI ERDILH+MVK+VKKKPDLNVREKILILIDTWQ+A GG  GRFPQYHAAY E
Sbjct  72   GDYIHQQIAERDILHEMVKVVKKKPDLNVREKILILIDTWQDAFGGAGGRFPQYHAAYQE  131

Query  726  LKAFGVEFPPREENSVPLFTPP  791
            L+A GVEFPPR EN+ PLFTPP
Sbjct  132  LRAAGVEFPPRTENTAPLFTPP  153



>ref|XP_009421173.1| PREDICTED: target of Myb protein 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009421174.1| PREDICTED: target of Myb protein 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009421175.1| PREDICTED: target of Myb protein 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009421176.1| PREDICTED: target of Myb protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=518

 Score =   262 bits (669),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +3

Query  366  TSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLSKNC  545
            TSDMLIGPDWA+NIELCDII+++PGQAKDALK+LKKRLG+KNPK+QLLALFVLETLSKNC
Sbjct  12   TSDMLIGPDWAINIELCDIISMDPGQAKDALKVLKKRLGSKNPKVQLLALFVLETLSKNC  71

Query  546  GENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAAYNE  725
            G+N+ QQIVERDILH+MVKIVKKKPDLNVREKIL+LID WQ+A GG  GR+PQYHAAY E
Sbjct  72   GDNVHQQIVERDILHEMVKIVKKKPDLNVREKILVLIDAWQDAFGGSGGRYPQYHAAYQE  131

Query  726  LKAFGVEFPPREENSVPLFTPP  791
            L+A GVEFPPR EN+ PLFTPP
Sbjct  132  LRAAGVEFPPRTENTSPLFTPP  153



>ref|XP_002893160.1| VHS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69419.1| VHS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERAT+DMLIGPDWA+NIELCDIIN+ P QAK+A+K+LKKRLG+KN K+Q+L
Sbjct  1    MANNAAACAERATNDMLIGPDWAINIELCDIINMEPSQAKEAVKVLKKRLGSKNSKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LETLSKNCGE+++Q IV+RDIL DMVKIVKKKPDL VREKIL L+DTWQEA GG  
Sbjct  61   ALYALETLSKNCGESVYQLIVDRDILPDMVKIVKKKPDLTVREKILSLLDTWQEAFGGSG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQY+ AYNEL++ GVEFPPR E+SVP FTPP
Sbjct  121  GRFPQYYNAYNELRSAGVEFPPRTESSVPFFTPP  154



>ref|XP_006304594.1| hypothetical protein CARUB_v10011646mg [Capsella rubella]
 gb|EOA37492.1| hypothetical protein CARUB_v10011646mg [Capsella rubella]
Length=506

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERAT+DMLIGPDWA+NIELCDIIN+ P QAK+A+K+LKKRLG+KN K+Q+L
Sbjct  1    MANNAAACAERATNDMLIGPDWAINIELCDIINMEPSQAKEAVKVLKKRLGSKNSKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LETLSKNCGE+++Q IV+RDIL DMVKIVKKKPDL+VREKIL L+DTWQEA GG  
Sbjct  61   ALYALETLSKNCGESVYQLIVDRDILPDMVKIVKKKPDLSVREKILSLLDTWQEAFGGSG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQY+ AYNEL++ G+EFPPR E+SVP FTPP
Sbjct  121  GRFPQYYNAYNELRSAGIEFPPRTESSVPFFTPP  154



>ref|XP_006416309.1| hypothetical protein EUTSA_v10007405mg [Eutrema salsugineum]
 gb|ESQ34662.1| hypothetical protein EUTSA_v10007405mg [Eutrema salsugineum]
Length=508

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERAT+DMLIGPDWA+NIELCDIIN++P QAK+A+K+LKKRLG+KN K+Q+L
Sbjct  1    MANNAAACAERATNDMLIGPDWAINIELCDIINMDPSQAKEAVKVLKKRLGSKNSKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LETLSKNCGE+++Q IV+RDIL DMVKIVKKKPDL+VREKIL L+DTWQEA GG  
Sbjct  61   ALYALETLSKNCGESVYQLIVDRDILPDMVKIVKKKPDLSVREKILSLLDTWQEAFGGSG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQY+ AYNEL++ G+EFPPR E+SVP FTPP
Sbjct  121  GRFPQYYNAYNELRSAGIEFPPRTESSVPFFTPP  154



>ref|XP_009149655.1| PREDICTED: TOM1-like protein 2 [Brassica rapa]
Length=496

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERAT+DMLIGPDWA+NIELCDIIN++P QAK+A+K+LKKRL +KN K+Q+L
Sbjct  1    MANNAAACAERATNDMLIGPDWAINIELCDIINMDPSQAKEAVKVLKKRLASKNSKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LETLSKNCGE+++Q IVER+IL DMVKIVKKKPDL+VREKIL L+DTWQEA GG  
Sbjct  61   ALYALETLSKNCGESVYQLIVEREILPDMVKIVKKKPDLSVREKILSLLDTWQEAFGGSG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQY+ AYNEL++ G+EFPPR E+SVP FTPP
Sbjct  121  GRFPQYYNAYNELRSAGIEFPPRTESSVPFFTPP  154



>emb|CDY50235.1| BnaA06g15120D [Brassica napus]
Length=496

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERAT+DMLIGPDWA+NIELCDIIN++P QAK+A+K+LKKRL +KN K+Q+L
Sbjct  1    MANNAAACAERATNDMLIGPDWAINIELCDIINMDPSQAKEAVKVLKKRLASKNSKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LETLSKNCGE+++Q IVER+IL DMVKIVKKKPDL+VREKIL L+DTWQEA GG  
Sbjct  61   ALYALETLSKNCGESVYQLIVEREILPDMVKIVKKKPDLSVREKILSLLDTWQEAFGGSG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQY+ AYNEL++ G+EFPPR E+SVP FTPP
Sbjct  121  GRFPQYYNAYNELRSAGIEFPPRTESSVPFFTPP  154



>ref|XP_006593776.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase 
substrate-like isoform X2 [Glycine max]
 ref|XP_006593777.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase 
substrate-like isoform X3 [Glycine max]
Length=530

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 143/176 (81%), Gaps = 23/176 (13%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPG----------------------Q  443
            MAN+AAACAERATSDMLIGPDWA+NIELCDIIN++P                       Q
Sbjct  1    MANNAAACAERATSDMLIGPDWAINIELCDIINMDPRICFIYLLRNDQETSCLIGHVFWQ  60

Query  444  AKDALKILKKRLGNKNPKIQLLALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPD  623
            AKDA+KILKKRL +KNP+IQLLALF LETLSKNCG+++FQQI+E+DILH+MVKIVKK PD
Sbjct  61   AKDAIKILKKRLSSKNPQIQLLALFALETLSKNCGDSVFQQIIEQDILHEMVKIVKK-PD  119

Query  624  LNVREKILILIDTWQEALGGPRGRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            L VREKILILIDTWQEA GGP G++PQY AAYNELK+ GVEFPPREENS P FTPP
Sbjct  120  LRVREKILILIDTWQEAFGGPSGKYPQYLAAYNELKSAGVEFPPREENSAPFFTPP  175



>ref|NP_564138.1| Target of Myb protein 1 [Arabidopsis thaliana]
 gb|AAF87893.1|AC015447_3 Unknown protein [Arabidopsis thaliana]
 gb|AAK59479.1| unknown protein [Arabidopsis thaliana]
 gb|AAL34154.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30096.1| Target of Myb protein 1 [Arabidopsis thaliana]
Length=506

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERAT+DMLIGPDWA+NIELCDIIN+ P QAK+A+K+LKKRLG+KN K+Q+L
Sbjct  1    MANNAAACAERATNDMLIGPDWAINIELCDIINMEPSQAKEAVKVLKKRLGSKNSKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LETLSKNCGE+++Q IV+RDIL DMVKIVKKKPDL VREKIL L+DTWQEA GG  
Sbjct  61   ALYALETLSKNCGESVYQLIVDRDILPDMVKIVKKKPDLTVREKILSLLDTWQEAFGGSG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQY+ AYNEL++ G+EFPPR E+SVP FTPP
Sbjct  121  GRFPQYYNAYNELRSAGIEFPPRTESSVPFFTPP  154



>gb|EEC67842.1| hypothetical protein OsI_35454 [Oryza sativa Indica Group]
Length=627

 Score =   262 bits (670),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A ACAERATSDMLIGPDWAVNIELCDIIN++PGQAK+ LK+LKKRLGNKN K+Q+L L+V
Sbjct  4    AVACAERATSDMLIGPDWAVNIELCDIINMDPGQAKETLKLLKKRLGNKNSKVQILTLYV  63

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LETLSKNCG+ ++QQI+ERDIL +MVKIVKKKPDLNVREKIL LIDTWQ A GG  GR+P
Sbjct  64   LETLSKNCGDVVYQQIIERDILSEMVKIVKKKPDLNVREKILSLIDTWQVAFGGASGRYP  123

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QYHAAY EL+  GV+FPPREEN+VPLFTPP
Sbjct  124  QYHAAYQELRNAGVDFPPREENTVPLFTPP  153



>ref|XP_006301355.1| hypothetical protein CARUB_v10021765mg [Capsella rubella]
 gb|EOA34253.1| hypothetical protein CARUB_v10021765mg [Capsella rubella]
Length=471

 Score =   258 bits (659),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MANDAAACAERAT+DMLIGPDWA+NIELCDIIN++P QAK+A+K+LKKRLG+KN K+Q+L
Sbjct  1    MANDAAACAERATNDMLIGPDWAINIELCDIINMDPSQAKEAVKVLKKRLGSKNSKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LETLSKNCGEN++Q I++RDIL DMVKIVKKKPDLNVREKIL L+DTWQEA GG  
Sbjct  61   ALYALETLSKNCGENVYQLIIDRDILIDMVKIVKKKPDLNVREKILSLLDTWQEAFGGRG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY+ AYNEL++ G+EFPPR E+S+  FTPP
Sbjct  121  GRYPQYYNAYNELRSAGIEFPPRTESSLSFFTPP  154



>emb|CDY61061.1| BnaA07g37280D [Brassica napus]
Length=478

 Score =   258 bits (659),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+ AACAERAT+DMLIGPDWA+NIELCDIIN++P QAK+A+K+LKKRLG+KN K+Q+L
Sbjct  1    MANNGAACAERATNDMLIGPDWAINIELCDIINLDPSQAKEAVKVLKKRLGSKNSKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LETLSKNCGE++FQ IV+R IL DMVKIVKKKPDL+VREKIL L+DTWQEA GG  
Sbjct  61   ALYALETLSKNCGESVFQLIVDRGILPDMVKIVKKKPDLSVREKILSLLDTWQEAFGGSG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQY+ AYNEL++ GVEFPPR E+SVP FTPP
Sbjct  121  GRFPQYYNAYNELRSAGVEFPPRTESSVPFFTPP  154



>ref|XP_009103295.1| PREDICTED: TOM1-like protein 2 [Brassica rapa]
Length=479

 Score =   258 bits (658),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+ AACAERAT+DMLIGPDWA+NIELCDIIN++P QAK+A+K+LKKRLG+KN K+Q+L
Sbjct  1    MANNGAACAERATNDMLIGPDWAINIELCDIINLDPSQAKEAVKVLKKRLGSKNSKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LETLSKNCGE++FQ IV+R IL DMVKIVKKKPDL+VREKIL L+DTWQEA GG  
Sbjct  61   ALYALETLSKNCGESVFQLIVDRGILPDMVKIVKKKPDLSVREKILSLLDTWQEAFGGSG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQY+ AYNEL++ GVEFPPR E+SVP FTPP
Sbjct  121  GRFPQYYNAYNELRSAGVEFPPRTESSVPFFTPP  154



>emb|CDX87552.1| BnaA07g33210D [Brassica napus]
Length=444

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MANDAAACAERAT+DMLIGPDWA+NIELCDIIN+NP QAK+A+K+LKKRLGNKN K+Q+L
Sbjct  1    MANDAAACAERATNDMLIGPDWAINIELCDIINMNPSQAKEAVKVLKKRLGNKNSKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            +L+ LETLSKNCGEN+ + I++R++L DMVKIVKKKP+LNVREKIL L+DTWQEA GG  
Sbjct  61   SLYALETLSKNCGENVCKLIIDRNVLTDMVKIVKKKPELNVREKILSLLDTWQEAFGGRG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            G++PQY+ AYNELKA G+EFPPR E+S+  FTPP
Sbjct  121  GQYPQYYNAYNELKAAGIEFPPRTESSMSFFTPP  154



>ref|XP_002450494.1| hypothetical protein SORBIDRAFT_05g006160 [Sorghum bicolor]
 gb|EES09482.1| hypothetical protein SORBIDRAFT_05g006160 [Sorghum bicolor]
Length=582

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A ACAERAT+DMLIGPDWAVNIELCDIIN++PGQAKD LK+LKKRLG+KN K+Q+L L+V
Sbjct  4    AVACAERATNDMLIGPDWAVNIELCDIINMDPGQAKDTLKLLKKRLGSKNSKVQILTLYV  63

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LETLSKNCG+ + QQIVERDIL +MVKIVKKKPDLNVREKIL LIDTWQ A GGP G++ 
Sbjct  64   LETLSKNCGDIVHQQIVERDILSEMVKIVKKKPDLNVREKILSLIDTWQVAFGGPSGKYK  123

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QYH AY EL+A GV+FPPREENSVPLFTPP
Sbjct  124  QYHVAYQELRAAGVDFPPREENSVPLFTPP  153



>emb|CDX88333.1| BnaC06g37770D [Brassica napus]
Length=447

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MANDAAACAERAT+DMLIGPDWA+NIELCDIIN+NP QAK+A+K+LKKRLG+KN K+Q+L
Sbjct  1    MANDAAACAERATNDMLIGPDWAINIELCDIINMNPSQAKEAVKVLKKRLGSKNSKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LETLSKNCGEN+ + I++R++L DMVKIVKKKP+LNVREKIL L+DTWQEA GG  
Sbjct  61   ALYALETLSKNCGENVCKLIIDRNVLTDMVKIVKKKPELNVREKILSLLDTWQEAFGGSN  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            G++PQY+ AYNEL+A G+EFPPR E+S+  FTPP
Sbjct  121  GQYPQYYNAYNELRATGIEFPPRTESSMSFFTPP  154



>emb|CDY00376.1| BnaC07g14500D [Brassica napus]
Length=488

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERAT+DMLIGPDWA+NIELCDIIN++P QAK+A+K+LKKRL +KN K+Q+L
Sbjct  1    MANNAAACAERATNDMLIGPDWAINIELCDIINLDPSQAKEAVKVLKKRLASKNSKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LETLSKNCGE++FQ IV+R IL DMVKIVKKKPDL+VREKIL L+DTWQEA GG  
Sbjct  61   ALYALETLSKNCGESVFQLIVDRGILPDMVKIVKKKPDLSVREKILSLLDTWQEAFGGSG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQY+ AYNEL++ GVEFPPR E+SVP FTPP
Sbjct  121  GRFPQYYNAYNELRSAGVEFPPRTESSVPFFTPP  154



>ref|XP_002889114.1| VHS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65373.1| VHS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=436

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MANDAAACAERAT+DMLIGPDWA+NIELCDIIN++P QAK+A+K+LKKRLG+KN K+Q+L
Sbjct  1    MANDAAACAERATNDMLIGPDWAINIELCDIINMDPSQAKEAVKVLKKRLGSKNSKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LETLSKNCGEN++Q  ++RDIL DMVK+VKKKPDLNVREKIL L+DTWQEA GG  
Sbjct  61   ALYALETLSKNCGENVYQLFIDRDILIDMVKLVKKKPDLNVREKILSLLDTWQEAFGGRG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY+ AYN+L++ G+EFPPR E+S+  FTPP
Sbjct  121  GRYPQYYNAYNDLRSAGIEFPPRTESSLSFFTPP  154



>ref|XP_010477399.1| PREDICTED: target of Myb protein 1-like [Camelina sativa]
 ref|XP_010477401.1| PREDICTED: target of Myb protein 1-like [Camelina sativa]
Length=513

 Score =   256 bits (655),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERAT+DMLIGPDWA+NIELCDIIN++P Q K+A+K+LKKRLG+KN K+Q+L
Sbjct  1    MANNAAACAERATNDMLIGPDWAINIELCDIINMDPSQTKEAVKVLKKRLGSKNSKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LETLSKNCGE++ Q IV+RDIL DMVKIVKKKPDL VREKIL L+DTWQEA GG  
Sbjct  61   ALYALETLSKNCGESVCQLIVDRDILPDMVKIVKKKPDLAVREKILSLLDTWQEAFGGSG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQY+ AYNEL++ G+EFPPR E+SVP FTPP
Sbjct  121  GRFPQYYNAYNELRSAGIEFPPRTESSVPFFTPP  154



>ref|NP_177823.2| Target of Myb protein 1 [Arabidopsis thaliana]
 gb|AAQ62873.1| At1g76970 [Arabidopsis thaliana]
 dbj|BAD94203.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35914.1| Target of Myb protein 1 [Arabidopsis thaliana]
Length=446

 Score =   254 bits (650),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MANDAAACAERAT+DMLIGPDWA+NIELCD+IN++P QAK+A+K+LKKRLG+KN K+Q+L
Sbjct  1    MANDAAACAERATNDMLIGPDWAINIELCDLINMDPSQAKEAVKVLKKRLGSKNSKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LETLSKNCGEN++Q I++R +L+DMVKIVKKKP+LNVREKIL L+DTWQEA GG  
Sbjct  61   ALYALETLSKNCGENVYQLIIDRGLLNDMVKIVKKKPELNVREKILTLLDTWQEAFGGRG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY+ AYN+L++ G+EFPPR E+S+  FTPP
Sbjct  121  GRYPQYYNAYNDLRSAGIEFPPRTESSLSFFTPP  154



>ref|XP_010459845.1| PREDICTED: TOM1-like protein 2 [Camelina sativa]
 ref|XP_010459846.1| PREDICTED: TOM1-like protein 2 [Camelina sativa]
 ref|XP_010459847.1| PREDICTED: TOM1-like protein 2 [Camelina sativa]
 ref|XP_010459848.1| PREDICTED: TOM1-like protein 2 [Camelina sativa]
Length=508

 Score =   256 bits (653),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERAT+DMLIGPDWA+NIELCDIIN++P Q K+A+K+LKKRLG+KN K+Q+L
Sbjct  1    MANNAAACAERATNDMLIGPDWAINIELCDIINMDPSQTKEAVKVLKKRLGSKNSKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LETLSKNCGE++ Q IV+RDIL DMVKIVKKKPDL VREKIL L+DTWQEA GG  
Sbjct  61   ALYALETLSKNCGESVCQLIVDRDILPDMVKIVKKKPDLAVREKILSLLDTWQEAFGGSG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQY+ AYNEL++ G+EFPPR E+SVP FTPP
Sbjct  121  GRFPQYYNAYNELRSAGIEFPPRTESSVPFFTPP  154



>ref|XP_009106360.1| PREDICTED: TOM1-like protein 2 [Brassica rapa]
 ref|XP_009106361.1| PREDICTED: TOM1-like protein 2 [Brassica rapa]
Length=444

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MANDAAACAERAT+DMLIGPDWA+NIELCDIIN+NP QAK+A+K+LKKRLGNKN K+Q+L
Sbjct  1    MANDAAACAERATNDMLIGPDWAINIELCDIINMNPSQAKEAVKVLKKRLGNKNSKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            +L+ LETLSKNCGEN+ + I++R++L DMVKIVKKKP+LNVREKIL L+DTWQEA GG  
Sbjct  61   SLYALETLSKNCGENVCKLIIDRNVLTDMVKIVKKKPELNVREKILSLLDTWQEAFGGRG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            G++PQY+ AYNEL+A G+EFPPR E+++  FTPP
Sbjct  121  GQYPQYYNAYNELRAAGIEFPPRTESNMSFFTPP  154



>ref|XP_010498591.1| PREDICTED: TOM1-like protein 2 [Camelina sativa]
 ref|XP_010498592.1| PREDICTED: TOM1-like protein 2 [Camelina sativa]
Length=506

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERAT+DMLIGPDWA+NIELCDIIN++P Q K+A+K+LKKRLG+KN K+Q+L
Sbjct  1    MANNAAACAERATNDMLIGPDWAINIELCDIINMDPSQTKEAVKVLKKRLGSKNSKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LETLSKNCGE++ Q IV+RDIL DMVKIVKKKPDL VREKIL L+DTWQEA GG  
Sbjct  61   ALYALETLSKNCGESVCQLIVDRDILPDMVKIVKKKPDLAVREKILSLLDTWQEAFGGSG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQY+ AYNEL++ G EFPPR E+SVP FTPP
Sbjct  121  GRFPQYYHAYNELRSAGFEFPPRTESSVPFFTPP  154



>gb|ACR38743.1| unknown [Zea mays]
 gb|AFW60669.1| putative VHS/GAT domain containing family protein [Zea mays]
Length=584

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A ACAERAT+DMLIGPDWAVNIELCDIIN++PGQAKD LK+LKKRL +KN K+Q+L L+V
Sbjct  4    AVACAERATNDMLIGPDWAVNIELCDIINMDPGQAKDTLKLLKKRLASKNTKVQILTLYV  63

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LETLSKNCG+ + QQIVERDIL +MVKIVKKKPDL+VREKIL LIDTWQ A GGP G++ 
Sbjct  64   LETLSKNCGDIVHQQIVERDILSEMVKIVKKKPDLSVREKILSLIDTWQVAFGGPSGKYR  123

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QYHAAY EL+A GV+FPPREENSVPLFTPP
Sbjct  124  QYHAAYQELRAAGVDFPPREENSVPLFTPP  153



>emb|CDY04626.1| BnaC05g16640D [Brassica napus]
Length=497

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERAT+DMLIGPDWA+NIELCDIIN++P QAK+A+K+LKKRL +KN K+Q+L
Sbjct  1    MANNAAACAERATNDMLIGPDWAINIELCDIINMDPSQAKEAVKVLKKRLASKNSKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LETLSKNCGE ++Q IVERDIL DMVKIVKKKPDL+VREKIL L+DTWQEA  G  
Sbjct  61   ALYALETLSKNCGECVYQLIVERDILPDMVKIVKKKPDLSVREKILSLLDTWQEAFSGSG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQY+ AYNEL++ G+EFPPR E+SV  FTPP
Sbjct  121  GRFPQYYNAYNELRSAGIEFPPRTESSVSFFTPP  154



>ref|NP_001148113.1| LOC100281721 [Zea mays]
 gb|ACG29770.1| VHS and GAT domain protein [Zea mays]
Length=584

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A ACAERAT+DMLIGPDWAVNIELCDIIN++PGQAKD LK+LKKRL +KN K+Q+L L+V
Sbjct  4    AVACAERATNDMLIGPDWAVNIELCDIINMDPGQAKDTLKLLKKRLASKNSKVQILTLYV  63

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LETLSKNCG+ + QQIVERDIL +MVKIVKKKPDL+VREKIL LIDTWQ A GGP G++ 
Sbjct  64   LETLSKNCGDIVHQQIVERDILSEMVKIVKKKPDLSVREKILSLIDTWQVAFGGPSGKYR  123

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QYHAAY EL+A GV+FPPREENSVPLFTPP
Sbjct  124  QYHAAYQELRAAGVDFPPREENSVPLFTPP  153



>gb|AFW60668.1| putative VHS/GAT domain containing family protein [Zea mays]
Length=585

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A ACAERAT+DMLIGPDWAVNIELCDIIN++PGQAKD LK+LKKRL +KN K+Q+L L+V
Sbjct  4    AVACAERATNDMLIGPDWAVNIELCDIINMDPGQAKDTLKLLKKRLASKNTKVQILTLYV  63

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LETLSKNCG+ + QQIVERDIL +MVKIVKKKPDL+VREKIL LIDTWQ A GGP G++ 
Sbjct  64   LETLSKNCGDIVHQQIVERDILSEMVKIVKKKPDLSVREKILSLIDTWQVAFGGPSGKYR  123

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QYHAAY EL+A GV+FPPREENSVPLFTPP
Sbjct  124  QYHAAYQELRAAGVDFPPREENSVPLFTPP  153



>ref|XP_009404857.1| PREDICTED: target of Myb protein 1 [Musa acuminata subsp. malaccensis]
Length=514

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +3

Query  366  TSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLSKNC  545
            TSDMLIGPDWA+NIELCDIIN++PGQAKDALK+LKKRLG+KNPKIQLLALFVLETLSKNC
Sbjct  12   TSDMLIGPDWAINIELCDIINMDPGQAKDALKVLKKRLGSKNPKIQLLALFVLETLSKNC  71

Query  546  GENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAAYNE  725
            G+NI  QIVERDILH+MVKIVKKKPDLNVREKILILID WQ+A G   G+ PQY+AAY E
Sbjct  72   GDNIHHQIVERDILHEMVKIVKKKPDLNVREKILILIDAWQDAFGRAGGKHPQYYAAYQE  131

Query  726  LKAFGVEFPPREENSVPLFTPP  791
            L+A GVEFPPR EN+VPLFTPP
Sbjct  132  LRAAGVEFPPRTENTVPLFTPP  153



>ref|XP_010525669.1| PREDICTED: TOM1-like protein 2 isoform X1 [Tarenaya hassleriana]
 ref|XP_010525670.1| PREDICTED: TOM1-like protein 2 isoform X1 [Tarenaya hassleriana]
Length=499

 Score =   253 bits (647),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN    CAERAT+DMLIGPDWA+NIELCDIIN++P QAK+ALK+LKK+LG++NPK+QLL
Sbjct  1    MANTGEVCAERATNDMLIGPDWAINIELCDIINMDPSQAKEALKVLKKQLGSRNPKVQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LETLSKNCGEN++Q I++ DILH+MVKIVKKKPDLNV+EKIL L+DTWQ+A GG R
Sbjct  61   ALYALETLSKNCGENVYQLIIDGDILHEMVKIVKKKPDLNVKEKILSLLDTWQDAFGGIR  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GR+PQY+ AYNEL + GV+FPPR E+SVP FTPP
Sbjct  121  GRYPQYYNAYNELISAGVDFPPRTESSVPFFTPP  154



>gb|EMS53515.1| TOM1-like protein 2 [Triticum urartu]
Length=603

 Score =   256 bits (654),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 139/177 (79%), Gaps = 27/177 (15%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A ACAERATSDMLIGPDWAVNIELCDIIN++PGQAKDALK+LKKRLGNKN K+Q+LAL+V
Sbjct  4    AVACAERATSDMLIGPDWAVNIELCDIINMDPGQAKDALKLLKKRLGNKNSKVQILALYV  63

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKK---------------------------P  620
            LETLSKNCG+ ++QQI+ERDIL +MVKIVKKK                           P
Sbjct  64   LETLSKNCGDIVYQQIIERDILSEMVKIVKKKVAILIEWLTIVFLDSSPSVLILYLSLQP  123

Query  621  DLNVREKILILIDTWQEALGGPRGRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            DLNVREKIL LIDTWQ A GGP GR+PQYH AY EL+A GV+FPPREEN+VPLFTPP
Sbjct  124  DLNVREKILSLIDTWQVAFGGPSGRYPQYHTAYQELRAAGVDFPPREENTVPLFTPP  180



>ref|XP_006390135.1| hypothetical protein EUTSA_v10019577mg [Eutrema salsugineum]
 gb|ESQ27421.1| hypothetical protein EUTSA_v10019577mg [Eutrema salsugineum]
Length=465

 Score =   252 bits (644),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACA RAT+DMLIGPDWA+NIELCDIIN++P QAK+A+K+LKKRLG+KNPK+Q+L
Sbjct  1    MANEAAACAGRATNDMLIGPDWAINIELCDIINMDPSQAKEAVKLLKKRLGSKNPKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LETLSKNCGEN+++ I++RDIL DMVKIVKKKPDLNVREK+L L+DTWQEA GG  
Sbjct  61   ALYALETLSKNCGENVYKLIIDRDILIDMVKIVKKKPDLNVREKVLSLLDTWQEAFGGSG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            G++PQY+ AYNEL++ G+EFPPR E+S+  FTPP
Sbjct  121  GQYPQYYNAYNELRSAGIEFPPRTESSLSFFTPP  154



>emb|CDY65111.1| BnaUnng01020D [Brassica napus]
Length=488

 Score =   251 bits (641),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 138/154 (90%), Gaps = 3/154 (2%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAN+AAACAERAT+DMLIGPDWA+NIELCDIIN++P QAK+A+K+LKKRL +KN K+Q+L
Sbjct  1    MANNAAACAERATNDMLIGPDWAINIELCDIINLDPSQAKEAVKVLKKRLASKNSKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL+ LETLSKNCGE+++Q IV+RDIL DMVKIVKKKPDL+VREKIL L+DTWQEA G   
Sbjct  61   ALYALETLSKNCGESVYQLIVDRDILPDMVKIVKKKPDLSVREKILSLLDTWQEAFG---  117

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            GRFPQY  AYNEL++ G+EFPPR E+SVP FTPP
Sbjct  118  GRFPQYKNAYNELRSAGIEFPPRTESSVPFFTPP  151



>gb|EMT28552.1| TOM1-like protein 2 [Aegilops tauschii]
Length=649

 Score =   254 bits (650),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 138/177 (78%), Gaps = 27/177 (15%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A  CAERATSDMLIGPDWAVNIELCDIIN++PGQAKDALK+LKKRLGNKN K+Q+LAL+V
Sbjct  4    AVVCAERATSDMLIGPDWAVNIELCDIINMDPGQAKDALKLLKKRLGNKNSKVQILALYV  63

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKK---------------------------P  620
            LETLSKNCG+ ++QQI+ERDIL +MVKIVKKK                           P
Sbjct  64   LETLSKNCGDIVYQQIIERDILSEMVKIVKKKVAILIQWLTIVFPDSSDSVLILYLSLQP  123

Query  621  DLNVREKILILIDTWQEALGGPRGRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            DLNVREKIL LIDTWQ A GGP GR+PQYH AY EL+A GV+FPPREEN+VPLFTPP
Sbjct  124  DLNVREKILSLIDTWQVAFGGPSGRYPQYHTAYQELRAAGVDFPPREENTVPLFTPP  180



>gb|KCW71188.1| hypothetical protein EUGRSUZ_F04281 [Eucalyptus grandis]
Length=494

 Score =   250 bits (639),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +3

Query  339  DAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALF  518
            DA  CAERATSD+LIGPDW +NIELCDIIN++PG+AK+ +KILKKRLGNK+PKIQLL L+
Sbjct  2    DAVDCAERATSDLLIGPDWGINIELCDIINMDPGKAKEVMKILKKRLGNKDPKIQLLTLY  61

Query  519  VLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRF  698
            VLETLSKNCG ++FQ I+E DIL +MV++V KKPD +V EK+L LID+WQEALGGPRGR+
Sbjct  62   VLETLSKNCGNSVFQNIIESDILQEMVRMVFKKPDFDVMEKLLTLIDSWQEALGGPRGRY  121

Query  699  PQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            PQY++AYNEL   GV FPPREE SVP FTPP
Sbjct  122  PQYYSAYNELMTAGVRFPPREEKSVPFFTPP  152



>gb|KCW71189.1| hypothetical protein EUGRSUZ_F04281 [Eucalyptus grandis]
 gb|KCW71190.1| hypothetical protein EUGRSUZ_F04281 [Eucalyptus grandis]
Length=493

 Score =   250 bits (639),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +3

Query  339  DAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALF  518
            DA  CAERATSD+LIGPDW +NIELCDIIN++PG+AK+ +KILKKRLGNK+PKIQLL L+
Sbjct  2    DAVDCAERATSDLLIGPDWGINIELCDIINMDPGKAKEVMKILKKRLGNKDPKIQLLTLY  61

Query  519  VLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRF  698
            VLETLSKNCG ++FQ I+E DIL +MV++V KKPD +V EK+L LID+WQEALGGPRGR+
Sbjct  62   VLETLSKNCGNSVFQNIIESDILQEMVRMVFKKPDFDVMEKLLTLIDSWQEALGGPRGRY  121

Query  699  PQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            PQY++AYNEL   GV FPPREE SVP FTPP
Sbjct  122  PQYYSAYNELMTAGVRFPPREEKSVPFFTPP  152



>ref|NP_001182882.1| putative VHS/GAT domain containing family protein [Zea mays]
 gb|ACR35011.1| unknown [Zea mays]
 tpg|DAA41920.1| TPA: putative VHS/GAT domain containing family protein [Zea mays]
Length=582

 Score =   253 bits (645),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A ACAE+AT+DMLIGPDWA+NIELCDIINI+PG+AKD LK+LKKRLG++N K+Q+L L+V
Sbjct  4    AVACAEKATNDMLIGPDWAINIELCDIINIDPGEAKDTLKLLKKRLGSENSKVQILTLYV  63

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LETLSKNCG+ + QQIVERDIL +M+KIVKKKPDLNVREKIL LIDTWQ   GGP G++ 
Sbjct  64   LETLSKNCGDIVHQQIVERDILSEMIKIVKKKPDLNVREKILSLIDTWQVVFGGPSGKYR  123

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QYHAAY EL+A GV+FPPREENS+PLFTPP
Sbjct  124  QYHAAYEELRAAGVDFPPREENSLPLFTPP  153



>ref|XP_010063905.1| PREDICTED: LOW QUALITY PROTEIN: target of Myb protein 1 [Eucalyptus 
grandis]
Length=503

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +3

Query  339  DAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALF  518
            DA  CAERATSD+LIGPDW +NIELCDIIN++PG+AK+ +KILKKRLGNK+PKIQLL L+
Sbjct  2    DAVDCAERATSDLLIGPDWGINIELCDIINMDPGKAKEVMKILKKRLGNKDPKIQLLTLY  61

Query  519  VLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRF  698
            VLETLSKNCG ++FQ I+E DIL +MV++V KKPD +V EK+L LID+WQEALGGPRGR+
Sbjct  62   VLETLSKNCGNSVFQNIIESDILQEMVRMVFKKPDFDVMEKLLTLIDSWQEALGGPRGRY  121

Query  699  PQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            PQY++AYNEL   GV FPPREE SVP FTPP
Sbjct  122  PQYYSAYNELMTAGVRFPPREEKSVPFFTPP  152



>ref|XP_006855126.1| PREDICTED: TOM1-like protein 2 [Amborella trichopoda]
 gb|ERN16593.1| hypothetical protein AMTR_s00031p00234160 [Amborella trichopoda]
Length=541

 Score =   243 bits (621),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            AA+  ERATSDMLIGPDW +NIE+CDIIN++PGQ KDA+K +KKRLG+KNPKIQLL L V
Sbjct  2    AASLVERATSDMLIGPDWGMNIEICDIINMDPGQTKDAMKTVKKRLGSKNPKIQLLVLTV  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LET++KNCG+++  QI+ERDILH+MVKIVKKKPDLNVREKIL+L+D WQEA GGP G++P
Sbjct  62   LETMTKNCGDSVLVQIIERDILHEMVKIVKKKPDLNVREKILVLLDAWQEAFGGPSGKYP  121

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTP  788
            Q++AAY ELK  GVE+PPR  N+ PLFTP
Sbjct  122  QFYAAYQELKNAGVEYPPRMANAGPLFTP  150



>ref|XP_010537308.1| PREDICTED: TOM1-like protein 2 isoform X2 [Tarenaya hassleriana]
 ref|XP_010537309.1| PREDICTED: TOM1-like protein 2 isoform X2 [Tarenaya hassleriana]
Length=469

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = +3

Query  330  MAND-AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQL  506
            MAN+ AA+CAERAT+ ML+GPDW +NIELCDIIN++P QAK+ALK+LKKRLG+KNPK+QL
Sbjct  1    MANNGAASCAERATNGMLVGPDWTINIELCDIINMDPSQAKEALKVLKKRLGSKNPKVQL  60

Query  507  LALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGP  686
            LAL+ LETLSKNCGEN+++ I++R ILHDM KIVKKKPDLNV+EKIL L+DTWQEA  G 
Sbjct  61   LALYALETLSKNCGENVYKLIIDRGILHDMAKIVKKKPDLNVKEKILSLLDTWQEAFSGR  120

Query  687  RGRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
             GR+PQY+ +YNEL++ G  F PR E+SV  FT P
Sbjct  121  EGRYPQYYNSYNELRSAGFGFLPRTESSVSFFTQP  155



>ref|XP_010537307.1| PREDICTED: target of Myb protein 1-like isoform X1 [Tarenaya 
hassleriana]
Length=509

 Score =   235 bits (599),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = +3

Query  330  MAND-AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQL  506
            MAN+ AA+CAERAT+ ML+GPDW +NIELCDIIN++P QAK+ALK+LKKRLG+KNPK+QL
Sbjct  41   MANNGAASCAERATNGMLVGPDWTINIELCDIINMDPSQAKEALKVLKKRLGSKNPKVQL  100

Query  507  LALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGP  686
            LAL+ LETLSKNCGEN+++ I++R ILHDM KIVKKKPDLNV+EKIL L+DTWQEA  G 
Sbjct  101  LALYALETLSKNCGENVYKLIIDRGILHDMAKIVKKKPDLNVKEKILSLLDTWQEAFSGR  160

Query  687  RGRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
             GR+PQY+ +YNEL++ G  F PR E+SV  FT P
Sbjct  161  EGRYPQYYNSYNELRSAGFGFLPRTESSVSFFTQP  195



>emb|CDX68071.1| BnaA07g21110D [Brassica napus]
Length=244

 Score =   222 bits (565),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MAND AA AERAT+DML  PDW  NIELCDI N+NP QAK A+ +LKK+LG+  PK+Q+L
Sbjct  19   MANDTAAWAERATNDMLTDPDWDSNIELCDI-NMNPSQAKKAMMVLKKQLGSTKPKVQIL  77

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL  LE+LSKNCGEN++Q IV+ DIL DMVKIVK+KPDLNVREK+L L+D WQEA GG  
Sbjct  78   ALHALESLSKNCGENVYQLIVDYDILVDMVKIVKEKPDLNVREKVLSLLDMWQEAFGGRG  137

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            G++ QY+ AYNEL++ G+EFPPR ++S PLFTPP
Sbjct  138  GQYSQYYNAYNELRSAGIEFPPRTQSSPPLFTPP  171



>ref|XP_010925873.1| PREDICTED: target of Myb protein 1-like isoform X1 [Elaeis guineensis]
Length=684

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            AA+  ERATSDMLIGPDWA+N+E+CDI+N +PGQAKDA+K LKKR+G+KNPKIQLLAL +
Sbjct  2    AASLVERATSDMLIGPDWAMNLEICDILNHDPGQAKDAVKALKKRIGHKNPKIQLLALTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LET+ KNCG+ +   + E+DILH+MVKIVK+KPD +V+EKILILIDTWQEA GGPR R+P
Sbjct  62   LETVIKNCGDIVHMHVAEKDILHEMVKIVKRKPDFHVKEKILILIDTWQEAFGGPRARYP  121

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QY+AAY EL   G  FP R E S P+FTPP
Sbjct  122  QYYAAYQELLRAGAVFPQRSERSTPIFTPP  151



>ref|XP_010048112.1| PREDICTED: target of Myb protein 1-like [Eucalyptus grandis]
 gb|KCW80246.1| hypothetical protein EUGRSUZ_C01589 [Eucalyptus grandis]
Length=668

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERAT+DMLIGPDWA+NIE+CDI+N +PGQAKD +K +KKRLG+KNPK+QLLAL +LE
Sbjct  4    SMVERATTDMLIGPDWAMNIEICDILNHDPGQAKDVVKGIKKRLGSKNPKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + ERD+LH+MVKIVKKKPD++V+EKILILIDTWQEA GGPR R+PQY
Sbjct  64   TIIKNCGDIVHMHVAERDVLHEMVKIVKKKPDIHVKEKILILIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FP R E S P+FTPP
Sbjct  124  YAAYQELLRAGAVFPQRAEGSAPVFTPP  151



>ref|XP_002284083.2| PREDICTED: target of Myb protein 1 [Vitis vinifera]
 emb|CBI20881.3| unnamed protein product [Vitis vinifera]
Length=691

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+NIE+CD++N +PGQAKD +K +KKR+G+KNPK+QLLAL +LE
Sbjct  4    SMVERATSDMLIGPDWAMNIEICDMLNHDPGQAKDVVKGIKKRIGSKNPKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + ERDILH+MVKIVKKKPDL+VREKILILIDTWQEA GGPR R+PQY
Sbjct  64   TVVKNCGDIVHMHVAERDILHEMVKIVKKKPDLHVREKILILIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FP R E + P+FTPP
Sbjct  124  YAAYQELLRAGAVFPQRSERTAPVFTPP  151



>ref|XP_008800580.1| PREDICTED: target of Myb protein 1-like isoform X1 [Phoenix dactylifera]
Length=685

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            AA+  ERATSD+LIGPDWA+N+E+CDI+N +PGQAKDA+K +KKR+G+KNPKIQLLAL +
Sbjct  2    AASLVERATSDVLIGPDWAMNLEICDILNHDPGQAKDAVKTIKKRIGHKNPKIQLLALTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LET+ KNCG+ +   + E+DILH+MVKIVK+KPD +V+E+ILILIDTWQEA GGPR R+P
Sbjct  62   LETVIKNCGDIVHMHVAEKDILHEMVKIVKRKPDFHVKERILILIDTWQEAFGGPRARYP  121

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QY+AAY EL   G  FP R E S P+FTPP
Sbjct  122  QYYAAYQELLRAGAVFPRRPERSAPIFTPP  151



>ref|XP_008775805.1| PREDICTED: TOM1-like protein 1 isoform X1 [Phoenix dactylifera]
Length=681

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            AA+  ERATSDMLIGPDWA+N+E+CDI+N +P Q KDA+K LKKR+G+KNPKIQLLAL +
Sbjct  2    AASLVERATSDMLIGPDWAMNLEICDILNRDPVQVKDAIKALKKRIGHKNPKIQLLALTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LET+ KNCG+ +   + E+DILH+MVKIVK+KPD +V+EKILILIDTWQEA GGPR R+P
Sbjct  62   LETVIKNCGDIVHMHVAEKDILHEMVKIVKRKPDFHVKEKILILIDTWQEAFGGPRARYP  121

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QY+AAY EL   G  FP R E S P+FTPP
Sbjct  122  QYYAAYQELLRAGAVFPQRPERSAPIFTPP  151



>gb|AFW70949.1| putative VHS/GAT domain containing family protein [Zea mays]
Length=212

 Score =   211 bits (536),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            ++A  ERATSDMLIGPDWA+N+E+CDI+N  PGQAKD +K LKKR+ +KNPK+QLLAL +
Sbjct  2    SSAMVERATSDMLIGPDWAMNLEICDILNREPGQAKDVVKSLKKRIAHKNPKVQLLALTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LET+ KNCG+ +   + ERDILH+MVKIVKK+ D +V+EKIL LIDTWQE  GG R R+P
Sbjct  62   LETMIKNCGDVVHMVVAERDILHEMVKIVKKRHDYHVKEKILTLIDTWQEVFGGARARYP  121

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QY+AAY EL   GV FP R   SVP+ TPP
Sbjct  122  QYYAAYEELLRAGVVFPQRLNGSVPIITPP  151



>emb|CDX79179.1| BnaC06g21240D [Brassica napus]
Length=340

 Score =   215 bits (547),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            M NDA   AERAT DML GPDW  NIELCDIIN++P QAK+A+ +LKK+LG++NPK+Q+L
Sbjct  1    MPNDAGTWAERATDDMLTGPDWDSNIELCDIINMDPSQAKEAVMVLKKQLGSENPKVQIL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL  LE+LSKNCGEN+ + IV+ ++L DMV IVK+KP LNVREK+L L+D WQEA GG  
Sbjct  61   ALHALESLSKNCGENVDKLIVDCELLIDMVNIVKEKPGLNVREKMLNLLDIWQEAFGGRG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            G++ QY+ AYNEL++ G+EFPPR ++S PLFTPP
Sbjct  121  GQYSQYYNAYNELRSAGIEFPPRTQSSPPLFTPP  154



>ref|XP_007161403.1| hypothetical protein PHAVU_001G065700g [Phaseolus vulgaris]
 gb|ESW33397.1| hypothetical protein PHAVU_001G065700g [Phaseolus vulgaris]
Length=480

 Score =   219 bits (557),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  438  GQAKDALKILKKRLGNKNPKIQLLALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKK  617
            GQAKDA+KILKK+L +KNPKIQLLALF LETLSKNCG+++FQQI+ERDIL DMVKIVKKK
Sbjct  6    GQAKDAIKILKKQLSSKNPKIQLLALFALETLSKNCGDSVFQQIIERDILRDMVKIVKKK  65

Query  618  PDLNVREKILILIDTWQEALGGPRGRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            PDL+VREKIL LIDTWQEA GGP GR+PQYHAAYNELK+ GVEFPPREENSVP FTPP
Sbjct  66   PDLSVREKILTLIDTWQEAFGGPNGRYPQYHAAYNELKSAGVEFPPREENSVPFFTPP  123



>ref|XP_009389963.1| PREDICTED: target of Myb protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=693

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 126/151 (83%), Gaps = 1/151 (1%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A A  +RATSDMLIGPDWA+N+E+CDI+N +PGQAKD +K+LKKR+G+KN K+QLLAL +
Sbjct  2    AGALVDRATSDMLIGPDWAMNLEICDILNHDPGQAKDVVKVLKKRIGHKNSKVQLLALTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKK-PDLNVREKILILIDTWQEALGGPRGRF  698
            LET+ KNCG+ +   + E+DILH+MVKIVKKK PDL+V+EKILILIDTWQEA GGPR R+
Sbjct  62   LETVIKNCGDIVHMHVAEKDILHEMVKIVKKKQPDLHVKEKILILIDTWQEAFGGPRARY  121

Query  699  PQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            PQY+AAY EL   G  FP R E+S P+FTPP
Sbjct  122  PQYYAAYQELLRAGAVFPQRSESSAPIFTPP  152



>ref|XP_008441590.1| PREDICTED: target of Myb protein 1 isoform X2 [Cucumis melo]
Length=485

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            M+ +AAACAERAT+D+LI PDWA+NIELCDIIN++P QAKDALKILKKRL +KNPKIQLL
Sbjct  1    MSTNAAACAERATNDVLIAPDWAINIELCDIINMDPRQAKDALKILKKRLTSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEAL-GGP  686
            AL+ LE LSKNCG+ +F+ IV+R+ILH+MVKIVKKKPD  VREKIL L+D WQ A  GG 
Sbjct  61   ALYALEALSKNCGDTVFKLIVDRNILHEMVKIVKKKPDSTVREKILALVDAWQAAFGGGS  120

Query  687  RGRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            +G++PQY+AAYN+LK  G +FPPREEN    F+PP
Sbjct  121  KGKYPQYYAAYNDLKNAGFQFPPREENVEQFFSPP  155



>ref|XP_010915838.1| PREDICTED: TOM1-like protein 1 isoform X2 [Elaeis guineensis]
Length=680

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            AA+  ERATSD+LIGPDWA+N+E+CDI+N + GQ KDA+K LKKR+G+KNPKIQLLAL +
Sbjct  2    AASLVERATSDVLIGPDWAMNLEICDILNRDSGQVKDAIKALKKRIGHKNPKIQLLALTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LET+ KNCG+ +   + E+DILH+MVKIVK+KPD +V+EKIL+LIDTWQEA GGPR R+P
Sbjct  62   LETVIKNCGDIVHMHVAEKDILHEMVKIVKRKPDFHVKEKILVLIDTWQEAFGGPRARYP  121

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QY+AAY EL   G  FP R E S P+FTPP
Sbjct  122  QYYAAYQELLRAGAVFPQRPERSAPIFTPP  151



>ref|XP_003544671.1| PREDICTED: TOM1-like protein 2-like [Glycine max]
 gb|KHN13671.1| Target of Myb protein 1 [Glycine soja]
Length=672

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+NIE+CD++N +PGQAKD +K +KKR+G+KN K+QLLAL +LE
Sbjct  4    SMVERATSDMLIGPDWAMNIEICDMLNHDPGQAKDVVKGIKKRIGSKNSKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + ERD+LH+MVKIVKKKPD +V+EKILILIDTWQEA GGPR R+PQY
Sbjct  64   TIIKNCGDIVHMHVAERDVLHEMVKIVKKKPDFHVKEKILILIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FP R E S P+FTPP
Sbjct  124  YAAYQELLRAGAVFPQRSEQSAPVFTPP  151



>ref|XP_009104642.1| PREDICTED: LOW QUALITY PROTEIN: target of Myb protein 1-like 
[Brassica rapa]
Length=306

 Score =   211 bits (538),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 1/143 (1%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MANDAAA AERAT+DML  PDW  NIELCDI N+NP QAK+A+ +LKK+LGN NPK+Q+L
Sbjct  1    MANDAAAWAERATNDMLTDPDWDSNIELCDI-NMNPSQAKEAMMVLKKQLGNTNPKVQIL  59

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL  LE+LSKNCGEN++Q IV+ DIL DMVKIVK+KPDLNVREK+L L+D WQEA GG  
Sbjct  60   ALHALESLSKNCGENVYQLIVDYDILIDMVKIVKEKPDLNVREKVLSLLDMWQEAFGGRG  119

Query  690  GRFPQYHAAYNELKAFGVEFPPR  758
            G++ QY+ AYNEL+  G+EFPPR
Sbjct  120  GQYSQYYNAYNELRYAGIEFPPR  142



>ref|NP_001237269.1| VHS and GAT domain protein [Glycine max]
 gb|ABB90835.1| VHS and GAT domain protein [Glycine max]
 gb|KHN31566.1| Target of Myb protein 1 [Glycine soja]
Length=672

 Score =   220 bits (560),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+NIE+CD++N +PGQAKD +K +KKR+G+KN K+QLLAL +LE
Sbjct  4    SMVERATSDMLIGPDWAMNIEICDMLNHDPGQAKDVVKGIKKRIGSKNSKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + ERD+LH+MVKIVKKKPD +V+EKIL+L+DTWQEA GGPR R+PQY
Sbjct  64   TIIKNCGDIVHMHVAERDVLHEMVKIVKKKPDFHVKEKILVLVDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FP R E S P+FTPP
Sbjct  124  YAAYQELLRAGAVFPQRSEQSAPVFTPP  151



>gb|KJB07514.1| hypothetical protein B456_001G027900 [Gossypium raimondii]
Length=471

 Score =   216 bits (549),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSD+LIGPDWA NIE+CD++N +PGQAKD +K +KK+LG+KNPK+QLLAL +LE
Sbjct  4    SMVERATSDLLIGPDWARNIEICDMLNHDPGQAKDVVKGIKKKLGSKNPKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + ERD+LH+MV+IVKKKPD NV+EKIL LIDTWQEA GG R R+PQY
Sbjct  64   TIIKNCGDIVHMHVAERDVLHEMVRIVKKKPDFNVKEKILTLIDTWQEAFGGARARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            + AY EL   G  FPPR E S P+ TPP
Sbjct  124  YVAYQELLRLGAVFPPRSERSAPVLTPP  151



>ref|XP_004144251.2| PREDICTED: TOM1-like protein 2 isoform X2 [Cucumis sativus]
Length=486

 Score =   216 bits (549),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = +3

Query  327  NMANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQL  506
            NM+ +AAACAERAT+D+LI PDWA+NIELCDIIN++P QAKDALKILKKRL +KNPKIQL
Sbjct  2    NMSTNAAACAERATNDVLIAPDWAINIELCDIINMDPRQAKDALKILKKRLTSKNPKIQL  61

Query  507  LALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEAL-GG  683
            LAL+ LE LSKNCG+ +F+ IV+R+ILH+MVKIVKKKPD  VREKIL L+D WQ A  GG
Sbjct  62   LALYALEALSKNCGDTVFKLIVDRNILHEMVKIVKKKPDSTVREKILALVDAWQAAFGGG  121

Query  684  PRGRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
              G++PQY+ AYN+LK  G  FPPREEN    F+PP
Sbjct  122  SEGKYPQYYVAYNDLKNAGFRFPPREENVEQFFSPP  157



>gb|KEH40293.1| ENTH/VHS/GAT family protein [Medicago truncatula]
Length=674

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+NIE+CD++N +PGQAKD +K +KKR+G++N K+QLLAL +LE
Sbjct  4    SMVERATSDMLIGPDWAMNIEICDMLNHDPGQAKDVVKGIKKRIGSRNSKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + ERD+LH+MVKIVKKKPD +V+EKIL+L+DTWQEA GGPR R+PQY
Sbjct  64   TIIKNCGDIVHMHVAERDVLHEMVKIVKKKPDFHVKEKILLLVDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FP R E S P+FTPP
Sbjct  124  YAAYQELLRAGAVFPQRSEQSAPVFTPP  151



>ref|XP_004498477.1| PREDICTED: TOM1-like protein 1-like [Cicer arietinum]
Length=662

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+NIE+CD++N +PGQAK+ +K +KKR+G++N K+QLLAL +LE
Sbjct  4    SMVERATSDMLIGPDWAMNIEICDMLNHDPGQAKEVVKGIKKRIGSRNSKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + ERD+LH+MVKIVKKKPD +V+EKILILIDTWQEA GGPR R+PQY
Sbjct  64   TIIKNCGDIVHMHVAERDVLHEMVKIVKKKPDFHVKEKILILIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FP R E S P+FTPP
Sbjct  124  YAAYQELLRAGAVFPQRSEQSAPVFTPP  151



>gb|KHG12147.1| TOM1-like protein 2 [Gossypium arboreum]
Length=678

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSD+LIGPDWA NIE+CD++N +PGQAKD +K +KK+LG+KNPK+QLLAL +LE
Sbjct  4    SMVERATSDLLIGPDWARNIEICDMLNHDPGQAKDVVKGIKKKLGSKNPKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + ERD+LH+MV+IVKKKPD NV+EKILILIDTWQEA GG R R+PQY
Sbjct  64   TIIKNCGDIVHMHVAERDVLHEMVRIVKKKPDFNVKEKILILIDTWQEAFGGARARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            + AY EL   G  FPPR E S P+ TPP
Sbjct  124  YVAYQELLRLGAVFPPRSERSAPVLTPP  151



>ref|XP_010264484.1| PREDICTED: TOM1-like protein 2 isoform X1 [Nelumbo nucifera]
Length=625

 Score =   217 bits (553),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            M++ A    E+ATSD+LIGPDW +N+E+CD IN + GQAKD +K+LKKRL NKNPK+QLL
Sbjct  1    MSSSATVRVEKATSDLLIGPDWTMNMEICDSINSSYGQAKDVIKVLKKRLQNKNPKVQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL +LET+ KNCG+N+  QI ER+IL +MVKIVKK+ D+NVR+KIL+L+D+WQEA GGP 
Sbjct  61   ALTLLETIIKNCGDNVHFQIAERNILQEMVKIVKKQMDMNVRDKILVLLDSWQEAFGGPG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            G++PQY+ AY EL+  GVEFP R  ++ P+FTPP
Sbjct  121  GKYPQYYWAYEELRRSGVEFPQRSSDAAPIFTPP  154



>ref|XP_012077432.1| PREDICTED: TOM1-like protein 2 [Jatropha curcas]
 gb|KDP34202.1| hypothetical protein JCGZ_07773 [Jatropha curcas]
Length=682

 Score =   217 bits (553),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+NIE+CDI N +P QAKD +K +KKR+G+KN K+QLLAL +LE
Sbjct  4    SMVERATSDMLIGPDWAMNIEICDICNHDPAQAKDVVKGIKKRIGSKNSKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+D+LHDMVKIVKKKPD +V+EKIL LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDIVHMHVAEKDLLHDMVKIVKKKPDFHVKEKILTLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FP R E S P+FTPP
Sbjct  124  YAAYQELLRAGAVFPQRSERSAPVFTPP  151



>gb|KJB07512.1| hypothetical protein B456_001G027900 [Gossypium raimondii]
Length=678

 Score =   217 bits (553),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSD+LIGPDWA NIE+CD++N +PGQAKD +K +KK+LG+KNPK+QLLAL +LE
Sbjct  4    SMVERATSDLLIGPDWARNIEICDMLNHDPGQAKDVVKGIKKKLGSKNPKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + ERD+LH+MV+IVKKKPD NV+EKIL LIDTWQEA GG R R+PQY
Sbjct  64   TIIKNCGDIVHMHVAERDVLHEMVRIVKKKPDFNVKEKILTLIDTWQEAFGGARARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            + AY EL   G  FPPR E S P+ TPP
Sbjct  124  YVAYQELLRLGAVFPPRSERSAPVLTPP  151



>gb|KJB07516.1| hypothetical protein B456_001G027900 [Gossypium raimondii]
Length=679

 Score =   217 bits (553),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSD+LIGPDWA NIE+CD++N +PGQAKD +K +KK+LG+KNPK+QLLAL +LE
Sbjct  4    SMVERATSDLLIGPDWARNIEICDMLNHDPGQAKDVVKGIKKKLGSKNPKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + ERD+LH+MV+IVKKKPD NV+EKIL LIDTWQEA GG R R+PQY
Sbjct  64   TIIKNCGDIVHMHVAERDVLHEMVRIVKKKPDFNVKEKILTLIDTWQEAFGGARARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            + AY EL   G  FPPR E S P+ TPP
Sbjct  124  YVAYQELLRLGAVFPPRSERSAPVLTPP  151



>ref|XP_008441585.1| PREDICTED: target of Myb protein 1 isoform X1 [Cucumis melo]
 ref|XP_008441586.1| PREDICTED: target of Myb protein 1 isoform X1 [Cucumis melo]
 ref|XP_008441588.1| PREDICTED: target of Myb protein 1 isoform X1 [Cucumis melo]
 ref|XP_008441589.1| PREDICTED: target of Myb protein 1 isoform X1 [Cucumis melo]
Length=486

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 132/156 (85%), Gaps = 2/156 (1%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            M+ +AAACAERAT+D+LI PDWA+NIELCDIIN++P QAKDALKILKKRL +KNPKIQLL
Sbjct  1    MSTNAAACAERATNDVLIAPDWAINIELCDIINMDPRQAKDALKILKKRLTSKNPKIQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKK-PDLNVREKILILIDTWQEAL-GG  683
            AL+ LE LSKNCG+ +F+ IV+R+ILH+MVKIVKKK PD  VREKIL L+D WQ A  GG
Sbjct  61   ALYALEALSKNCGDTVFKLIVDRNILHEMVKIVKKKQPDSTVREKILALVDAWQAAFGGG  120

Query  684  PRGRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
             +G++PQY+AAYN+LK  G +FPPREEN    F+PP
Sbjct  121  SKGKYPQYYAAYNDLKNAGFQFPPREENVEQFFSPP  156



>ref|XP_004501181.1| PREDICTED: TOM1-like protein 2-like [Cicer arietinum]
Length=662

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATSDMLIGPDWA+NIE+CDI+N +PGQAKD +K +KKR+G++N K QLLAL +LET+ 
Sbjct  7    ERATSDMLIGPDWALNIEICDILNRDPGQAKDVVKGIKKRIGSRNSKTQLLALTLLETIV  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + ERD+ H+MVKIVKKKPD +VREKILILIDTWQEA GGPR R+PQY+AA
Sbjct  67   KNCGDIVHMHVAERDVPHEMVKIVKKKPDGHVREKILILIDTWQEAFGGPRARYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTP  788
            Y EL   G  FP R E+S P+FTP
Sbjct  127  YQELLHSGAVFPQRSEHSAPVFTP  150



>ref|XP_002309556.2| hypothetical protein POPTR_0006s25770g [Populus trichocarpa]
 gb|EEE93079.2| hypothetical protein POPTR_0006s25770g [Populus trichocarpa]
Length=650

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+NIE+CD+ N +P QAKD +K +KK+LG++N K+QLLAL +LE
Sbjct  4    SMVERATSDMLIGPDWAMNIEICDMCNRDPTQAKDVIKGIKKKLGSRNSKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+D+LH+MVKI KKKPD +V+EKILIL+DTWQEA GGPR R+PQY
Sbjct  64   TIIKNCGDIVHMHVAEKDLLHEMVKIAKKKPDFHVKEKILILVDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FPPR E+S P+FTPP
Sbjct  124  YAAYQELLRAGAVFPPRSESSAPVFTPP  151



>ref|XP_011019641.1| PREDICTED: TOM1-like protein 2 isoform X2 [Populus euphratica]
Length=657

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+NIE+CD+ N +P QAKD +K +KK+LG++N K+QLLAL +LE
Sbjct  4    SMVERATSDMLIGPDWAMNIEICDMCNRDPTQAKDVIKGIKKKLGSRNSKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+D+LH+MVKI KKKPD +V+EKILIL+DTWQEA GGPR R+PQY
Sbjct  64   TIIKNCGDIVHMHVAEKDLLHEMVKIAKKKPDFHVKEKILILVDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FPPR E S P+FTPP
Sbjct  124  YAAYQELLRAGAVFPPRSERSAPVFTPP  151



>ref|XP_007012073.1| ENTH/VHS/GAT family protein [Theobroma cacao]
 gb|EOY29692.1| ENTH/VHS/GAT family protein [Theobroma cacao]
Length=650

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA NIE+CD++N +PGQAKD +K +KK+LG+KN K+QLLAL +LE
Sbjct  4    SMVERATSDMLIGPDWARNIEICDMLNHDPGQAKDVVKGIKKKLGSKNAKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + ERD+LH+MVKIVKKKPD +V+EKILILIDTWQEA GG R R+PQY
Sbjct  64   TIIKNCGDIVHMHVAERDVLHEMVKIVKKKPDFHVKEKILILIDTWQEAFGGARARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            + AY EL   G  FP R E S P+FTPP
Sbjct  124  YVAYQELLRAGAVFPQRSERSAPVFTPP  151



>gb|KDO79744.1| hypothetical protein CISIN_1g005810mg [Citrus sinensis]
Length=484

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  +RATSDMLIGPDWA+NIE+CD++N +PGQAKD +K +KKR+G++N K+QLLAL +LE
Sbjct  4    SMVDRATSDMLIGPDWAMNIEICDMLNHDPGQAKDVVKGIKKRIGSRNSKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+++LH+MVKI +KKPD +V+EKILILIDTWQEA GGPR R+PQY
Sbjct  64   TIIKNCGDIVHMHVAEKNVLHEMVKIARKKPDTHVKEKILILIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FP R E S P+FTPP
Sbjct  124  YAAYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_011657324.1| PREDICTED: target of Myb protein 1 isoform X1 [Cucumis sativus]
 ref|XP_011657325.1| PREDICTED: target of Myb protein 1 isoform X1 [Cucumis sativus]
 ref|XP_011657326.1| PREDICTED: target of Myb protein 1 isoform X1 [Cucumis sativus]
 gb|KGN47506.1| hypothetical protein Csa_6G349830 [Cucumis sativus]
Length=487

 Score =   211 bits (538),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 130/157 (83%), Gaps = 2/157 (1%)
 Frame = +3

Query  327  NMANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQL  506
            NM+ +AAACAERAT+D+LI PDWA+NIELCDIIN++P QAKDALKILKKRL +KNPKIQL
Sbjct  2    NMSTNAAACAERATNDVLIAPDWAINIELCDIINMDPRQAKDALKILKKRLTSKNPKIQL  61

Query  507  LALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKK-PDLNVREKILILIDTWQEAL-G  680
            LAL+ LE LSKNCG+ +F+ IV+R+ILH+MVKIVKKK PD  VREKIL L+D WQ A  G
Sbjct  62   LALYALEALSKNCGDTVFKLIVDRNILHEMVKIVKKKQPDSTVREKILALVDAWQAAFGG  121

Query  681  GPRGRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            G  G++PQY+ AYN+LK  G  FPPREEN    F+PP
Sbjct  122  GSEGKYPQYYVAYNDLKNAGFRFPPREENVEQFFSPP  158



>ref|XP_011081815.1| PREDICTED: TOM1-like protein 2 [Sesamum indicum]
Length=651

 Score =   214 bits (545),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+NIE+CDI N +P QAKD +K +KKRLG+KNPK+QLLAL +LE
Sbjct  4    SMVERATSDMLIGPDWAMNIEICDICNHDPVQAKDVVKGIKKRLGSKNPKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+D+ H+MV+IVKKKPD +V+EKILILIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDIVHMHVAEKDLPHEMVRIVKKKPDFHVKEKILILIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
             AAY +L   G  FP R E S P+FTPP
Sbjct  124  FAAYQDLLRLGAVFPQRSERSAPVFTPP  151



>ref|XP_009631039.1| PREDICTED: target of Myb protein 1-like [Nicotiana tomentosiformis]
Length=673

 Score =   214 bits (546),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 121/149 (81%), Gaps = 1/149 (1%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATSDMLIGPDWA+N+E+CDI N +P QAKD +K +K+RLG+KNPK+QLLAL +LE
Sbjct  4    AMVERATSDMLIGPDWAMNLEICDICNHDPAQAKDVVKGIKRRLGSKNPKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKK-PDLNVREKILILIDTWQEALGGPRGRFPQ  704
            T+ KNCG+ +   + E+D+LH+MVKIVKKK PDL+V+EK+LILIDTWQEA GGPR R+PQ
Sbjct  64   TIVKNCGDIVHMHVAEKDLLHEMVKIVKKKQPDLHVKEKVLILIDTWQEAFGGPRARYPQ  123

Query  705  YHAAYNELKAFGVEFPPREENSVPLFTPP  791
            ++ AY EL   G  FP R E S P+FTPP
Sbjct  124  FYGAYQELLRIGAVFPQRSERSAPVFTPP  152



>ref|XP_009421202.1| PREDICTED: TOM1-like protein 1 [Musa acuminata subsp. malaccensis]
Length=691

 Score =   214 bits (546),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A A  ERATS MLIGPDWA+N+E+CDI+N +PGQAKD ++ LKKR+G+K+PK+QLLAL +
Sbjct  2    AGALVERATSSMLIGPDWAMNVEICDILNRDPGQAKDVVRALKKRIGHKSPKVQLLALSL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKK-PDLNVREKILILIDTWQEALGGPRGRF  698
            LET+ KNCGE +   + E+D+LH MVKIVKKK PD +V+EKIL L+DTWQEA GGP+ R+
Sbjct  62   LETMIKNCGEIVHMHVAEKDMLHKMVKIVKKKQPDSHVKEKILTLMDTWQEAFGGPQARY  121

Query  699  PQYHAAYNELKAFGVEFPPREENSVPLFTP  788
            PQYHAAY EL   G  FP R E S P+FTP
Sbjct  122  PQYHAAYQELLRAGAVFPQRSERSAPVFTP  151



>ref|XP_011026602.1| PREDICTED: TOM1-like protein 2 [Populus euphratica]
 ref|XP_011026603.1| PREDICTED: TOM1-like protein 2 [Populus euphratica]
 ref|XP_011026604.1| PREDICTED: TOM1-like protein 2 [Populus euphratica]
 ref|XP_011026605.1| PREDICTED: TOM1-like protein 2 [Populus euphratica]
Length=674

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATSDMLIGPDWA+NIE+CDI N +P QAKD +K +KK+LG++N K+QLL+L +LE
Sbjct  4    AMVERATSDMLIGPDWAMNIEICDICNRDPSQAKDVVKGIKKKLGSRNSKVQLLSLTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+D+LH+MV+I KKKPDL+V+EKIL+L+DTWQEA GG R R+PQY
Sbjct  64   TIIKNCGDIVHMHVAEKDLLHEMVRIAKKKPDLHVKEKILVLVDTWQEAFGGARARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FPPR E S PLFTPP
Sbjct  124  YAAYQELLRAGAVFPPRSERSTPLFTPP  151



>ref|XP_008367799.1| PREDICTED: target of Myb protein 1-like [Malus domestica]
Length=434

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATSDMLIGPDWA+N+ +CDI N +P QAKD +K +KKRLG+KN K+QLLAL +LET+ 
Sbjct  7    ERATSDMLIGPDWAMNLXICDICNHDPVQAKDVVKGIKKRLGSKNSKVQLLALTLLETII  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + E+D+LHDMV+I KKKPD +V+EKIL+LIDTWQEA GGPR R+PQY+AA
Sbjct  67   KNCGDIVHMHVAEKDLLHDMVRIAKKKPDYHVKEKILVLIDTWQEAFGGPRARYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y +L   G  FP R E+S P+FTPP
Sbjct  127  YQDLLRSGAVFPQRSESSAPVFTPP  151



>ref|XP_010526178.1| PREDICTED: TOM1-like protein 2 [Tarenaya hassleriana]
Length=646

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATSDMLIGPDWA+N+E+CD++N +P QAKD +K +KKR+G+KNPK+QLLAL +LE
Sbjct  4    AMVERATSDMLIGPDWAMNLEICDMLNNDPVQAKDVVKGIKKRIGSKNPKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ +LH+MV+IVKKKPD +V+EKIL+L+DTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVLHEMVRIVKKKPDFHVKEKILVLVDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FP R E S P+FTPP
Sbjct  124  YAAYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_009768540.1| PREDICTED: target of Myb protein 1-like isoform X1 [Nicotiana 
sylvestris]
Length=673

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 121/149 (81%), Gaps = 1/149 (1%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+N+E+CDI N +P QAKD +K +K+RLG+KNPK+QLLAL +LE
Sbjct  4    SMVERATSDMLIGPDWAMNLEICDICNHDPAQAKDVVKGIKRRLGSKNPKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKK-PDLNVREKILILIDTWQEALGGPRGRFPQ  704
            T+ KNCG+ +   + E+D+LH+MVKIVKKK PDL+V+EK+LILIDTWQEA GGPR R+PQ
Sbjct  64   TIVKNCGDIVHMHVAEKDLLHEMVKIVKKKQPDLHVKEKVLILIDTWQEAFGGPRARYPQ  123

Query  705  YHAAYNELKAFGVEFPPREENSVPLFTPP  791
            ++ AY EL   G  FP R E S P+FTPP
Sbjct  124  FYGAYQELLRIGAVFPQRSERSAPVFTPP  152



>ref|XP_003526479.1| PREDICTED: ADP-ribosylation factor-binding protein GGA1-like 
isoform X1 [Glycine max]
Length=666

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATS ML+GPDWA+N+E+CDI+N +PG AKD +K LKKR+G+K P++Q+LAL +LET+ 
Sbjct  7    ERATSSMLVGPDWALNMEICDILNRDPGHAKDVVKGLKKRIGSKVPRVQILALTLLETII  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ I   + ERD+LH+MVKIVKKKPD +VREKILILIDTWQEA GGPR R+PQY+AA
Sbjct  67   KNCGDIIHMHVAERDVLHEMVKIVKKKPDYHVREKILILIDTWQEAFGGPRARYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTP  788
            Y EL   G  FP R + S P+FTP
Sbjct  127  YQELLHAGAAFPQRSKQSAPVFTP  150



>ref|XP_006450645.1| hypothetical protein CICLE_v10007656mg [Citrus clementina]
 gb|ESR63885.1| hypothetical protein CICLE_v10007656mg [Citrus clementina]
Length=676

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  +RATSDMLIGPDWA+NIE+CD++N +PGQAKD +K +KKR+G++N K+QLLAL +LE
Sbjct  4    SMVDRATSDMLIGPDWAMNIEICDMLNHDPGQAKDVVKGIKKRIGSRNSKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+++LH+MVKI +KKPD +V+EKILILIDTWQEA GGPR R+PQY
Sbjct  64   TIIKNCGDIVHMHVAEKNVLHEMVKIARKKPDTHVKEKILILIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FP R E S P+FTPP
Sbjct  124  YAAYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_006476080.1| PREDICTED: ADP-ribosylation factor-binding protein GGA3-like 
[Citrus sinensis]
 gb|KDO79742.1| hypothetical protein CISIN_1g005810mg [Citrus sinensis]
Length=676

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  +RATSDMLIGPDWA+NIE+CD++N +PGQAKD +K +KKR+G++N K+QLLAL +LE
Sbjct  4    SMVDRATSDMLIGPDWAMNIEICDMLNHDPGQAKDVVKGIKKRIGSRNSKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+++LH+MVKI +KKPD +V+EKILILIDTWQEA GGPR R+PQY
Sbjct  64   TIIKNCGDIVHMHVAEKNVLHEMVKIARKKPDTHVKEKILILIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FP R E S P+FTPP
Sbjct  124  YAAYQELLRAGAVFPQRSERSAPVFTPP  151



>gb|KDO79743.1| hypothetical protein CISIN_1g005810mg [Citrus sinensis]
Length=672

 Score =   213 bits (542),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  +RATSDMLIGPDWA+NIE+CD++N +PGQAKD +K +KKR+G++N K+QLLAL +LE
Sbjct  4    SMVDRATSDMLIGPDWAMNIEICDMLNHDPGQAKDVVKGIKKRIGSRNSKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+++LH+MVKI +KKPD +V+EKILILIDTWQEA GGPR R+PQY
Sbjct  64   TIIKNCGDIVHMHVAEKNVLHEMVKIARKKPDTHVKEKILILIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FP R E S P+FTPP
Sbjct  124  YAAYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_002516559.1| protein transporter, putative [Ricinus communis]
 gb|EEF45900.1| protein transporter, putative [Ricinus communis]
Length=667

 Score =   213 bits (542),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+NIE+CD+ N +P QAKD +K +KKR+G+K+PK+QLLAL +LE
Sbjct  4    SMVERATSDMLIGPDWAMNIEICDMCNHDPAQAKDVVKGIKKRIGSKSPKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + ERDILH+MVKIVKKKPD +V+EKIL LIDTWQEA GG R R+PQY
Sbjct  64   TIVKNCGDIVHMHVAERDILHEMVKIVKKKPDFHVKEKILTLIDTWQEAFGGARARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            + AY EL   G  FP R E S P+FTPP
Sbjct  124  YTAYQELLRAGAVFPQRTERSAPVFTPP  151



>ref|XP_008378101.1| PREDICTED: TOM1-like protein 1 [Malus domestica]
Length=704

 Score =   213 bits (543),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATSDMLIGPDWA+NIE+CDI N +P QAKD +K +KKRLG+KN K+QLLAL +LET+ 
Sbjct  7    ERATSDMLIGPDWAMNIEICDICNHDPVQAKDVVKGIKKRLGSKNSKVQLLALTLLETII  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + E+D+LHDMV+IVKKKPD +V++KILILIDTWQEA GGPR R+PQY+AA
Sbjct  67   KNCGDIVHMHVAEKDLLHDMVRIVKKKPDYHVKDKILILIDTWQEAFGGPRARYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y +L   G  FP R E+S P+FTPP
Sbjct  127  YQDLLRSGAVFPQRSESSAPVFTPP  151



>ref|XP_002324811.2| hypothetical protein POPTR_0018s00620g [Populus trichocarpa]
 gb|EEF03376.2| hypothetical protein POPTR_0018s00620g [Populus trichocarpa]
Length=674

 Score =   213 bits (542),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATSDMLIGPDWA+NIE+CDI N +P Q KD +K +KK+LG++N K+QLL+L +LE
Sbjct  4    AMVERATSDMLIGPDWAMNIEICDICNRDPSQGKDVVKGIKKKLGSRNSKVQLLSLTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+D+LH+MV+I KKKPDL+V+EKIL+L+DTWQEA GG R R+PQY
Sbjct  64   TIIKNCGDIVHMHVAEKDLLHEMVRIAKKKPDLHVKEKILVLVDTWQEAFGGARARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FPPR E S PLFTPP
Sbjct  124  YAAYQELLRAGAVFPPRSERSTPLFTPP  151



>ref|XP_006647153.1| PREDICTED: target of Myb protein 1-like [Oryza brachyantha]
Length=623

 Score =   211 bits (537),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            +RAT+DMLIGPDWA+N+E+CD +N +PGQAKD +K LKKR+ +KNPK+QLLAL +LET++
Sbjct  7    DRATNDMLIGPDWAMNLEICDTLNRDPGQAKDVVKYLKKRIAHKNPKVQLLALTLLETMT  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + ERDILH+MVKIVKK+PD +V+EKIL LIDTWQE  GG R  +PQY+AA
Sbjct  67   KNCGDIVHMHVAERDILHEMVKIVKKRPDFHVKEKILTLIDTWQEVFGGARAGYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y EL   G  FP R   SVP+FTPP
Sbjct  127  YQELLRAGAVFPQRSSGSVPIFTPP  151



>ref|XP_004150282.2| PREDICTED: target of Myb protein 1 [Cucumis sativus]
Length=687

 Score =   212 bits (540),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +   RATSDMLIGPDWA+NIE+CD++N +PGQAKD +K +KKRLG+KN K+QLLAL +LE
Sbjct  4    SVVARATSDMLIGPDWAMNIEICDMLNHDPGQAKDVVKGIKKRLGSKNAKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ +LH++VK+VKKKPD  V+EKILILIDTWQEA GGPR R+PQY
Sbjct  64   TIIKNCGDIVHMHVAEKGLLHELVKMVKKKPDFRVKEKILILIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FP R E+S P+FTPP
Sbjct  124  YAAYQELLRAGAVFPQRSESSAPVFTPP  151



>ref|XP_008445032.1| PREDICTED: ADP-ribosylation factor-binding protein GGA2 [Cucumis 
melo]
Length=685

 Score =   212 bits (539),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +   RATSDMLIGPDWA+NIE+CD++N +PGQAKD +K +KKRLG+KN K+QLLAL +LE
Sbjct  4    SVVARATSDMLIGPDWAMNIEICDMLNHDPGQAKDVVKGIKKRLGSKNAKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ +LH++VK+VKKKPD  V+EKILILIDTWQEA GGPR R+PQY
Sbjct  64   TIIKNCGDIVHMHVAEKGLLHELVKMVKKKPDFRVKEKILILIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FP R E+S P+FTPP
Sbjct  124  YAAYQELLRAGAVFPQRSESSAPVFTPP  151



>ref|XP_006578217.1| PREDICTED: ADP-ribosylation factor-binding protein GGA3-like 
isoform X4 [Glycine max]
Length=457

 Score =   207 bits (528),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATS ML+GPDWA+N+E+CDI+N + GQAKD +K +KKR+G+K P++Q+LAL +LET+ 
Sbjct  7    ERATSSMLVGPDWALNMEICDILNRDLGQAKDVVKGIKKRIGSKVPRVQILALTLLETII  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + ERD+LH+MVKIVKKKPD +VREKILILIDTWQEA GG R R+PQY+AA
Sbjct  67   KNCGDIVHMHVAERDVLHEMVKIVKKKPDYHVREKILILIDTWQEAFGGSRARYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTP  788
            Y EL   G  FP R E S P+FTP
Sbjct  127  YQELLHAGTAFPQRYEQSTPVFTP  150



>ref|XP_006366215.1| PREDICTED: TOM1-like protein 2-like [Solanum tuberosum]
Length=674

 Score =   212 bits (539),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 121/149 (81%), Gaps = 1/149 (1%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+N+E+CDI N +P QAKD +K +K+RLG+KNPK+QLLAL +LE
Sbjct  4    SMVERATSDMLIGPDWAMNLEICDICNHDPAQAKDVVKGIKRRLGSKNPKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKK-PDLNVREKILILIDTWQEALGGPRGRFPQ  704
            T+ KNCG+ +   + E+D+LH+MVKIVKKK PDL+V+EK+LILIDTWQEA GGPR R+PQ
Sbjct  64   TIVKNCGDIVHMHVAEKDLLHEMVKIVKKKQPDLHVKEKVLILIDTWQEAFGGPRARYPQ  123

Query  705  YHAAYNELKAFGVEFPPREENSVPLFTPP  791
            ++ AY EL   G  FP R E + P+FTPP
Sbjct  124  FYGAYQELLRIGAVFPQRAEKAAPVFTPP  152



>ref|XP_004967413.1| PREDICTED: signal transducing adapter molecule 2-like isoform 
X2 [Setaria italica]
Length=717

 Score =   212 bits (540),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A +  +RATSDMLIGPDWA N+E+CDI N +PGQ+KD +K LKKR+G+KNPK+QLLAL +
Sbjct  2    AGSMVDRATSDMLIGPDWAKNMEICDICNRDPGQSKDVVKALKKRIGHKNPKVQLLALTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LET+ KNCG+ +   + ERDILH+MVKIVKKK D  V+EK+L+LIDTWQE LGGPR R+P
Sbjct  62   LETVIKNCGDILHMHVAERDILHEMVKIVKKKSDPRVKEKVLVLIDTWQETLGGPRARYP  121

Query  702  QYHAAYNELKAFGVEFPPREENSVPLF  782
            QY+AAY+EL   G EFP R E   PLF
Sbjct  122  QYYAAYHELVRAGAEFPKRSEKPAPLF  148



>ref|XP_009367903.1| PREDICTED: target of Myb protein 1 [Pyrus x bretschneideri]
Length=701

 Score =   212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATSDMLIGPDWA+N+E+CDI N +P QAKD +K +KKRLG+KN K+QLLAL +LET+ 
Sbjct  7    ERATSDMLIGPDWAMNLEICDICNHDPVQAKDVVKGIKKRLGSKNSKVQLLALTLLETII  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + E+D+LHDMV+I KKKPD +V+EKILILIDTWQEA GGPR R+PQY+AA
Sbjct  67   KNCGDIVHMHVAEKDLLHDMVRIAKKKPDYHVKEKILILIDTWQEAFGGPRARYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y +L   G  FP R E+S P+FTPP
Sbjct  127  YQDLLRSGAVFPQRSESSAPVFTPP  151



>ref|XP_006578216.1| PREDICTED: ADP-ribosylation factor-binding protein GGA3-like 
isoform X3 [Glycine max]
Length=478

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATS ML+GPDWA+N+E+CDI+N + GQAKD +K +KKR+G+K P++Q+LAL +LET+ 
Sbjct  7    ERATSSMLVGPDWALNMEICDILNRDLGQAKDVVKGIKKRIGSKVPRVQILALTLLETII  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + ERD+LH+MVKIVKKKPD +VREKILILIDTWQEA GG R R+PQY+AA
Sbjct  67   KNCGDIVHMHVAERDVLHEMVKIVKKKPDYHVREKILILIDTWQEAFGGSRARYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTP  788
            Y EL   G  FP R E S P+FTP
Sbjct  127  YQELLHAGTAFPQRYEQSTPVFTP  150



>ref|XP_004245269.1| PREDICTED: target of Myb protein 1 [Solanum lycopersicum]
Length=674

 Score =   211 bits (538),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 121/149 (81%), Gaps = 1/149 (1%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+N+E+CDI N +P QAKD +K +K+RLG+KNPK+QLLAL +LE
Sbjct  4    SMVERATSDMLIGPDWAMNLEICDICNHDPAQAKDVVKGIKRRLGSKNPKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKK-PDLNVREKILILIDTWQEALGGPRGRFPQ  704
            T+ KNCG+ +   + E+D+LH+MVKIVKKK PDL+V+EK+LILIDTWQEA GGPR R+PQ
Sbjct  64   TIVKNCGDIVHMHVAEKDLLHEMVKIVKKKQPDLHVKEKVLILIDTWQEAFGGPRARYPQ  123

Query  705  YHAAYNELKAFGVEFPPREENSVPLFTPP  791
            ++ AY EL   G  FP R E + P+FTPP
Sbjct  124  FYGAYQELLRIGAVFPQRAEKAAPVFTPP  152



>ref|XP_004967412.1| PREDICTED: signal transducing adapter molecule 2-like isoform 
X1 [Setaria italica]
Length=759

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A +  +RATSDMLIGPDWA N+E+CDI N +PGQ+KD +K LKKR+G+KNPK+QLLAL +
Sbjct  2    AGSMVDRATSDMLIGPDWAKNMEICDICNRDPGQSKDVVKALKKRIGHKNPKVQLLALTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LET+ KNCG+ +   + ERDILH+MVKIVKKK D  V+EK+L+LIDTWQE LGGPR R+P
Sbjct  62   LETVIKNCGDILHMHVAERDILHEMVKIVKKKSDPRVKEKVLVLIDTWQETLGGPRARYP  121

Query  702  QYHAAYNELKAFGVEFPPREENSVPLF  782
            QY+AAY+EL   G EFP R E   PLF
Sbjct  122  QYYAAYHELVRAGAEFPKRSEKPAPLF  148



>gb|KEH36032.1| ENTH/VHS/GAT family protein [Medicago truncatula]
Length=481

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATSD LIGPDWA+N+E+CD++N +PGQAK  ++ LKKR+G++N KIQ+LAL +LET+ 
Sbjct  7    ERATSDFLIGPDWALNLEICDVLNRDPGQAKHIVRGLKKRIGHRNSKIQILALTLLETVI  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + ER++LH+MVKIVKKKPD +VREKIL LIDTWQEA GGPR ++PQY+AA
Sbjct  67   KNCGDIVHMHVAEREVLHEMVKIVKKKPDYHVREKILALIDTWQEAFGGPRAKYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTP  788
            Y EL   G  FP R E S P+FTP
Sbjct  127  YQELLHAGAPFPSRSEQSAPVFTP  150



>emb|CDX72371.1| BnaC07g43930D [Brassica napus]
Length=645

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KKR+G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPSQAKDVVKGVKKRIGSRNPKTQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+IVKKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIVKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>emb|CDY13501.1| BnaA03g52190D [Brassica napus]
Length=649

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KKR+G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGVKKRIGSRNPKTQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+IVKKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIVKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_009138141.1| PREDICTED: TOM1-like protein 2 isoform X1 [Brassica rapa]
Length=649

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KKR+G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGVKKRIGSRNPKTQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+IVKKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIVKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_009138142.1| PREDICTED: TOM1-like protein 2 isoform X2 [Brassica rapa]
Length=648

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KKR+G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGVKKRIGSRNPKTQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+IVKKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIVKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_011019640.1| PREDICTED: TOM1-like protein 2 isoform X1 [Populus euphratica]
Length=658

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 120/149 (81%), Gaps = 1/149 (1%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+NIE+CD+ N +P QAKD +K +KK+LG++N K+QLLAL +LE
Sbjct  4    SMVERATSDMLIGPDWAMNIEICDMCNRDPTQAKDVIKGIKKKLGSRNSKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKK-PDLNVREKILILIDTWQEALGGPRGRFPQ  704
            T+ KNCG+ +   + E+D+LH+MVKI KKK PD +V+EKILIL+DTWQEA GGPR R+PQ
Sbjct  64   TIIKNCGDIVHMHVAEKDLLHEMVKIAKKKQPDFHVKEKILILVDTWQEAFGGPRARYPQ  123

Query  705  YHAAYNELKAFGVEFPPREENSVPLFTPP  791
            Y+AAY EL   G  FPPR E S P+FTPP
Sbjct  124  YYAAYQELLRAGAVFPPRSERSAPVFTPP  152



>ref|XP_006412434.1| hypothetical protein EUTSA_v10024602mg [Eutrema salsugineum]
 gb|ESQ53887.1| hypothetical protein EUTSA_v10024602mg [Eutrema salsugineum]
Length=672

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KKR+G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRIGSRNPKAQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+IVKKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIVKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_006283262.1| hypothetical protein CARUB_v10004294mg [Capsella rubella]
 gb|EOA16160.1| hypothetical protein CARUB_v10004294mg [Capsella rubella]
Length=673

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KKR+G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGVKKRIGSRNPKAQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+IVKKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIVKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|NP_001147567.1| VHS and GAT domain protein [Zea mays]
 gb|ACG27947.1| VHS and GAT domain protein [Zea mays]
 gb|AFW70948.1| putative VHS/GAT domain containing family protein [Zea mays]
Length=665

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            ++A  ERATSDMLIGPDWA+N+E+CDI+N  PGQAKD +K LKKR+ +KNPK+QLLAL +
Sbjct  2    SSAMVERATSDMLIGPDWAMNLEICDILNREPGQAKDVVKSLKKRIAHKNPKVQLLALTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LET+ KNCG+ +   + ERDILH+MVKIVKK+ D +V+EKIL LIDTWQE  GG R R+P
Sbjct  62   LETMIKNCGDVVHMVVAERDILHEMVKIVKKRHDYHVKEKILTLIDTWQEVFGGARARYP  121

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QY+AAY EL   GV FP R   SVP+ TPP
Sbjct  122  QYYAAYEELLRAGVVFPQRLNGSVPIITPP  151



>ref|XP_011459005.1| PREDICTED: target of Myb protein 1 [Fragaria vesca subsp. vesca]
Length=707

 Score =   211 bits (536),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+NIE+CDI N +P QAKD +K +KKRLG++N K+QLLAL +LE
Sbjct  4    SMVERATSDMLIGPDWAMNIEICDICNHDPVQAKDVVKGIKKRLGSRNSKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + ERD+LH+MVKIVKKKPD +V+EKILILIDTWQEA GGPR R+PQY
Sbjct  64   TIIKNCGDIVHMHVAERDLLHEMVKIVKKKPDYHVKEKILILIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTP  788
            +AAY EL   G  FP R E + P+FTP
Sbjct  124  YAAYQELLRAGAVFPHRSEAAAPVFTP  150



>ref|NP_195002.2| ENTH/VHS/GAT family protein [Arabidopsis thaliana]
 gb|AAM53282.1| putative protein [Arabidopsis thaliana]
 gb|AAN15352.1| putative protein [Arabidopsis thaliana]
 gb|AEE86114.1| ENTH/VHS/GAT family protein [Arabidopsis thaliana]
Length=675

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KKR+G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRIGSRNPKAQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+IVKKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIVKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|NP_001190892.1| ENTH/VHS/GAT family protein [Arabidopsis thaliana]
 gb|AEE86115.1| ENTH/VHS/GAT family protein [Arabidopsis thaliana]
Length=676

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KKR+G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRIGSRNPKAQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+IVKKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIVKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_010432670.1| PREDICTED: TOM1-like protein 2 isoform X2 [Camelina sativa]
Length=676

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KKR+G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRIGSRNPKAQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+IVKKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIVKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_010432669.1| PREDICTED: TOM1-like protein 2 isoform X1 [Camelina sativa]
Length=677

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KKR+G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRIGSRNPKAQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+IVKKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIVKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_002869247.1| protein transporter [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45506.1| protein transporter [Arabidopsis lyrata subsp. lyrata]
Length=667

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KKR+G++NPK QLLAL VLET+ 
Sbjct  3    ERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRIGSRNPKAQLLALTVLETIV  62

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + E+ ++H+MV+IVKKKPD +V+EKIL+LIDTWQEA GGPR R+PQY+A 
Sbjct  63   KNCGDMVHMHVAEKGVIHEMVRIVKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQYYAG  122

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y EL   G  FP R E S P+FTPP
Sbjct  123  YQELLRAGAVFPQRSERSAPVFTPP  147



>ref|XP_010447346.1| PREDICTED: TOM1-like protein 2 isoform X1 [Camelina sativa]
Length=679

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KKR+G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRIGSRNPKAQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+IVKKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIVKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_010437859.1| PREDICTED: TOM1-like protein 2 isoform X2 [Camelina sativa]
Length=679

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KKR+G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRIGSRNPKAQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+IVKKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIVKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_010447347.1| PREDICTED: TOM1-like protein 2 isoform X2 [Camelina sativa]
Length=678

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KKR+G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRIGSRNPKAQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+IVKKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIVKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_010437858.1| PREDICTED: TOM1-like protein 2 isoform X1 [Camelina sativa]
Length=680

 Score =   210 bits (534),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KKR+G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRIGSRNPKAQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+IVKKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIVKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_002457079.1| hypothetical protein SORBIDRAFT_03g000910 [Sorghum bicolor]
 gb|EES02199.1| hypothetical protein SORBIDRAFT_03g000910 [Sorghum bicolor]
Length=674

 Score =   209 bits (533),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A +  +RATSD LIGPDWA N+E+CDI N +PGQ+KD +K LKKR+G+KNPK+QLLAL +
Sbjct  2    AGSMVDRATSDHLIGPDWAKNMEICDICNRDPGQSKDVVKALKKRIGHKNPKVQLLALTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LET+ KNCG+ +   + ERDILH+MVKIVKKK D  V+EK+L+LIDTWQEA GGPR R+P
Sbjct  62   LETVIKNCGDILHMHVAERDILHEMVKIVKKKSDPRVKEKVLVLIDTWQEAFGGPRARYP  121

Query  702  QYHAAYNELKAFGVEFPPREENSVPLF  782
            QY+AAY+EL   G EFP R E   PLF
Sbjct  122  QYYAAYHELVRAGAEFPKRPEKPAPLF  148



>ref|XP_008672286.1| PREDICTED: uncharacterized protein LOC100217079 isoform X1 [Zea 
mays]
Length=673

 Score =   209 bits (533),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A +  +RATSDMLI PDWA N+E+CDI N +PGQ+KD +K LKKR+G+KNPK+QLLAL +
Sbjct  2    AGSMVDRATSDMLISPDWAKNMEICDICNRDPGQSKDVVKALKKRIGHKNPKVQLLALTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LET+ KNCG+ +   + ERDILH+MVKIVKKK D  V+EK+L+LIDTWQEA GGPR R+P
Sbjct  62   LETVIKNCGDILHMHVAERDILHEMVKIVKKKSDPRVKEKVLVLIDTWQEAFGGPRARYP  121

Query  702  QYHAAYNELKAFGVEFPPREENSVPLF  782
            QY+AAY+EL   G EFP R E   PLF
Sbjct  122  QYYAAYHELVRAGAEFPKRPEKPAPLF  148



>tpg|DAA52772.1| TPA: putative VHS/GAT domain containing family protein [Zea mays]
Length=592

 Score =   208 bits (529),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A +  +RATSDMLI PDWA N+E+CDI N +PGQ+KD +K LKKR+G+KNPK+QLLAL +
Sbjct  2    AGSMVDRATSDMLISPDWAKNMEICDICNRDPGQSKDVVKALKKRIGHKNPKVQLLALTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LET+ KNCG+ +   + ERDILH+MVKIVKKK D  V+EK+L+LIDTWQEA GGPR R+P
Sbjct  62   LETVIKNCGDILHMHVAERDILHEMVKIVKKKSDPRVKEKVLVLIDTWQEAFGGPRARYP  121

Query  702  QYHAAYNELKAFGVEFPPREENSVPLF  782
            QY+AAY+EL   G EFP R E   PLF
Sbjct  122  QYYAAYHELVRAGAEFPKRPEKPAPLF  148



>ref|XP_010256973.1| PREDICTED: target of Myb protein 1-like isoform X2 [Nelumbo nucifera]
Length=628

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            M++      E+ATSD+LIGPDW +N+++CD IN N  QAKD +K LK+RL NKNPK+QLL
Sbjct  1    MSSSVTVRVEKATSDLLIGPDWTMNMDICDTINSNHWQAKDVVKALKRRLQNKNPKVQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL +LET++KNCG+ +  QI ERD+L +M+KIVKKK D++VR+KILIL+D+WQEA GGP 
Sbjct  61   ALTLLETMTKNCGDYVHFQIAERDVLQEMIKIVKKKTDMHVRDKILILLDSWQEAFGGPG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            G++PQY+ AY EL+  GVEFP R  ++  +FTPP
Sbjct  121  GKYPQYYWAYEELRRSGVEFPRRSSDAAQIFTPP  154



>gb|KFK29873.1| hypothetical protein AALP_AA7G190000 [Arabis alpina]
Length=678

 Score =   209 bits (531),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS++LIGPDWA+N+E+CD++N +P QAKD +K +KKR+G++NPK QLLAL +LE
Sbjct  4    AMVERATSELLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRIGSRNPKAQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+IVKKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIVKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>gb|KFK29872.1| hypothetical protein AALP_AA7G190000 [Arabis alpina]
Length=679

 Score =   209 bits (531),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS++LIGPDWA+N+E+CD++N +P QAKD +K +KKR+G++NPK QLLAL +LE
Sbjct  4    AMVERATSELLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRIGSRNPKAQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+IVKKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIVKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>emb|CDY49322.1| BnaC03g66920D [Brassica napus]
Length=664

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KKR+G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPVQAKDVVKGVKKRIGSRNPKTQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+I KKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIAKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_009108832.1| PREDICTED: TOM1-like protein 2 isoform X1 [Brassica rapa]
Length=651

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KKR+G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPVQAKDVVKGVKKRIGSRNPKTQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+I KKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIAKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_009796168.1| PREDICTED: ADP-ribosylation factor-binding protein GGA2-like 
isoform X2 [Nicotiana sylvestris]
Length=658

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATSDMLIGPDWA+N+E+CDI N +PGQAKD +K +KKRL +K PK+QLLAL +LE + 
Sbjct  7    ERATSDMLIGPDWAMNVEICDICNRDPGQAKDIVKGIKKRLRSKKPKVQLLALTLLEAIV  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + E+ +LH MVKIVKKKPD  VREKIL L+DTWQEA GGPR R+PQY+ +
Sbjct  67   KNCGDIVHMHVAEKGLLHQMVKIVKKKPDFYVREKILTLVDTWQEAFGGPRARYPQYYGS  126

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y EL   G  FP R E S P+FTPP
Sbjct  127  YQELLRIGAVFPQRSERSAPVFTPP  151



>ref|XP_009796167.1| PREDICTED: ADP-ribosylation factor-binding protein GGA2-like 
isoform X1 [Nicotiana sylvestris]
Length=660

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATSDMLIGPDWA+N+E+CDI N +PGQAKD +K +KKRL +K PK+QLLAL +LE + 
Sbjct  7    ERATSDMLIGPDWAMNVEICDICNRDPGQAKDIVKGIKKRLRSKKPKVQLLALTLLEAIV  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + E+ +LH MVKIVKKKPD  VREKIL L+DTWQEA GGPR R+PQY+ +
Sbjct  67   KNCGDIVHMHVAEKGLLHQMVKIVKKKPDFYVREKILTLVDTWQEAFGGPRARYPQYYGS  126

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y EL   G  FP R E S P+FTPP
Sbjct  127  YQELLRIGAVFPQRSERSAPVFTPP  151



>ref|XP_008793055.1| PREDICTED: TOM1-like protein 1 isoform X1 [Phoenix dactylifera]
Length=673

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 121/150 (81%), Gaps = 1/150 (1%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A A  +RATS M IGPDWA+N+E+CDI N +PGQAKDA+K LKKRLG+KNPK+QLLAL +
Sbjct  2    AGALVDRATSVMQIGPDWAMNMEICDICNRDPGQAKDAVKGLKKRLGHKNPKVQLLALTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKK-PDLNVREKILILIDTWQEALGGPRGRF  698
            LET+ +NCG+ +   + E+DILH+MVKIV+KK PD++V+EK+L+LIDTWQEA GGP+ R+
Sbjct  62   LETMIRNCGDIVHMHVAEKDILHEMVKIVRKKQPDIHVKEKVLVLIDTWQEAFGGPQARY  121

Query  699  PQYHAAYNELKAFGVEFPPREENSVPLFTP  788
            PQY AAY EL   G  FP R E S P+FTP
Sbjct  122  PQYFAAYQELLHAGAVFPRRPERSAPIFTP  151



>emb|CDY45016.1| BnaA08g12030D [Brassica napus]
Length=666

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KKR+G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPVQAKDVVKGVKKRIGSRNPKTQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+I KKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIAKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>gb|KHN10222.1| TOM1-like protein 2 [Glycine soja]
Length=666

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATS ML+GPDWA+N+E+CDI+N + GQAKD +K +KKR+G+K P++Q+LAL +LET+ 
Sbjct  7    ERATSSMLVGPDWALNMEICDILNRDLGQAKDVVKGIKKRIGSKVPRVQILALTLLETII  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + ERD+LH+MVKIVKKKPD +VREKILILIDTWQEA GG R R+PQY+AA
Sbjct  67   KNCGDIVHMHVAERDVLHEMVKIVKKKPDYHVREKILILIDTWQEAFGGSRARYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTP  788
            Y EL   G  FP R E S P+FTP
Sbjct  127  YQELLHAGTAFPQRYEQSTPVFTP  150



>ref|XP_003522697.1| PREDICTED: ADP-ribosylation factor-binding protein GGA3-like 
isoform X1 [Glycine max]
Length=666

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATS ML+GPDWA+N+E+CDI+N + GQAKD +K +KKR+G+K P++Q+LAL +LET+ 
Sbjct  7    ERATSSMLVGPDWALNMEICDILNRDLGQAKDVVKGIKKRIGSKVPRVQILALTLLETII  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + ERD+LH+MVKIVKKKPD +VREKILILIDTWQEA GG R R+PQY+AA
Sbjct  67   KNCGDIVHMHVAERDVLHEMVKIVKKKPDYHVREKILILIDTWQEAFGGSRARYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTP  788
            Y EL   G  FP R E S P+FTP
Sbjct  127  YQELLHAGTAFPQRYEQSTPVFTP  150



>ref|XP_003636408.1| Hepatocyte growth factor-regulated tyrosine kinase substrate 
[Medicago truncatula]
 gb|KEH36031.1| ENTH/VHS/GAT family protein [Medicago truncatula]
Length=668

 Score =   207 bits (528),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATSD LIGPDWA+N+E+CD++N +PGQAK  ++ LKKR+G++N KIQ+LAL +LET+ 
Sbjct  7    ERATSDFLIGPDWALNLEICDVLNRDPGQAKHIVRGLKKRIGHRNSKIQILALTLLETVI  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + ER++LH+MVKIVKKKPD +VREKIL LIDTWQEA GGPR ++PQY+AA
Sbjct  67   KNCGDIVHMHVAEREVLHEMVKIVKKKPDYHVREKILALIDTWQEAFGGPRAKYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTP  788
            Y EL   G  FP R E S P+FTP
Sbjct  127  YQELLHAGAPFPSRSEQSAPVFTP  150



>gb|EEE56715.1| hypothetical protein OsJ_06216 [Oryza sativa Japonica Group]
Length=592

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            +RAT+DMLIGPDWA+N+E+CD +N +PGQAKD +K +KKR+ ++N K+QLLAL +LET+ 
Sbjct  7    DRATNDMLIGPDWAMNLEICDTLNRDPGQAKDVVKSIKKRIAHRNAKVQLLALTLLETMI  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +  Q+ E+DILH+MVKIVKK+PD +V+EKIL LIDTWQE  GG R R+PQY+AA
Sbjct  67   KNCGDIVHMQVAEKDILHEMVKIVKKRPDFHVKEKILTLIDTWQEVFGGVRARYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y EL   G  FP R   SVP+FTPP
Sbjct  127  YQELLRAGAVFPQRSNGSVPIFTPP  151



>gb|ERM98612.1| hypothetical protein AMTR_s00109p00078110 [Amborella trichopoda]
Length=617

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+NIE+CDI+N +PGQAKD ++ +KKR+G+KNPK+QLLAL +LE
Sbjct  4    SLVERATSDMLIGPDWAMNIEICDILNHDPGQAKDVVRGIKKRMGSKNPKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            TL KNCG+ +  Q+ E+D+LH+MVKIVKKKPD++V+EKIL LIDTWQEA GGPR R+PQY
Sbjct  64   TLIKNCGDIVHMQVAEKDLLHEMVKIVKKKPDMHVKEKILTLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FP R E + P+FTPP
Sbjct  124  YAAYQELLRAGAAFPQRTERTAPIFTPP  151



>ref|XP_010100264.1| Protein PEROXIN-4 [Morus notabilis]
 gb|EXB82271.1| Protein PEROXIN-4 [Morus notabilis]
Length=905

 Score =   209 bits (532),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 94/145 (65%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATSDMLIGPDWA+NIE+CD++N +P QAKD +K +KKR+G++NPK+QLLAL +LET+ 
Sbjct  7    ERATSDMLIGPDWAMNIEICDMLNHDPAQAKDVVKGIKKRIGSRNPKVQLLALTLLETII  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + E+D+LH+MVKIVKKKPD++V+EKILILIDTWQE  GG R R+PQY+AA
Sbjct  67   KNCGDIVHMHVAEKDVLHEMVKIVKKKPDVHVKEKILILIDTWQEVFGGARARYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y EL   G  FP R E + P+FTPP
Sbjct  127  YQELLRAGAVFPQRSERAAPVFTPP  151



>gb|EYU20455.1| hypothetical protein MIMGU_mgv1a002579mg [Erythranthe guttata]
Length=657

 Score =   207 bits (527),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+NIE+CDI N +P QAKD ++ +KKRLG++NPK+QLLAL +LE
Sbjct  4    SMVERATSDMLIGPDWAMNIEICDICNHDPAQAKDVVRGIKKRLGSRNPKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+D+ H+MVKIV+KKPD +V+EKILILIDTWQEA GG R R+PQY
Sbjct  64   TVVKNCGDIVHMHVAEKDLPHEMVKIVRKKPDFHVKEKILILIDTWQEAFGGSRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
              AY +L   G  FP R E + P+FTPP
Sbjct  124  FVAYQDLLRLGAVFPQRTETTAPVFTPP  151



>ref|XP_003572401.1| PREDICTED: target of Myb protein 1 [Brachypodium distachyon]
Length=678

 Score =   207 bits (527),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            +RATSD+LIGPDWA+N+E+CD +N +PG+AKDA+K LKKR+ +KN K+QLLAL +LET+ 
Sbjct  7    DRATSDVLIGPDWAMNLEICDTLNRDPGKAKDAVKSLKKRIAHKNSKVQLLALTLLETMI  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + ERDILH+MVKIVKKKPD +V+EKIL LIDTWQE  GG R R+PQY+AA
Sbjct  67   KNCGDIVHMYVAERDILHEMVKIVKKKPDFHVKEKILTLIDTWQEVFGGVRARYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y EL   G  FP R   SVP+FTPP
Sbjct  127  YQELLRAGAIFPERPNGSVPIFTPP  151



>ref|XP_008337081.1| PREDICTED: TOM1-like protein 1 [Malus domestica]
Length=698

 Score =   207 bits (528),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATSDMLIGPDWA+N+ +CDI N +P QAKD +K +KKRLG+KN K+QLLAL +LET+ 
Sbjct  7    ERATSDMLIGPDWAMNLXICDICNHDPVQAKDVVKGIKKRLGSKNSKVQLLALTLLETII  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + E+D+LHDMV+I KKKPD +V+EKIL LIDTWQEA GGPR R+PQY+AA
Sbjct  67   KNCGDIVHMHVAEKDLLHDMVRIAKKKPDYHVKEKILXLIDTWQEAFGGPRARYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y +L   G  FP R E+S P+FTPP
Sbjct  127  YQDLLRSGAVFPQRSESSAPVFTPP  151



>ref|NP_001046532.1| Os02g0273700 [Oryza sativa Japonica Group]
 dbj|BAD21829.1| putative VHS domain-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAD28297.1| putative VHS domain-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAF08446.1| Os02g0273700 [Oryza sativa Japonica Group]
 gb|EEC72896.1| hypothetical protein OsI_06718 [Oryza sativa Indica Group]
 dbj|BAJ84576.1| P0413A11.12 [Oryza sativa Indica Group]
Length=634

 Score =   206 bits (525),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            +RAT+DMLIGPDWA+N+E+CD +N +PGQAKD +K +KKR+ ++N K+QLLAL +LET+ 
Sbjct  7    DRATNDMLIGPDWAMNLEICDTLNRDPGQAKDVVKSIKKRIAHRNAKVQLLALTLLETMI  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +  Q+ E+DILH+MVKIVKK+PD +V+EKIL LIDTWQE  GG R R+PQY+AA
Sbjct  67   KNCGDIVHMQVAEKDILHEMVKIVKKRPDFHVKEKILTLIDTWQEVFGGVRARYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y EL   G  FP R   SVP+FTPP
Sbjct  127  YQELLRAGAVFPQRSNGSVPIFTPP  151



>ref|XP_004952188.1| PREDICTED: target of Myb protein 1-like [Setaria italica]
Length=643

 Score =   206 bits (525),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 117/150 (78%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            ++A  ERATSDMLIGPDWA+N+E+CDI+N +PGQAKD +K LKKR+ +KNPK+QLLAL +
Sbjct  2    SSAMVERATSDMLIGPDWAMNLEICDILNRDPGQAKDVVKSLKKRIIHKNPKVQLLALTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LET+ KNCG+ +   + ERDILH+MVKIVKK+ D +V+EKIL LID WQE  GG R R+P
Sbjct  62   LETMIKNCGDIVHMHVAERDILHEMVKIVKKRHDYHVKEKILTLIDNWQEVFGGARARYP  121

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QY AAY EL   G  FP R   SVP+ TPP
Sbjct  122  QYFAAYQELLRTGAVFPQRSNGSVPIITPP  151



>ref|XP_010668103.1| PREDICTED: target of Myb protein 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010668108.1| PREDICTED: target of Myb protein 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=698

 Score =   207 bits (526),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  +RATSDMLIGPDWA+NIE+CD++N +PGQAKD +K +KKR+G+KN KIQLLAL +LE
Sbjct  4    SMVDRATSDMLIGPDWAMNIEICDMLNNDPGQAKDVVKGIKKRIGSKNSKIQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+++ H+MVKI KKK D +V+EKILILIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDIVHMHVAEKELPHEMVKIAKKKLDFHVKEKILILIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FP + E S P+FTPP
Sbjct  124  YAAYQELLRAGAVFPQKSERSAPVFTPP  151



>ref|XP_011620554.1| PREDICTED: target of Myb protein 1 [Amborella trichopoda]
 ref|XP_011620555.1| PREDICTED: target of Myb protein 1 [Amborella trichopoda]
 ref|XP_011620556.1| PREDICTED: target of Myb protein 1 [Amborella trichopoda]
Length=665

 Score =   206 bits (524),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+NIE+CDI+N +PGQAKD ++ +KKR+G+KNPK+QLLAL +LE
Sbjct  4    SLVERATSDMLIGPDWAMNIEICDILNHDPGQAKDVVRGIKKRMGSKNPKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            TL KNCG+ +  Q+ E+D+LH+MVKIVKKKPD++V+EKIL LIDTWQEA GGPR R+PQY
Sbjct  64   TLIKNCGDIVHMQVAEKDLLHEMVKIVKKKPDMHVKEKILTLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FP R E + P+FTPP
Sbjct  124  YAAYQELLRAGAAFPQRTERTAPIFTPP  151



>ref|XP_007225177.1| hypothetical protein PRUPE_ppa002235mg [Prunus persica]
 gb|EMJ26376.1| hypothetical protein PRUPE_ppa002235mg [Prunus persica]
Length=697

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATSDMLIGPDWA+NIE+CD+ N +P QAKD +K +KKRLG++N K+QLLAL +LET+ 
Sbjct  7    ERATSDMLIGPDWAMNIEICDMCNHDPVQAKDVVKGIKKRLGSRNSKVQLLALTLLETII  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + E+D+LH+MVKIVKKKPD +V+EKILILIDTWQEA GGPR R+PQY+AA
Sbjct  67   KNCGDIVHMHVAEKDLLHEMVKIVKKKPDYHVKEKILILIDTWQEAFGGPRARYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSV-PLFTPP  791
            Y EL   G  FP R +++  P+FTPP
Sbjct  127  YQELLRAGAVFPQRSDSAAPPVFTPP  152



>ref|XP_010249685.1| PREDICTED: TOM1-like protein 2 isoform X2 [Nelumbo nucifera]
Length=657

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 114/148 (77%), Gaps = 7/148 (5%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+NIE+CDI+N +PGQAKD +K LKKRLG+KNPK+       LE
Sbjct  4    SLVERATSDMLIGPDWAMNIEICDILNHDPGQAKDVVKGLKKRLGSKNPKL-------LE  56

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            TL KNCG+ +   + E+DILH+MVKIVKKKPD +V+EKIL LIDTWQE  GGPR R+ QY
Sbjct  57   TLIKNCGDIVHMHVAEKDILHEMVKIVKKKPDFHVKEKILTLIDTWQETFGGPRARYSQY  116

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FP R E S P+FTPP
Sbjct  117  YAAYQELLRAGAVFPRRSERSAPIFTPP  144



>ref|XP_008220049.1| PREDICTED: target of Myb protein 1 [Prunus mume]
Length=699

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATSDMLIGPDWA+NIE+CD+ N +P QAKD +K +KKRLG++N K+QLLAL +LET+ 
Sbjct  7    ERATSDMLIGPDWAMNIEICDMCNHDPVQAKDVVKGIKKRLGSRNSKVQLLALTLLETII  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + E+D+LH+MVKIVKKKPD +V+EKILILIDTWQEA GGPR R+PQY+AA
Sbjct  67   KNCGDIVHMHVAEKDLLHEMVKIVKKKPDYHVKEKILILIDTWQEAFGGPRARYPQYYAA  126

Query  717  YNELKAFGVEFPPREEN-SVPLFTPP  791
            Y EL   G  FP R ++ ++P+FTPP
Sbjct  127  YQELLRAGAVFPQRSDSAALPVFTPP  152



>gb|AEK78080.1| VHS [Triticum aestivum]
Length=253

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +3

Query  345  AACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVL  524
            +   +RATS+ LIGPDW++N+E+CDI+N +P QAKD +K +KKR+G+KN KIQLLAL +L
Sbjct  4    SVLVDRATSESLIGPDWSLNLEICDILNHDPSQAKDVVKSIKKRIGHKNSKIQLLALTLL  63

Query  525  ETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQ  704
            ETL KNCG+ +   + ERDILH+MVKIVKKKPD +V+EKILILIDTWQEA GG R R+PQ
Sbjct  64   ETLIKNCGDFVHMHVAERDILHEMVKIVKKKPDYHVKEKILILIDTWQEAFGGARARYPQ  123

Query  705  YHAAYNELKAFGVEFPPREENSVPLFTPP  791
            Y+AAY EL   G  FP R E+SVP++TPP
Sbjct  124  YYAAYQELLRAGAVFPQRSESSVPIYTPP  152



>gb|EAY73130.1| hypothetical protein OsI_01005 [Oryza sativa Indica Group]
Length=714

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A +  +RATSDMLIGPDWA N+E+CDI N +PGQ+KD +K LKKR+G+KNPK+Q+LAL +
Sbjct  2    AGSMVDRATSDMLIGPDWAKNMEICDICNRDPGQSKDVVKALKKRIGHKNPKVQILALTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LET  KNCG+     + ERD+LH+MVKIVKKK D NV+EK+L +IDTWQEA GGPR R+P
Sbjct  62   LETAIKNCGDIFHMHVAERDVLHEMVKIVKKKSDQNVKEKVLTMIDTWQEAFGGPRARYP  121

Query  702  QYHAAYNELKAFGVEFPPREENSVPLF  782
            QY+AAY++L   G  FP R +   PLF
Sbjct  122  QYYAAYHDLVRAGAAFPKRSDRPAPLF  148



>ref|NP_001042484.1| Os01g0229200 [Oryza sativa Japonica Group]
 dbj|BAD81322.1| target of myb1 -like [Oryza sativa Japonica Group]
 dbj|BAD82421.1| target of myb1 -like [Oryza sativa Japonica Group]
 dbj|BAF04398.1| Os01g0229200 [Oryza sativa Japonica Group]
 gb|EAZ11130.1| hypothetical protein OsJ_00977 [Oryza sativa Japonica Group]
 dbj|BAG89779.1| unnamed protein product [Oryza sativa Japonica Group]
Length=711

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A +  +RATSDMLIGPDWA N+E+CDI N +PGQ+KD +K LKKR+G+KNPK+Q+LAL +
Sbjct  2    AGSMVDRATSDMLIGPDWAKNMEICDICNRDPGQSKDVVKALKKRIGHKNPKVQILALTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LET  KNCG+     + ERD+LH+MVKIVKKK D NV+EK+L +IDTWQEA GGPR R+P
Sbjct  62   LETAIKNCGDIFHMHVAERDVLHEMVKIVKKKSDQNVKEKVLTMIDTWQEAFGGPRARYP  121

Query  702  QYHAAYNELKAFGVEFPPREENSVPLF  782
            QY+AAY++L   G  FP R +   PLF
Sbjct  122  QYYAAYHDLVRAGAAFPKRSDRPAPLF  148



>gb|KJB54840.1| hypothetical protein B456_009G051300 [Gossypium raimondii]
Length=762

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERAT+D+L+GPDWA NIE+CD++N  PGQAKD +K +KK+LG+KN K+QLLAL +LE
Sbjct  4    SMVERATNDLLVGPDWARNIEICDMLNQEPGQAKDVIKGIKKKLGSKNSKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + ER ILHDMV+IVKKKPD  V+EKIL LIDTWQEA GG R R+ QY
Sbjct  64   TIIKNCGDIVHMHVAERGILHDMVRIVKKKPDFYVKEKILTLIDTWQEAFGGARARYTQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            + AY EL   G  FPPR E S P+FTPP
Sbjct  124  YVAYQELLRAGAVFPPRSERSAPVFTPP  151



>ref|XP_010249684.1| PREDICTED: TOM1-like protein 2 isoform X1 [Nelumbo nucifera]
Length=664

 Score =   204 bits (520),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+NIE+CDI+N +PGQAKD +K LKKRLG+KNPK+QLLAL +LE
Sbjct  4    SLVERATSDMLIGPDWAMNIEICDILNHDPGQAKDVVKGLKKRLGSKNPKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            TL KNCG+ +   + E+DILH+MVKIVKKKPD +V+EKIL LIDTWQE  GGPR R+ QY
Sbjct  64   TLIKNCGDIVHMHVAEKDILHEMVKIVKKKPDFHVKEKILTLIDTWQETFGGPRARYSQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FP R E S P+FTPP
Sbjct  124  YAAYQELLRAGAVFPRRSERSAPIFTPP  151



>ref|XP_007137187.1| hypothetical protein PHAVU_009G107100g [Phaseolus vulgaris]
 gb|ESW09181.1| hypothetical protein PHAVU_009G107100g [Phaseolus vulgaris]
Length=664

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATS ML+GPDWA+N+E+CDI+N +PGQ K+ +K +KKRLG+K P++Q+ AL +LET+ 
Sbjct  7    ERATSSMLVGPDWALNMEICDILNRDPGQGKNVVKGIKKRLGSKVPRVQIAALTLLETII  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ I   + ERD+LH+MVKI KKK D +VREKIL+LIDTWQEA GGPR R+PQY+AA
Sbjct  67   KNCGDIIHMHVAERDVLHEMVKIAKKKIDYHVREKILVLIDTWQEAFGGPRARYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTP  788
            Y EL   G  FP R E S P+FTP
Sbjct  127  YQELLRAGAVFPQRSERSAPVFTP  150



>ref|XP_007161372.1| hypothetical protein PHAVU_001G063400g [Phaseolus vulgaris]
 gb|ESW33366.1| hypothetical protein PHAVU_001G063400g [Phaseolus vulgaris]
Length=662

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSDMLIGPDWA+NIE+CD++N +PGQAKD +K +KK++G+KN K+QLLAL +LE
Sbjct  4    SMVERATSDMLIGPDWAMNIEICDMLNHDPGQAKDVVKGIKKKIGSKNSKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + ERD+LHDMVK+VKKKPD +V+EKILIL+DTWQEA GGPR R+PQY
Sbjct  64   TIIKNCGDIVHMHVAERDVLHDMVKMVKKKPDFHVKEKILILVDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +AAY EL   G  FP R E S P+ TPP
Sbjct  124  YAAYQELLRAGAVFPQRSEQSAPVLTPP  151



>ref|XP_010924586.1| PREDICTED: target of Myb protein 1-like [Elaeis guineensis]
Length=676

 Score =   204 bits (518),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
              + A+RATS MLIGPDWA+N+E+CDI N +PGQAKD +K LKKRL +KNPK+QLLAL +
Sbjct  2    TGSLADRATSIMLIGPDWAMNMEICDICNRDPGQAKDVVKGLKKRLRHKNPKVQLLALTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKK-PDLNVREKILILIDTWQEALGGPRGRF  698
            LET+ KNCG+ +   + E+DILH+MVKIV+KK PD++V+EK+L+LIDTWQEA GGP+ R+
Sbjct  62   LETMVKNCGDIVHVHVAEKDILHEMVKIVRKKQPDIHVKEKVLVLIDTWQEAFGGPQARY  121

Query  699  PQYHAAYNELKAFGVEFPPREENSVPLFTP  788
            PQY AAY EL   G  +P R E S P+FTP
Sbjct  122  PQYFAAYQELLHAGAVYPQRPERSAPVFTP  151



>ref|XP_006366880.1| PREDICTED: TOM1-like protein 2-like [Solanum tuberosum]
Length=720

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            AA   E+ATS+ LIGPDW +NI++CD IN N   AKD +K +KKRL +KNPK+QLLAL +
Sbjct  29   AAVRVEKATSEFLIGPDWTMNIDICDTINSNQWLAKDVVKAVKKRLQHKNPKVQLLALTL  88

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            +ET+ KNCG+N+  QI ER IL DMVKIVKKK D++VR+K+L+L+D+WQEA GGP G++P
Sbjct  89   METMVKNCGDNVHFQITERTILQDMVKIVKKKTDMHVRDKVLVLLDSWQEAFGGPGGKYP  148

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QY+ AY EL+  GVEFP R  ++ P+FTPP
Sbjct  149  QYYWAYEELRRAGVEFPKRSFDTAPIFTPP  178



>ref|XP_004246315.1| PREDICTED: target of Myb protein 1 [Solanum lycopersicum]
Length=705

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            AA   E+ATS+ LIGPDW +NI++CD IN N   AKD +K +KKRL +KNPK+QLLAL +
Sbjct  19   AAVRVEKATSEFLIGPDWTMNIDICDTINSNQWLAKDVVKAVKKRLQHKNPKVQLLALTL  78

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            +ET+ KNCG+N+  QI ER IL DMVKIVKKK D++VR+K+L+L+D+WQEA GGP G++P
Sbjct  79   METMVKNCGDNVHFQITERTILQDMVKIVKKKTDMHVRDKVLVLLDSWQEAFGGPGGKYP  138

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QY+ AY EL+  GVEFP R  ++ P+FTPP
Sbjct  139  QYYWAYEELRRAGVEFPKRSFDTAPIFTPP  168



>ref|XP_008654770.1| PREDICTED: uncharacterized protein LOC100279184 isoform X1 [Zea 
mays]
 gb|AFW80486.1| putative VHS/GAT domain containing family protein [Zea mays]
Length=707

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A +  +RAT DMLIGPDWA N+E+CDI N +PGQ+KD +K LKKR+G+KNPK+QLLAL +
Sbjct  2    AGSMVDRATRDMLIGPDWAKNMEICDICNRDPGQSKDVVKALKKRIGHKNPKVQLLALTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LET+ KNCG+ +   + ERDILHDMVKIVKKK D  V+EK+L+LIDTWQ+  GG   R+P
Sbjct  62   LETVIKNCGDILHMHVAERDILHDMVKIVKKKSDPRVKEKVLVLIDTWQDVFGGSHARYP  121

Query  702  QYHAAYNELKAFGVEFPPREENSVPLF  782
            QY+AAY+EL   G EFP R E   PLF
Sbjct  122  QYYAAYHELVRAGAEFPKRPEKPAPLF  148



>ref|XP_010256972.1| PREDICTED: target of Myb protein 1-like isoform X1 [Nelumbo nucifera]
Length=634

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 122/160 (76%), Gaps = 6/160 (4%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            M++      E+ATSD+LIGPDW +N+++CD IN N  QAKD +K LK+RL NKNPK+QLL
Sbjct  1    MSSSVTVRVEKATSDLLIGPDWTMNMDICDTINSNHWQAKDVVKALKRRLQNKNPKVQLL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL +LET++KNCG+ +  QI ERD+L +M+KIVKKK D++VR+KILIL+D+WQEA GGP 
Sbjct  61   ALTLLETMTKNCGDYVHFQIAERDVLQEMIKIVKKKTDMHVRDKILILLDSWQEAFGGPG  120

Query  690  GRFPQYHAAYNELKA------FGVEFPPREENSVPLFTPP  791
            G++PQY+ AY EL+        GVEFP R  ++  +FTPP
Sbjct  121  GKYPQYYWAYEELRVSMIDERSGVEFPRRSSDAAQIFTPP  160



>ref|XP_008799838.1| PREDICTED: target of Myb protein 1-like isoform X1 [Phoenix dactylifera]
 ref|XP_008799839.1| PREDICTED: target of Myb protein 1-like isoform X1 [Phoenix dactylifera]
Length=651

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 121/154 (79%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            MA+ A    E+ATS +L+GPDWA+N+E+CD IN +  QAKD +K +KKRL NKNPK+Q L
Sbjct  1    MASSATVRVEKATSHLLMGPDWALNMEICDSINSDQWQAKDVIKAVKKRLQNKNPKVQFL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            +L +LETL KNCG+ +  Q+V+RDIL +M+KIV+KK D+ VR+KIL+L+D+WQEA GGP 
Sbjct  61   SLTLLETLVKNCGDYVHFQVVDRDILEEMIKIVRKKTDMQVRDKILVLLDSWQEAFGGPG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            G+ PQY+ AY ELK +GV FP R  N+ P+FTPP
Sbjct  121  GKHPQYYWAYAELKRYGVVFPQRSANAPPIFTPP  154



>ref|XP_008782607.1| PREDICTED: ADP-ribosylation factor-binding protein GGA1-like 
isoform X1 [Phoenix dactylifera]
Length=624

 Score =   201 bits (511),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 121/153 (79%), Gaps = 0/153 (0%)
 Frame = +3

Query  333  ANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLA  512
            ++ A+   E+ATSD+LIGPDW +N+E+CD IN +  QAKD +K +KKRL +KNPK+Q LA
Sbjct  3    SSSASVRVEKATSDLLIGPDWTLNLEICDSINTDHWQAKDVVKAVKKRLQHKNPKVQFLA  62

Query  513  LFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRG  692
            L +LET+ KNCG+ +  Q+VERDIL DMVKIV+KK D+ VR+KIL+L+D+WQEA GGP G
Sbjct  63   LTLLETMIKNCGDYVHFQVVERDILQDMVKIVRKKTDMQVRDKILVLLDSWQEAFGGPGG  122

Query  693  RFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            ++PQY+ AY +LK  GVEFP R  +S  +FTPP
Sbjct  123  KYPQYYLAYVDLKRSGVEFPQRPPDSTLIFTPP  155



>ref|XP_010922673.1| PREDICTED: target of Myb protein 1-like isoform X1 [Elaeis guineensis]
Length=643

 Score =   201 bits (510),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLL  509
            M++ A    E+ATS +L+GPDWA+N+E+CD IN +  QA+D +K +KKRL NKNPK+Q L
Sbjct  1    MSSSATVRVEKATSHLLMGPDWALNMEICDSINSDQWQARDVIKAVKKRLQNKNPKVQFL  60

Query  510  ALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPR  689
            AL +LETL KNCG+ +  Q+VERDIL +M+KIV+KK D+ VR+KIL+L+D+WQEA GGP 
Sbjct  61   ALTLLETLVKNCGDYVHFQVVERDILEEMIKIVRKKTDMQVRDKILVLLDSWQEAFGGPG  120

Query  690  GRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            G+ PQY+ AY ELK  GV FP R  N+ P+FTPP
Sbjct  121  GKHPQYYWAYAELKRSGVVFPQRSANAPPIFTPP  154



>ref|XP_009623810.1| PREDICTED: target of Myb protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=709

 Score =   201 bits (512),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            E+ATS+ LIGPDW +NI++CD IN N   AKD  K +KKRL +KNPK+QLLAL +LET+ 
Sbjct  25   EKATSEFLIGPDWTINIDICDTINSNHWLAKDVAKAVKKRLQHKNPKVQLLALTLLETMV  84

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+N+  QI ER IL DMVKIVKKK D++VR+K+L+L+D+WQEA GGP G++PQY+ A
Sbjct  85   KNCGDNVHFQIAERSILQDMVKIVKKKTDMHVRDKVLVLLDSWQEAFGGPGGKYPQYYWA  144

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y EL+  GVEFP R  ++ P+FTPP
Sbjct  145  YEELRRAGVEFPKRSFDTAPIFTPP  169



>ref|XP_009766354.1| PREDICTED: target of Myb protein 1-like [Nicotiana sylvestris]
Length=719

 Score =   201 bits (511),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            E+ATS+ LIGPDW +NI++CD IN N   AKD +K +KKRL +KNPK+QLL+L +LET+ 
Sbjct  35   EKATSEFLIGPDWTINIDICDTINSNHWLAKDVVKAVKKRLQHKNPKVQLLSLTLLETMV  94

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+N+  QI ER IL DMVKIVKKK D++VR+K+L+L+D+WQEA GGP G++PQY+ A
Sbjct  95   KNCGDNVHFQIAERSILQDMVKIVKKKTDMHVRDKVLVLLDSWQEAFGGPGGKYPQYYWA  154

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y EL+  GVEFP R  ++ P+FTPP
Sbjct  155  YEELRRAGVEFPKRSFDTAPIFTPP  179



>ref|XP_009623811.1| PREDICTED: target of Myb protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=703

 Score =   201 bits (511),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            E+ATS+ LIGPDW +NI++CD IN N   AKD  K +KKRL +KNPK+QLLAL +LET+ 
Sbjct  19   EKATSEFLIGPDWTINIDICDTINSNHWLAKDVAKAVKKRLQHKNPKVQLLALTLLETMV  78

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+N+  QI ER IL DMVKIVKKK D++VR+K+L+L+D+WQEA GGP G++PQY+ A
Sbjct  79   KNCGDNVHFQIAERSILQDMVKIVKKKTDMHVRDKVLVLLDSWQEAFGGPGGKYPQYYWA  138

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y EL+  GVEFP R  ++ P+FTPP
Sbjct  139  YEELRRAGVEFPKRSFDTAPIFTPP  163



>gb|EMS50126.1| TOM1-like protein 2 [Triticum urartu]
Length=701

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 120/165 (73%), Gaps = 20/165 (12%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLAL-------  515
            +RATS+ LIGPDW++N+E+CDI+N +P QAKD +K +KKR+G+KN KIQLLAL       
Sbjct  8    DRATSESLIGPDWSLNLEICDILNHDPSQAKDVVKSIKKRIGHKNSKIQLLALTLARAKK  67

Query  516  -------------FVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILI  656
                          +LETL KNCG+ +   + ERDILH+MVKIVKKKPD +V+EKILILI
Sbjct  68   TLKRLQSALQHHCMLLETLIKNCGDFVHMHVAERDILHEMVKIVKKKPDYHVKEKILILI  127

Query  657  DTWQEALGGPRGRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            DTWQEA GG R R+PQY+AAY EL   G  FP R E+SVP++TPP
Sbjct  128  DTWQEAFGGARARYPQYYAAYQELLRAGAVFPQRSESSVPIYTPP  172



>ref|XP_006374041.1| hypothetical protein POPTR_0016s13940g [Populus trichocarpa]
 gb|ERP51838.1| hypothetical protein POPTR_0016s13940g [Populus trichocarpa]
Length=731

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 138/213 (65%), Gaps = 5/213 (2%)
 Frame = +3

Query  168  SFYFFLVDFGL*SSTY---TRFLLCCILQLVDFFLCLVSY*--GDQSSVNLTDLGDCTNM  332
            SF FFL  + L SS+Y   +R    C            +    G++       +G     
Sbjct  23   SFSFFLAFYYLSSSSYHNHSRLQFSCQTNTTQKTREKEARKRKGERLMARAMGMGMGLGS  82

Query  333  ANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLA  512
            ++ A    ++ATSD+LIGPDW +NI++CD +N N  Q KD +K LKKRL +K+P++QLLA
Sbjct  83   SSSATVAVDKATSDLLIGPDWTMNIDICDSVNSNYWQPKDVVKALKKRLQHKSPRVQLLA  142

Query  513  LFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRG  692
            L +LET+ KNCG+ +  QI ER+IL +MVKIVKKK D++VR+KIL LID+WQEA GGP G
Sbjct  143  LTLLETMVKNCGDYVHFQIAERNILGEMVKIVKKKTDMHVRDKILALIDSWQEAFGGPGG  202

Query  693  RFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            +  QY+ AY EL+  GV+FP R  N+ P+FTPP
Sbjct  203  KHSQYYWAYEELRRAGVQFPQRSSNAAPIFTPP  235



>ref|XP_004137684.1| PREDICTED: TOM1-like protein 2 [Cucumis sativus]
 gb|KGN58706.1| hypothetical protein Csa_3G730700 [Cucumis sativus]
Length=689

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A    E+ATSD+LI PDW +NI++CD IN N  QAKD +K +K+RL ++NPK+QLL+L +
Sbjct  9    ATVAVEKATSDLLISPDWTMNIDICDSINSNHWQAKDVMKAVKRRLQHRNPKVQLLSLTL  68

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            +ET+ KNCG+ +  QI ER+IL +M+KIVKKK D+NVR+K+L+L+D+WQEA GGP G+ P
Sbjct  69   IETMVKNCGDYVHFQIAERNILGEMIKIVKKKADMNVRDKVLVLLDSWQEAFGGPGGKHP  128

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QY+ AY+EL+  G+EFP R  N+ P+FTPP
Sbjct  129  QYYWAYDELRRSGIEFPRRSLNAAPIFTPP  158



>ref|XP_010921084.1| PREDICTED: probable ADP-ribosylation factor-binding protein C1F3.05 
isoform X1 [Elaeis guineensis]
Length=641

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 121/153 (79%), Gaps = 0/153 (0%)
 Frame = +3

Query  333  ANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLA  512
            ++ A+   E+ATSD+LIGPDW +N+E+CD IN +  QAKD +K +KKRL +K+PK+Q LA
Sbjct  3    SSSASVRVEKATSDLLIGPDWTLNMEICDSINSDQWQAKDVVKAVKKRLQHKSPKVQFLA  62

Query  513  LFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRG  692
            L +LET+ KNCG+ +  Q+VERDIL +MVKIV+KK D+ VR+KIL+L+D+WQEA GGP G
Sbjct  63   LTLLETMIKNCGDYVHFQVVERDILQEMVKIVRKKTDMQVRDKILVLLDSWQEAFGGPGG  122

Query  693  RFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            ++PQY+ AY +LK  GVEFP R  +S  +FTPP
Sbjct  123  KYPQYYLAYADLKRSGVEFPQRTPDSTLIFTPP  155



>ref|XP_008442341.1| PREDICTED: TOM1-like protein 2 [Cucumis melo]
Length=689

 Score =   198 bits (504),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A    ++ATSD+LI PDW +NI++CD IN N  QAKD +K +K+RL ++NPK+QLL+L +
Sbjct  9    ATVAVDKATSDLLISPDWTMNIDICDSINSNHWQAKDVMKAVKRRLQHRNPKVQLLSLTL  68

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            +ET+ KNCG+ +  QI ER+IL +M+KIVKKK D+NVR+K+L+L+D+WQEA GGP G+ P
Sbjct  69   IETMVKNCGDYVHFQIAERNILGEMIKIVKKKADMNVRDKVLVLLDSWQEAFGGPGGKHP  128

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QY+ AY+EL+  G+EFP R  N+ P+FTPP
Sbjct  129  QYYWAYDELRRSGIEFPKRSLNAAPIFTPP  158



>ref|XP_008466043.1| PREDICTED: target of Myb protein 1-like isoform X1 [Cucumis melo]
 ref|XP_008466044.1| PREDICTED: target of Myb protein 1-like isoform X1 [Cucumis melo]
 ref|XP_008466045.1| PREDICTED: target of Myb protein 1-like isoform X1 [Cucumis melo]
Length=662

 Score =   198 bits (503),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATSDMLIGPDWA N+E+CD+IN + GQ KD +K +KKRLG+K+PK+QLLAL +LET+ 
Sbjct  7    ERATSDMLIGPDWAANMEICDMINRDYGQTKDVVKGIKKRLGSKHPKVQLLALTLLETIF  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG      + E++I HDMVKIVKKK DL V+EKIL+LIDTWQ+ALGGP GR+PQY+AA
Sbjct  67   KNCGNISHAHVAEKEIPHDMVKIVKKKCDLRVQEKILLLIDTWQDALGGPTGRYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTP  788
            Y EL   G  FP + E   P FTP
Sbjct  127  YQELLRAGAVFPHKSEGPAPGFTP  150



>gb|KGN60332.1| hypothetical protein Csa_3G895780 [Cucumis sativus]
Length=638

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATSDMLIGPDWA N+E+CD+IN + GQ KD +K +KKRLG+K+PK+QLLAL +LET+ 
Sbjct  7    ERATSDMLIGPDWAANMEICDMINRDYGQTKDVVKGIKKRLGSKHPKVQLLALTLLETIF  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG      + E++I HDMVKIVKK+PDL V+EKIL+LIDTWQEALGG  GR+PQY+AA
Sbjct  67   KNCGNISHAHMAEKEIPHDMVKIVKKRPDLRVQEKILLLIDTWQEALGGSTGRYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTP  788
            Y EL   G  FP + E   P FTP
Sbjct  127  YQELLRAGAVFPHKSEIPAPGFTP  150



>ref|XP_004136216.1| PREDICTED: target of Myb protein 1-like [Cucumis sativus]
Length=659

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATSDMLIGPDWA N+E+CD+IN + GQ KD +K +KKRLG+K+PK+QLLAL +LET+ 
Sbjct  7    ERATSDMLIGPDWAANMEICDMINRDYGQTKDVVKGIKKRLGSKHPKVQLLALTLLETIF  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG      + E++I HDMVKIVKK+PDL V+EKIL+LIDTWQEALGG  GR+PQY+AA
Sbjct  67   KNCGNISHAHMAEKEIPHDMVKIVKKRPDLRVQEKILLLIDTWQEALGGSTGRYPQYYAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTP  788
            Y EL   G  FP + E   P FTP
Sbjct  127  YQELLRAGAVFPHKSEIPAPGFTP  150



>ref|XP_002267147.1| PREDICTED: TOM1-like protein 2 [Vitis vinifera]
Length=625

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A    E+ATSD+LIGPDW +NI++CD IN N  QAK+ +K +K+RL +KNPK+QLLAL +
Sbjct  15   ATVRVEKATSDLLIGPDWTMNIDICDTINSNHWQAKEVVKAVKRRLQHKNPKVQLLALTL  74

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            +ET+ KNCG+ +  QI ER IL +M+KIVKKK D+ VREKIL L+D+WQEA GGP G+ P
Sbjct  75   VETMVKNCGDYVHFQITERAILQEMIKIVKKKADMQVREKILALLDSWQEAFGGPGGKHP  134

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QY+ AY EL+  GVEFP R  ++ P+FTPP
Sbjct  135  QYYWAYEELRRAGVEFPKRSLDAAPIFTPP  164



>ref|XP_011003578.1| PREDICTED: target of Myb protein 1-like [Populus euphratica]
Length=700

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = +3

Query  333  ANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLA  512
            ++ A    ++ATSD+LIGPDW +NI++CD +N N  QAKD +K LKKRL +K+P++QLLA
Sbjct  14   SSSATVAVDKATSDLLIGPDWTMNIDICDSVNSNYWQAKDVVKALKKRLQHKSPRVQLLA  73

Query  513  LFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRG  692
            L +LET+ KNCG+ +  QI ER+IL +MVKIVKKK D++VR+KIL LID+WQEA GGP G
Sbjct  74   LTLLETMVKNCGDYVHFQIAERNILGEMVKIVKKKTDMHVRDKILALIDSWQEAFGGPGG  133

Query  693  RFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            +  QY+ AY EL+  GV+FP R  N+ P+FTPP
Sbjct  134  KHSQYYWAYEELRRAGVQFPQRSSNAAPIFTPP  166



>gb|ABR17546.1| unknown [Picea sitchensis]
Length=595

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A++  ERATSDMLIGPDWA+NIE+CDI++ + GQAKD +K +KKRL NKN K+QLL+L +
Sbjct  2    ASSLVERATSDMLIGPDWAMNIEICDIVSSDQGQAKDVVKAVKKRLVNKNSKVQLLSLTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LETL KNCG+ +  Q+ ERD+LH+MVK+VKKK DL+V+EK+L+LIDTWQEA G   GR+P
Sbjct  62   LETLIKNCGDPVHLQVAERDVLHEMVKLVKKKADLHVKEKVLVLIDTWQEAFGRSGGRYP  121

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QY+AAY+EL   GV FP R E+S P+ TPP
Sbjct  122  QYYAAYHELVRAGVRFPQRAESSAPIHTPP  151



>gb|EYU29271.1| hypothetical protein MIMGU_mgv1a004368mg [Erythranthe guttata]
Length=531

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATSDMLIGPDWA+NIE+CDI N +P QAKD ++ +KKR+ +K+ K+Q+LAL +LET+ 
Sbjct  7    ERATSDMLIGPDWAMNIEICDICNHDPAQAKDVVRGIKKRIRSKSSKVQILALTLLETIV  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNC + I   + E+++ H+MV+IVKKKP+  V+EKILILIDTWQEA GGPR R+PQY  A
Sbjct  67   KNCSDIIHMHVAEKELPHEMVRIVKKKPEFRVKEKILILIDTWQEAFGGPRARYPQYFIA  126

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y EL   G  FP R + S P+FTPP
Sbjct  127  YQELLRLGAVFPRRPDTSAPVFTPP  151



>ref|XP_010227670.1| PREDICTED: TOM1-like protein 2 isoform X2 [Brachypodium distachyon]
Length=470

 Score =   192 bits (488),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            +RATS+ LIGPDW++N+E+CDI+N +P QAKD +K +KKR+G+KN KIQLL+L +LETL 
Sbjct  8    DRATSESLIGPDWSLNLEICDILNHDPSQAKDVVKSIKKRIGHKNSKIQLLSLTLLETLI  67

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + ERDILH+MVKIVKKKPD +V+EKIL LIDTWQEA GG R R+PQY+AA
Sbjct  68   KNCGDFVHMHVAERDILHEMVKIVKKKPDYHVKEKILSLIDTWQEAFGGARARYPQYYAA  127

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y EL   G  FP R E+SVP++TPP
Sbjct  128  YQELLRTGAVFPQRSESSVPIYTPP  152



>ref|XP_006593778.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase 
substrate-like isoform X4 [Glycine max]
Length=498

 Score =   192 bits (489),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 112/176 (64%), Gaps = 55/176 (31%)
 Frame = +3

Query  330  MANDAAACAERATSDMLIGPDWAVNIELCDIININPG----------------------Q  443
            MAN+AAACAERATSDMLIGPDWA+NIELCDIIN++P                       Q
Sbjct  1    MANNAAACAERATSDMLIGPDWAINIELCDIINMDPRICFIYLLRNDQETSCLIGHVFWQ  60

Query  444  AKDALKILKKRLGNKNPKIQLLALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPD  623
            AKDA+KILKKRL +KNP+IQLLALF                                 PD
Sbjct  61   AKDAIKILKKRLSSKNPQIQLLALF---------------------------------PD  87

Query  624  LNVREKILILIDTWQEALGGPRGRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            L VREKILILIDTWQEA GGP G++PQY AAYNELK+ GVEFPPREENS P FTPP
Sbjct  88   LRVREKILILIDTWQEAFGGPSGKYPQYLAAYNELKSAGVEFPPREENSAPFFTPP  143



>ref|XP_010091105.1| TOM1-like protein 2 [Morus notabilis]
 gb|EXB42395.1| TOM1-like protein 2 [Morus notabilis]
Length=661

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 117/150 (78%), Gaps = 0/150 (0%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
            A    E+ATSD+LI PDW +NI++CD +N +  QAKD +K LK+RL +KN K+QLL+L +
Sbjct  14   ATVAVEKATSDLLISPDWTMNIDICDSVNSHHWQAKDVVKALKRRLQHKNSKVQLLSLTL  73

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFP  701
            LET+ KNCG+ +  QI ER+IL +M+KIVKKK D+ VREKIL+L+D+WQEA GGP G++P
Sbjct  74   LETMVKNCGDYVHFQIAERNILGEMIKIVKKKADMQVREKILVLLDSWQEAFGGPGGKYP  133

Query  702  QYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            QY+ AY EL+  GVEFP R  ++ P+FTPP
Sbjct  134  QYYWAYEELRRSGVEFPKRSLDASPIFTPP  163



>gb|EMT25957.1| TOM1-like protein 2 [Aegilops tauschii]
Length=723

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 117/161 (73%), Gaps = 14/161 (9%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLAL--  515
            A A  +RATSDMLIGPDWA N+E+CDI N +PGQ+KD +K L+KR+ +KNPK+QLLAL  
Sbjct  2    AGAMVDRATSDMLIGPDWAKNMEICDICNRDPGQSKDVVKALRKRIAHKNPKVQLLALTF  61

Query  516  ----------FV--LETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILID  659
                      FV  LET  KNCG+     + ERD+LH+MVK+VKKK D  V++KIL+LID
Sbjct  62   HVSLVYDSLWFVGLLETAIKNCGDIFHMHVAERDLLHEMVKLVKKKSDQRVKDKILVLID  121

Query  660  TWQEALGGPRGRFPQYHAAYNELKAFGVEFPPREENSVPLF  782
            TWQEALGGPR R+PQ++AAY+EL   G +FP R E   PLF
Sbjct  122  TWQEALGGPRSRYPQFYAAYHELVRAGAQFPKRSERPAPLF  162



>dbj|BAK05686.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=666

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            +RATS+ LIGPDW++N+E+CDI+N +P QAKD +K +KKR+G+KN KIQLLAL +LETL 
Sbjct  8    DRATSESLIGPDWSLNLEICDILNHDPSQAKDVVKSIKKRIGHKNSKIQLLALTLLETLI  67

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + ERDILH+MVKIVKKKPD +V+EKILILIDTWQEA GG R R+PQY+AA
Sbjct  68   KNCGDFVHMHVAERDILHEMVKIVKKKPDYHVKEKILILIDTWQEAFGGARARYPQYYAA  127

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y EL   G  FP R E+SVP++TPP
Sbjct  128  YQELLRAGAVFPQRSESSVPIYTPP  152



>ref|XP_010254072.1| PREDICTED: target of Myb protein 1-like isoform X1 [Nelumbo nucifera]
 ref|XP_010254073.1| PREDICTED: target of Myb protein 1-like isoform X1 [Nelumbo nucifera]
 ref|XP_010254075.1| PREDICTED: target of Myb protein 1-like isoform X1 [Nelumbo nucifera]
Length=715

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATSDMLIGPDWA+NIE+CDI+N NPGQ +D +K +KKRLG+KNPK+QLLAL +LETL 
Sbjct  7    ERATSDMLIGPDWAMNIEICDILNHNPGQVRDVVKGIKKRLGSKNPKVQLLALTLLETLV  66

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + +RDILH+MVKIVKKKPD +V+EKIL LIDTWQEA GGPR R+PQY AA
Sbjct  67   KNCGDIVHMHVADRDILHEMVKIVKKKPDFHVKEKILTLIDTWQEAFGGPRARYPQYFAA  126

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y+EL   G  FP + E + P  T P
Sbjct  127  YHELLRAGAVFPQKYEKATPALTHP  151



>ref|XP_008789328.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase 
substrate-like [Phoenix dactylifera]
Length=659

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
              + A RATS MLIGPDWA+N+E+CDI + +PGQAKD +K LKKRL +KNPK+QLLAL +
Sbjct  2    TGSLANRATSTMLIGPDWAMNMEICDICSRDPGQAKDVVKGLKKRLRHKNPKVQLLALTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKK-PDLNVREKILILIDTWQEALGGPRGRF  698
            LET+ KNCG+ +   + E+DILH+MV IV+KK  D+NV+EK+L+LIDTWQEA+GGP+ R+
Sbjct  62   LETMVKNCGDIVHMHVAEKDILHEMVMIVRKKQADINVKEKVLLLIDTWQEAIGGPQARY  121

Query  699  PQYHAAYNELKAFGVEFPPREENSVPLF  782
            PQY+AAY EL   G  F  R E S P+F
Sbjct  122  PQYYAAYQELLRGGAVFSRRPERSAPIF  149



>ref|XP_012089726.1| PREDICTED: target of Myb protein 1-like [Jatropha curcas]
 gb|KDP22799.1| hypothetical protein JCGZ_00386 [Jatropha curcas]
Length=747

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            E+ATSD+LIGPDW +NI++CD +N N   AKD +K +KKRL +KNPK+QLLAL +LET+ 
Sbjct  18   EKATSDLLIGPDWTMNIDICDSVNSNHWLAKDVVKAVKKRLQHKNPKVQLLALTLLETMV  77

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +  QI E++IL +MV+IVKKK D++VR+KIL+L+D+WQEA GGP G+ PQY+ A
Sbjct  78   KNCGDFVHFQIAEKNILGEMVRIVKKKSDMHVRDKILVLLDSWQEAFGGPGGKHPQYYWA  137

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y EL+  GVEFP R  ++ P+FTPP
Sbjct  138  YEELRRSGVEFPQRSLDAAPIFTPP  162



>gb|EMT09634.1| Target of Myb protein 1 [Aegilops tauschii]
Length=738

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            +RATSD LIGPDWA N+E+CD +N +PGQ KD +K LKKR+ +KN K+QLLAL +LET+ 
Sbjct  11   QRATSDALIGPDWATNLEICDTLNRDPGQTKDVVKSLKKRIAHKNSKVQLLALTLLETMI  70

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + ERDIL +MVKIVKK+PD +V+EKIL LIDTWQE  GG R ++PQY+A+
Sbjct  71   KNCGDIVHMHVAERDILREMVKIVKKRPDYHVKEKILTLIDTWQEFFGGARSKYPQYYAS  130

Query  717  YNELKAFGVEFPPREENSVPLFTP  788
            Y +L   G  FP R   SVP+FTP
Sbjct  131  YQDLLRAGAVFPQRSNGSVPIFTP  154



>gb|EMT01224.1| TOM1-like protein 2 [Aegilops tauschii]
Length=765

 Score =   194 bits (494),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            +RATS+ LIGPDW++N+E+CDI+N +P QAKD +K +KKR+G+KN KIQLLAL +LETL 
Sbjct  8    DRATSESLIGPDWSLNLEICDILNHDPSQAKDVVKSIKKRIGHKNSKIQLLALTLLETLI  67

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + ERDILH+MVKIVKKKPD +V+EKILILIDTWQEA GG R R+PQY+AA
Sbjct  68   KNCGDFVHMHVAERDILHEMVKIVKKKPDYHVKEKILILIDTWQEAFGGARARYPQYYAA  127

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y EL   G  FP R E+SVP++TPP
Sbjct  128  YQELLRAGAVFPQRSESSVPIYTPP  152



>emb|CDX75282.1| BnaA01g04200D [Brassica napus]
Length=651

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KK++G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPVQAKDVVKGVKKKIGSRNPKTQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+I KKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIAKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_002533826.1| protein transporter, putative [Ricinus communis]
 gb|EEF28561.1| protein transporter, putative [Ricinus communis]
Length=734

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            E+ATSD+LIGPDW +NI++CD +N N   AKD +K +KKRL +KNPK+QLLAL +LET+ 
Sbjct  14   EKATSDLLIGPDWTMNIDICDSLNSNRWLAKDVVKAVKKRLQHKNPKVQLLALTLLETMV  73

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +  QI E++IL +MV+IVKKK D++VR+KIL+L+D+WQEA GGP G+ PQY+ A
Sbjct  74   KNCGDYVHFQIAEKNILGEMVRIVKKKTDMHVRDKILVLLDSWQEAFGGPGGKHPQYYWA  133

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y EL+  GVEFP R  ++ P+FTPP
Sbjct  134  YEELRRSGVEFPQRSMDAAPIFTPP  158



>emb|CDX68888.1| BnaC01g05650D [Brassica napus]
Length=645

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KK++G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPVQAKDVVKGVKKKIGSRNPKTQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+I KKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIAKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_002308242.2| VHS domain-containing family protein [Populus trichocarpa]
 gb|EEE91765.2| VHS domain-containing family protein [Populus trichocarpa]
Length=641

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = +3

Query  312  LGDCTNMANDAAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKN  491
            +G     ++ A    ++ATSD+LIGPDW +NI++CD +N +  QAKD +K LKKRL +K+
Sbjct  5    MGMGLGSSSSATVAVDKATSDLLIGPDWTMNIDICDSVNSHHWQAKDVVKALKKRLQHKS  64

Query  492  PKIQLLALFVLETLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQE  671
            PK+QLLAL +LET+ KNCG+ +  QI E+++L +MVKI+KKK D++VR+KIL L+D+WQE
Sbjct  65   PKVQLLALTLLETMVKNCGDYVHFQIAEKNVLGEMVKIIKKKTDMHVRDKILALLDSWQE  124

Query  672  ALGGPRGRFPQYHAAYNELKAFGVEFPPREENSVPLFTPP  791
            A GGP G+ PQY+ AY EL+  GVEFP R  ++ P+FTPP
Sbjct  125  AFGGPGGKHPQYYWAYEELRRAGVEFPQRSLDAAPIFTPP  164



>ref|XP_010920465.1| PREDICTED: TOM1-like protein 2 [Elaeis guineensis]
Length=662

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 115/149 (77%), Gaps = 1/149 (1%)
 Frame = +3

Query  342  AAACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFV  521
              + A RATS MLIGPDWA+N+E+CDI N + GQAKD +K LKKRL +KNPK+QLLAL +
Sbjct  2    TGSLANRATSTMLIGPDWAMNMEICDICNRDSGQAKDVVKGLKKRLRHKNPKVQLLALTL  61

Query  522  LETLSKNCGENIFQQIVERDILHDMVKIVKKK-PDLNVREKILILIDTWQEALGGPRGRF  698
            LET+ KNC + +   + E+DILH+MV I++KK  D+ V+EK+L+LIDTWQEALGGP+ R+
Sbjct  62   LETMIKNCSDIVHMHVAEKDILHEMVTIMRKKQADIQVKEKVLLLIDTWQEALGGPQARY  121

Query  699  PQYHAAYNELKAFGVEFPPREENSVPLFT  785
            PQY+AAY EL   G  FP R E S P+F+
Sbjct  122  PQYYAAYQELLHLGAVFPRRPERSAPIFS  150



>ref|XP_004965472.1| PREDICTED: target of Myb protein 1-like [Setaria italica]
Length=685

 Score =   193 bits (491),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATS+ LIGPDW++N+E+CDI+N +P QAKD +K +KKR+G+KN K+QLLAL +LETL 
Sbjct  8    ERATSESLIGPDWSLNLEICDILNHDPSQAKDVVKTIKKRIGHKNSKVQLLALTLLETLI  67

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +  Q+ E+DILH+MVKI KKKPD +V+EKILILIDTWQEA GG R R+PQY+AA
Sbjct  68   KNCGDFVHMQVAEKDILHEMVKIAKKKPDYHVKEKILILIDTWQEAFGGARARYPQYYAA  127

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y E+   G  FP R E+SVP++TPP
Sbjct  128  YQEMLRAGAVFPQRPESSVPIYTPP  152



>ref|XP_009125501.1| PREDICTED: TOM1-like protein 2 isoform X2 [Brassica rapa]
Length=652

 Score =   193 bits (490),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KK++G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPVQAKDVVKGVKKKIGSRNPKTQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+I KKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIAKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_009125493.1| PREDICTED: TOM1-like protein 2 isoform X1 [Brassica rapa]
Length=653

 Score =   193 bits (490),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            A  ERATS+MLIGPDWA+N+E+CD++N +P QAKD +K +KK++G++NPK QLLAL +LE
Sbjct  4    AMVERATSEMLIGPDWAMNLEICDMLNSDPVQAKDVVKGVKKKIGSRNPKTQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+ ++H+MV+I KKKPD +V+EKIL+LIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDMVHMHVAEKGVIHEMVRIAKKKPDFHVKEKILVLIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
            +A Y EL   G  FP R E S P+FTPP
Sbjct  124  YAGYQELLRAGAVFPQRSERSAPVFTPP  151



>ref|XP_002437041.1| hypothetical protein SORBIDRAFT_10g019670 [Sorghum bicolor]
 gb|EER88408.1| hypothetical protein SORBIDRAFT_10g019670 [Sorghum bicolor]
Length=675

 Score =   192 bits (489),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            ERATS+ LIGPDW++N+E+CDI+N +P QAKD +K +KKR+G+KN K+QLLAL +LETL 
Sbjct  8    ERATSESLIGPDWSLNLEICDILNHDPSQAKDVVKTIKKRIGHKNSKVQLLALTLLETLI  67

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +  Q+ E+DILH+MVKI KKKPD +V+EKILILIDTWQEA GG R R+PQY+AA
Sbjct  68   KNCGDFVHMQVAEKDILHEMVKIAKKKPDYHVKEKILILIDTWQEAFGGARARYPQYYAA  127

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y E+   G  FP R E++VP++TPP
Sbjct  128  YQEMLRAGAVFPQRPESTVPIYTPP  152



>ref|XP_003563837.1| PREDICTED: ADP-ribosylation factor-binding protein GGA3-like 
isoform X1 [Brachypodium distachyon]
Length=663

 Score =   192 bits (489),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  357  ERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLETLS  536
            +RATS+ LIGPDW++N+E+CDI+N +P QAKD +K +KKR+G+KN KIQLL+L +LETL 
Sbjct  8    DRATSESLIGPDWSLNLEICDILNHDPSQAKDVVKSIKKRIGHKNSKIQLLSLTLLETLI  67

Query  537  KNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQYHAA  716
            KNCG+ +   + ERDILH+MVKIVKKKPD +V+EKIL LIDTWQEA GG R R+PQY+AA
Sbjct  68   KNCGDFVHMHVAERDILHEMVKIVKKKPDYHVKEKILSLIDTWQEAFGGARARYPQYYAA  127

Query  717  YNELKAFGVEFPPREENSVPLFTPP  791
            Y EL   G  FP R E+SVP++TPP
Sbjct  128  YQELLRTGAVFPQRSESSVPIYTPP  152



>ref|XP_011090403.1| PREDICTED: TOM1-like protein 2 [Sesamum indicum]
Length=663

 Score =   192 bits (488),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 110/148 (74%), Gaps = 0/148 (0%)
 Frame = +3

Query  348  ACAERATSDMLIGPDWAVNIELCDIININPGQAKDALKILKKRLGNKNPKIQLLALFVLE  527
            +  ERATSD+LIGPDWA+NIE+ DI N +P QAKD +K +K RL +K PK+QLLAL +LE
Sbjct  4    SMVERATSDLLIGPDWAMNIEISDICNHDPAQAKDVVKGIKARLRSKKPKVQLLALTLLE  63

Query  528  TLSKNCGENIFQQIVERDILHDMVKIVKKKPDLNVREKILILIDTWQEALGGPRGRFPQY  707
            T+ KNCG+ +   + E+++ H+MVK+VKKKPD +V EKILILIDTWQEA GGPR R+PQY
Sbjct  64   TIVKNCGDIVHMHVAEKELPHEMVKMVKKKPDFHVTEKILILIDTWQEAFGGPRARYPQY  123

Query  708  HAAYNELKAFGVEFPPREENSVPLFTPP  791
              AY EL   G  FP R E S P F  P
Sbjct  124  FVAYQELLRLGTVFPQRAETSAPNFAAP  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1600433394064