BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7396

Length=685
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006342320.1|  PREDICTED: TBCC domain-containing protein 1-...    329   5e-106   Solanum tuberosum [potatoes]
ref|XP_009629812.1|  PREDICTED: TBCC domain-containing protein 1-...    328   2e-105   Nicotiana tomentosiformis
ref|XP_009772589.1|  PREDICTED: TBCC domain-containing protein 1-...    323   6e-104   Nicotiana sylvestris
ref|XP_006351339.1|  PREDICTED: TBCC domain-containing protein 1-...    322   3e-103   Solanum tuberosum [potatoes]
ref|XP_009629687.1|  PREDICTED: TBCC domain-containing protein 1-...    320   1e-102   Nicotiana tomentosiformis
ref|XP_004249279.1|  PREDICTED: TBCC domain-containing protein 1        317   2e-101   Solanum lycopersicum
ref|XP_009797552.1|  PREDICTED: TBCC domain-containing protein 1-...    316   7e-101   Nicotiana sylvestris
emb|CDP20019.1|  unnamed protein product                                312   3e-99    Coffea canephora [robusta coffee]
ref|XP_002278205.1|  PREDICTED: TBCC domain-containing protein 1-...    291   3e-91    Vitis vinifera
ref|XP_008240959.1|  PREDICTED: TBCC domain-containing protein 1 ...    288   4e-90    Prunus mume [ume]
ref|XP_008240958.1|  PREDICTED: TBCC domain-containing protein 1 ...    288   4e-90    Prunus mume [ume]
ref|XP_007203759.1|  hypothetical protein PRUPE_ppa003584mg             285   5e-89    Prunus persica
gb|KJB82777.1|  hypothetical protein B456_013G212400                    277   2e-88    Gossypium raimondii
ref|XP_010548390.1|  PREDICTED: TBCC domain-containing protein 1-...    283   5e-88    Tarenaya hassleriana [spider flower]
ref|XP_008367539.1|  PREDICTED: TBCC domain-containing protein 1-...    276   7e-88    
ref|XP_003520533.1|  PREDICTED: TBCC domain-containing protein 1-...    281   1e-87    Glycine max [soybeans]
gb|KJB82778.1|  hypothetical protein B456_013G212400                    277   1e-87    Gossypium raimondii
ref|XP_003554199.1|  PREDICTED: TBCC domain-containing protein 1-...    281   2e-87    Glycine max [soybeans]
ref|XP_009369834.1|  PREDICTED: TBCC domain-containing protein 1-...    280   4e-87    Pyrus x bretschneideri [bai li]
ref|XP_009369843.1|  PREDICTED: TBCC domain-containing protein 1-...    280   4e-87    Pyrus x bretschneideri [bai li]
gb|KHF98763.1|  TBCC domain-containing 1                                281   4e-87    Gossypium arboreum [tree cotton]
gb|EYU39914.1|  hypothetical protein MIMGU_mgv1a003654mg                280   6e-87    Erythranthe guttata [common monkey flower]
ref|XP_010257397.1|  PREDICTED: TBCC domain-containing protein 1-...    280   7e-87    Nelumbo nucifera [Indian lotus]
ref|XP_012087738.1|  PREDICTED: TBCC domain-containing protein 1        279   8e-87    Jatropha curcas
ref|XP_008393107.1|  PREDICTED: uncharacterized protein LOC103455298    276   9e-87    
gb|KGN54813.1|  hypothetical protein Csa_4G507430                       278   2e-86    Cucumis sativus [cucumbers]
ref|XP_004146385.1|  PREDICTED: TBCC domain-containing protein 1-...    278   2e-86    Cucumis sativus [cucumbers]
ref|NP_973669.1|  C-CAP/cofactor C-like domain-containing protein       278   2e-86    Arabidopsis thaliana [mouse-ear cress]
ref|NP_181752.3|  C-CAP/cofactor C-like domain-containing protein       278   3e-86    
gb|AGJ83863.1|  tublin binding cofactor C                               278   3e-86    Gossypium hirsutum [American cotton]
ref|XP_011468069.1|  PREDICTED: TBCC domain-containing protein 1 ...    278   3e-86    Fragaria vesca subsp. vesca
gb|KFK35082.1|  hypothetical protein AALP_AA5G233000                    278   4e-86    Arabis alpina [alpine rockcress]
ref|XP_004304384.1|  PREDICTED: TBCC domain-containing protein 1 ...    278   4e-86    Fragaria vesca subsp. vesca
ref|XP_010111391.1|  TBCC domain-containing protein 1                   282   4e-86    
ref|XP_010507501.1|  PREDICTED: uncharacterized protein LOC104784134    276   5e-86    Camelina sativa [gold-of-pleasure]
gb|KJB82780.1|  hypothetical protein B456_013G212400                    276   7e-86    Gossypium raimondii
gb|KJB15037.1|  hypothetical protein B456_002G156800                    275   2e-85    Gossypium raimondii
ref|XP_007162300.1|  hypothetical protein PHAVU_001G140500g             276   2e-85    Phaseolus vulgaris [French bean]
gb|KJB82776.1|  hypothetical protein B456_013G212400                    276   2e-85    Gossypium raimondii
ref|NP_567059.1|  Tubulin binding cofactor C domain-containing pr...    276   2e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007028946.1|  Tubulin binding cofactor C domain-containing...    275   2e-85    
ref|XP_010427682.1|  PREDICTED: TBCC domain-containing protein 1-...    276   3e-85    Camelina sativa [gold-of-pleasure]
ref|XP_003554198.1|  PREDICTED: TBCC domain-containing protein 1-...    275   3e-85    Glycine max [soybeans]
gb|KJB15036.1|  hypothetical protein B456_002G156800                    275   3e-85    Gossypium raimondii
ref|XP_010524365.1|  PREDICTED: TBCC domain-containing protein 1-...    275   4e-85    Tarenaya hassleriana [spider flower]
gb|KJB15038.1|  hypothetical protein B456_002G156800                    275   4e-85    Gossypium raimondii
ref|XP_006290821.1|  hypothetical protein CARUB_v10016930mg             275   6e-85    Capsella rubella
ref|XP_009104081.1|  PREDICTED: LOW QUALITY PROTEIN: TBCC domain-...    274   6e-85    Brassica rapa
ref|XP_010516427.1|  PREDICTED: TBCC domain-containing protein 1-...    275   7e-85    Camelina sativa [gold-of-pleasure]
ref|XP_002876443.1|  hypothetical protein ARALYDRAFT_486241             274   8e-85    
ref|XP_003521203.1|  PREDICTED: TBCC domain-containing protein 1-...    273   1e-84    Glycine max [soybeans]
ref|XP_009142814.1|  PREDICTED: TBCC domain-containing protein 1        273   2e-84    Brassica rapa
ref|XP_011078850.1|  PREDICTED: TBCC domain-containing protein 1-...    273   2e-84    Sesamum indicum [beniseed]
gb|KJB16388.1|  hypothetical protein B456_002G228100                    273   3e-84    Gossypium raimondii
gb|KHG16745.1|  TBCC domain-containing 1                                273   3e-84    Gossypium arboreum [tree cotton]
ref|XP_010265832.1|  PREDICTED: TBCC domain-containing protein 1-...    271   4e-84    
ref|XP_009116487.1|  PREDICTED: TBCC domain-containing protein 1        272   4e-84    Brassica rapa
ref|XP_007162298.1|  hypothetical protein PHAVU_001G140300g             272   4e-84    Phaseolus vulgaris [French bean]
ref|XP_006402830.1|  hypothetical protein EUTSA_v10005862mg             272   5e-84    Eutrema salsugineum [saltwater cress]
ref|XP_010265831.1|  PREDICTED: TBCC domain-containing protein 1-...    271   9e-84    Nelumbo nucifera [Indian lotus]
ref|XP_010672700.1|  PREDICTED: TBCC domain-containing protein 1        271   1e-83    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006411483.1|  hypothetical protein EUTSA_v10016442mg             271   2e-83    Eutrema salsugineum [saltwater cress]
gb|KHN07410.1|  TBCC domain-containing protein 1                        271   2e-83    Glycine soja [wild soybean]
ref|XP_002532335.1|  conserved hypothetical protein                     270   3e-83    Ricinus communis
gb|EPS74445.1|  hypothetical protein M569_00304                         270   3e-83    Genlisea aurea
gb|KJB36105.1|  hypothetical protein B456_006G141400                    268   2e-82    Gossypium raimondii
gb|KHG18606.1|  TBCC domain-containing 1                                268   3e-82    Gossypium arboreum [tree cotton]
emb|CDX79886.1|  BnaA05g02700D                                          268   3e-82    
gb|KJB36106.1|  hypothetical protein B456_006G141400                    268   5e-82    Gossypium raimondii
ref|XP_008392091.1|  PREDICTED: TBCC domain-containing protein 1        266   7e-82    
ref|XP_009376106.1|  PREDICTED: TBCC domain-containing protein 1-...    266   9e-82    Pyrus x bretschneideri [bai li]
ref|XP_008442093.1|  PREDICTED: LOW QUALITY PROTEIN: TBCC domain-...    266   1e-81    Cucumis melo [Oriental melon]
ref|XP_011033249.1|  PREDICTED: TBCC domain-containing protein 1 ...    265   3e-81    Populus euphratica
ref|XP_011033250.1|  PREDICTED: TBCC domain-containing protein 1 ...    265   4e-81    Populus euphratica
ref|XP_010943570.1|  PREDICTED: TBCC domain-containing protein 1-...    265   5e-81    Elaeis guineensis
ref|XP_010517737.1|  PREDICTED: TBCC domain-containing protein 1-...    264   6e-81    Camelina sativa [gold-of-pleasure]
ref|XP_008800652.1|  PREDICTED: TBCC domain-containing protein 1-...    264   7e-81    Phoenix dactylifera
ref|XP_010508603.1|  PREDICTED: TBCC domain-containing protein 1-...    262   4e-80    Camelina sativa [gold-of-pleasure]
ref|XP_006293916.1|  hypothetical protein CARUB_v10022907mg             262   5e-80    
ref|XP_006437044.1|  hypothetical protein CICLE_v10031101mg             261   1e-79    Citrus clementina [clementine]
ref|XP_009139004.1|  PREDICTED: TBCC domain-containing protein 1-...    259   3e-79    Brassica rapa
ref|XP_006485027.1|  PREDICTED: TBCC domain-containing protein 1-...    259   4e-79    Citrus sinensis [apfelsine]
gb|KHN26370.1|  TBCC domain-containing protein 1                        258   9e-79    Glycine soja [wild soybean]
ref|XP_006381055.1|  tubulin-specific chaperone C-related family ...    258   1e-78    Populus trichocarpa [western balsam poplar]
ref|XP_004497930.1|  PREDICTED: TBCC domain-containing protein 1-...    257   3e-78    Cicer arietinum [garbanzo]
ref|XP_002323291.1|  tubulin-specific chaperone C-related family ...    257   3e-78    Populus trichocarpa [western balsam poplar]
emb|CDY53502.1|  BnaC04g02540D                                          258   3e-78    Brassica napus [oilseed rape]
ref|NP_001190120.1|  Tubulin binding cofactor C domain-containing...    257   5e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011075175.1|  PREDICTED: TBCC domain-containing protein 1-...    256   8e-78    Sesamum indicum [beniseed]
ref|XP_010506033.1|  PREDICTED: TBCC domain-containing protein 1-...    256   1e-77    Camelina sativa [gold-of-pleasure]
ref|XP_010928451.1|  PREDICTED: TBCC domain-containing protein 1 ...    254   2e-77    
ref|XP_010928450.1|  PREDICTED: TBCC domain-containing protein 1 ...    255   3e-77    
ref|XP_011020269.1|  PREDICTED: TBCC domain-containing protein 1 ...    254   7e-77    Populus euphratica
ref|XP_011020268.1|  PREDICTED: TBCC domain-containing protein 1 ...    254   7e-77    Populus euphratica
ref|XP_011020267.1|  PREDICTED: TBCC domain-containing protein 1 ...    254   8e-77    Populus euphratica
ref|XP_002881827.1|  hypothetical protein ARALYDRAFT_483312             253   9e-77    
gb|KHN26369.1|  TBCC domain-containing protein 1                        250   7e-76    Glycine soja [wild soybean]
ref|XP_009391882.1|  PREDICTED: TBCC domain-containing protein 1-...    249   3e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009411800.1|  PREDICTED: TBCC domain-containing protein 1-...    248   1e-74    Musa acuminata subsp. malaccensis [pisang utan]
emb|CAB67617.1|  putative protein                                       247   2e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008787292.1|  PREDICTED: TBCC domain-containing protein 1-...    246   4e-74    Phoenix dactylifera
emb|CDY06067.1|  BnaA09g37130D                                          243   2e-73    
emb|CDY61748.1|  BnaA04g27540D                                          244   6e-73    Brassica napus [oilseed rape]
ref|XP_010913921.1|  PREDICTED: TBCC domain-containing protein 1-...    242   2e-72    Elaeis guineensis
ref|XP_008795746.1|  PREDICTED: LOW QUALITY PROTEIN: TBCC domain-...    241   3e-72    Phoenix dactylifera
ref|XP_006850073.1|  PREDICTED: TBCC domain-containing protein 1        239   4e-71    Amborella trichopoda
ref|XP_004493562.1|  PREDICTED: TBCC domain-containing protein 1-...    238   4e-71    Cicer arietinum [garbanzo]
ref|XP_003625224.1|  TBCC domain-containing protein                     231   3e-68    
emb|CDX71986.1|  BnaC08g28880D                                          230   6e-68    
ref|XP_010038901.1|  PREDICTED: TBCC domain-containing protein 1        229   6e-68    
gb|KEH41654.1|  tubulin-binding cofactor C domain protein               224   5e-66    Medicago truncatula
ref|XP_003563624.1|  PREDICTED: TBCC domain-containing protein 1-...    223   5e-65    Brachypodium distachyon [annual false brome]
gb|EEC80975.1|  hypothetical protein OsI_23703                          218   3e-63    Oryza sativa Indica Group [Indian rice]
ref|NP_001058077.1|  Os06g0614300                                       217   6e-63    
gb|ABR16182.1|  unknown                                                 212   8e-61    Picea sitchensis
dbj|BAJ93674.1|  predicted protein                                      208   8e-60    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO57724.1|  hypothetical protein CISIN_1g041482mg                   197   3e-59    Citrus sinensis [apfelsine]
ref|XP_010233970.1|  PREDICTED: TBCC domain-containing protein 1-...    205   1e-58    Brachypodium distachyon [annual false brome]
dbj|BAJ90629.1|  predicted protein                                      206   1e-58    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003571239.1|  PREDICTED: TBCC domain-containing protein 1-...    205   1e-58    Brachypodium distachyon [annual false brome]
gb|AFW66196.1|  hypothetical protein ZEAMMB73_400795                    203   3e-58    
ref|XP_002453473.1|  hypothetical protein SORBIDRAFT_04g006490          204   4e-58    Sorghum bicolor [broomcorn]
gb|EEE66013.1|  hypothetical protein OsJ_21970                          204   4e-58    Oryza sativa Japonica Group [Japonica rice]
gb|ACN28202.1|  unknown                                                 203   1e-57    Zea mays [maize]
ref|XP_008643390.1|  PREDICTED: hypothetical protein isoform X2         201   7e-57    Zea mays [maize]
ref|XP_004951581.1|  PREDICTED: TBCC domain-containing protein 1-...    200   1e-56    Setaria italica
ref|NP_001144767.1|  hypothetical protein                               200   1e-56    Zea mays [maize]
ref|XP_008643389.1|  PREDICTED: hypothetical protein isoform X1         200   1e-56    Zea mays [maize]
ref|XP_004965884.1|  PREDICTED: TBCC domain-containing protein 1-...    199   3e-56    Setaria italica
emb|CDX98257.1|  BnaC06g16180D                                          198   9e-56    
gb|AFW76295.1|  hypothetical protein ZEAMMB73_911559                    195   3e-55    
emb|CDX67713.1|  BnaA07g17530D                                          196   4e-55    
ref|NP_001168301.1|  hypothetical protein                               196   6e-55    Zea mays [maize]
emb|CDY47657.1|  BnaC04g23940D                                          195   2e-54    Brassica napus [oilseed rape]
gb|EEC72669.1|  hypothetical protein OsI_06222                          193   5e-54    Oryza sativa Indica Group [Indian rice]
ref|NP_001046181.1|  Os02g0194800                                       191   2e-53    
emb|CBI30042.3|  unnamed protein product                                184   2e-51    Vitis vinifera
ref|XP_002986516.1|  hypothetical protein SELMODRAFT_182480             176   8e-48    
ref|XP_002964936.1|  hypothetical protein SELMODRAFT_439144             171   1e-45    Selaginella moellendorffii
gb|AAB88648.1|  hypothetical protein                                    166   3e-44    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001778693.1|  predicted protein                                  166   6e-44    
ref|XP_001757659.1|  predicted protein                                  165   1e-43    
ref|XP_006648417.1|  PREDICTED: TBCC domain-containing protein 1-...    163   2e-43    Oryza brachyantha
ref|XP_006657134.1|  PREDICTED: TBCC domain-containing protein 1-...    163   2e-43    Oryza brachyantha
gb|EEE56495.1|  hypothetical protein OsJ_05741                          162   6e-43    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001758135.1|  predicted protein                                  135   4e-33    
ref|XP_001765734.1|  predicted protein                                  119   3e-27    
gb|AFN53653.1|  putative G-patch domain protein                         114   2e-25    Linum usitatissimum
ref|XP_008657282.1|  PREDICTED: spidroin-1-like                         106   7e-24    
gb|EMS64518.1|  TBCC domain-containing protein 1                      92.0    6e-18    Triticum urartu
gb|EMS61357.1|  hypothetical protein TRIUR3_14905                     84.0    2e-17    Triticum urartu
gb|EEC67872.1|  hypothetical protein OsI_35505                        85.1    4e-16    Oryza sativa Indica Group [Indian rice]
gb|ACM17606.1|  tubulin-specific chaperon-like protein                85.1    7e-16    Oryza sativa Indica Group [Indian rice]
gb|EMT07109.1|  TBCC domain-containing protein 1                      84.7    2e-15    
ref|XP_003624015.1|  hypothetical protein MTR_7g078290                73.9    3e-13    
ref|XP_008656241.1|  PREDICTED: uncharacterized protein LOC103635607  67.8    1e-10    Zea mays [maize]
gb|KCW48079.1|  hypothetical protein EUGRSUZ_K01823                   63.9    1e-08    Eucalyptus grandis [rose gum]
gb|KCW48078.1|  hypothetical protein EUGRSUZ_K01823                   63.9    1e-08    Eucalyptus grandis [rose gum]
gb|KJB82781.1|  hypothetical protein B456_013G212400                  63.2    3e-08    Gossypium raimondii
ref|XP_008360822.1|  PREDICTED: TBCC domain-containing protein 1-...  62.0    6e-08    
gb|EYU20708.1|  hypothetical protein MIMGU_mgv1a007731mg              62.0    6e-08    Erythranthe guttata [common monkey flower]
gb|AET02086.2|  microtubule associated protein, MAP65/ASE1 family...  59.3    4e-07    Medicago truncatula
ref|XP_003627610.1|  ABC transporter family protein                   58.9    6e-07    
gb|KDO57723.1|  hypothetical protein CISIN_1g0403991mg                50.4    2e-05    Citrus sinensis [apfelsine]
ref|XP_002505027.1|  predicted protein                                49.7    0.001    Micromonas commoda



>ref|XP_006342320.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Solanum 
tuberosum]
Length=567

 Score =   329 bits (843),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  115  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQIS  294
            P YIHPRR+PFEHGLL I KLIFTDGTQTLGPIKDKLLSLS++S +RVN +S++E+LQIS
Sbjct  18   PAYIHPRRDPFEHGLLPIPKLIFTDGTQTLGPIKDKLLSLSSESTYRVNPESIAESLQIS  77

Query  295  PDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDS  474
            PD A+L+LET+A VLH+ SDPLV+A P+E+ SVGVNVFDLVVFLYIQSYKRLLPKGHKDS
Sbjct  78   PDQAQLLLETIACVLHSVSDPLVTAKPSEIGSVGVNVFDLVVFLYIQSYKRLLPKGHKDS  137

Query  475  AAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLA  654
            AAVADVWPSTSAFDGFLSALSPLQL RSNSRR MPSQSDEEAHQLSYLQKH+GNILSLL+
Sbjct  138  AAVADVWPSTSAFDGFLSALSPLQLARSNSRRNMPSQSDEEAHQLSYLQKHLGNILSLLS  197

Query  655  DSVEGEAEES  684
            +SVEG+ EES
Sbjct  198  ESVEGDCEES  207



>ref|XP_009629812.1| PREDICTED: TBCC domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=570

 Score =   328 bits (840),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +1

Query  100  AGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSE  279
            A +  PIYIHPRREPF+HGLL I+KLIFTDGTQTL PI+DKLLSL++ SAHR N ++++E
Sbjct  16   ASSTAPIYIHPRREPFQHGLLPISKLIFTDGTQTLLPIRDKLLSLTSGSAHRANFEAIAE  75

Query  280  TLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK  459
             LQIS +HARLVLET+A+VLH++SDP+V+A P+E+ SVGVNVFDL++FL+IQSYKRLLPK
Sbjct  76   ALQISHEHARLVLETIASVLHSDSDPIVTAKPSEIGSVGVNVFDLMLFLHIQSYKRLLPK  135

Query  460  GHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNI  639
            GHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+GNI
Sbjct  136  GHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHLGNI  195

Query  640  LSLLADSVEGEAEES  684
            LSLLA+SVEG+ EES
Sbjct  196  LSLLAESVEGDGEES  210



>ref|XP_009772589.1| PREDICTED: TBCC domain-containing protein 1-like [Nicotiana sylvestris]
Length=568

 Score =   323 bits (829),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = +1

Query  100  AGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSE  279
            A +  PIYIHPRREPF+HGLL I+KLIFTDGTQTL PI+DKLLSL++ SA R N ++++E
Sbjct  14   ASSTAPIYIHPRREPFQHGLLPISKLIFTDGTQTLLPIRDKLLSLTSGSALRANFEAIAE  73

Query  280  TLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK  459
             LQIS +HARLVLET+A+VLH++SDP+V+A P+E+ SVGVNVFDL++FL+IQSYKRLLPK
Sbjct  74   ALQISHEHARLVLETIASVLHSDSDPIVTAKPSEIGSVGVNVFDLMLFLHIQSYKRLLPK  133

Query  460  GHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNI  639
            GHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+GNI
Sbjct  134  GHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHLGNI  193

Query  640  LSLLADSVEGEAEES  684
            LSLLA+SVEG+ EES
Sbjct  194  LSLLAESVEGDGEES  208



>ref|XP_006351339.1| PREDICTED: TBCC domain-containing protein 1-like [Solanum tuberosum]
Length=569

 Score =   322 bits (824),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  115  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQIS  294
            P+YIHPRREPFEHGLL I KLIFTDG QTL PI+DKLLSLS+ S HRVN ++++E  QIS
Sbjct  20   PVYIHPRREPFEHGLLPIPKLIFTDGAQTLIPIRDKLLSLSSGSIHRVNFEAIAEAFQIS  79

Query  295  PDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDS  474
             DHARLV+ET+A+VLH++SDP V+A P+E+ SVGVNVFDL++FLYIQSYKRLLPKGHKDS
Sbjct  80   HDHARLVIETIASVLHSDSDPSVTAKPSEIGSVGVNVFDLMMFLYIQSYKRLLPKGHKDS  139

Query  475  AAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLA  654
            AAVADVWPSTSAFDGFLSALSPLQLVRSNSRR MPSQ+DEEAHQLSYLQKH+GNILSLLA
Sbjct  140  AAVADVWPSTSAFDGFLSALSPLQLVRSNSRRSMPSQADEEAHQLSYLQKHLGNILSLLA  199

Query  655  DSVEGEAEES  684
            +SVEG+ EES
Sbjct  200  ESVEGDGEES  209



>ref|XP_009629687.1| PREDICTED: TBCC domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=572

 Score =   320 bits (821),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 178/195 (91%), Gaps = 5/195 (3%)
 Frame = +1

Query  115  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSA-----DSAHRVNSKSVSE  279
            PIYIHPRREPFEHGLL I KLIFTDGTQTLGPIKDKLLS  +      +  RVN++S++E
Sbjct  18   PIYIHPRREPFEHGLLPIPKLIFTDGTQTLGPIKDKLLSSLSSSESSTTHQRVNTESIAE  77

Query  280  TLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK  459
            +LQISP+HARLVLET+A VLH++SDPLV+A P+EV SVGVNVFDLVVFLYIQSYKRLLPK
Sbjct  78   SLQISPEHARLVLETIACVLHSDSDPLVTAKPSEVGSVGVNVFDLVVFLYIQSYKRLLPK  137

Query  460  GHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNI  639
            GHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRR MPSQSDEEAHQLSYLQKH+GNI
Sbjct  138  GHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRNMPSQSDEEAHQLSYLQKHLGNI  197

Query  640  LSLLADSVEGEAEES  684
            LSLL+++VEGE +E+
Sbjct  198  LSLLSEAVEGEGDET  212



>ref|XP_004249279.1| PREDICTED: TBCC domain-containing protein 1 [Solanum lycopersicum]
Length=569

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +1

Query  97   AAGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVS  276
            +  +  P+YIHPRREPFEHGLL I KLIFTDG QTL  I+DKLLSLS+ S HRVN ++++
Sbjct  14   STASTSPVYIHPRREPFEHGLLPIPKLIFTDGAQTLTQIRDKLLSLSSGSTHRVNFEAIA  73

Query  277  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  456
            E LQIS DHARLV+ET+A+VLH++SDP V+A P+E+ SVGVNVFDL++FLYIQSYKRLLP
Sbjct  74   EALQISHDHARLVIETIASVLHSDSDPSVTAKPSEIGSVGVNVFDLMMFLYIQSYKRLLP  133

Query  457  KGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGN  636
            KGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRR MPSQ+DEEAHQLSYLQKH+GN
Sbjct  134  KGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRSMPSQADEEAHQLSYLQKHLGN  193

Query  637  ILSLLADSVEGEAEES  684
            ILSLLA+S EG+ +ES
Sbjct  194  ILSLLAESGEGDGDES  209



>ref|XP_009797552.1| PREDICTED: TBCC domain-containing protein 1-like [Nicotiana sylvestris]
Length=572

 Score =   316 bits (809),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 177/195 (91%), Gaps = 5/195 (3%)
 Frame = +1

Query  115  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSA-----DSAHRVNSKSVSE  279
            PIYIHPRREPFEHGLL I KLIFTDGTQTLGPIKDKLLS  +      +  RVN++S++E
Sbjct  18   PIYIHPRREPFEHGLLPIPKLIFTDGTQTLGPIKDKLLSSLSSSESSTTNQRVNTESIAE  77

Query  280  TLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK  459
            +LQIS +HARLVLET+A VLH++SDPLV+A P+EV S+GVNVFDLVVFLYIQSYKRLLPK
Sbjct  78   SLQISLEHARLVLETIACVLHSDSDPLVTAKPSEVGSIGVNVFDLVVFLYIQSYKRLLPK  137

Query  460  GHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNI  639
            GHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRR MPSQSDEEAHQLSYLQKH+GNI
Sbjct  138  GHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRNMPSQSDEEAHQLSYLQKHLGNI  197

Query  640  LSLLADSVEGEAEES  684
            LSLL+++VEGE +E+
Sbjct  198  LSLLSEAVEGEGDET  212



>emb|CDP20019.1| unnamed protein product [Coffea canephora]
Length=590

 Score =   312 bits (799),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 177/193 (92%), Gaps = 4/193 (2%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADS----AHRVNSKSVSETL  285
            IYIHPRREPFEHGLL I KLIF+DGTQ+L  IKDKLLSLS+ S     HRVNS +++ETL
Sbjct  35   IYIHPRREPFEHGLLPIPKLIFSDGTQSLASIKDKLLSLSSSSSSESTHRVNSAAIAETL  94

Query  286  QISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGH  465
            QISPDHARLVL+T+++VLHN++DPLV+A P+E+D VG+ VFDLVVFLY+QSYKRLLPKGH
Sbjct  95   QISPDHARLVLDTISSVLHNDTDPLVNAKPSEIDDVGIGVFDLVVFLYVQSYKRLLPKGH  154

Query  466  KDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILS  645
            +DSAAVADVWPSTSAFDGFLSAL+PLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+GNIL+
Sbjct  155  RDSAAVADVWPSTSAFDGFLSALTPLQLVRSNSRRFMPSQADEEAHQLSYLQKHLGNILA  214

Query  646  LLADSVEGEAEES  684
            LLAD+ EGE E+S
Sbjct  215  LLADTAEGEGEDS  227



>ref|XP_002278205.1| PREDICTED: TBCC domain-containing protein 1-like [Vitis vinifera]
Length=568

 Score =   291 bits (744),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 169/192 (88%), Gaps = 1/192 (1%)
 Frame = +1

Query  112  EPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSAD-SAHRVNSKSVSETLQ  288
            E ++IHPRREPFEHGLL I KLIFTD   TL P++DKL++ +AD    RV+SK++S+ LQ
Sbjct  17   ESVFIHPRREPFEHGLLPIPKLIFTDPNATLAPLRDKLVAAAADHPTRRVDSKALSDALQ  76

Query  289  ISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHK  468
            IS DHARLV++T+ +VLH+++DPLV A  +E+D+VG +V+DL++FLYIQSYKRLLP+ HK
Sbjct  77   ISLDHARLVVDTLTSVLHDDADPLVRAKSSEIDAVGADVYDLILFLYIQSYKRLLPRTHK  136

Query  469  DSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSL  648
            DSAAVADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ NILSL
Sbjct  137  DSAAVADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHLANILSL  196

Query  649  LADSVEGEAEES  684
            LA+ VEGE EES
Sbjct  197  LAEPVEGEGEES  208



>ref|XP_008240959.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Prunus 
mume]
Length=564

 Score =   288 bits (736),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 170/197 (86%), Gaps = 3/197 (2%)
 Frame = +1

Query  97   AAGTAEP-IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSV  273
            ++ T +P + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S  S+HRVNS ++
Sbjct  11   SSSTKDPALLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEQS--SSHRVNSAAI  68

Query  274  SETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLL  453
            SE LQIS DHARLVL+T+A+VLH+ESDPL+ + P  VD VG +V DLV+FLYIQSYK+LL
Sbjct  69   SEVLQISIDHARLVLDTLASVLHSESDPLLKSKPDVVDEVGADVNDLVLFLYIQSYKKLL  128

Query  454  PKGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVG  633
            P+ HKDSAAVADVWPSTSAFDG+LSALSPLQLVRSNSRRF+PSQ+DEEAHQLSYLQKH+ 
Sbjct  129  PRTHKDSAAVADVWPSTSAFDGYLSALSPLQLVRSNSRRFVPSQADEEAHQLSYLQKHLA  188

Query  634  NILSLLADSVEGEAEES  684
            NI+SLLA+ VEGE EES
Sbjct  189  NIVSLLAEPVEGEGEES  205



>ref|XP_008240958.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Prunus 
mume]
Length=565

 Score =   288 bits (736),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 170/197 (86%), Gaps = 3/197 (2%)
 Frame = +1

Query  97   AAGTAEP-IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSV  273
            ++ T +P + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S  S+HRVNS ++
Sbjct  11   SSSTKDPALLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEQS--SSHRVNSAAI  68

Query  274  SETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLL  453
            SE LQIS DHARLVL+T+A+VLH+ESDPL+ + P  VD VG +V DLV+FLYIQSYK+LL
Sbjct  69   SEVLQISIDHARLVLDTLASVLHSESDPLLKSKPDVVDEVGADVNDLVLFLYIQSYKKLL  128

Query  454  PKGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVG  633
            P+ HKDSAAVADVWPSTSAFDG+LSALSPLQLVRSNSRRF+PSQ+DEEAHQLSYLQKH+ 
Sbjct  129  PRTHKDSAAVADVWPSTSAFDGYLSALSPLQLVRSNSRRFVPSQADEEAHQLSYLQKHLA  188

Query  634  NILSLLADSVEGEAEES  684
            NI+SLLA+ VEGE EES
Sbjct  189  NIVSLLAEPVEGEGEES  205



>ref|XP_007203759.1| hypothetical protein PRUPE_ppa003584mg [Prunus persica]
 gb|EMJ04958.1| hypothetical protein PRUPE_ppa003584mg [Prunus persica]
Length=564

 Score =   285 bits (729),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 169/197 (86%), Gaps = 3/197 (2%)
 Frame = +1

Query  97   AAGTAEP-IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSV  273
            ++ T +P + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S  S+HRVNS ++
Sbjct  11   SSSTKDPALLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEQS--SSHRVNSAAI  68

Query  274  SETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLL  453
            SE LQIS DHARLVL+T+A+VL +ESDPL+ + P  VD VG +V DLV+FLYIQSYK+LL
Sbjct  69   SEVLQISIDHARLVLDTLASVLQSESDPLLKSKPDVVDEVGADVNDLVLFLYIQSYKKLL  128

Query  454  PKGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVG  633
            P+ HKDSAAVADVWPSTSAFDG+LSALSPLQLVRSNSRRF+PSQ+DEEAHQLSYLQKH+ 
Sbjct  129  PRTHKDSAAVADVWPSTSAFDGYLSALSPLQLVRSNSRRFVPSQADEEAHQLSYLQKHLA  188

Query  634  NILSLLADSVEGEAEES  684
            NI+SLLA+ VEGE EES
Sbjct  189  NIVSLLAEPVEGEGEES  205



>gb|KJB82777.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
Length=357

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 163/189 (86%), Gaps = 3/189 (2%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            I +HPRREPFEHGLL I KLIFTD  Q L  +K+KL   S+  A RV S ++++ LQIS 
Sbjct  24   ILLHPRREPFEHGLLPIQKLIFTDPVQALTQLKEKL---SSSFALRVGSAALADALQISS  80

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARL+L+T+++VLH+ESDPLV+A P +VDS+G ++ DLV+FLYIQSYKRLLP+ HKDSA
Sbjct  81   DHARLILDTLSSVLHSESDPLVTARPEDVDSIGADLRDLVLFLYIQSYKRLLPRSHKDSA  140

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            AVADVWPSTSAFDG+LSALSPLQLVRSN+RRFMPSQ+DEEAHQLSYLQKH+ NILSLL++
Sbjct  141  AVADVWPSTSAFDGYLSALSPLQLVRSNTRRFMPSQADEEAHQLSYLQKHLANILSLLSE  200

Query  658  SVEGEAEES  684
             VEGE +ES
Sbjct  201  HVEGEGKES  209



>ref|XP_010548390.1| PREDICTED: TBCC domain-containing protein 1-like [Tarenaya hassleriana]
Length=577

 Score =   283 bits (723),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 164/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRREPFEHGLL I KLIFTD  QTL P+K KL +  A S +RV S ++SE LQIS 
Sbjct  31   LVIHPRREPFEHGLLPIQKLIFTDPIQTLTPVKQKLAA--AASNNRVGSSALSEALQISG  88

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARLVLET+A+VLH+++DPL+ A P EVDS+G ++ DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  89   DHARLVLETLASVLHSDADPLIRAKPEEVDSIGADLRDLVLFLYIQSYKKLLPRTHKDSA  148

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            AVADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+DEEAHQL+YLQKH+ NILSLLA+
Sbjct  149  AVADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADEEAHQLTYLQKHLSNILSLLAE  208

Query  658  SVEGEAEES  684
             +EGE +ES
Sbjct  209  PMEGEGDES  217



>ref|XP_008367539.1| PREDICTED: TBCC domain-containing protein 1-like [Malus domestica]
Length=381

 Score =   276 bits (707),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 161/189 (85%), Gaps = 2/189 (1%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S   +HRV+S ++SE LQIS 
Sbjct  19   LLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEKSP--SHRVDSAAISEALQISI  76

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            D A+LVL+T+A+VLH+ESD LV A P  +D  G +V DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  77   DQAKLVLDTLASVLHSESDLLVKAKPDGIDEAGADVHDLVLFLYIQSYKKLLPRTHKDSA  136

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            AVADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ N++SLLA+
Sbjct  137  AVADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHLANLVSLLAE  196

Query  658  SVEGEAEES  684
             VEG+ EES
Sbjct  197  PVEGDGEES  205



>ref|XP_003520533.1| PREDICTED: TBCC domain-containing protein 1-like [Glycine max]
Length=565

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 166/187 (89%), Gaps = 2/187 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL I +LIF+D TQTL  +K KLL LS++   RV+S ++SE+LQI  +H
Sbjct  21   VHPRREPFEHGLLPIPRLIFSDPTQTLISLKQKLLELSSN--QRVDSAAISESLQIPIEH  78

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A++LH++S+PLV+A   E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVLDTLASILHSDSEPLVAAKLEEIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  138

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ NI+SLLA+ V
Sbjct  139  ADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHLANIVSLLAEPV  198

Query  664  EGEAEES  684
            EGE EES
Sbjct  199  EGEGEES  205



>gb|KJB82778.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
Length=434

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 163/189 (86%), Gaps = 3/189 (2%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            I +HPRREPFEHGLL I KLIFTD  Q L  +K+KL   S+  A RV S ++++ LQIS 
Sbjct  24   ILLHPRREPFEHGLLPIQKLIFTDPVQALTQLKEKL---SSSFALRVGSAALADALQISS  80

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARL+L+T+++VLH+ESDPLV+A P +VDS+G ++ DLV+FLYIQSYKRLLP+ HKDSA
Sbjct  81   DHARLILDTLSSVLHSESDPLVTARPEDVDSIGADLRDLVLFLYIQSYKRLLPRSHKDSA  140

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            AVADVWPSTSAFDG+LSALSPLQLVRSN+RRFMPSQ+DEEAHQLSYLQKH+ NILSLL++
Sbjct  141  AVADVWPSTSAFDGYLSALSPLQLVRSNTRRFMPSQADEEAHQLSYLQKHLANILSLLSE  200

Query  658  SVEGEAEES  684
             VEGE +ES
Sbjct  201  HVEGEGKES  209



>ref|XP_003554199.1| PREDICTED: TBCC domain-containing protein 1-like [Glycine max]
Length=565

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 165/187 (88%), Gaps = 2/187 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL I +LIF+D  QTL P+K KLL LS++   RV+  ++SE+LQIS +H
Sbjct  21   VHPRREPFEHGLLPIPRLIFSDPAQTLIPLKQKLLELSSN--QRVDLAAISESLQISIEH  78

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A++LH++S+PLV AN  E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVLDTLASILHSDSEPLVVANLVEIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  138

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
             DVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ NI+SLLA+ V
Sbjct  139  TDVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHLANIVSLLAEPV  198

Query  664  EGEAEES  684
            EGE +ES
Sbjct  199  EGEGDES  205



>ref|XP_009369834.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=565

 Score =   280 bits (716),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 162/189 (86%), Gaps = 2/189 (1%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S   +HRV+S ++SE LQIS 
Sbjct  19   LLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEKSP--SHRVDSAAISEALQISI  76

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            D A+LVL+T+A+VLH+ESDPLV A P  +D  G +V DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  77   DQAKLVLDTLASVLHSESDPLVKAKPDGIDEAGADVHDLVLFLYIQSYKKLLPRTHKDSA  136

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            AVADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ N++SLLA+
Sbjct  137  AVADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHLANLVSLLAE  196

Query  658  SVEGEAEES  684
             VEG+ EES
Sbjct  197  PVEGDGEES  205



>ref|XP_009369843.1| PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=564

 Score =   280 bits (716),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 162/189 (86%), Gaps = 2/189 (1%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S   +HRV+S ++SE LQIS 
Sbjct  19   LLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEKSP--SHRVDSAAISEALQISI  76

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            D A+LVL+T+A+VLH+ESDPLV A P  +D  G +V DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  77   DQAKLVLDTLASVLHSESDPLVKAKPDGIDEAGADVHDLVLFLYIQSYKKLLPRTHKDSA  136

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            AVADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ N++SLLA+
Sbjct  137  AVADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHLANLVSLLAE  196

Query  658  SVEGEAEES  684
             VEG+ EES
Sbjct  197  PVEGDGEES  205



>gb|KHF98763.1| TBCC domain-containing 1 [Gossypium arboreum]
Length=598

 Score =   281 bits (718),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL I KLIFTD  Q L P+K KL S S+ S HRVNS ++++ LQIS +H
Sbjct  24   LHPRREPFEHGLLPIQKLIFTDPLQALIPLKQKLASSSSSSTHRVNSDALADALQISSEH  83

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARL+L+T+A+VLH+E DPLV+A+P +VDSVG ++ DL++FLYIQSYKRLLP+ HKDSAAV
Sbjct  84   ARLILDTLASVLHSEPDPLVNAHPDDVDSVGSDLSDLILFLYIQSYKRLLPRSHKDSAAV  143

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSPLQLVRSN+RRFMPSQ+DEEAHQLSYLQKH+ NI+SLL++ V
Sbjct  144  ADVWPSTSAFDGYLSALSPLQLVRSNTRRFMPSQADEEAHQLSYLQKHLANIMSLLSEPV  203

Query  664  EGEAEES  684
            EGE EES
Sbjct  204  EGEGEES  210



>gb|EYU39914.1| hypothetical protein MIMGU_mgv1a003654mg [Erythranthe guttata]
Length=571

 Score =   280 bits (715),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 166/193 (86%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  AEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQ  288
            A    +HPRREPFEHGLL I KLIF DG QTL  +K  LL+  ++S HRV+S++++  LQ
Sbjct  22   ASTFQLHPRREPFEHGLLPIPKLIFNDGVQTLSGLKSTLLA--SNSNHRVSSENLAGVLQ  79

Query  289  ISPDHARLVLETVAAVLHNESDPLVSANPAE-VDSVGVNVFDLVVFLYIQSYKRLLPKGH  465
            I  +H+RLV+ET+++VL+++SDPLV+A+ +E VD +GVNVFDL+VFL IQSYKRLLPKGH
Sbjct  80   IPIEHSRLVIETLSSVLYDDSDPLVTASTSEEVDEIGVNVFDLLVFLCIQSYKRLLPKGH  139

Query  466  KDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILS  645
            KDSAAVADVWPSTSAFDGFLS LSPLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+GNI+S
Sbjct  140  KDSAAVADVWPSTSAFDGFLSVLSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHIGNIVS  199

Query  646  LLADSVEGEAEES  684
            LLAD  EGE +ES
Sbjct  200  LLADIAEGEGDES  212



>ref|XP_010257397.1| PREDICTED: TBCC domain-containing protein 1-like [Nelumbo nucifera]
Length=575

 Score =   280 bits (715),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 171/196 (87%), Gaps = 5/196 (3%)
 Frame = +1

Query  112  EPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAH-----RVNSKSVS  276
            EP+++  RREPFE+GLL I+KLIF+DGT TLGP+K+KL+  ++ S+      RV++  +S
Sbjct  20   EPVFLRARREPFEYGLLPISKLIFSDGTATLGPLKEKLIQRASASSPPSSPLRVDADGIS  79

Query  277  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  456
            E LQIS ++ARLVL+T+AAVLH++SDPLVSA+P E+DSVG +V  L++FLYIQSYKRLLP
Sbjct  80   EVLQISIENARLVLDTLAAVLHSDSDPLVSASPQELDSVGADVNYLILFLYIQSYKRLLP  139

Query  457  KGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGN  636
            + HKDS AVADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ N
Sbjct  140  RTHKDSVAVADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHMAN  199

Query  637  ILSLLADSVEGEAEES  684
            IL+LLA+SVEG+ EES
Sbjct  200  ILALLAESVEGDEEES  215



>ref|XP_012087738.1| PREDICTED: TBCC domain-containing protein 1 [Jatropha curcas]
 gb|KDP24597.1| hypothetical protein JCGZ_25513 [Jatropha curcas]
Length=568

 Score =   279 bits (714),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 161/187 (86%), Gaps = 5/187 (3%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF D TQTL  ++ KL+S       RV+S +++++LQIS DH
Sbjct  27   IHPRREPFEHGLLPIPKLIFPDPTQTLTQLRQKLVSHP-----RVDSATLADSLQISTDH  81

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A+VLH+E DPLV A P ++DSVG ++ DL++FLYIQSYKRLLP+ HKDSAAV
Sbjct  82   ARLVLDTLASVLHSECDPLVKAQPGDIDSVGADLHDLILFLYIQSYKRLLPRTHKDSAAV  141

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ NILSLLA+ V
Sbjct  142  ADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHMANILSLLAEPV  201

Query  664  EGEAEES  684
            EGE EES
Sbjct  202  EGEGEES  208



>ref|XP_008393107.1| PREDICTED: uncharacterized protein LOC103455298 [Malus domestica]
Length=450

 Score =   276 bits (705),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 161/189 (85%), Gaps = 2/189 (1%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S   +HRV+S ++SE LQIS 
Sbjct  19   LLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEKSP--SHRVDSXAISEALQISI  76

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            D A+LVL+T+A+VLH+ESD LV A P  +D  G +V DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  77   DQAKLVLDTLASVLHSESDLLVKAKPDGIDEAGADVHDLVLFLYIQSYKKLLPRTHKDSA  136

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            AVADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ N++SLLA+
Sbjct  137  AVADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHLANLVSLLAE  196

Query  658  SVEGEAEES  684
             VEG+ EES
Sbjct  197  PVEGDGEES  205



>gb|KGN54813.1| hypothetical protein Csa_4G507430 [Cucumis sativus]
Length=561

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 173/192 (90%), Gaps = 2/192 (1%)
 Frame = +1

Query  112  EPI-YIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQ  288
            +PI  IHPRREPFEHGLL I KLIF+D  QTL P+K KLL  S+ S +R+NS ++SE+LQ
Sbjct  20   DPISLIHPRREPFEHGLLPIPKLIFSDPIQTLIPLKQKLLQSSSPS-NRLNSSAISESLQ  78

Query  289  ISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHK  468
            IS DHARLVL+T+A+VLH++SDPLV+A P +VDSVGV+V DL++FLYIQSYKRLLP+ HK
Sbjct  79   ISIDHARLVLDTLASVLHSDSDPLVNATPHDVDSVGVDVLDLLLFLYIQSYKRLLPRSHK  138

Query  469  DSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSL  648
            DSAAVADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+GNILSL
Sbjct  139  DSAAVADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHLGNILSL  198

Query  649  LADSVEGEAEES  684
            LA++VEGE EES
Sbjct  199  LAETVEGEGEES  210



>ref|XP_004146385.1| PREDICTED: TBCC domain-containing protein 1-like [Cucumis sativus]
Length=570

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 173/192 (90%), Gaps = 2/192 (1%)
 Frame = +1

Query  112  EPI-YIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQ  288
            +PI  IHPRREPFEHGLL I KLIF+D  QTL P+K KLL  S+  ++R+NS ++SE+LQ
Sbjct  20   DPISLIHPRREPFEHGLLPIPKLIFSDPIQTLIPLKQKLLQ-SSSPSNRLNSSAISESLQ  78

Query  289  ISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHK  468
            IS DHARLVL+T+A+VLH++SDPLV+A P +VDSVGV+V DL++FLYIQSYKRLLP+ HK
Sbjct  79   ISIDHARLVLDTLASVLHSDSDPLVNATPHDVDSVGVDVLDLLLFLYIQSYKRLLPRSHK  138

Query  469  DSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSL  648
            DSAAVADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+GNILSL
Sbjct  139  DSAAVADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHLGNILSL  198

Query  649  LADSVEGEAEES  684
            LA++VEGE EES
Sbjct  199  LAETVEGEGEES  210



>ref|NP_973669.1| C-CAP/cofactor C-like domain-containing protein [Arabidopsis 
thaliana]
 gb|AAU05480.1| At2g42230 [Arabidopsis thaliana]
 gb|AAU95425.1| At2g42230 [Arabidopsis thaliana]
 dbj|BAE98485.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10091.1| C-CAP/cofactor C-like domain-containing protein [Arabidopsis 
thaliana]
Length=568

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 161/189 (85%), Gaps = 2/189 (1%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRR PFEHGLL I KL+FTD  QTL PIK KL SL+ +  HRV S ++S+ L IS 
Sbjct  22   LIIHPRRVPFEHGLLPIQKLVFTDPIQTLAPIKQKLASLATN--HRVGSAAISDALSISD  79

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARLVLET+++VLH E+DPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSA
Sbjct  80   DHARLVLETLSSVLHCETDPLVLAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSA  139

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            +VADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPS +DEEAHQLSYLQKH+ NI+SLLA+
Sbjct  140  SVADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSPTDEEAHQLSYLQKHIANIISLLAE  199

Query  658  SVEGEAEES  684
             VEG+ ++S
Sbjct  200  PVEGQGDDS  208



>ref|NP_181752.3| C-CAP/cofactor C-like domain-containing protein [Arabidopsis 
thaliana]
 gb|AEC10092.1| C-CAP/cofactor C-like domain-containing protein [Arabidopsis 
thaliana]
Length=562

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 161/189 (85%), Gaps = 2/189 (1%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRR PFEHGLL I KL+FTD  QTL PIK KL SL+ +  HRV S ++S+ L IS 
Sbjct  22   LIIHPRRVPFEHGLLPIQKLVFTDPIQTLAPIKQKLASLATN--HRVGSAAISDALSISD  79

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARLVLET+++VLH E+DPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSA
Sbjct  80   DHARLVLETLSSVLHCETDPLVLAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSA  139

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            +VADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPS +DEEAHQLSYLQKH+ NI+SLLA+
Sbjct  140  SVADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSPTDEEAHQLSYLQKHIANIISLLAE  199

Query  658  SVEGEAEES  684
             VEG+ ++S
Sbjct  200  PVEGQGDDS  208



>gb|AGJ83863.1| tublin binding cofactor C [Gossypium hirsutum]
Length=570

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL I KLIFTD  Q L P+K KL S S+ S  RVNS ++++ LQIS +H
Sbjct  24   LHPRREPFEHGLLPIQKLIFTDPLQALIPLKQKLASSSSSSTQRVNSDALADALQISSEH  83

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARL+L+T+A+VLH+E DPLV+A+P +VDSVG ++ DL++FLYIQSYKRLLP+ HKDSAAV
Sbjct  84   ARLILDTLASVLHSEPDPLVNAHPDDVDSVGSDLRDLILFLYIQSYKRLLPRSHKDSAAV  143

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSPLQLVRSN+RRFMPSQ+DEEAHQLSYLQKH+ NI+SLL++ V
Sbjct  144  ADVWPSTSAFDGYLSALSPLQLVRSNTRRFMPSQADEEAHQLSYLQKHLANIISLLSEPV  203

Query  664  EGEAEES  684
            EGE EES
Sbjct  204  EGEGEES  210



>ref|XP_011468069.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=568

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 161/187 (86%), Gaps = 2/187 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF D TQTL P+K KL+  S +  HRVN+ ++SE+LQIS D 
Sbjct  25   IHPRREPFEHGLLSIPKLIFADPTQTLIPLKHKLIEQSPN--HRVNAAAISESLQISIDL  82

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A+VLH ESDPLV A P  +D VG +V DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  83   ARLVLDTLASVLHLESDPLVLAKPDVIDEVGADVHDLVLFLYIQSYKKLLPRTHKDSAAV  142

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSPLQLVRSNSRRF+PSQ+DEEAHQLSYLQKH+ N++SLLA+ V
Sbjct  143  ADVWPSTSAFDGYLSALSPLQLVRSNSRRFVPSQADEEAHQLSYLQKHLANLISLLAEPV  202

Query  664  EGEAEES  684
            EGE EES
Sbjct  203  EGEGEES  209



>gb|KFK35082.1| hypothetical protein AALP_AA5G233000 [Arabis alpina]
Length=576

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 159/187 (85%), Gaps = 2/187 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL PIK KL   S +  +RV S +V++ LQIS DH
Sbjct  32   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPIKQKLADASTN--NRVGSVAVADVLQISGDH  89

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  90   ARLVLETLGSVLHSESDPLVKAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  149

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+D+EAHQLSYLQKH+ NI+SLLA+ V
Sbjct  150  ADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADDEAHQLSYLQKHLANIISLLAEPV  209

Query  664  EGEAEES  684
            EGE EES
Sbjct  210  EGEGEES  216



>ref|XP_004304384.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=569

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 161/187 (86%), Gaps = 2/187 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF D TQTL P+K KL+  S +  HRVN+ ++SE+LQIS D 
Sbjct  25   IHPRREPFEHGLLSIPKLIFADPTQTLIPLKHKLIEQSPN--HRVNAAAISESLQISIDL  82

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A+VLH ESDPLV A P  +D VG +V DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  83   ARLVLDTLASVLHLESDPLVLAKPDVIDEVGADVHDLVLFLYIQSYKKLLPRTHKDSAAV  142

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSPLQLVRSNSRRF+PSQ+DEEAHQLSYLQKH+ N++SLLA+ V
Sbjct  143  ADVWPSTSAFDGYLSALSPLQLVRSNSRRFVPSQADEEAHQLSYLQKHLANLISLLAEPV  202

Query  664  EGEAEES  684
            EGE EES
Sbjct  203  EGEGEES  209



>ref|XP_010111391.1| TBCC domain-containing protein 1 [Morus notabilis]
 gb|EXC30869.1| TBCC domain-containing protein 1 [Morus notabilis]
Length=760

 Score =   282 bits (721),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 163/187 (87%), Gaps = 1/187 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL I KLIFTD TQTL P+K KL+  S+ +  R+++ ++++  QIS DH
Sbjct  32   MHPRREPFEHGLLPIPKLIFTDPTQTLIPLKRKLVEQSS-TGQRISASAIADAFQISIDH  90

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A++LH+ESDPLV A P+E+D VG +V DLV+FLYIQSYKRLLP+ HKDSA+V
Sbjct  91   ARLVLDTLASILHSESDPLVRAKPSEIDDVGADVHDLVLFLYIQSYKRLLPRTHKDSASV  150

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSPLQLVRSNSRR MPSQ+DEEAHQLSYLQKH+ NILSLLA+ V
Sbjct  151  ADVWPSTSAFDGYLSALSPLQLVRSNSRRLMPSQADEEAHQLSYLQKHLANILSLLAEPV  210

Query  664  EGEAEES  684
            EGE EES
Sbjct  211  EGEGEES  217



>ref|XP_010507501.1| PREDICTED: uncharacterized protein LOC104784134 [Camelina sativa]
Length=512

 Score =   276 bits (705),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 159/187 (85%), Gaps = 2/187 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  33   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAIADVLQISGDH  90

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  91   ARLVLETLGSVLHSESDPLVKAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  150

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+D+EAHQLSYLQKH+ NI+SLLA+ V
Sbjct  151  ADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADDEAHQLSYLQKHLANIISLLAEPV  210

Query  664  EGEAEES  684
            EGE +ES
Sbjct  211  EGEGDES  217



>gb|KJB82780.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
Length=534

 Score =   276 bits (706),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 163/189 (86%), Gaps = 3/189 (2%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            I +HPRREPFEHGLL I KLIFTD  Q L  +K+KL   S+  A RV S ++++ LQIS 
Sbjct  24   ILLHPRREPFEHGLLPIQKLIFTDPVQALTQLKEKL---SSSFALRVGSAALADALQISS  80

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARL+L+T+++VLH+ESDPLV+A P +VDS+G ++ DLV+FLYIQSYKRLLP+ HKDSA
Sbjct  81   DHARLILDTLSSVLHSESDPLVTARPEDVDSIGADLRDLVLFLYIQSYKRLLPRSHKDSA  140

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            AVADVWPSTSAFDG+LSALSPLQLVRSN+RRFMPSQ+DEEAHQLSYLQKH+ NILSLL++
Sbjct  141  AVADVWPSTSAFDGYLSALSPLQLVRSNTRRFMPSQADEEAHQLSYLQKHLANILSLLSE  200

Query  658  SVEGEAEES  684
             VEGE +ES
Sbjct  201  HVEGEGKES  209



>gb|KJB15037.1| hypothetical protein B456_002G156800 [Gossypium raimondii]
Length=536

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 160/187 (86%), Gaps = 3/187 (2%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL I KLIF D  Q L P+K K  S    S  RV+S +++E LQIS DH
Sbjct  24   LHPRREPFEHGLLTIQKLIFNDPVQALTPLKQKFAS---PSTQRVDSAALAELLQISFDH  80

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            +RLVLET+A+VLH+ESDPLV+A P +VDS+G ++ DL++FLYIQSYKRLLP+ HKDSAAV
Sbjct  81   SRLVLETLASVLHSESDPLVTALPDDVDSIGADLRDLILFLYIQSYKRLLPRSHKDSAAV  140

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPS SAFDG+LSALSPLQLVRSNSRR+MPSQ+DEEAHQLSYLQKH+ NILSLL++ V
Sbjct  141  ADVWPSMSAFDGYLSALSPLQLVRSNSRRYMPSQADEEAHQLSYLQKHLANILSLLSEHV  200

Query  664  EGEAEES  684
            EGE+EES
Sbjct  201  EGESEES  207



>ref|XP_007162300.1| hypothetical protein PHAVU_001G140500g [Phaseolus vulgaris]
 gb|ESW34294.1| hypothetical protein PHAVU_001G140500g [Phaseolus vulgaris]
Length=565

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 163/187 (87%), Gaps = 2/187 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I +LIF+D  QTL P+K KLL LS++   RV+S ++S++LQIS +H
Sbjct  21   IHPRREPFEHGLLPIPRLIFSDPAQTLIPLKQKLLQLSSN--QRVDSVAISDSLQISIEH  78

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            A+LVL+T+A++LH++S+PL  A   E+DSVGV+V DLV+FLYIQSYKR+LP+ HKDS AV
Sbjct  79   AKLVLDTLASILHSDSEPLTVAKFGEIDSVGVDVHDLVLFLYIQSYKRILPRTHKDSVAV  138

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQ+D EAHQLSYLQKH+ NI+SLLA+ V
Sbjct  139  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQADIEAHQLSYLQKHLANIMSLLAEPV  198

Query  664  EGEAEES  684
            EGE EES
Sbjct  199  EGEGEES  205



>gb|KJB82776.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
 gb|KJB82779.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
Length=569

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 163/189 (86%), Gaps = 3/189 (2%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            I +HPRREPFEHGLL I KLIFTD  Q L  +K+KL   S+  A RV S ++++ LQIS 
Sbjct  24   ILLHPRREPFEHGLLPIQKLIFTDPVQALTQLKEKL---SSSFALRVGSAALADALQISS  80

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARL+L+T+++VLH+ESDPLV+A P +VDS+G ++ DLV+FLYIQSYKRLLP+ HKDSA
Sbjct  81   DHARLILDTLSSVLHSESDPLVTARPEDVDSIGADLRDLVLFLYIQSYKRLLPRSHKDSA  140

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            AVADVWPSTSAFDG+LSALSPLQLVRSN+RRFMPSQ+DEEAHQLSYLQKH+ NILSLL++
Sbjct  141  AVADVWPSTSAFDGYLSALSPLQLVRSNTRRFMPSQADEEAHQLSYLQKHLANILSLLSE  200

Query  658  SVEGEAEES  684
             VEGE +ES
Sbjct  201  HVEGEGKES  209



>ref|NP_567059.1| Tubulin binding cofactor C domain-containing protein [Arabidopsis 
thaliana]
 gb|AAK96632.1| AT3g57890/T10K17_100 [Arabidopsis thaliana]
 gb|AAL36073.1| AT3g57890/T10K17_100 [Arabidopsis thaliana]
 gb|AEE79713.1| Tubulin binding cofactor C domain-containing protein [Arabidopsis 
thaliana]
Length=573

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 159/187 (85%), Gaps = 2/187 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  31   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAIADVLQISGDH  88

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  89   ARLVLETLGSVLHSESDPLVRAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  148

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+D+EAHQLSYLQKH+ NI+SLLA+ V
Sbjct  149  ADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADDEAHQLSYLQKHLANIISLLAEPV  208

Query  664  EGEAEES  684
            EGE +ES
Sbjct  209  EGEGDES  215



>ref|XP_007028946.1| Tubulin binding cofactor C domain-containing protein isoform 
1 [Theobroma cacao]
 ref|XP_007028947.1| Tubulin binding cofactor C domain-containing protein isoform 
1 [Theobroma cacao]
 gb|EOY09448.1| Tubulin binding cofactor C domain-containing protein isoform 
1 [Theobroma cacao]
 gb|EOY09449.1| Tubulin binding cofactor C domain-containing protein isoform 
1 [Theobroma cacao]
Length=567

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 166/203 (82%), Gaps = 10/203 (5%)
 Frame = +1

Query  97   AAGTAEPI-------YIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHR  255
            +  T++PI        +HPRREPFEHGLL I KLIFTD  Q L P+K K  S    S HR
Sbjct  8    STSTSDPIPSRSPTTLLHPRREPFEHGLLPIQKLIFTDPVQALTPLKQKHAS---SSTHR  64

Query  256  VNSKSVSETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQ  435
            V+S ++++ LQIS DHARLVL+T+A+VLH+ESD LV+A   +VDSVG ++ DL++FLYIQ
Sbjct  65   VDSVALADALQISADHARLVLDTLASVLHSESDQLVTARSDDVDSVGADLRDLILFLYIQ  124

Query  436  SYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSY  615
            SYKRLLP+ HKDSAAVADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLSY
Sbjct  125  SYKRLLPRSHKDSAAVADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSY  184

Query  616  LQKHVGNILSLLADSVEGEAEES  684
            LQKH+ NILSLL++ VEGE EES
Sbjct  185  LQKHLANILSLLSEPVEGEGEES  207



>ref|XP_010427682.1| PREDICTED: TBCC domain-containing protein 1-like [Camelina sativa]
Length=575

 Score =   276 bits (705),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 159/187 (85%), Gaps = 2/187 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  32   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAIADVLQISGDH  89

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  90   ARLVLETLGSVLHSESDPLVKAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  149

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+D+EAHQLSYLQKH+ NI+SLLA+ V
Sbjct  150  ADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADDEAHQLSYLQKHLANIISLLAEPV  209

Query  664  EGEAEES  684
            EGE +ES
Sbjct  210  EGEGDES  216



>ref|XP_003554198.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Glycine 
max]
Length=566

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 162/187 (87%), Gaps = 2/187 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I + IF+D  QTL P+K KLL LS++   RV+S ++SE+LQIS +H
Sbjct  21   IHPRREPFEHGLLPIPRFIFSDPAQTLIPLKQKLLELSSN--QRVDSAAISESLQISIEH  78

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A+VLH++++PLV+A   E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVLDTLASVLHSDAEPLVAAKLDEIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  138

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
             DVWPSTSAFDG+LSALSPLQLVRSNSRR MPSQ DEEAHQLSYLQKH+ NI+SLLA  V
Sbjct  139  TDVWPSTSAFDGYLSALSPLQLVRSNSRRGMPSQVDEEAHQLSYLQKHLANIVSLLAQPV  198

Query  664  EGEAEES  684
            EGE EES
Sbjct  199  EGEGEES  205



>gb|KJB15036.1| hypothetical protein B456_002G156800 [Gossypium raimondii]
Length=567

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 160/187 (86%), Gaps = 3/187 (2%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL I KLIF D  Q L P+K K  S    S  RV+S +++E LQIS DH
Sbjct  24   LHPRREPFEHGLLTIQKLIFNDPVQALTPLKQKFAS---PSTQRVDSAALAELLQISFDH  80

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            +RLVLET+A+VLH+ESDPLV+A P +VDS+G ++ DL++FLYIQSYKRLLP+ HKDSAAV
Sbjct  81   SRLVLETLASVLHSESDPLVTALPDDVDSIGADLRDLILFLYIQSYKRLLPRSHKDSAAV  140

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPS SAFDG+LSALSPLQLVRSNSRR+MPSQ+DEEAHQLSYLQKH+ NILSLL++ V
Sbjct  141  ADVWPSMSAFDGYLSALSPLQLVRSNSRRYMPSQADEEAHQLSYLQKHLANILSLLSEHV  200

Query  664  EGEAEES  684
            EGE+EES
Sbjct  201  EGESEES  207



>ref|XP_010524365.1| PREDICTED: TBCC domain-containing protein 1-like [Tarenaya hassleriana]
Length=569

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 161/186 (87%), Gaps = 2/186 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF+D  Q LGP+K+KL++  A S +RV S ++S+ LQIS DH
Sbjct  25   IHPRREPFEHGLLPIQKLIFSDPIQALGPVKEKLVA--AASNNRVGSAALSDALQISGDH  82

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+A+VLH++SDPLV A   EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  83   ARLVLETLASVLHSDSDPLVLAKAEEVDSVGADLRDLILFLYIQSYKKLLPRPHKDSAAV  142

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+DEEAH L+YLQKH+ NILSLLA+ V
Sbjct  143  ADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQTDEEAHHLTYLQKHLANILSLLAEPV  202

Query  664  EGEAEE  681
            E E +E
Sbjct  203  EAEGDE  208



>gb|KJB15038.1| hypothetical protein B456_002G156800 [Gossypium raimondii]
Length=582

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 160/187 (86%), Gaps = 3/187 (2%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL I KLIF D  Q L P+K K  S    S  RV+S +++E LQIS DH
Sbjct  24   LHPRREPFEHGLLTIQKLIFNDPVQALTPLKQKFAS---PSTQRVDSAALAELLQISFDH  80

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            +RLVLET+A+VLH+ESDPLV+A P +VDS+G ++ DL++FLYIQSYKRLLP+ HKDSAAV
Sbjct  81   SRLVLETLASVLHSESDPLVTALPDDVDSIGADLRDLILFLYIQSYKRLLPRSHKDSAAV  140

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPS SAFDG+LSALSPLQLVRSNSRR+MPSQ+DEEAHQLSYLQKH+ NILSLL++ V
Sbjct  141  ADVWPSMSAFDGYLSALSPLQLVRSNSRRYMPSQADEEAHQLSYLQKHLANILSLLSEHV  200

Query  664  EGEAEES  684
            EGE+EES
Sbjct  201  EGESEES  207



>ref|XP_006290821.1| hypothetical protein CARUB_v10016930mg [Capsella rubella]
 ref|XP_006290822.1| hypothetical protein CARUB_v10016930mg [Capsella rubella]
 gb|EOA23719.1| hypothetical protein CARUB_v10016930mg [Capsella rubella]
 gb|EOA23720.1| hypothetical protein CARUB_v10016930mg [Capsella rubella]
Length=573

 Score =   275 bits (702),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 159/187 (85%), Gaps = 2/187 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  29   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNYRVGSAAIADVLQISGDH  86

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDS+G ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  87   ARLVLETLGSVLHSESDPLVKAKPEEVDSLGADLRDLILFLYIQSYKKLLPRTHKDSAAV  146

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+D+EAHQLSYLQKH+ NI+SLLA+ V
Sbjct  147  ADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADDEAHQLSYLQKHLANIISLLAEPV  206

Query  664  EGEAEES  684
            EGE +ES
Sbjct  207  EGEGDES  213



>ref|XP_009104081.1| PREDICTED: LOW QUALITY PROTEIN: TBCC domain-containing protein 
1-like [Brassica rapa]
Length=554

 Score =   274 bits (701),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 158/187 (84%), Gaps = 2/187 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+F D  QTL P+K KL    + S +RV S ++++ LQIS DH
Sbjct  23   IHPRRVSFEHGLLPIQKLVFADPIQTLAPVKQKLTE--SASNNRVGSAAIADVLQISGDH  80

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  81   ARLVLETLGSVLHSESDPLVGAKPEEVDSVGADLRDLVLFLYIQSYKKLLPRTHKDSAAV  140

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+D+EAHQLSYLQKH+ NI+SLLA+ V
Sbjct  141  ADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADDEAHQLSYLQKHLANIVSLLAEPV  200

Query  664  EGEAEES  684
            EGE EES
Sbjct  201  EGEGEES  207



>ref|XP_010516427.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010516428.1| PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Camelina 
sativa]
Length=612

 Score =   275 bits (704),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 159/187 (85%), Gaps = 2/187 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  68   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAIADVLQISGDH  125

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  126  ARLVLETLGSVLHSESDPLVKAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  185

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+D+EAHQLSYLQKH+ NI+SLLA+ V
Sbjct  186  ADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADDEAHQLSYLQKHLANIISLLAEPV  245

Query  664  EGEAEES  684
            EGE +ES
Sbjct  246  EGEGDES  252



>ref|XP_002876443.1| hypothetical protein ARALYDRAFT_486241 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52702.1| hypothetical protein ARALYDRAFT_486241 [Arabidopsis lyrata subsp. 
lyrata]
Length=571

 Score =   274 bits (701),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 158/187 (84%), Gaps = 2/187 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S  +++ LQIS DH
Sbjct  29   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAVIADVLQISGDH  86

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  87   ARLVLETLGSVLHSESDPLVRAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  146

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+D+EAHQLSYLQKH+ NI+SLLA+ V
Sbjct  147  ADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADDEAHQLSYLQKHLANIISLLAEPV  206

Query  664  EGEAEES  684
            EGE +ES
Sbjct  207  EGEGDES  213



>ref|XP_003521203.1| PREDICTED: TBCC domain-containing protein 1-like [Glycine max]
Length=566

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 162/187 (87%), Gaps = 2/187 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I +LIF+D  QTL P+K KLL  S++   RV+S ++SE+LQIS + 
Sbjct  21   IHPRREPFEHGLLPIPRLIFSDPAQTLIPLKQKLLESSSN--QRVDSAAISESLQISIEQ  78

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A+VLH++++PLV+A   E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVLDTLASVLHSDAEPLVAAKLGEIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  138

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSPLQLVRSNSRR MPSQ DEEAHQLSYLQKH+ NI+SL+A  V
Sbjct  139  ADVWPSTSAFDGYLSALSPLQLVRSNSRRGMPSQVDEEAHQLSYLQKHLANIVSLVAQPV  198

Query  664  EGEAEES  684
            EGE EES
Sbjct  199  EGEGEES  205



>ref|XP_009142814.1| PREDICTED: TBCC domain-containing protein 1 [Brassica rapa]
Length=569

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 157/187 (84%), Gaps = 2/187 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR PFEHGLL I  L+FTD  QTL PIK KL S + +  +RV S ++S+ L IS DH
Sbjct  25   IHPRRVPFEHGLLPIPNLLFTDPIQTLAPIKQKLASSATN--NRVGSPAISDALSISSDH  82

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+A+VLH+E+DPLV A P EVD VG +V DLV+F+Y+QSYKRL+P+ HKDSAAV
Sbjct  83   ARLVLETLASVLHSETDPLVVAKPEEVDLVGADVRDLVLFMYVQSYKRLMPRTHKDSAAV  142

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPS SAFDG+LSALSP+QLVRSNSRRFMPS +DEEAHQLSYLQKH+ NI+SLLAD V
Sbjct  143  ADVWPSASAFDGYLSALSPIQLVRSNSRRFMPSPADEEAHQLSYLQKHMANIISLLADPV  202

Query  664  EGEAEES  684
            EGE +ES
Sbjct  203  EGEGDES  209



>ref|XP_011078850.1| PREDICTED: TBCC domain-containing protein 1-like [Sesamum indicum]
Length=573

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 166/189 (88%), Gaps = 3/189 (2%)
 Frame = +1

Query  121  YIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPD  300
            +++PRREPF+HGLL I KLIFTDGTQTL  +K  LLS S++   RVNS +++  LQI   
Sbjct  27   HLYPRREPFDHGLLPIPKLIFTDGTQTLSHLKSMLLSSSSN--QRVNSDTLARVLQIPIG  84

Query  301  HARLVLETVAAVLHNESDPLVSAN-PAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            HARL++ET+++VLH++SDPLV A  P E+D +GVNVFDL+VFLYIQSYKRLLPKGHKDSA
Sbjct  85   HARLLIETISSVLHDDSDPLVKACVPDEIDEIGVNVFDLLVFLYIQSYKRLLPKGHKDSA  144

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            AVADVWPSTSAFDGFLSALSPLQLVRSNSR+FMPSQ+DE+AHQLSYLQ+H+GNILSLLAD
Sbjct  145  AVADVWPSTSAFDGFLSALSPLQLVRSNSRKFMPSQADEQAHQLSYLQRHIGNILSLLAD  204

Query  658  SVEGEAEES  684
            S EGE ++S
Sbjct  205  STEGEVDDS  213



>gb|KJB16388.1| hypothetical protein B456_002G228100 [Gossypium raimondii]
Length=572

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 164/189 (87%), Gaps = 2/189 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKL--LSLSADSAHRVNSKSVSETLQISP  297
            +HPRREPFEHGLL I KLIFTD  Q L P+K KL   S S+ S HRVNS ++++ LQIS 
Sbjct  24   LHPRREPFEHGLLPIQKLIFTDPLQALIPLKQKLASSSSSSSSTHRVNSDALADALQISS  83

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            +HARL+L+T+A+VLH+E DPLV+A+P +V SVG ++ DL++FLYIQSYKRLLP+ HKDSA
Sbjct  84   EHARLILDTLASVLHSEPDPLVNAHPDDVGSVGSDLRDLILFLYIQSYKRLLPRSHKDSA  143

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            AVADVWPSTSAFDG+LSALSPLQLVRSN+RRFMPSQ+DEEAHQLSYLQKH+ NI+SLL++
Sbjct  144  AVADVWPSTSAFDGYLSALSPLQLVRSNTRRFMPSQADEEAHQLSYLQKHLANIISLLSE  203

Query  658  SVEGEAEES  684
             VEGE EES
Sbjct  204  PVEGEGEES  212



>gb|KHG16745.1| TBCC domain-containing 1 [Gossypium arboreum]
Length=569

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 161/189 (85%), Gaps = 3/189 (2%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            I +HPRREPFEHGLL I KLIFTD  Q L  +K+KL   S+  A RV S ++++ LQIS 
Sbjct  24   ILLHPRREPFEHGLLPIQKLIFTDPVQALTQLKEKL---SSSLALRVGSAALADALQISS  80

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARL+L+T+++VLH+ESDPLV+A P + DS+G ++ DLV+FLYIQSYKRLLP+ HKDSA
Sbjct  81   DHARLILDTLSSVLHSESDPLVTARPEDFDSIGADLRDLVLFLYIQSYKRLLPRSHKDSA  140

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            AVADVWPSTSAFDG+LSALSPLQLVRSN+RRFMPS +DEEAHQLSYLQKH+ NILSLL++
Sbjct  141  AVADVWPSTSAFDGYLSALSPLQLVRSNTRRFMPSLADEEAHQLSYLQKHLANILSLLSE  200

Query  658  SVEGEAEES  684
             VEGE EES
Sbjct  201  PVEGEGEES  209



>ref|XP_010265832.1| PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Nelumbo 
nucifera]
Length=520

 Score =   271 bits (693),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  112  EPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQI  291
            EP+++  RREPFE+GLL I+KLIF+D T TLGP+K+KL+  ++ S  R+++  +SE LQI
Sbjct  18   EPVFLRARREPFEYGLLPISKLIFSDRTATLGPLKEKLIQRASSSPPRIDADGISEVLQI  77

Query  292  SPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKD  471
            S ++A LVL+T+AAVL ++SDPLVSA P E+ SVG NV DL++FLYIQSYKRLLPK HKD
Sbjct  78   SIENAHLVLDTLAAVLPSDSDPLVSAKPHELGSVGANVDDLILFLYIQSYKRLLPKTHKD  137

Query  472  SAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLL  651
            SA+VADVWPSTSAFDG+LSALSP+QLVR+NSRRFMPSQ+DEEAHQLSYL+KH+ NI++LL
Sbjct  138  SASVADVWPSTSAFDGYLSALSPMQLVRTNSRRFMPSQADEEAHQLSYLEKHMENIIALL  197

Query  652  ADSVEGEAEES  684
            A+ VEG  EE+
Sbjct  198  AEPVEGNDEET  208



>ref|XP_009116487.1| PREDICTED: TBCC domain-containing protein 1 [Brassica rapa]
Length=570

 Score =   272 bits (696),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 157/187 (84%), Gaps = 2/187 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+F D  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  26   IHPRRVSFEHGLLPIQKLVFADPIQTLAPVKQKLAD--AASNNRVGSGAIADALQISGDH  83

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+E DPLV A P EV+SVG ++ DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  84   ARLVLETLGSVLHSEGDPLVGAKPEEVESVGADLRDLVLFLYIQSYKKLLPRTHKDSAAV  143

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+D+EAHQLSYLQKH+ NI+SLLA+ V
Sbjct  144  ADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADDEAHQLSYLQKHLANIISLLAEPV  203

Query  664  EGEAEES  684
            EGE EES
Sbjct  204  EGEGEES  210



>ref|XP_007162298.1| hypothetical protein PHAVU_001G140300g [Phaseolus vulgaris]
 gb|ESW34292.1| hypothetical protein PHAVU_001G140300g [Phaseolus vulgaris]
Length=566

 Score =   272 bits (696),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 162/186 (87%), Gaps = 2/186 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I +LIF+D  QTL  +K KLL LS++   RV+S ++SE LQIS +H
Sbjct  21   IHPRREPFEHGLLPIPRLIFSDPAQTLISLKRKLLQLSSN--QRVDSAAISEALQISIEH  78

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLV++T+A++LH++S+PLV+A   E DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVIDTLASILHSDSEPLVAAKLDEADSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  138

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLS+LQKH+ NILSLLA+ V
Sbjct  139  ADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQTDEEAHQLSFLQKHLANILSLLAEPV  198

Query  664  EGEAEE  681
            +GE  E
Sbjct  199  DGEGVE  204



>ref|XP_006402830.1| hypothetical protein EUTSA_v10005862mg [Eutrema salsugineum]
 gb|ESQ44283.1| hypothetical protein EUTSA_v10005862mg [Eutrema salsugineum]
Length=573

 Score =   272 bits (696),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 156/183 (85%), Gaps = 2/183 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S +V++ LQIS DH
Sbjct  31   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAVADVLQISGDH  88

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  89   ARLVLETLGSVLHSESDPLVRAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  148

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+D+EAHQLSYLQKH+ NI+SLLA+ V
Sbjct  149  ADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADDEAHQLSYLQKHLANIISLLAEPV  208

Query  664  EGE  672
            EGE
Sbjct  209  EGE  211



>ref|XP_010265831.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Nelumbo 
nucifera]
Length=567

 Score =   271 bits (694),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  112  EPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQI  291
            EP+++  RREPFE+GLL I+KLIF+D T TLGP+K+KL+  ++ S  R+++  +SE LQI
Sbjct  18   EPVFLRARREPFEYGLLPISKLIFSDRTATLGPLKEKLIQRASSSPPRIDADGISEVLQI  77

Query  292  SPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKD  471
            S ++A LVL+T+AAVL ++SDPLVSA P E+ SVG NV DL++FLYIQSYKRLLPK HKD
Sbjct  78   SIENAHLVLDTLAAVLPSDSDPLVSAKPHELGSVGANVDDLILFLYIQSYKRLLPKTHKD  137

Query  472  SAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLL  651
            SA+VADVWPSTSAFDG+LSALSP+QLVR+NSRRFMPSQ+DEEAHQLSYL+KH+ NI++LL
Sbjct  138  SASVADVWPSTSAFDGYLSALSPMQLVRTNSRRFMPSQADEEAHQLSYLEKHMENIIALL  197

Query  652  ADSVEGEAEES  684
            A+ VEG  EE+
Sbjct  198  AEPVEGNDEET  208



>ref|XP_010672700.1| PREDICTED: TBCC domain-containing protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=568

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 165/192 (86%), Gaps = 1/192 (1%)
 Frame = +1

Query  112  EPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLS-LSADSAHRVNSKSVSETLQ  288
            +PI +H RREPFE+GLL I+KLIFTDGT TLG +K+KLL   S+  + RV+  ++++ LQ
Sbjct  19   DPITLHTRREPFEYGLLPISKLIFTDGTATLGSLKEKLLQHASSSDSFRVDLSAIADILQ  78

Query  289  ISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHK  468
            IS +H+RLVL+T+A+VL  +SDPLV A P +V ++G NVFDL++FL IQSYKRLLP+ HK
Sbjct  79   ISQEHSRLVLDTLASVLPFDSDPLVVAKPDDVPAIGANVFDLILFLCIQSYKRLLPRTHK  138

Query  469  DSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSL  648
            DSAAVADVWPSTSAFDG+LSALSPLQLVRSN+R+FMPSQ+DEEAHQLSYLQKH+ NIL+L
Sbjct  139  DSAAVADVWPSTSAFDGYLSALSPLQLVRSNTRKFMPSQADEEAHQLSYLQKHLPNILTL  198

Query  649  LADSVEGEAEES  684
            LA+ VEGE +ES
Sbjct  199  LAEPVEGEGDES  210



>ref|XP_006411483.1| hypothetical protein EUTSA_v10016442mg [Eutrema salsugineum]
 gb|ESQ52936.1| hypothetical protein EUTSA_v10016442mg [Eutrema salsugineum]
Length=572

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 159/187 (85%), Gaps = 2/187 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            I+PRR PFEHGLL I KL+FTD  Q L PIK KL S++ +  +RV S ++S+ L IS DH
Sbjct  28   IYPRRVPFEHGLLPIQKLVFTDPIQNLAPIKQKLASVAKN--NRVGSAAISDALLISGDH  85

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+E+DPLV A P EVDS+G ++ DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  86   ARLVLETLGSVLHSETDPLVLAKPEEVDSIGADLRDLVLFLYIQSYKKLLPRTHKDSAAV  145

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPS +DEEAHQLSYLQKH+ NI+SLLA+ V
Sbjct  146  ADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSPADEEAHQLSYLQKHMPNIISLLAEPV  205

Query  664  EGEAEES  684
            EGE +ES
Sbjct  206  EGEGDES  212



>gb|KHN07410.1| TBCC domain-containing protein 1 [Glycine soja]
Length=566

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 161/187 (86%), Gaps = 2/187 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I +LIF+D  QTL P+K KLL  S++   RV+S ++SE+LQIS + 
Sbjct  21   IHPRREPFEHGLLPIPRLIFSDPAQTLIPLKQKLLESSSN--QRVDSAAISESLQISIEQ  78

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A+VLH++++PLV+A   E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVLDTLASVLHSDAEPLVAAKLDEIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  138

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
             DVWPSTSAFDG+LSALSPLQLVRSNSRR MPSQ DEEAHQLSYLQKH+ NI+SL+A  V
Sbjct  139  TDVWPSTSAFDGYLSALSPLQLVRSNSRRGMPSQVDEEAHQLSYLQKHLANIVSLVAQPV  198

Query  664  EGEAEES  684
            EGE EES
Sbjct  199  EGEGEES  205



>ref|XP_002532335.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30037.1| conserved hypothetical protein [Ricinus communis]
Length=572

 Score =   270 bits (690),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 158/186 (85%), Gaps = 4/186 (2%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF D TQ L  +K KL S +     R+++  ++E+LQIS DH
Sbjct  30   IHPRREPFEHGLLPIPKLIFPDPTQALSQLKQKLASHNG----RIDTAILAESLQISTDH  85

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A++LH+++DPLV A P ++D VG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  86   ARLVLDTLASILHSDADPLVKAQPGDIDLVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  145

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ NILSLLA+ V
Sbjct  146  ADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHMANILSLLAEPV  205

Query  664  EGEAEE  681
            EGE EE
Sbjct  206  EGEGEE  211



>gb|EPS74445.1| hypothetical protein M569_00304, partial [Genlisea aurea]
Length=572

 Score =   270 bits (690),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 158/188 (84%), Gaps = 3/188 (2%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +H RREPFEHGLL I KLIFTDG QTL  +K  LLS S+D   RVN++ VS  LQI  +H
Sbjct  24   LHARREPFEHGLLPIPKLIFTDGVQTLSNVKSALLSASSD--ERVNTEIVSAVLQIPIEH  81

Query  304  ARLVLETVAAVLHNESDPLVSA-NPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAA  480
            + +++ET++AVLH+ESDPL  A  P E+  +G NVFDL+V LYIQSYKRL+PKGHKDSAA
Sbjct  82   SCILMETLSAVLHDESDPLGRAKTPEEIGGIGANVFDLLVLLYIQSYKRLVPKGHKDSAA  141

Query  481  VADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADS  660
            VADVWPSTSAFDGFLSALSPLQLVRSNSR+FMPSQ+DEEAHQLSYLQKHVGNIL+LLAD+
Sbjct  142  VADVWPSTSAFDGFLSALSPLQLVRSNSRKFMPSQTDEEAHQLSYLQKHVGNILALLADT  201

Query  661  VEGEAEES  684
             +  ++ES
Sbjct  202  TDENSDES  209



>gb|KJB36105.1| hypothetical protein B456_006G141400 [Gossypium raimondii]
Length=555

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 161/187 (86%), Gaps = 3/187 (2%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL + KLIFTD  Q L  +K KL+S    S  RV+S +++++LQIS DH
Sbjct  21   LHPRREPFEHGLLPMQKLIFTDPLQALTSLKQKLVS---SSIQRVDSAALADSLQISLDH  77

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A+VLH+ESDPLV++   +VDSVG ++ DL++FLYIQSYKRLLP+ HKD+AAV
Sbjct  78   ARLVLDTLASVLHSESDPLVTSRFDDVDSVGADLLDLILFLYIQSYKRLLPRLHKDAAAV  137

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSPLQLVR N+RRF+PSQ+DEEAHQLSYLQKH+ NILSLL++ V
Sbjct  138  ADVWPSTSAFDGYLSALSPLQLVRCNTRRFLPSQADEEAHQLSYLQKHLANILSLLSEPV  197

Query  664  EGEAEES  684
            EGE EES
Sbjct  198  EGEGEES  204



>gb|KHG18606.1| TBCC domain-containing 1 [Gossypium arboreum]
Length=582

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 159/187 (85%), Gaps = 3/187 (2%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL I KLIFTD  Q L  +K KL+S    S  RV+S ++++ L+IS DH
Sbjct  21   LHPRREPFEHGLLPIQKLIFTDPLQALTSLKQKLVS---SSTQRVDSAALADALEISLDH  77

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A+VLH ESDPLV++   +VDSVG ++ DL++FLYIQSYKRLLP+ HKD+AAV
Sbjct  78   ARLVLDTLASVLHAESDPLVTSRFDDVDSVGADLLDLILFLYIQSYKRLLPRSHKDAAAV  137

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAF+G+LSALSPLQLVR N+RRFMPSQ+DEEAHQLSYLQKH+ NILSLL++ V
Sbjct  138  ADVWPSTSAFEGYLSALSPLQLVRCNTRRFMPSQADEEAHQLSYLQKHLANILSLLSEPV  197

Query  664  EGEAEES  684
            EGE EES
Sbjct  198  EGEGEES  204



>emb|CDX79886.1| BnaA05g02700D [Brassica napus]
Length=582

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 158/202 (78%), Gaps = 17/202 (8%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR PFEHGLL I  L+FTD  QTL PIK KL S + +  +RV S ++SE L IS DH
Sbjct  23   IHPRRAPFEHGLLPIPNLLFTDPIQTLAPIKQKLASSATN--NRVGSPAISEALSISSDH  80

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+A+VLH+E+DPLV A P EVDS+G +V DLV+F+Y+QSYKRL+P+ HKDSAAV
Sbjct  81   ARLVLETLASVLHSETDPLVVAKPEEVDSIGADVRDLVLFMYVQSYKRLMPRTHKDSAAV  140

Query  484  ADVWPSTSAFDGFLSALSPLQ---------------LVRSNSRRFMPSQSDEEAHQLSYL  618
            ADVWPS SAFDG+LSALSP+Q               LVRSNSRRFMPS +DEEAHQLSYL
Sbjct  141  ADVWPSASAFDGYLSALSPIQACSLRLNIGLIIMETLVRSNSRRFMPSPADEEAHQLSYL  200

Query  619  QKHVGNILSLLADSVEGEAEES  684
            QKH+ NI+SLLAD VEGE +ES
Sbjct  201  QKHMANIISLLADPVEGEGDES  222



>gb|KJB36106.1| hypothetical protein B456_006G141400 [Gossypium raimondii]
Length=606

 Score =   268 bits (684),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 161/187 (86%), Gaps = 3/187 (2%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL + KLIFTD  Q L  +K KL+S    S  RV+S +++++LQIS DH
Sbjct  21   LHPRREPFEHGLLPMQKLIFTDPLQALTSLKQKLVS---SSIQRVDSAALADSLQISLDH  77

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+A+VLH+ESDPLV++   +VDSVG ++ DL++FLYIQSYKRLLP+ HKD+AAV
Sbjct  78   ARLVLDTLASVLHSESDPLVTSRFDDVDSVGADLLDLILFLYIQSYKRLLPRLHKDAAAV  137

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSPLQLVR N+RRF+PSQ+DEEAHQLSYLQKH+ NILSLL++ V
Sbjct  138  ADVWPSTSAFDGYLSALSPLQLVRCNTRRFLPSQADEEAHQLSYLQKHLANILSLLSEPV  197

Query  664  EGEAEES  684
            EGE EES
Sbjct  198  EGEGEES  204



>ref|XP_008392091.1| PREDICTED: TBCC domain-containing protein 1 [Malus domestica]
Length=564

 Score =   266 bits (680),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 154/179 (86%), Gaps = 2/179 (1%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S   +HRV+S ++SE LQIS 
Sbjct  19   LLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEKSP--SHRVDSAAISEALQISI  76

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            D A+LVL+T+A+VLH+ESDPLV A P  +D  G +V DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  77   DQAKLVLDTLASVLHSESDPLVKAKPDGIDEAGADVHDLVLFLYIQSYKKLLPRTHKDSA  136

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLA  654
            AVADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYL+KH+ N++SLLA
Sbjct  137  AVADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLKKHLANLVSLLA  195



>ref|XP_009376106.1| PREDICTED: TBCC domain-containing protein 1-like [Pyrus x bretschneideri]
Length=564

 Score =   266 bits (680),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 154/179 (86%), Gaps = 2/179 (1%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S   +HRV+S ++SE LQIS 
Sbjct  19   LLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEKSP--SHRVDSAAISEALQISI  76

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            D A+LVL+T+A+VLH+ESDPLV A P  +D  G +V DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  77   DQAKLVLDTLASVLHSESDPLVKAKPDGIDEAGADVNDLVLFLYIQSYKKLLPRTHKDSA  136

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLA  654
            AVADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYL+KH+ N++SLLA
Sbjct  137  AVADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLKKHLANLVSLLA  195



>ref|XP_008442093.1| PREDICTED: LOW QUALITY PROTEIN: TBCC domain-containing protein 
1-like [Cucumis melo]
Length=570

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 172/192 (90%), Gaps = 2/192 (1%)
 Frame = +1

Query  112  EPI-YIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQ  288
            +PI  IHPRREPFEHGLL I KLIF+D  QTL P+K KLL  S+  + R+NS ++SE+LQ
Sbjct  20   DPISLIHPRREPFEHGLLPIPKLIFSDPIQTLIPLKQKLLQSSS-PSSRLNSSAISESLQ  78

Query  289  ISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHK  468
            IS DHARLVL+T+A+VLH++SDPLV+A P +VDS+GV+V DL++FLYIQSYKRLLP+ HK
Sbjct  79   ISIDHARLVLDTLASVLHSDSDPLVNAAPHDVDSIGVDVLDLLLFLYIQSYKRLLPRSHK  138

Query  469  DSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSL  648
            DSAAVADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+GNILSL
Sbjct  139  DSAAVADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHLGNILSL  198

Query  649  LADSVEGEAEES  684
            LA++VEGE EES
Sbjct  199  LAETVEGEGEES  210



>ref|XP_011033249.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Populus 
euphratica]
Length=575

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 158/188 (84%), Gaps = 7/188 (4%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAH-RVNSKSVSETLQISPD  300
            IHPRREPFEHGLL I KLIF D TQ L  +K KL      + H RVNS  ++++LQIS D
Sbjct  27   IHPRREPFEHGLLPIPKLIFPDTTQILTQLKQKL------ARHDRVNSSLLADSLQISAD  80

Query  301  HARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAA  480
            HARL+L+T+A+VL++ESDPLV A   EVDSV  ++ DL++FLYIQSYK+LLP+ HKD+AA
Sbjct  81   HARLILDTLASVLNSESDPLVKAPSDEVDSVDADLRDLILFLYIQSYKKLLPRTHKDAAA  140

Query  481  VADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADS  660
            VADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ NILSLLA+S
Sbjct  141  VADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHMANILSLLAES  200

Query  661  VEGEAEES  684
            VEGE  ES
Sbjct  201  VEGEGGES  208



>ref|XP_011033250.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Populus 
euphratica]
Length=569

 Score =   265 bits (676),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 158/188 (84%), Gaps = 7/188 (4%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAH-RVNSKSVSETLQISPD  300
            IHPRREPFEHGLL I KLIF D TQ L  +K KL      + H RVNS  ++++LQIS D
Sbjct  27   IHPRREPFEHGLLPIPKLIFPDTTQILTQLKQKL------ARHDRVNSSLLADSLQISAD  80

Query  301  HARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAA  480
            HARL+L+T+A+VL++ESDPLV A   EVDSV  ++ DL++FLYIQSYK+LLP+ HKD+AA
Sbjct  81   HARLILDTLASVLNSESDPLVKAPSDEVDSVDADLRDLILFLYIQSYKKLLPRTHKDAAA  140

Query  481  VADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADS  660
            VADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ NILSLLA+S
Sbjct  141  VADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHMANILSLLAES  200

Query  661  VEGEAEES  684
            VEGE  ES
Sbjct  201  VEGEGGES  208



>ref|XP_010943570.1| PREDICTED: TBCC domain-containing protein 1-like [Elaeis guineensis]
Length=579

 Score =   265 bits (676),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 156/196 (80%), Gaps = 9/196 (5%)
 Frame = +1

Query  97   AAGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVS  276
             AG   P+ + PRREPFEHGLL I KLIF+DGT TLGP++DKLL LS+    RV++ +++
Sbjct  21   GAGAGAPLLLRPRREPFEHGLLPIPKLIFSDGTLTLGPLRDKLLGLSSTRPGRVDAPALA  80

Query  277  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  456
            E LQISPDHARLVL+T+A+VL   SDP   A  A+V       +DLV+FLYIQ+YKRLLP
Sbjct  81   EALQISPDHARLVLDTLASVL--PSDPPDPAGTADV-------YDLVLFLYIQTYKRLLP  131

Query  457  KGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGN  636
            K HKDS  VADVWPSTSAFDGF SALSP+QLVRSNSRR MPSQ+DEEAHQLSYLQKH+ N
Sbjct  132  KAHKDSVTVADVWPSTSAFDGFFSALSPIQLVRSNSRRSMPSQADEEAHQLSYLQKHMAN  191

Query  637  ILSLLADSVEGEAEES  684
            +L LLA+SVEGE +E 
Sbjct  192  MLDLLAESVEGEGDEC  207



>ref|XP_010517737.1| PREDICTED: TBCC domain-containing protein 1-like [Camelina sativa]
Length=572

 Score =   264 bits (675),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 159/188 (85%), Gaps = 3/188 (2%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR PFEHGLL I KL+FTD  QTL PIK KL + + +  +RV S +VS+ L IS D+
Sbjct  30   IHPRRVPFEHGLLPIQKLVFTDPIQTLAPIKQKLAASATN--NRVGSAAVSDALLISGDN  87

Query  304  ARLVLETVAAVLHNESDPLVSANPAE-VDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAA  480
            ARLVLET+ +VLH E+DPLV A  +E VDSVGV++ DL++FLYIQSYK+LLP+ HKDSAA
Sbjct  88   ARLVLETLGSVLHCENDPLVLAKKSEEVDSVGVDLRDLILFLYIQSYKKLLPRTHKDSAA  147

Query  481  VADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADS  660
            VADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPS +DEEAHQLSYLQKH+ NI+SLL++ 
Sbjct  148  VADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSPADEEAHQLSYLQKHITNIISLLSEP  207

Query  661  VEGEAEES  684
            VEGE +ES
Sbjct  208  VEGEGDES  215



>ref|XP_008800652.1| PREDICTED: TBCC domain-containing protein 1-like [Phoenix dactylifera]
Length=577

 Score =   264 bits (675),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 156/196 (80%), Gaps = 9/196 (5%)
 Frame = +1

Query  97   AAGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVS  276
            AAG   P  + PRREPFEHGLL I KLIF+DGT TLGP++DKLL LS+    RV++ +++
Sbjct  19   AAGAGAPFLLRPRREPFEHGLLPIPKLIFSDGTLTLGPLRDKLLGLSSPCPGRVDAPALA  78

Query  277  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  456
            E LQISPD ARLVL+T+A+VL   SDP   A  A+V       +DLV+FLYIQ+YKRLLP
Sbjct  79   EALQISPDRARLVLDTLASVL--PSDPPDPAGTADV-------YDLVLFLYIQTYKRLLP  129

Query  457  KGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGN  636
            K HKDSA VADVWPSTSAFDGF SALSP+QLVRSNSRR MPSQ+DEEAHQLSYLQKH+ N
Sbjct  130  KAHKDSANVADVWPSTSAFDGFFSALSPIQLVRSNSRRSMPSQADEEAHQLSYLQKHMAN  189

Query  637  ILSLLADSVEGEAEES  684
            +L LLA+SVEGE +E 
Sbjct  190  MLDLLAESVEGEGDEC  205



>ref|XP_010508603.1| PREDICTED: TBCC domain-containing protein 1-like [Camelina sativa]
Length=565

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 158/187 (84%), Gaps = 4/187 (2%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR PFEHGL+ I KL+FTD  QTL PIK KL + + +  +RV S ++++ L IS D+
Sbjct  26   IHPRRVPFEHGLIPIQKLVFTDPIQTLAPIKQKLAASATN--NRVGSTAIADALLISGDN  83

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH E+DPLV A   EVDSVGV++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  84   ARLVLETLGSVLHCENDPLVLAQ--EVDSVGVDLRDLILFLYIQSYKKLLPRTHKDSAAV  141

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPS +DEEAHQLSYLQKH+ NI+SLL++ V
Sbjct  142  ADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSPADEEAHQLSYLQKHITNIISLLSEPV  201

Query  664  EGEAEES  684
            EGE +ES
Sbjct  202  EGEGDES  208



>ref|XP_006293916.1| hypothetical protein CARUB_v10022907mg [Capsella rubella]
 gb|EOA26814.1| hypothetical protein CARUB_v10022907mg [Capsella rubella]
Length=570

 Score =   262 bits (669),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 158/194 (81%), Gaps = 3/194 (2%)
 Frame = +1

Query  103  GTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSET  282
              + PI IHPRR PFEHGL+ I KL+FTD  QTL PIK KL + + +  +RV S ++S+ 
Sbjct  24   ANSNPI-IHPRRVPFEHGLIPIQKLVFTDPIQTLAPIKQKLAASATN--NRVGSAAISDA  80

Query  283  LQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKG  462
            L IS D ARLVLET+ +VLH E+DPLV A P EVDS+G ++ DLV+FLYIQSYK+L P+ 
Sbjct  81   LLISGDQARLVLETLGSVLHCETDPLVLAKPEEVDSIGADLRDLVLFLYIQSYKKLQPRT  140

Query  463  HKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNIL  642
            HKD+A+VADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPS +DEE HQLSYLQKH+ NI+
Sbjct  141  HKDAASVADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSPADEETHQLSYLQKHITNII  200

Query  643  SLLADSVEGEAEES  684
            SLL++ VEGE +ES
Sbjct  201  SLLSEPVEGEGDES  214



>ref|XP_006437044.1| hypothetical protein CICLE_v10031101mg [Citrus clementina]
 gb|ESR50284.1| hypothetical protein CICLE_v10031101mg [Citrus clementina]
Length=568

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 150/176 (85%), Gaps = 5/176 (3%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLI +D  QTL P+K KL         RVNS++++E+LQIS DH
Sbjct  27   IHPRREPFEHGLLPIPKLILSDPIQTLIPLKQKLAPTG-----RVNSETLAESLQISIDH  81

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            A+LVL+T+ +VLH ++DP+V A PAE+DSVG ++ DL++FLYIQSYKRLLP+ HKDSA+V
Sbjct  82   AQLVLDTLGSVLHADADPIVKARPAEIDSVGADLRDLILFLYIQSYKRLLPRTHKDSASV  141

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLL  651
            ADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKH+ NIL LL
Sbjct  142  ADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHMANILQLL  197



>ref|XP_009139004.1| PREDICTED: TBCC domain-containing protein 1-like [Brassica rapa]
Length=569

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 148/176 (84%), Gaps = 2/176 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL FTD  QTL PIK KL    A S +RV S +++E LQIS DH
Sbjct  25   IHPRRVSFEHGLLPIQKLAFTDPIQTLAPIKQKLAD--AASNNRVGSDAIAEALQISGDH  82

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+E DPLV A P EVDSVG ++ DLV+FLY+QSYK+++P+ HKDSAAV
Sbjct  83   ARLVLETLGSVLHSEGDPLVRAKPEEVDSVGADLRDLVLFLYVQSYKKMMPRTHKDSAAV  142

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLL  651
            ADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+D+EAHQLSYLQKH+ NI+SLL
Sbjct  143  ADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADDEAHQLSYLQKHLANIISLL  198



>ref|XP_006485027.1| PREDICTED: TBCC domain-containing protein 1-like [Citrus sinensis]
Length=568

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 150/176 (85%), Gaps = 5/176 (3%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLI +D  QTL P+K KL         RVNS++++E+LQIS DH
Sbjct  27   IHPRREPFEHGLLPIPKLILSDPIQTLIPLKLKLAPTG-----RVNSETLAESLQISIDH  81

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            A+LVL+T+ +VLH ++DP+V A PAE+DSVG ++ DL++FLYIQSYKRLLP+ HKDSA+V
Sbjct  82   AQLVLDTLGSVLHADADPIVKARPAEIDSVGADLRDLILFLYIQSYKRLLPRTHKDSASV  141

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLL  651
            ADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKH+ NIL LL
Sbjct  142  ADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHMANILQLL  197



>gb|KHN26370.1| TBCC domain-containing protein 1 [Glycine soja]
Length=553

 Score =   258 bits (659),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 153/187 (82%), Gaps = 14/187 (7%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            +HPRREPFEHGLL I +LIF+D  QTL P+K KLL LS++   RV+  ++SE+LQIS +H
Sbjct  21   VHPRREPFEHGLLPIPRLIFSDPAQTLIPLKQKLLELSSN--QRVDLAAISESLQISIEH  78

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARL            S+PLV AN  E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARL------------SEPLVVANLVEIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  126

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
             DVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ NI+SLLA+ V
Sbjct  127  TDVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHLANIVSLLAEPV  186

Query  664  EGEAEES  684
            EGE +ES
Sbjct  187  EGEGDES  193



>ref|XP_006381055.1| tubulin-specific chaperone C-related family protein [Populus 
trichocarpa]
 gb|ERP58852.1| tubulin-specific chaperone C-related family protein [Populus 
trichocarpa]
Length=585

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 153/180 (85%), Gaps = 5/180 (3%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF D T TL  +K +L      + +RVNS  ++E+LQIS DH
Sbjct  37   IHPRREPFEHGLLPIPKLIFPDPTPTLIQLKQQL-----STHNRVNSSLLAESLQISTDH  91

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARL+L+T+A+VLH++SDPLV A P EVDS G ++ DL++FLYIQSYK+LLP+ HKD+A+V
Sbjct  92   ARLILDTLASVLHSDSDPLVKARPDEVDSAGADLRDLILFLYIQSYKKLLPRTHKDAASV  151

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSPLQLVRSN+RRFMPSQ+DEEAHQLSYLQKH+ NILSLLA+ V
Sbjct  152  ADVWPSTSAFDGYLSALSPLQLVRSNNRRFMPSQADEEAHQLSYLQKHMANILSLLAEPV  211



>ref|XP_004497930.1| PREDICTED: TBCC domain-containing protein 1-like [Cicer arietinum]
Length=561

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 153/177 (86%), Gaps = 2/177 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPF+HGLL I KLIF+D TQ+L  +K KLL  S++  HRV+S ++S++LQIS DH
Sbjct  16   IHPRREPFDHGLLPIQKLIFSDPTQSLTALKKKLLDSSSN--HRVDSAAISDSLQISTDH  73

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            A+L+L+T+A+V H++S+PLV   P + D+VG +V DLV+ LYIQSYKRLLP+ HKDSA+V
Sbjct  74   AKLLLDTLASVHHSDSEPLVRNEPGQNDAVGADVHDLVLLLYIQSYKRLLPRSHKDSASV  133

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLA  654
            ADVWPSTSAFDG+ SALSPLQL+RSNSRRFMPSQ+DEEAHQL YLQKH+GNILSLLA
Sbjct  134  ADVWPSTSAFDGYFSALSPLQLMRSNSRRFMPSQADEEAHQLLYLQKHLGNILSLLA  190



>ref|XP_002323291.1| tubulin-specific chaperone C-related family protein [Populus 
trichocarpa]
 gb|EEF05052.1| tubulin-specific chaperone C-related family protein [Populus 
trichocarpa]
Length=571

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 150/177 (85%), Gaps = 5/177 (3%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF D TQ L  +K KL S      +RVNS  ++++LQI  DH
Sbjct  29   IHPRREPFEHGLLPIPKLIFPDTTQILTQLKQKLAS-----HNRVNSSLLADSLQIPADH  83

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARL+L+T+A+VL++ESDPLV A P EVDS G ++ DL++FLYIQSYK+LLP+ HKD+AAV
Sbjct  84   ARLILDTLASVLNSESDPLVKAPPDEVDSAGADLRDLILFLYIQSYKKLLPRTHKDAAAV  143

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLA  654
            ADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ NILSLLA
Sbjct  144  ADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQADEEAHQLSYLQKHMANILSLLA  200



>emb|CDY53502.1| BnaC04g02540D [Brassica napus]
Length=599

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 157/217 (72%), Gaps = 32/217 (15%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR PFEHGLL I  L+F D  QTL PIK KL S + +  +RV S +VSE L IS DH
Sbjct  25   IHPRRVPFEHGLLPIPNLLFADPIQTLAPIKQKLASSATN--NRVGSPAVSEALSISSDH  82

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+A+VLH+E+DPLV A P EVDS+G +V DLV+F+Y+QSYK+L+P+ HKDSAAV
Sbjct  83   ARLVLETLASVLHSETDPLVVAKPEEVDSIGADVRDLVLFMYVQSYKKLMPRTHKDSAAV  142

Query  484  ADVWPSTSAFDGFLSALSPLQ------------------------------LVRSNSRRF  573
            ADVWPS SAFDG+LSALSP+Q                              LVRSNSRRF
Sbjct  143  ADVWPSASAFDGYLSALSPIQASSLRLSVWRALFKFGSRLFDKMTIPKQCKLVRSNSRRF  202

Query  574  MPSQSDEEAHQLSYLQKHVGNILSLLADSVEGEAEES  684
            MPS +DEEAHQLSYLQKH+ NI+SLLAD VEG+ +ES
Sbjct  203  MPSPADEEAHQLSYLQKHIANIISLLADPVEGQGDES  239



>ref|NP_001190120.1| Tubulin binding cofactor C domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE79714.1| Tubulin binding cofactor C domain-containing protein [Arabidopsis 
thaliana]
Length=609

 Score =   257 bits (657),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 159/223 (71%), Gaps = 38/223 (17%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  31   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAIADVLQISGDH  88

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  89   ARLVLETLGSVLHSESDPLVRAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  148

Query  484  ADVWPSTSAFDGFLSALSPLQ------------------------------------LVR  555
            ADVWPSTSAFDG+LSALSP+Q                                    LVR
Sbjct  149  ADVWPSTSAFDGYLSALSPIQSCNILFPVWYGCSIESFRKQSYNLKLFSVFYSHCSLLVR  208

Query  556  SNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSVEGEAEES  684
            SNSRRFMPSQ+D+EAHQLSYLQKH+ NI+SLLA+ VEGE +ES
Sbjct  209  SNSRRFMPSQADDEAHQLSYLQKHLANIISLLAEPVEGEGDES  251



>ref|XP_011075175.1| PREDICTED: TBCC domain-containing protein 1-like [Sesamum indicum]
Length=570

 Score =   256 bits (654),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 163/189 (86%), Gaps = 3/189 (2%)
 Frame = +1

Query  121  YIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPD  300
            ++HPRREPFEHGLL I KLIFTDGTQTL     K   LS+ S +RV+S+++S  LQI  +
Sbjct  24   HLHPRREPFEHGLLPIPKLIFTDGTQTL--SLLKSTLLSSSSNYRVSSETLSRVLQIPIE  81

Query  301  HARLVLETVAAVLHNESDPLVSANPA-EVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            H+R+++ET+++VLH++SDPLV A  + E++ +G NVFDL+VFLYIQSYKRLLPKGHKDSA
Sbjct  82   HSRILIETLSSVLHDDSDPLVKARTSKEIEEIGANVFDLLVFLYIQSYKRLLPKGHKDSA  141

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            AVADVWPSTSAFDGFLSALSPLQLVRSNSRR MPSQ+DEEAHQLSYLQKH+GNILSLLAD
Sbjct  142  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRSMPSQADEEAHQLSYLQKHLGNILSLLAD  201

Query  658  SVEGEAEES  684
            S E E +ES
Sbjct  202  SAEAEGDES  210



>ref|XP_010506033.1| PREDICTED: TBCC domain-containing protein 1-like [Camelina sativa]
Length=568

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 156/188 (83%), Gaps = 3/188 (2%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR PFEHGL+ I KL+FTD  Q L PIK KL + + +  +RV S ++S+ L IS D+
Sbjct  26   IHPRRVPFEHGLIPIQKLVFTDPIQALAPIKQKLAASATN--NRVGSAAISDALLISVDN  83

Query  304  ARLVLETVAAVLHNESDPLVSANPAE-VDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAA  480
            ARLVLET+ +VLH E+DPLV A  +E VDSVG ++ DL++FLYIQSYK+LLP+ HKDSAA
Sbjct  84   ARLVLETLGSVLHCENDPLVLAQKSEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAA  143

Query  481  VADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADS  660
            VADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPS +DEEAHQLSYL KH+ NI++LL++ 
Sbjct  144  VADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSPADEEAHQLSYLHKHITNIITLLSEH  203

Query  661  VEGEAEES  684
            VEGE +ES
Sbjct  204  VEGEGDES  211



>ref|XP_010928451.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Elaeis 
guineensis]
Length=557

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 158/191 (83%), Gaps = 11/191 (6%)
 Frame = +1

Query  115  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQIS  294
            P+ + PRREPFE+GLL I KLIF+DGT TLGP++DKLL LS+  +  V++ +++E LQIS
Sbjct  38   PLLLRPRREPFEYGLLPIPKLIFSDGTLTLGPLRDKLLGLSSPCSGCVDALALAEALQIS  97

Query  295  PDHARLVLETVAAVLHNES-DPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKD  471
            PD ARLVL+T+A+VL +++ DP  +A+          V+DLV+FLYIQSYKRLLPK HKD
Sbjct  98   PDLARLVLDTLASVLPSDTPDPAGTAD----------VYDLVLFLYIQSYKRLLPKAHKD  147

Query  472  SAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLL  651
            SAAVADVWPSTSAFDG+ SALSP+QLVRSNSRR MPSQ+DEEAHQLSYLQKH+ NIL LL
Sbjct  148  SAAVADVWPSTSAFDGYFSALSPIQLVRSNSRRSMPSQADEEAHQLSYLQKHMANILGLL  207

Query  652  ADSVEGEAEES  684
            A+SVEGE +ES
Sbjct  208  AESVEGEDDES  218



>ref|XP_010928450.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Elaeis 
guineensis]
Length=592

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 158/191 (83%), Gaps = 11/191 (6%)
 Frame = +1

Query  115  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQIS  294
            P+ + PRREPFE+GLL I KLIF+DGT TLGP++DKLL LS+  +  V++ +++E LQIS
Sbjct  38   PLLLRPRREPFEYGLLPIPKLIFSDGTLTLGPLRDKLLGLSSPCSGCVDALALAEALQIS  97

Query  295  PDHARLVLETVAAVLHNES-DPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKD  471
            PD ARLVL+T+A+VL +++ DP  +A+          V+DLV+FLYIQSYKRLLPK HKD
Sbjct  98   PDLARLVLDTLASVLPSDTPDPAGTAD----------VYDLVLFLYIQSYKRLLPKAHKD  147

Query  472  SAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLL  651
            SAAVADVWPSTSAFDG+ SALSP+QLVRSNSRR MPSQ+DEEAHQLSYLQKH+ NIL LL
Sbjct  148  SAAVADVWPSTSAFDGYFSALSPIQLVRSNSRRSMPSQADEEAHQLSYLQKHMANILGLL  207

Query  652  ADSVEGEAEES  684
            A+SVEGE +ES
Sbjct  208  AESVEGEDDES  218



>ref|XP_011020269.1| PREDICTED: TBCC domain-containing protein 1 isoform X3 [Populus 
euphratica]
Length=577

 Score =   254 bits (648),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 152/180 (84%), Gaps = 5/180 (3%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF D T TL  +K +L      + +RVNS  ++++LQIS DH
Sbjct  33   IHPRREPFEHGLLPIPKLIFPDPTPTLIQLKQQL-----STHNRVNSSLLADSLQISTDH  87

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARL+L+T+A+VLH++SDPLV A   EVDS G ++ DL++FLYIQSYK+LLP+ HKD+A+V
Sbjct  88   ARLILDTLASVLHSDSDPLVKARSDEVDSAGADLRDLILFLYIQSYKKLLPRTHKDAASV  147

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSPLQLVRSN+RRFMPSQ+DEEAHQLSYLQKH+ NILSLLA+ V
Sbjct  148  ADVWPSTSAFDGYLSALSPLQLVRSNNRRFMPSQADEEAHQLSYLQKHMANILSLLAEPV  207



>ref|XP_011020268.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Populus 
euphratica]
Length=579

 Score =   254 bits (648),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 152/180 (84%), Gaps = 5/180 (3%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF D T TL  +K +L      + +RVNS  ++++LQIS DH
Sbjct  33   IHPRREPFEHGLLPIPKLIFPDPTPTLIQLKQQL-----STHNRVNSSLLADSLQISTDH  87

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARL+L+T+A+VLH++SDPLV A   EVDS G ++ DL++FLYIQSYK+LLP+ HKD+A+V
Sbjct  88   ARLILDTLASVLHSDSDPLVKARSDEVDSAGADLRDLILFLYIQSYKKLLPRTHKDAASV  147

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSPLQLVRSN+RRFMPSQ+DEEAHQLSYLQKH+ NILSLLA+ V
Sbjct  148  ADVWPSTSAFDGYLSALSPLQLVRSNNRRFMPSQADEEAHQLSYLQKHMANILSLLAEPV  207



>ref|XP_011020267.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Populus 
euphratica]
Length=581

 Score =   254 bits (648),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 152/180 (84%), Gaps = 5/180 (3%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF D T TL  +K +L      + +RVNS  ++++LQIS DH
Sbjct  33   IHPRREPFEHGLLPIPKLIFPDPTPTLIQLKQQL-----STHNRVNSSLLADSLQISTDH  87

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARL+L+T+A+VLH++SDPLV A   EVDS G ++ DL++FLYIQSYK+LLP+ HKD+A+V
Sbjct  88   ARLILDTLASVLHSDSDPLVKARSDEVDSAGADLRDLILFLYIQSYKKLLPRTHKDAASV  147

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSPLQLVRSN+RRFMPSQ+DEEAHQLSYLQKH+ NILSLLA+ V
Sbjct  148  ADVWPSTSAFDGYLSALSPLQLVRSNNRRFMPSQADEEAHQLSYLQKHMANILSLLAEPV  207



>ref|XP_002881827.1| hypothetical protein ARALYDRAFT_483312 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58086.1| hypothetical protein ARALYDRAFT_483312 [Arabidopsis lyrata subsp. 
lyrata]
Length=562

 Score =   253 bits (646),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 158/189 (84%), Gaps = 2/189 (1%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRR PFEHGLL I KL+FTD  QTL PIK KL + + +  +RV S ++S+ L IS 
Sbjct  22   LVIHPRRVPFEHGLLPIQKLVFTDPIQTLAPIKQKLAASATN--NRVGSAAISDALSISN  79

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARLVLET+ +VLH E+DPLV A P EVDSVG ++ DL++FL+IQSYK+LLP+ HKDSA
Sbjct  80   DHARLVLETLGSVLHCETDPLVLAKPEEVDSVGADLRDLLLFLFIQSYKKLLPRTHKDSA  139

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            +VADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPS +DEEAHQLSYLQKH+ NI++LLA+
Sbjct  140  SVADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSPADEEAHQLSYLQKHIANIVALLAE  199

Query  658  SVEGEAEES  684
              EGE +ES
Sbjct  200  PGEGEGDES  208



>gb|KHN26369.1| TBCC domain-containing protein 1 [Glycine soja]
Length=551

 Score =   250 bits (639),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 149/187 (80%), Gaps = 17/187 (9%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I +LIF+D  QTL P+K KLL LS++   RV+S ++SE+LQIS +H
Sbjct  21   IHPRREPFEHGLLPIPRLIFSDPAQTLIPLKQKLLELSSN--QRVDSAAISESLQISIEH  78

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVL+T+                 E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVLDTLLD---------------EIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  123

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
             DVWPSTSAFDG+LSALSPLQLVRSNSRR MPSQ DEEAHQLSYLQKH+ NI+SLLA  V
Sbjct  124  TDVWPSTSAFDGYLSALSPLQLVRSNSRRGMPSQVDEEAHQLSYLQKHLANIVSLLAQPV  183

Query  664  EGEAEES  684
            EGE EES
Sbjct  184  EGEGEES  190



>ref|XP_009391882.1| PREDICTED: TBCC domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 149/189 (79%), Gaps = 10/189 (5%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + + PRREPFEHGLL I KLIF+DGTQTL  + DKLL  S  S HRV+  ++++  QIS 
Sbjct  34   LLLRPRREPFEHGLLPIPKLIFSDGTQTLAALADKLLHRSISSPHRVDVPALADAFQISL  93

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARL L+T+A+VL  E DP         D V  NV D+V+FLY+QSYKRL+P+ HKDSA
Sbjct  94   DHARLALDTLASVLPFEPDP---------DGVA-NVHDIVLFLYVQSYKRLVPRPHKDSA  143

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            A+ADVWPSTSAFDG+LSALSPLQLVRSNSRRFMPSQ DEEAHQLSYLQKH+ NI++LLA+
Sbjct  144  AIADVWPSTSAFDGYLSALSPLQLVRSNSRRFMPSQVDEEAHQLSYLQKHMANIITLLAE  203

Query  658  SVEGEAEES  684
              EGE +ES
Sbjct  204  PAEGEGDES  212



>ref|XP_009411800.1| PREDICTED: TBCC domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 156/196 (80%), Gaps = 10/196 (5%)
 Frame = +1

Query  97   AAGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVS  276
            AAG +  + + PRREPFEHGLL I KLIF+DGT TL  + DKLL  S  S HRV++ S++
Sbjct  26   AAGGSLQLLLRPRREPFEHGLLPIPKLIFSDGTLTLAALADKLLRRSIPSPHRVDATSLA  85

Query  277  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  456
            + LQIS D+ARL L+T+A+VL +E DP  +A+          V  LV+FL IQSYKRL+P
Sbjct  86   DALQISLDYARLALDTLASVLPSEPDPDGTAD----------VHVLVLFLCIQSYKRLVP  135

Query  457  KGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGN  636
            + HKDSAA+ADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ N
Sbjct  136  RPHKDSAAIADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADEEAHQLSYLQKHMAN  195

Query  637  ILSLLADSVEGEAEES  684
            I++LLA+SVEGE +ES
Sbjct  196  IVTLLAESVEGEGDES  211



>emb|CAB67617.1| putative protein [Arabidopsis thaliana]
Length=570

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 147/187 (79%), Gaps = 13/187 (7%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  31   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAIADVLQISGDH  88

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  89   ARLVLETLGSVLHSESDPLVRAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  148

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+            NSRRFMPSQ+D+EAHQLSYLQKH+ NI+SLLA+ V
Sbjct  149  ADVWPSTSAFDGYF-----------NSRRFMPSQADDEAHQLSYLQKHLANIISLLAEPV  197

Query  664  EGEAEES  684
            EGE +ES
Sbjct  198  EGEGDES  204



>ref|XP_008787292.1| PREDICTED: TBCC domain-containing protein 1-like [Phoenix dactylifera]
Length=574

 Score =   246 bits (629),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 153/188 (81%), Gaps = 12/188 (6%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            + PRRE FEHGLL I+KLIF+DGT TL  IK+KLL  S  S +RV++ ++++TLQISPD 
Sbjct  31   LRPRRELFEHGLLPISKLIFSDGTLTLASIKNKLLQRSIPSPNRVDAPTIADTLQISPDI  90

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGV-NVFDLVVFLYIQSYKRLLPKGHKDSAA  480
            A LVL+T+AAVL           P++  S G  +V DLV+FLYIQSYKRL+P+ HKDSAA
Sbjct  91   AFLVLDTLAAVL-----------PSDSGSAGTADVHDLVLFLYIQSYKRLVPRAHKDSAA  139

Query  481  VADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADS  660
            VADVWPSTSAFDG+LSALSPLQLVRSNSRR MPSQ+DEEAHQLSYLQKH+ NIL+LLA+S
Sbjct  140  VADVWPSTSAFDGYLSALSPLQLVRSNSRRSMPSQADEEAHQLSYLQKHMANILTLLAES  199

Query  661  VEGEAEES  684
            VEGE +ES
Sbjct  200  VEGEGDES  207



>emb|CDY06067.1| BnaA09g37130D [Brassica napus]
Length=513

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 147/187 (79%), Gaps = 13/187 (7%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+F D  QTL P+K KL    A S +RV S  ++E LQIS DH
Sbjct  26   IHPRRVSFEHGLLPIQKLVFADPIQTLAPVKQKLAD--AASNNRVGSGVIAEALQISGDH  83

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+E DPL         SVG ++ DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  84   ARLVLETLGSVLHSEGDPL---------SVGADLRDLVLFLYIQSYKKLLPRTHKDSAAV  134

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSP+Q   +NSRRFMPSQ+D+EAHQLSYLQKH+ NI+SLLA+ V
Sbjct  135  ADVWPSTSAFDGYLSALSPIQ--ANNSRRFMPSQADDEAHQLSYLQKHLANIISLLAEPV  192

Query  664  EGEAEES  684
            EGE EES
Sbjct  193  EGEGEES  199



>emb|CDY61748.1| BnaA04g27540D [Brassica napus]
Length=595

 Score =   244 bits (622),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 147/202 (73%), Gaps = 28/202 (14%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL FTD  QTL PIK KL    A S +RV S +++E LQIS DH
Sbjct  25   IHPRRVSFEHGLLPIQKLAFTDPIQTLAPIKQKLAD--AASNNRVGSDAIAEALQISGDH  82

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+E DPLV A P EVDSVG ++ DLV+FLY+QSYK+L P+ HKDSAAV
Sbjct  83   ARLVLETLGSVLHSEGDPLVRAKPEEVDSVGADLRDLVLFLYVQSYKKLTPRTHKDSAAV  142

Query  484  ADVWPSTSAFDGFLSALSPLQ--------------------------LVRSNSRRFMPSQ  585
            ADVWPSTSAFDG+LSALSP+Q                          LVRSNSRRFMPSQ
Sbjct  143  ADVWPSTSAFDGYLSALSPIQANIRLSFAWCFERHALSCMYCTYAFGLVRSNSRRFMPSQ  202

Query  586  SDEEAHQLSYLQKHVGNILSLL  651
            +D+EAHQLSYLQKH+ NI+SL+
Sbjct  203  ADDEAHQLSYLQKHLANIISLI  224



>ref|XP_010913921.1| PREDICTED: TBCC domain-containing protein 1-like [Elaeis guineensis]
Length=577

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 151/188 (80%), Gaps = 12/188 (6%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            + PRRE FEHGLL I+KLIF+DGT TL  +K+KLL  S  S+ RV++ ++++ LQISPD 
Sbjct  31   LRPRRELFEHGLLPISKLIFSDGTLTLASLKNKLLQRSIPSSDRVDALTIADALQISPDI  90

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGV-NVFDLVVFLYIQSYKRLLPKGHKDSAA  480
            A LVL T+AAVL           P++  S G  +V DLV+FLYIQSYKRLLP+ HKDSAA
Sbjct  91   ALLVLGTLAAVL-----------PSDPGSAGTADVHDLVLFLYIQSYKRLLPRAHKDSAA  139

Query  481  VADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADS  660
            VADVWPSTSAFDG+LSALSPLQLVRSNSRR MPSQ+DEEAHQLSYLQKH+ NIL+LLA+S
Sbjct  140  VADVWPSTSAFDGYLSALSPLQLVRSNSRRSMPSQADEEAHQLSYLQKHMANILTLLAES  199

Query  661  VEGEAEES  684
            +EGE +ES
Sbjct  200  IEGEGDES  207



>ref|XP_008795746.1| PREDICTED: LOW QUALITY PROTEIN: TBCC domain-containing protein 
1 [Phoenix dactylifera]
Length=577

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 152/190 (80%), Gaps = 9/190 (5%)
 Frame = +1

Query  115  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQIS  294
            P+ + PRREPFE+GLL I KLIF+DGT TLG ++DKLL LS+     V++ +++E LQIS
Sbjct  22   PLLLRPRREPFEYGLLPIPKLIFSDGTLTLGTLRDKLLGLSSPCPGSVDALALAEALQIS  81

Query  295  PDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDS  474
             D ARLVL+T+A+VL     P  + +PA       +V+DLV+FLYIQSYKRLLPK H+DS
Sbjct  82   ADLARLVLDTLASVL-----PSGTQDPAGT----ADVYDLVLFLYIQSYKRLLPKAHRDS  132

Query  475  AAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLA  654
            AAVADVWPSTSAFDG+ SAL P+QLVRSNSRR M SQ+DEEAHQLSYLQKH+ NIL+LLA
Sbjct  133  AAVADVWPSTSAFDGYFSALLPIQLVRSNSRRSMHSQADEEAHQLSYLQKHMANILNLLA  192

Query  655  DSVEGEAEES  684
            +SVEGE +ES
Sbjct  193  ESVEGEGDES  202



>ref|XP_006850073.1| PREDICTED: TBCC domain-containing protein 1 [Amborella trichopoda]
 gb|ERN11654.1| hypothetical protein AMTR_s00022p00213770 [Amborella trichopoda]
Length=589

 Score =   239 bits (609),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 156/207 (75%), Gaps = 15/207 (7%)
 Frame = +1

Query  106  TAEPIY-IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADS--------AHRV  258
            TA P + +H RREPFE+GLL I+KLIFTDGT TL P++DK   LS +         + R+
Sbjct  14   TAPPTFSLHIRREPFEYGLLPISKLIFTDGTSTLAPLRDKFFQLSFNKDSFSLSSSSLRI  73

Query  259  NSKSVSETLQISPDHARLVLETVAAVLHNE-----SDPLVSANPAEVDSVGVNVFDLVVF  423
            ++  +S+ L+IS ++A LVL+T+A VL +      SDPLV A P E+D +G NV DL++F
Sbjct  74   DASGISQALEISIENAHLVLDTLATVLPDYGDVGLSDPLVYAKPDEIDKIGANVCDLILF  133

Query  424  LYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAH  603
            LYIQSYK+LLP+ HKDSA++ADVWPSTS FDG+L ALSPLQ VR+N RRFMPSQ+DEEAH
Sbjct  134  LYIQSYKKLLPRPHKDSASIADVWPSTSVFDGYLCALSPLQFVRTN-RRFMPSQADEEAH  192

Query  604  QLSYLQKHVGNILSLLADSVEGEAEES  684
            QLSYLQKH+ N+L+LLA   E E +E+
Sbjct  193  QLSYLQKHLPNMLALLAQPAEAEDDEA  219



>ref|XP_004493562.1| PREDICTED: TBCC domain-containing protein 1-like [Cicer arietinum]
Length=555

 Score =   238 bits (607),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 151/187 (81%), Gaps = 13/187 (7%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I +LIF+D  QTL  +K KL+  S++  +RV+S ++S++LQIS + 
Sbjct  22   IHPRREPFEHGLLPIPRLIFSDPAQTLISLKHKLIESSSN--NRVDSVAISDSLQISVEQ  79

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            A+LVL+T+A+VL           P E DS  V+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  80   AKLVLDTLASVL-----------PHESDSDTVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  128

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSPLQLVRSNS++F PSQ+DE AHQLSYLQKH+ NI+SLLA+ V
Sbjct  129  ADVWPSTSAFDGYLSALSPLQLVRSNSKKFTPSQADEVAHQLSYLQKHLANIVSLLAEPV  188

Query  664  EGEAEES  684
            EGE EES
Sbjct  189  EGEGEES  195



>ref|XP_003625224.1| TBCC domain-containing protein [Medicago truncatula]
 gb|ABN08645.1| Tubulin binding cofactor C [Medicago truncatula]
 gb|AES81442.1| tubulin-binding cofactor C domain protein [Medicago truncatula]
Length=558

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 150/187 (80%), Gaps = 11/187 (6%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIF+D  QTL   K KLL  S++  +RV S ++SE+LQIS + 
Sbjct  23   IHPRREPFEHGLLPIPKLIFSDPAQTLISFKHKLLESSSN--NRVGSVAISESLQISVEQ  80

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            A+LVL+T+A+VL     P  S + ++   V     DLV+FLY+QSYKRLLP+ HKDSAAV
Sbjct  81   AKLVLDTLASVL-----PSESDSESDSVDVN----DLVLFLYVQSYKRLLPRTHKDSAAV  131

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            ADVWPSTSAFDG+LSALSPLQLVRSNS+RF PSQ+DEEAHQLSYLQKH+ NI+SLLA+ V
Sbjct  132  ADVWPSTSAFDGYLSALSPLQLVRSNSKRFTPSQADEEAHQLSYLQKHLANIVSLLAEPV  191

Query  664  EGEAEES  684
            EGE+EES
Sbjct  192  EGESEES  198



>emb|CDX71986.1| BnaC08g28880D [Brassica napus]
Length=565

 Score =   230 bits (586),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 143/184 (78%), Gaps = 17/184 (9%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSA--HRVNSKSVSETLQISP  297
            IHPRR  FEHGLL I KL+F D  QTL P+K KL    AD+A  +RV S  ++E LQIS 
Sbjct  26   IHPRRVSFEHGLLPIQKLVFADPIQTLAPVKRKL----ADAATNNRVGSGVIAEVLQISG  81

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARLVLET+ +VLH+E DPL         SVG ++ DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  82   DHARLVLETLGSVLHSEGDPL---------SVGADLRDLVLFLYIQSYKKLLPRTHKDSA  132

Query  478  AVADVWPSTSAFDGFLSALSPLQ--LVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLL  651
            AVADVWPSTSAFDG+LSALSP+Q   +  NSRRFMPSQ+D+EAHQLSYLQKH+ NI+SLL
Sbjct  133  AVADVWPSTSAFDGYLSALSPIQAKFLTFNSRRFMPSQADDEAHQLSYLQKHLANIISLL  192

Query  652  ADSV  663
            A+ V
Sbjct  193  AEPV  196



>ref|XP_010038901.1| PREDICTED: TBCC domain-containing protein 1 [Eucalyptus grandis]
Length=523

 Score =   229 bits (583),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 134/161 (83%), Gaps = 3/161 (2%)
 Frame = +1

Query  202  LGPIKDKLLSLSADSAHRVNSKSVSETLQISPDHARLVLETVAAVLHNESDPLVSANPAE  381
            L P+K KL      +  R   + ++E+LQISPDHARLVL+T+ +VLH++SDPLV A P E
Sbjct  6    LLPLKQKLWGSPVTTRRR---RRLAESLQISPDHARLVLDTLVSVLHSDSDPLVRAKPDE  62

Query  382  VDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSN  561
            VDS+G +V DLV+FLYIQSYK+LLP+ HKDS AVADVWPSTSAFDG+LSALSPLQL RSN
Sbjct  63   VDSLGADVNDLVLFLYIQSYKKLLPRSHKDSVAVADVWPSTSAFDGYLSALSPLQLARSN  122

Query  562  SRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSVEGEAEES  684
            SRRFMPSQ DEEAHQLSYLQKH+ NI+SLLA+ VEGE EES
Sbjct  123  SRRFMPSQVDEEAHQLSYLQKHLANIVSLLAEPVEGEGEES  163



>gb|KEH41654.1| tubulin-binding cofactor C domain protein [Medicago truncatula]
Length=553

 Score =   224 bits (572),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 148/180 (82%), Gaps = 9/180 (5%)
 Frame = +1

Query  115  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQIS  294
            P  IHPRREPFEHGL+ I KLIF+D TQ+L  +K  LL+ S+++   ++S  +S++LQIS
Sbjct  13   PTMIHPRREPFEHGLIPIPKLIFSDPTQSLLTLKQTLLASSSNNL--ISSAIISDSLQIS  70

Query  295  PDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDS  474
             +HA+L+L+T+++V+H+E+D  V  + AE D     V+DL++ LYIQSYK+LLP+ +KD 
Sbjct  71   TEHAQLLLDTLSSVVHHEND--VVFDGAECD-----VYDLILLLYIQSYKKLLPRSNKDP  123

Query  475  AAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLA  654
            A+VADVWPSTSAFDG+ SALSPLQL+RSNSRRFMPSQ+DEEAHQLSYLQKH+ NILSLLA
Sbjct  124  ASVADVWPSTSAFDGYFSALSPLQLMRSNSRRFMPSQADEEAHQLSYLQKHLANILSLLA  183



>ref|XP_003563624.1| PREDICTED: TBCC domain-containing protein 1-like [Brachypodium 
distachyon]
Length=583

 Score =   223 bits (567),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 146/190 (77%), Gaps = 11/190 (6%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRRE FEHGLL I KL+F +GT  QTL  +K +LL      + RV + +++E LQI  
Sbjct  36   LRPRRESFEHGLLPIPKLVFPEGTLTQTLAQLKGRLLE---SGSGRVGAPALAEALQIPV  92

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVG-VNVFDLVVFLYIQSYKRLLPKGHKDS  474
            + A LVL T+AAVL  + DP +      VD  G  ++ D+++FLYIQSYKRL+P+ HKDS
Sbjct  93   EQAALVLGTLAAVLPTDEDPALG-----VDGAGEADLRDVLLFLYIQSYKRLVPRAHKDS  147

Query  475  AAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLA  654
             +VADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ N+L+LLA
Sbjct  148  PSVADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADEEAHQLSYLQKHMANVLTLLA  207

Query  655  DSVEGEAEES  684
            D+V+GE +ES
Sbjct  208  DTVDGEGDES  217



>gb|EEC80975.1| hypothetical protein OsI_23703 [Oryza sativa Indica Group]
Length=568

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 147/196 (75%), Gaps = 18/196 (9%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLS-----ADSAHRVNSKSVS  276
            + + PRR  FEHGLL I KL+F +GT  QTL   K++L++ +     A +A RV + +++
Sbjct  31   LLLRPRRVAFEHGLLPIPKLVFPEGTLTQTLAQTKERLIAAAGGDGDASAAPRVGAAALA  90

Query  277  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  456
            E LQI  + A LVL T+AAVL           PAE ++   ++ D+++FLYIQSYKRL+P
Sbjct  91   EALQIPRELAALVLGTLAAVL-----------PAEEEAEDADLRDVLLFLYIQSYKRLVP  139

Query  457  KGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGN  636
            + HKDS AV DVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ N
Sbjct  140  RAHKDSPAVTDVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADEEAHQLSYLQKHMVN  199

Query  637  ILSLLADSVEGEAEES  684
            ILSLLADSV+GE +ES
Sbjct  200  ILSLLADSVDGEGDES  215



>ref|NP_001058077.1| Os06g0614300 [Oryza sativa Japonica Group]
 dbj|BAD35569.1| tubulin-specific chaperone C-like [Oryza sativa Japonica Group]
 dbj|BAD35914.1| tubulin-specific chaperone C-like [Oryza sativa Japonica Group]
 dbj|BAF19991.1| Os06g0614300 [Oryza sativa Japonica Group]
Length=581

 Score =   217 bits (553),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 146/194 (75%), Gaps = 18/194 (9%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLS-----ADSAHRVNSKSVSET  282
            + PRR  FEHGLL I KL+F +GT  QTL   K++L++ +     A +A RV + +++E 
Sbjct  33   LRPRRVAFEHGLLPIPKLVFPEGTLTQTLAQTKERLIAAAGGDGDASAAPRVGAAALAEA  92

Query  283  LQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKG  462
            LQI  + A LVL T+AAVL           PAE ++   ++ D+++FLYIQSYKRL+P+ 
Sbjct  93   LQIPRELAALVLGTLAAVL-----------PAEEEAEDADLRDVLLFLYIQSYKRLVPRA  141

Query  463  HKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNIL  642
            HKDS AV DVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ NIL
Sbjct  142  HKDSPAVTDVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADEEAHQLSYLQKHMVNIL  201

Query  643  SLLADSVEGEAEES  684
            SLLADSV+GE +ES
Sbjct  202  SLLADSVDGEGDES  215



>gb|ABR16182.1| unknown [Picea sitchensis]
Length=609

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 153/221 (69%), Gaps = 33/221 (15%)
 Frame = +1

Query  115  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLS---------------------  231
            P+++H RREPFE+GLL +  L+FTDGT TL  +++KLL                      
Sbjct  7    PLFLHLRREPFEYGLLPLPHLMFTDGTSTLKSVREKLLQNSFTYTVNNNNHNSNNDDNNN  66

Query  232  -----LSADSAHRVNSKSVSETLQISPDHARLVLETVAAVL------HNESDPLVSANPA  378
                 +S   + RVN+  ++E+LQ+S DHAR+V++T+AAVL         +DPLV A+  
Sbjct  67   DNNGEVSRSFSRRVNATGIAESLQLSEDHARVVIDTLAAVLPEYGRGGGAADPLVHASYV  126

Query  379  EVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRS  558
            +VDS+G +V+DL++FL IQ+YK+L+P+ HKD+A+VADVWPSTSAFDG  + LSPLQL+RS
Sbjct  127  DVDSIGADVYDLILFLLIQTYKKLVPRPHKDAASVADVWPSTSAFDGIFATLSPLQLMRS  186

Query  559  NSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSVEGEAEE  681
              RRFMPSQ+DEEAHQL Y+QK++ NIL LLA+  + E+ +
Sbjct  187  -GRRFMPSQADEEAHQLHYVQKNLPNILGLLAEPSDNESAD  226



>dbj|BAJ93674.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=570

 Score =   208 bits (530),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 140/185 (76%), Gaps = 8/185 (4%)
 Frame = +1

Query  139  EPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAH-RVNSKSVSETLQISPDHAR  309
            E FEHGLL I KLIF +GT  QTL  +K+KL+  +A +   RV + +++E LQI PD A 
Sbjct  28   EAFEHGLLPIPKLIFPEGTLAQTLSQLKEKLVPAAAAAGDGRVGAAALAEALQIPPDQAA  87

Query  310  LVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVAD  489
            L +  +AAVL  + DP + A          ++ D+++FLYIQSYKRL+P+ HKDS AVAD
Sbjct  88   LAIGMLAAVLPGD-DPALDAGGGG----SADLRDVLLFLYIQSYKRLVPRPHKDSPAVAD  142

Query  490  VWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSVEG  669
            VWPSTSAFDG+LS LSP+QLVRSNSRRF+PSQ+DEE HQLSYLQKH+ NIL+LLADSVEG
Sbjct  143  VWPSTSAFDGYLSVLSPIQLVRSNSRRFIPSQADEEIHQLSYLQKHMANILTLLADSVEG  202

Query  670  EAEES  684
            E ++S
Sbjct  203  EGDDS  207



>gb|KDO57724.1| hypothetical protein CISIN_1g041482mg [Citrus sinensis]
Length=192

 Score =   197 bits (500),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 117/141 (83%), Gaps = 5/141 (4%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLI +D  QTL P+K KL         RVNS++++E+LQIS DH
Sbjct  27   IHPRREPFEHGLLPIPKLILSDPIQTLIPLKQKL-----APTGRVNSETLAESLQISIDH  81

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            A+LVL T+A+VLH ++DP+V A PAE+DSVG ++ DL++FLYIQSYKRLLP+ HKDSA+V
Sbjct  82   AQLVLNTLASVLHADADPIVKARPAEIDSVGADLRDLILFLYIQSYKRLLPRTHKDSASV  141

Query  484  ADVWPSTSAFDGFLSALSPLQ  546
            ADVWPSTSAFDG+LSALSPLQ
Sbjct  142  ADVWPSTSAFDGYLSALSPLQ  162



>ref|XP_010233970.1| PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Brachypodium 
distachyon]
Length=560

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 141/189 (75%), Gaps = 9/189 (5%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRR  FEHGLL I KLIF +G   QTL  +KDKL   + D   RV++ ++++ LQI P
Sbjct  24   LRPRRVAFEHGLLPIPKLIFPEGALAQTLSQLKDKLAPAAVDG--RVSAAALADALQIPP  81

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            D A L L  +AAV H   DP + A          ++ D+++FLYIQSYKRL+P+ HKDS 
Sbjct  82   DQAALALGMLAAV-HPADDPALGAG----GDGSADLRDVLLFLYIQSYKRLVPRPHKDSP  136

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            AVADVWPSTSAFDG+LSALSP+QLVRSNSRRF+PSQ+DEE HQLSYLQKH+ NIL+LLAD
Sbjct  137  AVADVWPSTSAFDGYLSALSPIQLVRSNSRRFIPSQADEEIHQLSYLQKHMANILTLLAD  196

Query  658  SVEGEAEES  684
            SVEGE ++S
Sbjct  197  SVEGEGDDS  205



>dbj|BAJ90629.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=588

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 144/191 (75%), Gaps = 10/191 (5%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQI  291
            + + PRRE FEHGLL I KL+F +GT  QTL  +K KL   +A    RV + +++E LQI
Sbjct  40   LVLRPRRESFEHGLLPIPKLVFPEGTLTQTLTQLKAKL---AAPGHGRVGAAALAEALQI  96

Query  292  SPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKD  471
              D A L L T+AAVL  E D      PA   +   ++ D+++FLYIQSYKRL+P+ HKD
Sbjct  97   PADQAALALGTLAAVLPGEGD-----GPAADGAWEADLRDVLLFLYIQSYKRLVPRAHKD  151

Query  472  SAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLL  651
            S +VADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ N+L+LL
Sbjct  152  SPSVADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADEEAHQLSYLQKHMANVLTLL  211

Query  652  ADSVEGEAEES  684
            ADSV+GE +ES
Sbjct  212  ADSVDGEGDES  222



>ref|XP_003571239.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Brachypodium 
distachyon]
Length=568

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 141/189 (75%), Gaps = 9/189 (5%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRR  FEHGLL I KLIF +G   QTL  +KDKL   + D   RV++ ++++ LQI P
Sbjct  24   LRPRRVAFEHGLLPIPKLIFPEGALAQTLSQLKDKLAPAAVDG--RVSAAALADALQIPP  81

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            D A L L  +AAV H   DP + A          ++ D+++FLYIQSYKRL+P+ HKDS 
Sbjct  82   DQAALALGMLAAV-HPADDPALGAG----GDGSADLRDVLLFLYIQSYKRLVPRPHKDSP  136

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            AVADVWPSTSAFDG+LSALSP+QLVRSNSRRF+PSQ+DEE HQLSYLQKH+ NIL+LLAD
Sbjct  137  AVADVWPSTSAFDGYLSALSPIQLVRSNSRRFIPSQADEEIHQLSYLQKHMANILTLLAD  196

Query  658  SVEGEAEES  684
            SVEGE ++S
Sbjct  197  SVEGEGDDS  205



>gb|AFW66196.1| hypothetical protein ZEAMMB73_400795 [Zea mays]
Length=499

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 138/192 (72%), Gaps = 8/192 (4%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQI  291
            + + PRRE FEHGLL I KLIF +GT  QTL  +K+KL + + D   RV + +++E LQI
Sbjct  31   VLLRPRREAFEHGLLPIPKLIFPEGTLAQTLAQLKEKLAASAPDG--RVRAAALAEALQI  88

Query  292  SPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHK  468
             P     +     A +    DP +      VD    ++ D+++FLYIQSYKRL+P+  HK
Sbjct  89   -PQEQAALALATLAAVLPAEDPALGD--GAVDGSAADIRDMLLFLYIQSYKRLVPRSAHK  145

Query  469  DSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSL  648
            DS  VADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+DEE HQLSYLQKH+ NIL+L
Sbjct  146  DSPVVADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADEEIHQLSYLQKHMANILTL  205

Query  649  LADSVEGEAEES  684
            LADSVEG+ ++S
Sbjct  206  LADSVEGDGDDS  217



>ref|XP_002453473.1| hypothetical protein SORBIDRAFT_04g006490 [Sorghum bicolor]
 gb|EES06449.1| hypothetical protein SORBIDRAFT_04g006490 [Sorghum bicolor]
Length=582

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 138/190 (73%), Gaps = 7/190 (4%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRRE FEHGLL I KLIF +GT  QTL  +K+KL + SA    RV + +++E LQI P
Sbjct  36   LRPRREAFEHGLLPIPKLIFPEGTLAQTLAQLKEKLAA-SAAPDGRVPAAALAEALQI-P  93

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHKDS  474
                 +     A +    DP +      VD    ++ D+++FLYIQSYKRL+P+  HKDS
Sbjct  94   QEQAALALATLAAVLPAEDPAL--GDGAVDGAAADIRDVLLFLYIQSYKRLVPRSAHKDS  151

Query  475  AAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLA  654
             AVADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+DEE HQLSYLQKH+ NIL+LLA
Sbjct  152  PAVADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADEEIHQLSYLQKHMANILTLLA  211

Query  655  DSVEGEAEES  684
            DSVEGE ++S
Sbjct  212  DSVEGEGDDS  221



>gb|EEE66013.1| hypothetical protein OsJ_21970 [Oryza sativa Japonica Group]
Length=581

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 143/196 (73%), Gaps = 18/196 (9%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLS-----ADSAHRVNSKSVS  276
            + + PR    EHGLL I K +  +GT  QTL   K++L++ +     + +A RV + +++
Sbjct  31   LLLGPRGVALEHGLLAIPKRVSPEGTLTQTLAQTKERLIAAAGGDGDSSAAPRVGAAALA  90

Query  277  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  456
            E LQI  + A LVL T+AAVL           PAE ++   ++ D+++FLYIQSYKRL+P
Sbjct  91   EALQIPRELAALVLGTLAAVL-----------PAEEEAEDADLRDVLLFLYIQSYKRLVP  139

Query  457  KGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGN  636
            + HKDS AV DVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ N
Sbjct  140  RAHKDSPAVTDVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADEEAHQLSYLQKHMVN  199

Query  637  ILSLLADSVEGEAEES  684
            ILSLLADSV+GE +ES
Sbjct  200  ILSLLADSVDGEGDES  215



>gb|ACN28202.1| unknown [Zea mays]
 gb|AFW66195.1| hypothetical protein ZEAMMB73_400795 [Zea mays]
Length=579

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 138/192 (72%), Gaps = 8/192 (4%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQI  291
            + + PRRE FEHGLL I KLIF +GT  QTL  +K+KL + + D   RV + +++E LQI
Sbjct  31   VLLRPRREAFEHGLLPIPKLIFPEGTLAQTLAQLKEKLAASAPDG--RVRAAALAEALQI  88

Query  292  SPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHK  468
             P     +     A +    DP +      VD    ++ D+++FLYIQSYKRL+P+  HK
Sbjct  89   -PQEQAALALATLAAVLPAEDPALGD--GAVDGSAADIRDMLLFLYIQSYKRLVPRSAHK  145

Query  469  DSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSL  648
            DS  VADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+DEE HQLSYLQKH+ NIL+L
Sbjct  146  DSPVVADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADEEIHQLSYLQKHMANILTL  205

Query  649  LADSVEGEAEES  684
            LADSVEG+ ++S
Sbjct  206  LADSVEGDGDDS  217



>ref|XP_008643390.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=566

 Score =   201 bits (510),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 137/190 (72%), Gaps = 8/190 (4%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRRE FEHGLL I KLIF +G   QTL  +K+KL +   D   RV + +++E LQI P
Sbjct  35   LRPRREAFEHGLLPIPKLIFPEGMLAQTLAQLKEKLAASVPDG--RVRAAALAEALQI-P  91

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHKDS  474
                 +     A +    DP++      +D    ++ D+++FLYIQSYKRL+P+  HKDS
Sbjct  92   QEQAALALGTLAAVLPAEDPVLGD--GAMDGAAADIRDVLLFLYIQSYKRLVPRSAHKDS  149

Query  475  AAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLA  654
             AVADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+DEE HQLS+LQKH+ NIL+LLA
Sbjct  150  PAVADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADEEIHQLSFLQKHMANILTLLA  209

Query  655  DSVEGEAEES  684
            DSVEGE ++S
Sbjct  210  DSVEGEGDDS  219



>ref|XP_004951581.1| PREDICTED: TBCC domain-containing protein 1-like [Setaria italica]
Length=578

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 144/191 (75%), Gaps = 12/191 (6%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRRE FEHGLL I KLIF +GT  QTL  +K+KL + +     RV + +++E LQI  
Sbjct  34   LRPRREAFEHGLLPIPKLIFPEGTLAQTLAQLKEKLAA-AVPGGGRVGAAALAEALQIPQ  92

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVG-VNVFDLVVFLYIQSYKRLLPK-GHKD  471
            + A L L T+AAVL  E       +PA  D  G  ++ D+++FLY+QSYKRL+P+  HKD
Sbjct  93   EQAALALGTLAAVLPAE-------DPALGDGAGDADIHDVLLFLYVQSYKRLVPRSAHKD  145

Query  472  SAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLL  651
            S AVADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+DEE HQLSYLQKH+ NIL+LL
Sbjct  146  SPAVADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADEEIHQLSYLQKHMANILTLL  205

Query  652  ADSVEGEAEES  684
            ADSVEGE ++S
Sbjct  206  ADSVEGEGDDS  216



>ref|NP_001144767.1| hypothetical protein [Zea mays]
 gb|ACG42825.1| hypothetical protein [Zea mays]
 gb|AFW70774.1| hypothetical protein ZEAMMB73_883749 [Zea mays]
Length=569

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 137/190 (72%), Gaps = 8/190 (4%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRRE FEHGLL I KLIF +G   QTL  +K+KL +   D   RV + +++E LQI P
Sbjct  35   LRPRREAFEHGLLPIPKLIFPEGMLAQTLAQLKEKLAASVPDG--RVRAAALAEALQI-P  91

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHKDS  474
                 +     A +    DP++      +D    ++ D+++FLYIQSYKRL+P+  HKDS
Sbjct  92   QEQAALALGTLAAVLPAEDPVLGD--GAMDGAAADIRDVLLFLYIQSYKRLVPRSAHKDS  149

Query  475  AAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLA  654
             AVADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+DEE HQLS+LQKH+ NIL+LLA
Sbjct  150  PAVADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADEEIHQLSFLQKHMANILTLLA  209

Query  655  DSVEGEAEES  684
            DSVEGE ++S
Sbjct  210  DSVEGEGDDS  219



>ref|XP_008643389.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN30975.1| unknown [Zea mays]
 gb|AFW70773.1| hypothetical protein ZEAMMB73_883749 [Zea mays]
Length=581

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 137/190 (72%), Gaps = 8/190 (4%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRRE FEHGLL I KLIF +G   QTL  +K+KL +   D   RV + +++E LQI P
Sbjct  35   LRPRREAFEHGLLPIPKLIFPEGMLAQTLAQLKEKLAASVPDG--RVRAAALAEALQI-P  91

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHKDS  474
                 +     A +    DP++      +D    ++ D+++FLYIQSYKRL+P+  HKDS
Sbjct  92   QEQAALALGTLAAVLPAEDPVLGD--GAMDGAAADIRDVLLFLYIQSYKRLVPRSAHKDS  149

Query  475  AAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLA  654
             AVADVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+DEE HQLS+LQKH+ NIL+LLA
Sbjct  150  PAVADVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADEEIHQLSFLQKHMANILTLLA  209

Query  655  DSVEGEAEES  684
            DSVEGE ++S
Sbjct  210  DSVEGEGDDS  219



>ref|XP_004965884.1| PREDICTED: TBCC domain-containing protein 1-like [Setaria italica]
Length=583

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 137/189 (72%), Gaps = 11/189 (6%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRRE FEHGLL I KL+  +G  +QTL  +K++L    A    RV + +++E LQI  
Sbjct  38   LRPRREAFEHGLLPIPKLVIPEGALSQTLAQMKERL----APGGARVGAAALAEALQIPA  93

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            + A L L T+AAV+  E   L      E D     + DL++FLYIQSYKRL+P+GHKDS 
Sbjct  94   EQAALALGTLAAVIPAEDPALGEDGAGEAD-----LRDLLLFLYIQSYKRLVPRGHKDSP  148

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            AVADVWPSTSAFDG LSALSP+Q +R NSRRFMPSQ DEEAHQLSYLQKH+ NIL+LLAD
Sbjct  149  AVADVWPSTSAFDGCLSALSPIQFIRCNSRRFMPSQVDEEAHQLSYLQKHMANILTLLAD  208

Query  658  SVEGEAEES  684
            SV+GE ++S
Sbjct  209  SVDGEGDDS  217



>emb|CDX98257.1| BnaC06g16180D [Brassica napus]
Length=590

 Score =   198 bits (503),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 116/141 (82%), Gaps = 2/141 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    + S +RV S ++++ LQIS DH
Sbjct  23   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKHKLTE--SASNNRVGSAAIADVLQISGDH  80

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  81   ARLVLETLGSVLHSESDPLVRAKPEEVDSVGADLRDLVLFLYIQSYKKLLPRTHKDSAAV  140

Query  484  ADVWPSTSAFDGFLSALSPLQ  546
            ADVWPSTSAFDG+LSALSP+Q
Sbjct  141  ADVWPSTSAFDGYLSALSPIQ  161


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 50/67 (75%), Gaps = 7/67 (10%)
 Frame = +1

Query  505  SAFDGFLSALSPLQL-------VRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSV  663
            +A  GF+SA     L       VRSNSRRFMPSQ+D+EAHQLSYLQKH+ NI+SLLA+ V
Sbjct  210  AALCGFISAPVVFSLLFVVGLLVRSNSRRFMPSQADDEAHQLSYLQKHLANIVSLLAEPV  269

Query  664  EGEAEES  684
            EGE EES
Sbjct  270  EGEGEES  276



>gb|AFW76295.1| hypothetical protein ZEAMMB73_911559 [Zea mays]
Length=508

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 140/189 (74%), Gaps = 11/189 (6%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRRE FE+GLL I KL+F +G  TQTL  +K++L    A    RV + +++E LQI  
Sbjct  29   LRPRREAFEYGLLPIPKLVFPEGALTQTLSQLKERL----APGGPRVGAAALAEALQIPA  84

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            + A L L T+AAVL  E   L      E  S   ++ DL++FLYIQSYKRL+P+ HKDS 
Sbjct  85   EQAALALGTLAAVLPAEDSAL-----GEDGSGSADLRDLLLFLYIQSYKRLVPRVHKDSP  139

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            AV DVWPSTSAFDG+LSALSP+Q VRSNSRRFMPSQ+DEEAHQLSYLQKH+ NIL+LLAD
Sbjct  140  AVTDVWPSTSAFDGYLSALSPIQFVRSNSRRFMPSQADEEAHQLSYLQKHMTNILTLLAD  199

Query  658  SVEGEAEES  684
            S++GE ++S
Sbjct  200  SIDGEGDDS  208



>emb|CDX67713.1| BnaA07g17530D [Brassica napus]
Length=598

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 115/141 (82%), Gaps = 2/141 (1%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRR  FEHGLL I KL+F D  QTL P+K KL    + S +RV S ++++ LQIS DH
Sbjct  23   IHPRRVSFEHGLLPIQKLVFADPIQTLAPVKQKLTE--SASNNRVGSAAIADVLQISGDH  80

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  81   ARLVLETLGSVLHSESDPLVGAKPEEVDSVGADLRDLVLFLYIQSYKKLLPRTHKDSAAV  140

Query  484  ADVWPSTSAFDGFLSALSPLQ  546
            ADVWPSTSAFDG+LSALSP+Q
Sbjct  141  ADVWPSTSAFDGYLSALSPIQ  161


 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +1

Query  547  LVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSVEGEAEES  684
            LVRSNSRRFMPSQ+D+EAHQLSYLQKHV NI+SLLA+ VEGE EES
Sbjct  239  LVRSNSRRFMPSQADDEAHQLSYLQKHVSNIVSLLAEPVEGEGEES  284



>ref|NP_001168301.1| hypothetical protein [Zea mays]
 gb|ACN27744.1| unknown [Zea mays]
 gb|ACN28930.1| unknown [Zea mays]
 gb|AFW76296.1| hypothetical protein ZEAMMB73_911559 [Zea mays]
Length=574

 Score =   196 bits (497),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 140/189 (74%), Gaps = 11/189 (6%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + PRRE FE+GLL I KL+F +G  TQTL  +K++L    A    RV + +++E LQI  
Sbjct  29   LRPRREAFEYGLLPIPKLVFPEGALTQTLSQLKERL----APGGPRVGAAALAEALQIPA  84

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            + A L L T+AAVL  E   L      E  S   ++ DL++FLYIQSYKRL+P+ HKDS 
Sbjct  85   EQAALALGTLAAVLPAEDSAL-----GEDGSGSADLRDLLLFLYIQSYKRLVPRVHKDSP  139

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
            AV DVWPSTSAFDG+LSALSP+Q VRSNSRRFMPSQ+DEEAHQLSYLQKH+ NIL+LLAD
Sbjct  140  AVTDVWPSTSAFDGYLSALSPIQFVRSNSRRFMPSQADEEAHQLSYLQKHMTNILTLLAD  199

Query  658  SVEGEAEES  684
            S++GE ++S
Sbjct  200  SIDGEGDDS  208



>emb|CDY47657.1| BnaC04g23940D [Brassica napus]
Length=648

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 123/163 (75%), Gaps = 8/163 (5%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPR   FEHGLL I KL FTD  QTL PIK KL    A S +RV S +++E LQIS DH
Sbjct  25   IHPRLVSFEHGLLPIQKLAFTDPIQTLAPIKQKLAD--AASNNRVGSAAIAEALQISGDH  82

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  483
            ARLVLET+ +VLH+E DPLV A P EVDSVG ++ DLV+FLY+QSYK+L+P+ HKDSAAV
Sbjct  83   ARLVLETLGSVLHSEGDPLVRAKPEEVDSVGADLRDLVLFLYVQSYKKLMPRTHKDSAAV  142

Query  484  ADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLS  612
            ADVWPSTSAFDG+LSALSP+Q   +N RR   +   E AH LS
Sbjct  143  ADVWPSTSAFDGYLSALSPIQ---ANVRR---NPQLEGAHILS  179


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  481  VADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLL  651
            V  V+  +  FD  +     L LVRSNSRRFMPSQ+D+EAHQLSYLQKH+GNI+S L
Sbjct  221  VLSVFQQSLNFDMLIFPSHGLNLVRSNSRRFMPSQADDEAHQLSYLQKHLGNIISFL  277



>gb|EEC72669.1| hypothetical protein OsI_06222 [Oryza sativa Indica Group]
Length=579

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 133/184 (72%), Gaps = 8/184 (4%)
 Frame = +1

Query  139  EPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDHARL  312
            E FEHGLL I KLIF +GT   TL  +KDKL S +AD   RV + +++E LQI P     
Sbjct  39   EAFEHGLLPIPKLIFPEGTLAHTLAQVKDKLAS-AADGGGRVAAAALAEALQI-PHEQAA  96

Query  313  VLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADV  492
            +     A +    DP + +        G ++ D+++FLYIQSYKRL+P+ HKDS AV DV
Sbjct  97   LALATLAAVLPADDPALDSGGGG----GADLRDVLLFLYIQSYKRLVPRAHKDSPAVTDV  152

Query  493  WPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSVEGE  672
            WPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+DEE HQLSYLQKH+ NIL+LLADSVEGE
Sbjct  153  WPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADEEIHQLSYLQKHMANILTLLADSVEGE  212

Query  673  AEES  684
             ++S
Sbjct  213  GDDS  216



>ref|NP_001046181.1| Os02g0194800 [Oryza sativa Japonica Group]
 dbj|BAD25242.1| tubulin-specific chaperone C-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF08095.1| Os02g0194800 [Oryza sativa Japonica Group]
 dbj|BAH00408.1| unnamed protein product [Oryza sativa Japonica Group]
Length=579

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 137/184 (74%), Gaps = 8/184 (4%)
 Frame = +1

Query  139  EPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDHARL  312
            E FEHGLL I KLIF +GT   TL  +KDKL S +AD   RV + +++E LQI  + A L
Sbjct  39   EAFEHGLLPIPKLIFPEGTLAHTLAQVKDKLAS-AADGGGRVAAAALAEALQIPHEQAAL  97

Query  313  VLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADV  492
             L T+AAVL  +   L S      D     + D+++FLYIQSYKRL+P+ HKDS AV DV
Sbjct  98   ALATLAAVLPADDPALDSGGGGRAD-----LRDVLLFLYIQSYKRLVPRAHKDSPAVTDV  152

Query  493  WPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSVEGE  672
            WPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+DEE HQLSYLQKH+ NIL+LLADSVEGE
Sbjct  153  WPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADEEIHQLSYLQKHMANILTLLADSVEGE  212

Query  673  AEES  684
             ++S
Sbjct  213  GDDS  216



>emb|CBI30042.3| unnamed protein product [Vitis vinifera]
Length=466

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  376  AEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQLVR  555
            +E+D+VG +V+DL++FLYIQSYKRLLP+ HKDSAAVADVWPSTSAFDG+LSALSPLQLVR
Sbjct  4    SEIDAVGADVYDLILFLYIQSYKRLLPRTHKDSAAVADVWPSTSAFDGYLSALSPLQLVR  63

Query  556  SNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSVEGEAEES  684
            SNSRRFMPSQ+DEEAHQLSYLQKH+ NILSLLA+ VEGE EES
Sbjct  64   SNSRRFMPSQADEEAHQLSYLQKHLANILSLLAEPVEGEGEES  106



>ref|XP_002986516.1| hypothetical protein SELMODRAFT_182480 [Selaginella moellendorffii]
 gb|EFJ12373.1| hypothetical protein SELMODRAFT_182480 [Selaginella moellendorffii]
Length=570

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 135/196 (69%), Gaps = 9/196 (5%)
 Frame = +1

Query  97   AAGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVS  276
            A+   EP ++H RREPFE+G+L +  L+  DG  +L  +++KLL        RV   ++ 
Sbjct  13   ASAQGEPPWLHVRREPFEYGMLPLPSLMHHDGVGSLRELREKLLD-----NRRVGVAAIV  67

Query  277  ETLQISPDHARLVLETVAAVL--HNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRL  450
            E L +S  HA LVL+T+A+VL   ++ D L  A  AE+D+VG +V DL++FLYIQ Y+R+
Sbjct  68   ECLGLSEAHALLVLDTLASVLPDGDDCDQLARAYAAEIDTVGAHVDDLLLFLYIQIYRRV  127

Query  451  LPKGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHV  630
             P+ HKD AAVADVWPSTS FDGF S LSPLQ VR  +R+ +P Q +EEAHQL+++QKH+
Sbjct  128  PPRSHKDPAAVADVWPSTSPFDGFFSTLSPLQ-VRP-TRKSVPCQVEEEAHQLAFVQKHL  185

Query  631  GNILSLLADSVEGEAE  678
             ++L+LL D  E  A+
Sbjct  186  SSLLALLVDLEEDGAK  201



>ref|XP_002964936.1| hypothetical protein SELMODRAFT_439144 [Selaginella moellendorffii]
 gb|EFJ33774.1| hypothetical protein SELMODRAFT_439144 [Selaginella moellendorffii]
Length=599

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 138/217 (64%), Gaps = 25/217 (12%)
 Frame = +1

Query  97   AAGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLL----------------  228
            A+   EP ++H RREPFE+G+L +  L+  DG  +L  +++KLL                
Sbjct  16   ASAQGEPPWLHVRREPFEYGMLPLPSLMHHDGVGSLRELREKLLDKSIPQTSWQSGGGNA  75

Query  229  -----SLSADSAHRVNSKSVSETLQISPDHARLVLETVAAVL--HNESDPLVSANPAEVD  387
                 +++   + RV   ++ E L +S  HA LVL+T+A+VL   ++ D L  A  AE+D
Sbjct  76   SEDSSAMAQQPSRRVGVAAIVECLGLSEAHALLVLDTLASVLPDGDDCDQLARAYAAEID  135

Query  388  SVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSR  567
            +VG +V DL++FLYIQ Y+R+ P+ HKD AAVADVWPSTS FDGF S LSPLQ VR  +R
Sbjct  136  TVGAHVDDLLLFLYIQIYRRVPPRSHKDPAAVADVWPSTSPFDGFFSTLSPLQ-VRP-TR  193

Query  568  RFMPSQSDEEAHQLSYLQKHVGNILSLLADSVEGEAE  678
            + +P Q +EE HQL+++QKH+ ++L+LL D  E  A+
Sbjct  194  KSVPCQVEEEVHQLAFVQKHLSSLLALLVDLEEDGAK  230



>gb|AAB88648.1| hypothetical protein [Arabidopsis thaliana]
Length=551

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 112/189 (59%), Gaps = 54/189 (29%)
 Frame = +1

Query  118  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + IHPRR PFEHGLL I KL+FTD  QTL PIK KL SL+ +  HRV S ++S+ L IS 
Sbjct  22   LIIHPRRVPFEHGLLPIQKLVFTDPIQTLAPIKQKLASLATN--HRVGSAAISDALSISD  79

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  477
            DHARLVLET+++VLH E+DPLV A P EVDS                             
Sbjct  80   DHARLVLETLSSVLHCETDPLVLAKPEEVDS-----------------------------  110

Query  478  AVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLAD  657
                                   LVRSNSRRFMPS +DEEAHQLSYLQKH+ NI+SLLA+
Sbjct  111  -----------------------LVRSNSRRFMPSPTDEEAHQLSYLQKHIANIISLLAE  147

Query  658  SVEGEAEES  684
             VEG+ ++S
Sbjct  148  PVEGQGDDS  156



>ref|XP_001778693.1| predicted protein [Physcomitrella patens]
 gb|EDQ56486.1| predicted protein, partial [Physcomitrella patens]
Length=584

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 143/203 (70%), Gaps = 19/203 (9%)
 Frame = +1

Query  100  AGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAH---------  252
            A   EP  +H RRE FE+G+L +  L+ +D      PI    LS+++++++         
Sbjct  11   ACNTEPC-LHVRREAFEYGILPLPNLLHSDEAP---PISTWALSINSNASYTVPASGDRK  66

Query  253  RVNSKSVSETLQISPDHARLVLETVAAVLHN--ESDPLVSANP-AEVDSVGVNVFDLVVF  423
            RV ++ ++  L+++  HA LVL+T+A+VL++  E+  L++  P  E+DSVG +V DL++F
Sbjct  67   RVGTEGIAAALEVTEAHAHLVLDTLASVLNDGGEAVDLLATTPVTEIDSVGADVDDLLIF  126

Query  424  LYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSN--SRRFMPSQSDEE  597
            LYIQ+Y+R+  + H+D+A VADVWPSTSA DGFL ALSPLQ VRS+  SRR MPSQ++EE
Sbjct  127  LYIQTYRRVPSRPHRDAADVADVWPSTSAIDGFLPALSPLQ-VRSSTVSRRSMPSQAEEE  185

Query  598  AHQLSYLQKHVGNILSLLADSVE  666
             +QL+Y+QKH+ N+L+LLA++ E
Sbjct  186  VNQLTYVQKHLPNLLNLLAETAE  208



>ref|XP_001757659.1| predicted protein [Physcomitrella patens]
 gb|EDQ77716.1| predicted protein [Physcomitrella patens]
Length=608

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/218 (43%), Positives = 142/218 (65%), Gaps = 28/218 (13%)
 Frame = +1

Query  103  GTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLL-----------SLSADSA  249
            G  EP ++H RRE FE+G+L +  L+ +D    L  ++ KLL           S++A+++
Sbjct  11   GAREPPWLHVRREAFEYGMLPLPSLLHSDVVTGLRNLRVKLLQQAPSISTWPLSITANAS  70

Query  250  H---------RVNSKSVSETLQISPDHARLVLETVAAVLHNES---DPLVSANPAEVDSV  393
            H         RV ++ ++  L+++  HA LVL+T+A+VL+ E    DPL      E+DSV
Sbjct  71   HSTPASGGRERVGTEGIAAALEVAEAHAHLVLDTLASVLNEEGAGVDPLAITPVTEIDSV  130

Query  394  GVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQ---LVRSN-  561
            G ++ +L++FLYIQ+Y+R+  + H+ +A VADVWPSTSA DGFL ALS +Q    VRS+ 
Sbjct  131  GADIDELLIFLYIQTYRRVPSRPHRGAADVADVWPSTSAIDGFLPALSSMQSFLQVRSST  190

Query  562  -SRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSVEGE  672
             SRR MP Q++EE +QL+Y+QKH+ N+L+LLA++ E E
Sbjct  191  MSRRSMPGQAEEEVNQLTYVQKHLPNLLNLLAETTEDE  228



>ref|XP_006648417.1| PREDICTED: TBCC domain-containing protein 1-like [Oryza brachyantha]
Length=484

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +1

Query  400  NVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMP  579
            ++ D+++FLYIQSYKRL+P+ HKDS AV DVWPSTSAFDG+LSALSP+QLVRSNSRRFMP
Sbjct  27   DIRDVLLFLYIQSYKRLVPRAHKDSPAVTDVWPSTSAFDGYLSALSPIQLVRSNSRRFMP  86

Query  580  SQSDEEAHQLSYLQKHVGNILSLLADSVEGEAEES  684
            SQ+DEE HQLSYLQKH+ NIL+LLADSVEGE ++S
Sbjct  87   SQADEEIHQLSYLQKHMANILTLLADSVEGEGDDS  121



>ref|XP_006657134.1| PREDICTED: TBCC domain-containing protein 1-like, partial [Oryza 
brachyantha]
Length=481

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 97/115 (84%), Gaps = 6/115 (5%)
 Frame = +1

Query  358  LVSANPAEVDSVG------VNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDG  519
            L +  PAE  ++G       ++ D+++FLYIQSYKRL+P+ HKDS AVADVWPSTSAFDG
Sbjct  1    LAAVLPAEDPALGEDGTGDADLRDVLLFLYIQSYKRLVPRAHKDSPAVADVWPSTSAFDG  60

Query  520  FLSALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSVEGEAEES  684
            +LSALSP++LVRSNSRRFMPSQ+DEE HQLSYLQKH+ NILSLLADSV+GE +ES
Sbjct  61   YLSALSPIKLVRSNSRRFMPSQADEETHQLSYLQKHMVNILSLLADSVDGEGDES  115



>gb|EEE56495.1| hypothetical protein OsJ_05741 [Oryza sativa Japonica Group]
Length=544

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  409  DLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSNSRRFMPSQS  588
            D+++FLYIQSYKRL+P+ HKDS AV DVWPSTSAFDG+LSALSP+QLVRSNSRRFMPSQ+
Sbjct  90   DVLLFLYIQSYKRLVPRAHKDSPAVTDVWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQA  149

Query  589  DEEAHQLSYLQKHVGNILSLLADSVEGEAEES  684
            DEE HQLSYLQKH+ NIL+LLADSVEGE ++S
Sbjct  150  DEEIHQLSYLQKHMANILTLLADSVEGEGDDS  181



>ref|XP_001758135.1| predicted protein [Physcomitrella patens]
 gb|EDQ76957.1| predicted protein [Physcomitrella patens]
Length=579

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 133/197 (68%), Gaps = 12/197 (6%)
 Frame = +1

Query  106  TAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADS-AHRVNSKSVSET  282
            T EP ++H RREPFE+G L I  L+ +D   +L  ++ KLLS +  S   RV+   ++  
Sbjct  14   TREPPWLHVRREPFEYGTLPIPSLMHSDVLASLMTLRGKLLSQAPPSLTSRVSITGIAAA  73

Query  283  LQISPDHARLVLETVAAVLHNES---DPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLL  453
            L+++ ++A+L+LET+A+ L++E    D L S+   E++SVG ++ DL+++LY+Q+Y+R  
Sbjct  74   LELTEEYAQLILETLASTLNDEGTIVDRLASSLVNEIESVGADIDDLLLYLYLQTYRRAP  133

Query  454  PKGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRS--------NSRRFMPSQSDEEAHQL  609
             + H+D+++VADVWP TSA DG L A + L+   S         SRR MP+Q++EE HQL
Sbjct  134  SRPHRDASSVADVWPCTSAIDGILPASTLLKAGTSICHVRLAGVSRRLMPTQAEEEGHQL  193

Query  610  SYLQKHVGNILSLLADS  660
             Y++KH+ ++L++L+++
Sbjct  194  KYVRKHLRSLLTILSET  210



>ref|XP_001765734.1| predicted protein [Physcomitrella patens]
 gb|EDQ69325.1| predicted protein [Physcomitrella patens]
Length=559

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 119/196 (61%), Gaps = 31/196 (16%)
 Frame = +1

Query  112  EPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSA--DSAHRVNSKSVSETL  285
            +P ++H RRE FE+G+L +  L+ +D    L   + KLL  +    +  RV +  ++  L
Sbjct  16   DPPWLHVRREVFEYGILPLPSLVHSDVVTGLRNFRVKLLQQAPPISTWKRVATAGIATAL  75

Query  286  QISPDHARLVLETVAAVLHNES---DPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  456
            +++  HA+L+L+T+A+VL+ E    D L  A   E+DSVGV+V DL++FLYIQ+Y+R+  
Sbjct  76   EVTEAHAQLMLDTLASVLNEEGGVVDSLAIAPATEIDSVGVDVDDLLIFLYIQTYRRVPS  135

Query  457  KGHKDSAAVADVWPSTSAFDGFLSALSPLQLVRSN--SRRFMPSQSDEEAHQLSYLQKHV  630
            +            PS S          P+Q VRS+  SRR MP Q++EE +QL+Y+QKH+
Sbjct  136  R------------PSPS----------PMQ-VRSSTVSRRSMPGQAEEEVNQLTYVQKHL  172

Query  631  GNILSLLADSV-EGEA  675
             N+LSLLA++  EGE 
Sbjct  173  PNLLSLLAETTEEGEG  188



>gb|AFN53653.1| putative G-patch domain protein [Linum usitatissimum]
Length=565

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 70/90 (78%), Gaps = 5/90 (6%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  303
            IHPRREPFEHGLL I KLIFTD TQTLG ++ KL      S  RV++ ++++ LQIS DH
Sbjct  32   IHPRREPFEHGLLPIPKLIFTDPTQTLGQLRQKL-----SSQPRVDATALADALQISTDH  86

Query  304  ARLVLETVAAVLHNESDPLVSANPAEVDSV  393
            ARLVL+T+A+VLH+ESDPLV A   E+DSV
Sbjct  87   ARLVLDTLASVLHSESDPLVKAGSGEIDSV  116



>ref|XP_008657282.1| PREDICTED: spidroin-1-like [Zea mays]
Length=273

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = +1

Query  124  IHPRREPFEHGLLQ--ITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQI  291
            + PRRE F+HGL +  I KLIF +G   QTL  +K+KL +   D   RV + +++E  QI
Sbjct  134  LRPRREAFKHGLKEKLIPKLIFPEGMLAQTLAQLKEKLSASVPDG--RVRAAALAEAQQI  191

Query  292  SPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHK  468
             P     +     A +    DP++      +D    ++ D+++FLYIQSYKRL+ +  HK
Sbjct  192  -PQEQAALALGTLAAVLPAEDPVLGDG--AIDGAAADIRDVLLFLYIQSYKRLVQRSAHK  248

Query  469  DSAAVADVWPSTSAFDGFLSALS  537
            DS AVADVWPSTSAFDG+LSALS
Sbjct  249  DSPAVADVWPSTSAFDGYLSALS  271



>gb|EMS64518.1| TBCC domain-containing protein 1 [Triticum urartu]
Length=472

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  526  SALSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSVEGEAEES  684
            S   PLQLVRSNSRRFMPSQ+DEEAHQLSYLQKH+ N+L+LLADSV+GE +ES
Sbjct  39   SCYPPLQLVRSNSRRFMPSQADEEAHQLSYLQKHMANVLTLLADSVDGEGDES  91



>gb|EMS61357.1| hypothetical protein TRIUR3_14905 [Triticum urartu]
Length=71

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  394  GVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGFLSALSPLQ  546
            G ++ D+++FLYIQSYKRL+P+ HKDS  VADVWPSTSAFDG+LSALSP+Q
Sbjct  4    GADLRDVLLFLYIQSYKRLVPRPHKDSPVVADVWPSTSAFDGYLSALSPIQ  54



>gb|EEC67872.1| hypothetical protein OsI_35505 [Oryza sativa Indica Group]
Length=349

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  532  LSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSVEGEAEES  684
            LS  +LVRSNSRRFMPSQSDEE HQLSYLQKH+ NIL+LLADSVEGE ++S
Sbjct  16   LSIPELVRSNSRRFMPSQSDEEIHQLSYLQKHMANILTLLADSVEGEGDDS  66



>gb|ACM17606.1| tubulin-specific chaperon-like protein [Oryza sativa Indica Group]
Length=389

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  532  LSPLQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSVEGEAEES  684
            LS  +LVRSNSRRFMPSQSDEE HQLSYLQKH+ NIL+LLADSVEGE ++S
Sbjct  16   LSIPELVRSNSRRFMPSQSDEEIHQLSYLQKHMANILTLLADSVEGEGDDS  66



>gb|EMT07109.1| TBCC domain-containing protein 1 [Aegilops tauschii]
Length=511

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  541  LQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSVEGEAEES  684
            + LVRSNSRRFMPSQ+DEEAHQLSYLQKH+ N+L+LLADSV+GE +ES
Sbjct  70   IPLVRSNSRRFMPSQADEEAHQLSYLQKHMANVLTLLADSVDGEGDES  117



>ref|XP_003624015.1| hypothetical protein MTR_7g078290 [Medicago truncatula]
 gb|ABN08494.1| hypothetical protein MtrDRAFT_AC157473g9v2 [Medicago truncatula]
 gb|AES80233.1| hypothetical protein MTR_7g078290 [Medicago truncatula]
Length=114

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  544  QLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSVEGEAEES  684
            +LVRSNS+RF PSQ+DEEA QLSYLQKH+ NI+SLLA+ VEGE+E+S
Sbjct  58   KLVRSNSKRFTPSQADEEAPQLSYLQKHLANIVSLLAEPVEGESEKS  104



>ref|XP_008656241.1| PREDICTED: uncharacterized protein LOC103635607 [Zea mays]
Length=168

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 64/112 (57%), Gaps = 7/112 (6%)
 Frame = +1

Query  124  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  297
            + P+RE FEHGLL I KLIF +G   QTL  +K+KL +   D   RV + ++++  QI P
Sbjct  33   LRPQREAFEHGLLPIPKLIFPEGMLAQTLAQLKEKLAASVPDG--RVRAAALAKAQQI-P  89

Query  298  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLL  453
                 +     A +    DP++      +D    ++ D+++FLYIQSYKRL+
Sbjct  90   QEQAALALGTLAAMLPAEDPVLGDG--AMDGAAADIRDVLLFLYIQSYKRLV  139



>gb|KCW48079.1| hypothetical protein EUGRSUZ_K01823 [Eucalyptus grandis]
Length=363

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  574  MPSQSDEEAHQLSYLQKHVGNILSLLADSVEGEAEES  684
            MPSQ DEEAHQLSYLQKH+ NI+SLLA+ VEGE EES
Sbjct  1    MPSQVDEEAHQLSYLQKHLANIVSLLAEPVEGEGEES  37



>gb|KCW48078.1| hypothetical protein EUGRSUZ_K01823 [Eucalyptus grandis]
Length=397

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  574  MPSQSDEEAHQLSYLQKHVGNILSLLADSVEGEAEES  684
            MPSQ DEEAHQLSYLQKH+ NI+SLLA+ VEGE EES
Sbjct  1    MPSQVDEEAHQLSYLQKHLANIVSLLAEPVEGEGEES  37



>gb|KJB82781.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
Length=397

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  574  MPSQSDEEAHQLSYLQKHVGNILSLLADSVEGEAEES  684
            MPSQ+DEEAHQLSYLQKH+ NILSLL++ VEGE +ES
Sbjct  1    MPSQADEEAHQLSYLQKHLANILSLLSEHVEGEGKES  37



>ref|XP_008360822.1| PREDICTED: TBCC domain-containing protein 1-like [Malus domestica]
Length=362

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  574  MPSQSDEEAHQLSYLQKHVGNILSLLADSVEGEAEES  684
            MPSQ+DEEAHQLSYLQKH+ N++SLLA+ VEG+ EES
Sbjct  1    MPSQADEEAHQLSYLQKHLANLVSLLAEPVEGDGEES  37



>gb|EYU20708.1| hypothetical protein MIMGU_mgv1a007731mg [Erythranthe guttata]
Length=397

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  574  MPSQSDEEAHQLSYLQKHVGNILSLLADSVEGEAEES  684
            MPSQ+DEEAHQLSYLQKH+ NILSLLADS EG  ++S
Sbjct  1    MPSQADEEAHQLSYLQKHMANILSLLADSTEGGDDDS  37



>gb|AET02086.2| microtubule associated protein, MAP65/ASE1 family protein [Medicago 
truncatula]
Length=298

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 35/48 (73%), Gaps = 9/48 (19%)
 Frame = +1

Query  541  LQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSVEGEAEES  684
            LQLVRSNS+ F PS +DEEAHQLSYLQKH+          VEGE+EES
Sbjct  38   LQLVRSNSKWFTPSHADEEAHQLSYLQKHL---------PVEGESEES  76



>ref|XP_003627610.1| ABC transporter family protein [Medicago truncatula]
Length=342

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 35/48 (73%), Gaps = 9/48 (19%)
 Frame = +1

Query  541  LQLVRSNSRRFMPSQSDEEAHQLSYLQKHVGNILSLLADSVEGEAEES  684
            LQLVRSNS+ F PS +DEEAHQLSYLQKH+          VEGE+EES
Sbjct  58   LQLVRSNSKWFTPSHADEEAHQLSYLQKHL---------PVEGESEES  96



>gb|KDO57723.1| hypothetical protein CISIN_1g0403991mg, partial [Citrus sinensis]
Length=37

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  574  MPSQSDEEAHQLSYLQKHVGNILSLL  651
            MPSQSDEEAHQLSYLQKH+ NIL LL
Sbjct  1    MPSQSDEEAHQLSYLQKHMANILQLL  26



>ref|XP_002505027.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66285.1| predicted protein [Micromonas sp. RCC299]
Length=634

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 60/115 (52%), Gaps = 14/115 (12%)
 Frame = +1

Query  133  RREPFEHGLLQITKLI-FTDGTQTLGPIKDKLLSLSADSAHR-----VNSKSVSETLQIS  294
            RREPF+ G+L  + L+   +    L PI+ +LL  +  S H      V+    ++ + I+
Sbjct  13   RREPFDFGILPASFLLPRAESVAALVPIQRRLLQCAHPSRHDPTKLVVSVADAAQCMGIA  72

Query  295  PDHARLVLETVAAVLHNESDPLVSANPAEVDSVG----VNVFDLVVFLYIQSYKR  447
            P HA  V++T+ AV   E  P    +PAE D +     V V  L+ FL++Q++ R
Sbjct  73   PQHAEHVIDTMHAVAPAEPTP----HPAEDDGLPNEPEVRVQHLLQFLFVQTFAR  123



Lambda      K        H        a         alpha
   0.315    0.130    0.365    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1175390270628