BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7392

Length=975
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009777394.1|  PREDICTED: putative clathrin assembly protei...    486   6e-166   Nicotiana sylvestris
ref|XP_009627948.1|  PREDICTED: putative clathrin assembly protei...    486   1e-165   Nicotiana tomentosiformis
ref|XP_011070604.1|  PREDICTED: putative clathrin assembly protei...    484   3e-165   Sesamum indicum [beniseed]
ref|XP_006355077.1|  PREDICTED: putative clathrin assembly protei...    482   4e-164   Solanum tuberosum [potatoes]
ref|NP_001265941.1|  Hop-interacting protein THI028                     481   8e-164   Solanum lycopersicum
gb|EYU30088.1|  hypothetical protein MIMGU_mgv1a0050552mg               465   4e-161   Erythranthe guttata [common monkey flower]
gb|EYU21032.1|  hypothetical protein MIMGU_mgv1a020579mg                472   3e-160   Erythranthe guttata [common monkey flower]
ref|XP_007222905.1|  hypothetical protein PRUPE_ppa003610mg             470   1e-159   Prunus persica
ref|XP_007045208.1|  ENTH/ANTH/VHS superfamily protein                  470   1e-159   
ref|XP_010654389.1|  PREDICTED: putative clathrin assembly protei...    470   2e-159   Vitis vinifera
ref|XP_002284689.2|  PREDICTED: putative clathrin assembly protei...    469   3e-159   Vitis vinifera
ref|XP_008221433.1|  PREDICTED: putative clathrin assembly protei...    469   3e-159   Prunus mume [ume]
ref|XP_008389195.1|  PREDICTED: putative clathrin assembly protei...    466   5e-158   Malus domestica [apple tree]
ref|XP_009351512.1|  PREDICTED: putative clathrin assembly protei...    466   8e-158   Pyrus x bretschneideri [bai li]
ref|XP_002527787.1|  clathrin assembly protein, putative                466   1e-157   Ricinus communis
gb|KJB60905.1|  hypothetical protein B456_009G330700                    464   2e-157   Gossypium raimondii
ref|XP_002311513.1|  clathrin assembly family protein                   464   3e-157   Populus trichocarpa [western balsam poplar]
emb|CDP00810.1|  unnamed protein product                                464   4e-157   Coffea canephora [robusta coffee]
ref|XP_004142277.1|  PREDICTED: putative clathrin assembly protei...    462   1e-156   Cucumis sativus [cucumbers]
ref|XP_011463190.1|  PREDICTED: putative clathrin assembly protei...    462   1e-156   Fragaria vesca subsp. vesca
gb|KHN12469.1|  Putative clathrin assembly protein                      462   2e-156   Glycine soja [wild soybean]
ref|XP_010101968.1|  Putative clathrin assembly protein                 462   3e-156   
gb|KJB30771.1|  hypothetical protein B456_005G159800                    460   5e-156   Gossypium raimondii
gb|KJB30768.1|  hypothetical protein B456_005G159800                    461   7e-156   Gossypium raimondii
ref|XP_003531146.1|  PREDICTED: putative clathrin assembly protei...    461   7e-156   Glycine max [soybeans]
ref|XP_011023792.1|  PREDICTED: putative clathrin assembly protei...    460   1e-155   Populus euphratica
ref|XP_004504573.1|  PREDICTED: putative clathrin assembly protei...    460   1e-155   Cicer arietinum [garbanzo]
ref|XP_007158803.1|  hypothetical protein PHAVU_002G183100g             459   3e-155   Phaseolus vulgaris [French bean]
ref|XP_003524854.1|  PREDICTED: putative clathrin assembly protei...    459   3e-155   Glycine max [soybeans]
gb|KJB30770.1|  hypothetical protein B456_005G159800                    459   9e-155   Gossypium raimondii
ref|XP_010274743.1|  PREDICTED: putative clathrin assembly protei...    457   1e-154   Nelumbo nucifera [Indian lotus]
ref|XP_010681909.1|  PREDICTED: putative clathrin assembly protei...    457   1e-154   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008464707.1|  PREDICTED: putative clathrin assembly protei...    460   2e-154   
ref|XP_011038608.1|  PREDICTED: putative clathrin assembly protei...    457   2e-154   Populus euphratica
ref|XP_011023782.1|  PREDICTED: putative clathrin assembly protei...    456   6e-154   Populus euphratica
ref|XP_012072261.1|  PREDICTED: putative clathrin assembly protei...    456   7e-154   Jatropha curcas
ref|XP_010265534.1|  PREDICTED: putative clathrin assembly protei...    453   7e-153   Nelumbo nucifera [Indian lotus]
ref|XP_010044208.1|  PREDICTED: putative clathrin assembly protei...    453   7e-153   Eucalyptus grandis [rose gum]
gb|KCW86255.1|  hypothetical protein EUGRSUZ_B02940                     451   9e-153   Eucalyptus grandis [rose gum]
gb|KCW86253.1|  hypothetical protein EUGRSUZ_B02940                     452   2e-152   Eucalyptus grandis [rose gum]
ref|XP_008803559.1|  PREDICTED: putative clathrin assembly protei...    449   1e-151   Phoenix dactylifera
ref|XP_010924074.1|  PREDICTED: putative clathrin assembly protei...    448   7e-151   Elaeis guineensis
ref|XP_006448214.1|  hypothetical protein CICLE_v10014774mg             447   1e-150   Citrus clementina [clementine]
ref|XP_006469211.1|  PREDICTED: putative clathrin assembly protei...    447   1e-150   Citrus sinensis [apfelsine]
gb|KDO64585.1|  hypothetical protein CISIN_1g008579mg                   447   2e-150   Citrus sinensis [apfelsine]
ref|XP_008799224.1|  PREDICTED: putative clathrin assembly protei...    446   4e-150   Phoenix dactylifera
ref|XP_011621339.1|  PREDICTED: putative clathrin assembly protei...    446   4e-150   Amborella trichopoda
ref|XP_006838117.1|  PREDICTED: putative clathrin assembly protei...    446   5e-150   Amborella trichopoda
ref|XP_008799223.1|  PREDICTED: putative clathrin assembly protei...    446   5e-150   Phoenix dactylifera
ref|XP_002315872.2|  hypothetical protein POPTR_0010s12020g             445   5e-150   
ref|XP_002315925.2|  hypothetical protein POPTR_0010s12020g             445   7e-150   
gb|KHG06013.1|  hypothetical protein F383_02907                         445   9e-150   Gossypium arboreum [tree cotton]
ref|XP_009396332.1|  PREDICTED: putative clathrin assembly protei...    444   2e-149   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010553785.1|  PREDICTED: putative clathrin assembly protei...    444   3e-149   Tarenaya hassleriana [spider flower]
ref|XP_009396331.1|  PREDICTED: putative clathrin assembly protei...    444   3e-149   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS60394.1|  hypothetical protein M569_14409                         432   2e-148   Genlisea aurea
gb|KJB78156.1|  hypothetical protein B456_012G181700                    439   1e-147   Gossypium raimondii
gb|KJB78154.1|  hypothetical protein B456_012G181700                    439   1e-147   Gossypium raimondii
ref|XP_010921255.1|  PREDICTED: putative clathrin assembly protei...    439   2e-147   Elaeis guineensis
ref|XP_010527791.1|  PREDICTED: putative clathrin assembly protei...    439   3e-147   Tarenaya hassleriana [spider flower]
ref|XP_009418441.1|  PREDICTED: putative clathrin assembly protei...    437   8e-147   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN03156.1|  Putative clathrin assembly protein                      435   6e-146   Glycine soja [wild soybean]
ref|XP_010921261.1|  PREDICTED: putative clathrin assembly protei...    434   7e-146   
gb|KJB78157.1|  hypothetical protein B456_012G181700                    435   8e-146   Gossypium raimondii
ref|XP_010921252.1|  PREDICTED: putative clathrin assembly protei...    433   3e-145   Elaeis guineensis
ref|XP_003533950.1|  PREDICTED: putative clathrin assembly protei...    433   3e-145   Glycine max [soybeans]
ref|XP_006395874.1|  hypothetical protein EUTSA_v10003910mg             428   5e-143   Eutrema salsugineum [saltwater cress]
ref|XP_002441469.1|  hypothetical protein SORBIDRAFT_09g027370          427   7e-143   Sorghum bicolor [broomcorn]
gb|EAY98914.1|  hypothetical protein OsI_20869                          427   1e-142   Oryza sativa Indica Group [Indian rice]
ref|NP_001056232.1|  Os05g0549000                                       427   2e-142   
ref|XP_004961341.1|  PREDICTED: putative clathrin assembly protei...    426   2e-142   Setaria italica
ref|NP_001136989.1|  uncharacterized protein LOC100217151               425   5e-142   Zea mays [maize]
ref|XP_006292297.1|  hypothetical protein CARUB_v10018506mg             426   5e-142   Capsella rubella
ref|XP_006655551.1|  PREDICTED: putative clathrin assembly protei...    425   6e-142   Oryza brachyantha
ref|XP_010513887.1|  PREDICTED: putative clathrin assembly protei...    424   2e-141   Camelina sativa [gold-of-pleasure]
ref|XP_002875082.1|  hypothetical protein ARALYDRAFT_904366             423   3e-141   Arabidopsis lyrata subsp. lyrata
ref|NP_565267.1|  putative clathrin assembly protein                    422   1e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006850889.1|  PREDICTED: putative clathrin assembly protei...    421   1e-140   Amborella trichopoda
gb|AFW80976.1|  hypothetical protein ZEAMMB73_079219                    422   1e-140   
gb|KJB60906.1|  hypothetical protein B456_009G330700                    420   2e-140   Gossypium raimondii
gb|KJB60907.1|  hypothetical protein B456_009G330700                    421   2e-140   Gossypium raimondii
ref|XP_007153280.1|  hypothetical protein PHAVU_003G022000g             420   5e-140   Phaseolus vulgaris [French bean]
ref|NP_001145773.1|  uncharacterized protein LOC100279280               420   6e-140   Zea mays [maize]
ref|NP_172944.1|  putative clathrin assembly protein                    422   6e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009129221.1|  PREDICTED: putative clathrin assembly protei...    417   1e-138   
emb|CDY09433.1|  BnaA02g25770D                                          417   1e-138   Brassica napus [oilseed rape]
emb|CDY48813.1|  BnaC02g34010D                                          417   2e-138   Brassica napus [oilseed rape]
gb|AFW80975.1|  hypothetical protein ZEAMMB73_079219                    416   4e-138   
gb|KFK32949.1|  hypothetical protein AALP_AA6G310300                    420   4e-138   Arabis alpina [alpine rockcress]
ref|XP_006646232.1|  PREDICTED: putative clathrin assembly protei...    416   4e-138   Oryza brachyantha
ref|XP_010913847.1|  PREDICTED: LOW QUALITY PROTEIN: putative cla...    414   2e-137   Elaeis guineensis
emb|CDY17660.1|  BnaA06g34790D                                          414   2e-137   Brassica napus [oilseed rape]
ref|XP_009101331.1|  PREDICTED: putative clathrin assembly protei...    414   2e-137   Brassica rapa
emb|CDY36239.1|  BnaC07g20930D                                          413   3e-137   Brassica napus [oilseed rape]
gb|EEC71324.1|  hypothetical protein OsI_03369                          412   5e-137   Oryza sativa Indica Group [Indian rice]
ref|XP_002269299.1|  PREDICTED: putative clathrin assembly protei...    412   1e-136   Vitis vinifera
ref|NP_001043956.1|  Os01g0694900                                       411   2e-136   
ref|XP_008781765.1|  PREDICTED: putative clathrin assembly protei...    411   2e-136   Phoenix dactylifera
ref|XP_003567959.1|  PREDICTED: putative clathrin assembly protei...    410   3e-136   Brachypodium distachyon [annual false brome]
ref|XP_010459008.1|  PREDICTED: putative clathrin assembly protei...    407   3e-136   Camelina sativa [gold-of-pleasure]
ref|XP_006306843.1|  hypothetical protein CARUB_v10008396mg             416   4e-136   Capsella rubella
gb|KFK33381.1|  hypothetical protein AALP_AA5G005800                    410   4e-136   Arabis alpina [alpine rockcress]
ref|XP_004969636.1|  PREDICTED: putative clathrin assembly protei...    409   2e-135   Setaria italica
ref|XP_011648957.1|  PREDICTED: putative clathrin assembly protei...    409   2e-135   Cucumis sativus [cucumbers]
ref|XP_006416959.1|  hypothetical protein EUTSA_v10007171mg             409   3e-135   
ref|XP_010273537.1|  PREDICTED: putative clathrin assembly protei...    408   4e-135   Nelumbo nucifera [Indian lotus]
ref|XP_008451229.1|  PREDICTED: putative clathrin assembly protei...    408   5e-135   Cucumis melo [Oriental melon]
emb|CDM83847.1|  unnamed protein product                                407   6e-135   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002456192.1|  hypothetical protein SORBIDRAFT_03g031930          407   6e-135   Sorghum bicolor [broomcorn]
dbj|BAK06048.1|  predicted protein                                      407   7e-135   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010476568.1|  PREDICTED: putative clathrin assembly protei...    410   3e-134   Camelina sativa [gold-of-pleasure]
ref|XP_010496638.1|  PREDICTED: putative clathrin assembly protei...    410   3e-134   Camelina sativa [gold-of-pleasure]
ref|XP_010459007.1|  PREDICTED: putative clathrin assembly protei...    410   4e-134   Camelina sativa [gold-of-pleasure]
emb|CDY17459.1|  BnaC09g20780D                                          404   9e-134   Brassica napus [oilseed rape]
ref|XP_010424932.1|  PREDICTED: putative clathrin assembly protei...    404   2e-133   Camelina sativa [gold-of-pleasure]
ref|XP_010050955.1|  PREDICTED: putative clathrin assembly protei...    403   6e-133   Eucalyptus grandis [rose gum]
ref|XP_009114226.1|  PREDICTED: putative clathrin assembly protei...    402   9e-133   Brassica rapa
ref|XP_003569612.1|  PREDICTED: putative clathrin assembly protei...    401   1e-132   Brachypodium distachyon [annual false brome]
ref|XP_006453261.1|  hypothetical protein CICLE_v10010653mg             401   4e-132   Citrus clementina [clementine]
ref|XP_008811452.1|  PREDICTED: putative clathrin assembly protei...    400   4e-132   Phoenix dactylifera
emb|CDY53525.1|  BnaC05g11150D                                          404   4e-132   Brassica napus [oilseed rape]
gb|KDO61895.1|  hypothetical protein CISIN_1g040258mg                   400   7e-132   Citrus sinensis [apfelsine]
ref|XP_009408060.1|  PREDICTED: putative clathrin assembly protei...    398   2e-131   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007014413.1|  ENTH/ANTH/VHS superfamily protein                  398   2e-131   
emb|CDY45299.1|  BnaA06g09690D                                          402   2e-131   Brassica napus [oilseed rape]
ref|XP_002324695.1|  clathrin assembly family protein                   397   8e-131   Populus trichocarpa [western balsam poplar]
ref|XP_008223882.1|  PREDICTED: putative clathrin assembly protei...    397   8e-131   Prunus mume [ume]
ref|XP_002527806.1|  clathrin assembly protein, putative                397   9e-131   Ricinus communis
ref|XP_007222299.1|  hypothetical protein PRUPE_ppa003361mg             397   1e-130   Prunus persica
ref|XP_011017657.1|  PREDICTED: putative clathrin assembly protei...    396   2e-130   Populus euphratica
ref|XP_008672590.1|  PREDICTED: uncharacterized protein LOC100276...    395   3e-130   
ref|XP_008672589.1|  PREDICTED: uncharacterized protein LOC100276...    395   4e-130   Zea mays [maize]
ref|XP_009148877.1|  PREDICTED: putative clathrin assembly protei...    401   5e-130   Brassica rapa
ref|XP_010688409.1|  PREDICTED: putative clathrin assembly protei...    394   2e-129   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010536897.1|  PREDICTED: putative clathrin assembly protei...    394   2e-129   Tarenaya hassleriana [spider flower]
ref|XP_004297901.1|  PREDICTED: putative clathrin assembly protei...    393   3e-129   Fragaria vesca subsp. vesca
ref|XP_012068461.1|  PREDICTED: LOW QUALITY PROTEIN: putative cla...    393   4e-129   Jatropha curcas
ref|XP_009359933.1|  PREDICTED: putative clathrin assembly protei...    392   6e-129   Pyrus x bretschneideri [bai li]
ref|XP_010087990.1|  Putative clathrin assembly protein                 392   7e-129   Morus notabilis
gb|KJB53729.1|  hypothetical protein B456_009G002600                    391   1e-128   Gossypium raimondii
ref|XP_011020010.1|  PREDICTED: putative clathrin assembly protei...    387   1e-128   Populus euphratica
emb|CDP20659.1|  unnamed protein product                                390   3e-128   Coffea canephora [robusta coffee]
ref|XP_010929364.1|  PREDICTED: putative clathrin assembly protei...    388   7e-128   
ref|XP_007154718.1|  hypothetical protein PHAVU_003G141500g             389   1e-127   Phaseolus vulgaris [French bean]
ref|XP_010929362.1|  PREDICTED: putative clathrin assembly protei...    388   1e-127   
ref|XP_002864505.1|  predicted protein                                  389   2e-127   Arabidopsis lyrata subsp. lyrata
ref|XP_006279508.1|  hypothetical protein CARUB_v10027557mg             389   2e-127   Capsella rubella
ref|XP_002308116.2|  hypothetical protein POPTR_0006s07540g             388   2e-127   
ref|NP_200530.1|  putative clathrin assembly protein                    388   3e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011020009.1|  PREDICTED: putative clathrin assembly protei...    387   7e-127   Populus euphratica
ref|XP_010451872.1|  PREDICTED: putative clathrin assembly protei...    387   7e-127   Camelina sativa [gold-of-pleasure]
ref|XP_010483224.1|  PREDICTED: putative clathrin assembly protei...    387   8e-127   Camelina sativa [gold-of-pleasure]
ref|XP_010443398.1|  PREDICTED: putative clathrin assembly protei...    387   9e-127   Camelina sativa [gold-of-pleasure]
ref|XP_006401230.1|  hypothetical protein EUTSA_v10013043mg             387   1e-126   Eutrema salsugineum [saltwater cress]
ref|XP_009400569.1|  PREDICTED: putative clathrin assembly protei...    387   1e-126   
gb|KFK27275.1|  hypothetical protein AALP_AA8G360900                    386   2e-126   Arabis alpina [alpine rockcress]
ref|XP_009120244.1|  PREDICTED: putative clathrin assembly protei...    385   5e-126   Brassica rapa
emb|CDY38276.1|  BnaA10g11240D                                          385   5e-126   Brassica napus [oilseed rape]
emb|CDY52732.1|  BnaC09g53320D                                          385   6e-126   Brassica napus [oilseed rape]
ref|XP_011094096.1|  PREDICTED: putative clathrin assembly protei...    384   7e-126   Sesamum indicum [beniseed]
ref|XP_006648363.1|  PREDICTED: putative clathrin assembly protei...    382   5e-125   Oryza brachyantha
ref|XP_008391574.1|  PREDICTED: LOW QUALITY PROTEIN: putative cla...    380   3e-124   
gb|EYU18219.1|  hypothetical protein MIMGU_mgv1a003551mg                380   5e-124   Erythranthe guttata [common monkey flower]
gb|KFK29105.1|  hypothetical protein AALP_AA7G089800                    380   6e-124   Arabis alpina [alpine rockcress]
ref|XP_009126852.1|  PREDICTED: putative clathrin assembly protei...    380   8e-124   Brassica rapa
gb|AES65322.2|  clathrin assembly plant-like protein                    379   1e-123   Medicago truncatula
ref|XP_007138775.1|  hypothetical protein PHAVU_009G236300g             379   2e-123   Phaseolus vulgaris [French bean]
ref|XP_004951735.1|  PREDICTED: putative clathrin assembly protei...    378   2e-123   Setaria italica
ref|XP_002867587.1|  hypothetical protein ARALYDRAFT_492223             378   3e-123   Arabidopsis lyrata subsp. lyrata
ref|XP_009398623.1|  PREDICTED: putative clathrin assembly protei...    376   6e-123   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006586993.1|  PREDICTED: putative clathrin assembly protei...    377   1e-122   Glycine max [soybeans]
gb|EMT16298.1|  Putative clathrin assembly protein                      379   1e-122   
gb|KHN15336.1|  Putative clathrin assembly protein                      376   2e-122   Glycine soja [wild soybean]
ref|XP_010545389.1|  PREDICTED: putative clathrin assembly protei...    375   2e-122   Tarenaya hassleriana [spider flower]
ref|XP_006413249.1|  hypothetical protein EUTSA_v10024721mg             376   2e-122   
ref|XP_004231715.1|  PREDICTED: putative clathrin assembly protei...    375   2e-122   Solanum lycopersicum
ref|XP_006597797.1|  PREDICTED: putative clathrin assembly protei...    376   2e-122   
ref|XP_010545391.1|  PREDICTED: putative clathrin assembly protei...    375   2e-122   Tarenaya hassleriana [spider flower]
ref|XP_009595317.1|  PREDICTED: putative clathrin assembly protei...    377   3e-122   
ref|XP_006346667.1|  PREDICTED: putative clathrin assembly protei...    375   3e-122   Solanum tuberosum [potatoes]
gb|AAF79231.1|AC006917_16  F10B6.32                                     382   3e-122   Arabidopsis thaliana [mouse-ear cress]
gb|KHN35810.1|  Putative clathrin assembly protein                      375   4e-122   Glycine soja [wild soybean]
ref|XP_009595316.1|  PREDICTED: putative clathrin assembly protei...    376   4e-122   Nicotiana tomentosiformis
ref|XP_006593512.1|  PREDICTED: putative clathrin assembly protei...    374   4e-122   Glycine max [soybeans]
ref|XP_006413250.1|  hypothetical protein EUTSA_v10024721mg             375   6e-122   Eutrema salsugineum [saltwater cress]
gb|KHN22664.1|  Putative clathrin assembly protein                      374   7e-122   Glycine soja [wild soybean]
emb|CDX94400.1|  BnaC01g17840D                                          375   7e-122   
emb|CDX89382.1|  BnaA01g15110D                                          374   1e-121   
ref|XP_004487990.1|  PREDICTED: putative clathrin assembly protei...    374   1e-121   Cicer arietinum [garbanzo]
ref|XP_002453380.1|  hypothetical protein SORBIDRAFT_04g005060          373   1e-121   Sorghum bicolor [broomcorn]
emb|CDY47927.1|  BnaA02g08290D                                          371   1e-121   Brassica napus [oilseed rape]
ref|XP_009139694.1|  PREDICTED: putative clathrin assembly protei...    374   2e-121   Brassica rapa
ref|XP_006600479.1|  PREDICTED: putative clathrin assembly protei...    373   2e-121   Glycine max [soybeans]
emb|CAB39659.1|  predicted protein destination factor                   373   2e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283380.1|  hypothetical protein CARUB_v10004424mg             367   5e-121   
ref|XP_009757132.1|  PREDICTED: putative clathrin assembly protei...    372   5e-121   Nicotiana sylvestris
gb|EMT23238.1|  Putative clathrin assembly protein                      370   5e-121   
ref|NP_194324.2|  ENTH/ANTH/VHS superfamily protein                     372   5e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009757131.1|  PREDICTED: putative clathrin assembly protei...    372   8e-121   Nicotiana sylvestris
gb|KHN17630.1|  Putative clathrin assembly protein                      371   9e-121   Glycine soja [wild soybean]
ref|XP_010433571.1|  PREDICTED: putative clathrin assembly protei...    371   2e-120   Camelina sativa [gold-of-pleasure]
gb|EEC72596.1|  hypothetical protein OsI_06060                          370   3e-120   Oryza sativa Indica Group [Indian rice]
ref|NP_001046057.1|  Os02g0175700                                       370   3e-120   
ref|XP_010448345.1|  PREDICTED: putative clathrin assembly protei...    370   4e-120   Camelina sativa [gold-of-pleasure]
ref|XP_004487991.1|  PREDICTED: putative clathrin assembly protei...    369   7e-120   
ref|XP_009595513.1|  PREDICTED: putative clathrin assembly protei...    368   1e-119   Nicotiana tomentosiformis
emb|CDY42239.1|  BnaC02g11760D                                          360   2e-119   Brassica napus [oilseed rape]
ref|XP_009390454.1|  PREDICTED: putative clathrin assembly protei...    367   2e-119   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010438819.1|  PREDICTED: putative clathrin assembly protei...    368   2e-119   Camelina sativa [gold-of-pleasure]
ref|XP_004507895.1|  PREDICTED: putative clathrin assembly protei...    368   3e-119   Cicer arietinum [garbanzo]
ref|XP_004507896.1|  PREDICTED: putative clathrin assembly protei...    368   4e-119   
ref|XP_001755297.1|  predicted protein                                  363   6e-119   
ref|XP_009773773.1|  PREDICTED: putative clathrin assembly protei...    367   7e-119   Nicotiana sylvestris
ref|XP_002982426.1|  hypothetical protein SELMODRAFT_268581             365   1e-118   Selaginella moellendorffii
ref|XP_003595071.1|  hypothetical protein MTR_2g037980                  367   2e-118   
ref|NP_001169970.1|  hypothetical protein                               365   3e-118   Zea mays [maize]
ref|XP_008644118.1|  PREDICTED: hypothetical protein isoform X1         365   3e-118   Zea mays [maize]
ref|XP_006283381.1|  hypothetical protein CARUB_v10004424mg             365   4e-118   Capsella rubella
gb|KJB60910.1|  hypothetical protein B456_009G330700                    362   6e-118   Gossypium raimondii
ref|XP_002966589.1|  hypothetical protein SELMODRAFT_230819             362   1e-117   
ref|XP_011075418.1|  PREDICTED: putative clathrin assembly protei...    360   2e-117   
dbj|BAD54001.1|  destination factor-like                                362   2e-117   Oryza sativa Japonica Group [Japonica rice]
gb|KJB60908.1|  hypothetical protein B456_009G330700                    359   7e-117   Gossypium raimondii
gb|KJB30769.1|  hypothetical protein B456_005G159800                    359   1e-116   Gossypium raimondii
ref|XP_011077728.1|  PREDICTED: putative clathrin assembly protei...    360   3e-116   Sesamum indicum [beniseed]
gb|EEC81258.1|  hypothetical protein OsI_24348                          355   3e-115   Oryza sativa Indica Group [Indian rice]
ref|NP_001151036.1|  clathrin assembly protein                          357   4e-115   
ref|XP_004967244.1|  PREDICTED: putative clathrin assembly protei...    356   5e-115   
gb|AFW76126.1|  clathrin assembly protein                               356   6e-115   
ref|XP_006657301.1|  PREDICTED: putative clathrin assembly protei...    354   1e-114   Oryza brachyantha
ref|XP_004965651.1|  PREDICTED: putative clathrin assembly protei...    355   2e-114   Setaria italica
ref|XP_006656326.1|  PREDICTED: putative clathrin assembly protei...    352   3e-113   Oryza brachyantha
dbj|BAD46420.1|  phosphoprotein-like                                    352   4e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006344967.1|  PREDICTED: putative clathrin assembly protei...    351   6e-113   
ref|XP_010240260.1|  PREDICTED: putative clathrin assembly protei...    351   9e-113   Brachypodium distachyon [annual false brome]
ref|XP_003563341.1|  PREDICTED: putative clathrin assembly protei...    350   1e-112   Brachypodium distachyon [annual false brome]
ref|XP_002437533.1|  hypothetical protein SORBIDRAFT_10g028860          351   1e-112   
gb|AFW78995.1|  hypothetical protein ZEAMMB73_223268                    336   9e-112   
gb|AES92253.2|  clathrin assembly plant-like protein                    344   3e-110   Medicago truncatula
ref|XP_003610056.1|  Phosphoprotein-like protein                        344   5e-110   
gb|ABR16117.1|  unknown                                                 339   1e-108   Picea sitchensis
ref|XP_010929366.1|  PREDICTED: putative clathrin assembly protei...    335   2e-108   
ref|XP_002437409.1|  hypothetical protein SORBIDRAFT_10g026370          327   8e-108   
ref|XP_010929365.1|  PREDICTED: putative clathrin assembly protei...    335   1e-107   
ref|XP_010929363.1|  PREDICTED: putative clathrin assembly protei...    336   1e-107   
gb|EYU38747.1|  hypothetical protein MIMGU_mgv1a003095mg                338   2e-107   Erythranthe guttata [common monkey flower]
ref|XP_004508453.1|  PREDICTED: putative clathrin assembly protei...    329   1e-104   Cicer arietinum [garbanzo]
ref|XP_006845427.1|  PREDICTED: putative clathrin assembly protei...    328   1e-104   Amborella trichopoda
gb|KDO73483.1|  hypothetical protein CISIN_1g009078mg                   319   7e-104   Citrus sinensis [apfelsine]
gb|KJB78155.1|  hypothetical protein B456_012G181700                    325   8e-104   Gossypium raimondii
gb|KJB23396.1|  hypothetical protein B456_004G095900                    322   9e-104   Gossypium raimondii
gb|KDO73482.1|  hypothetical protein CISIN_1g009078mg                   320   2e-103   Citrus sinensis [apfelsine]
ref|XP_002531947.1|  clathrin assembly protein, putative                325   2e-103   Ricinus communis
ref|XP_010241584.1|  PREDICTED: putative clathrin assembly protei...    325   4e-103   Nelumbo nucifera [Indian lotus]
emb|CDP10454.1|  unnamed protein product                                324   8e-103   Coffea canephora [robusta coffee]
emb|CBI28256.3|  unnamed protein product                                322   1e-102   Vitis vinifera
gb|KDO73481.1|  hypothetical protein CISIN_1g009078mg                   320   1e-102   Citrus sinensis [apfelsine]
ref|XP_010250225.1|  PREDICTED: putative clathrin assembly protei...    322   6e-102   Nelumbo nucifera [Indian lotus]
ref|XP_012081185.1|  PREDICTED: putative clathrin assembly protei...    322   6e-102   Jatropha curcas
ref|XP_003609412.1|  hypothetical protein MTR_4g115420                  322   7e-102   Medicago truncatula
gb|KHN03612.1|  Putative clathrin assembly protein                      321   1e-101   Glycine soja [wild soybean]
ref|XP_002285448.2|  PREDICTED: putative clathrin assembly protei...    321   1e-101   Vitis vinifera
ref|XP_003542645.1|  PREDICTED: putative clathrin assembly protei...    321   1e-101   Glycine max [soybeans]
gb|EMT14882.1|  Putative clathrin assembly protein                      320   2e-101   
gb|KDO73477.1|  hypothetical protein CISIN_1g009078mg                   320   2e-101   Citrus sinensis [apfelsine]
ref|XP_006453089.1|  hypothetical protein CICLE_v10007931mg             320   2e-101   Citrus clementina [clementine]
ref|XP_004150528.1|  PREDICTED: putative clathrin assembly protei...    320   2e-101   Cucumis sativus [cucumbers]
gb|AFK40929.1|  unknown                                                 320   4e-101   Lotus japonicus
gb|KDP41089.1|  hypothetical protein JCGZ_03219                         318   4e-101   Jatropha curcas
ref|XP_011078406.1|  PREDICTED: putative clathrin assembly protei...    320   5e-101   Sesamum indicum [beniseed]
ref|XP_009614798.1|  PREDICTED: putative clathrin assembly protei...    319   6e-101   Nicotiana tomentosiformis
ref|XP_010057620.1|  PREDICTED: putative clathrin assembly protei...    319   7e-101   Eucalyptus grandis [rose gum]
emb|CAN83852.1|  hypothetical protein VITISV_037564                     320   7e-101   Vitis vinifera
ref|XP_003549739.1|  PREDICTED: putative clathrin assembly protei...    319   8e-101   Glycine max [soybeans]
ref|XP_007013562.1|  ENTH/ANTH/VHS superfamily protein isoform 2        314   1e-100   
gb|KJB64691.1|  hypothetical protein B456_010G060800                    313   2e-100   Gossypium raimondii
gb|EYU34970.1|  hypothetical protein MIMGU_mgv1a003922mg                318   2e-100   Erythranthe guttata [common monkey flower]
gb|EPS69599.1|  hypothetical protein M569_05168                         308   2e-100   Genlisea aurea
ref|XP_009363972.1|  PREDICTED: putative clathrin assembly protei...    318   3e-100   Pyrus x bretschneideri [bai li]
ref|XP_009785618.1|  PREDICTED: putative clathrin assembly protei...    317   3e-100   
ref|XP_009340644.1|  PREDICTED: putative clathrin assembly protei...    317   4e-100   
ref|XP_009340645.1|  PREDICTED: putative clathrin assembly protei...    317   4e-100   
ref|XP_007155057.1|  hypothetical protein PHAVU_003G169400g             317   5e-100   
ref|XP_008385249.1|  PREDICTED: putative clathrin assembly protei...    317   5e-100   
ref|XP_008361112.1|  PREDICTED: putative clathrin assembly protei...    317   6e-100   
ref|XP_011020194.1|  PREDICTED: putative clathrin assembly protei...    317   8e-100   
gb|EAZ38170.1|  hypothetical protein OsJ_22524                          315   9e-100   
gb|KJB64692.1|  hypothetical protein B456_010G060800                    313   1e-99    
gb|KDO73480.1|  hypothetical protein CISIN_1g009078mg                   316   1e-99    
ref|XP_007013561.1|  ENTH/ANTH/VHS superfamily protein isoform 1        315   2e-99    
ref|XP_011020196.1|  PREDICTED: putative clathrin assembly protei...    315   3e-99    
gb|EPS72077.1|  hypothetical protein M569_02679                         313   6e-99    
gb|KJB64689.1|  hypothetical protein B456_010G060800                    314   7e-99    
ref|XP_006358316.1|  PREDICTED: putative clathrin assembly protei...    314   1e-98    
ref|XP_008242823.1|  PREDICTED: putative clathrin assembly protei...    313   1e-98    
ref|XP_007201932.1|  hypothetical protein PRUPE_ppa003855mg             313   1e-98    
ref|XP_010323282.1|  PREDICTED: putative clathrin assembly protei...    313   1e-98    
gb|EMT21757.1|  Putative clathrin assembly protein                      313   1e-98    
gb|KHG16288.1|  hypothetical protein F383_00250                         313   2e-98    
ref|XP_008794954.1|  PREDICTED: putative clathrin assembly protei...    313   2e-98    
gb|AFW76125.1|  hypothetical protein ZEAMMB73_698620                    302   3e-98    
ref|XP_009401365.1|  PREDICTED: putative clathrin assembly protei...    311   1e-97    
ref|XP_002308057.2|  hypothetical protein POPTR_0006s06390g             310   2e-97    
ref|XP_002862789.1|  predicted protein                                  304   3e-97    
ref|XP_009395478.1|  PREDICTED: putative clathrin assembly protei...    310   3e-97    
ref|XP_010687911.1|  PREDICTED: putative clathrin assembly protei...    310   4e-97    
ref|XP_006372154.1|  hypothetical protein POPTR_0018s12580g             310   4e-97    
ref|XP_010110275.1|  Putative clathrin assembly protein                 310   5e-97    
ref|XP_002324629.1|  hypothetical protein POPTR_0018s12580g             310   6e-97    
ref|XP_004287277.1|  PREDICTED: putative clathrin assembly protei...    308   8e-97    
ref|XP_009403215.1|  PREDICTED: putative clathrin assembly protei...    308   8e-97    
ref|XP_011017841.1|  PREDICTED: putative clathrin assembly protei...    308   1e-96    
ref|XP_010906894.1|  PREDICTED: putative clathrin assembly protei...    306   4e-96    
ref|XP_010904605.1|  PREDICTED: putative clathrin assembly protei...    305   1e-95    
ref|XP_008443942.1|  PREDICTED: putative clathrin assembly protei...    306   1e-95    
ref|XP_004964715.1|  PREDICTED: putative clathrin assembly protei...    305   3e-95    
gb|EYU33129.1|  hypothetical protein MIMGU_mgv1a0037702mg               301   7e-95    
ref|XP_006403061.1|  hypothetical protein EUTSA_v10003447mg             303   9e-95    
ref|XP_004964714.1|  PREDICTED: putative clathrin assembly protei...    304   1e-94    
gb|KJB53994.1|  hypothetical protein B456_009G015300                    303   1e-94    
gb|KHG01485.1|  hypothetical protein F383_22177                         302   2e-94    
ref|NP_001182937.1|  uncharacterized protein LOC100501232               296   3e-94    
emb|CDY71126.1|  BnaAnng36220D                                          298   4e-94    
emb|CDY41768.1|  BnaA08g07230D                                          296   7e-94    
ref|XP_003564229.1|  PREDICTED: putative clathrin assembly protei...    301   1e-93    
ref|XP_006655844.1|  PREDICTED: putative clathrin assembly protei...    300   2e-93    
ref|NP_001056950.1|  Os06g0175500                                       298   2e-92    
emb|CDY12401.1|  BnaC08g08040D                                          296   4e-92    
ref|XP_006286251.1|  hypothetical protein CARUB_v10007821mg             296   4e-92    
ref|XP_009108052.1|  PREDICTED: putative clathrin assembly protei...    296   5e-92    
ref|XP_002870422.1|  hypothetical protein ARALYDRAFT_915653             295   8e-92    
ref|XP_010440697.1|  PREDICTED: putative clathrin assembly protei...    295   1e-91    
ref|XP_010435408.1|  PREDICTED: putative clathrin assembly protei...    295   2e-91    
ref|XP_008648219.1|  PREDICTED: uncharacterized protein LOC100501...    295   2e-91    
ref|NP_198370.1|  putative clathrin assembly protein                    294   3e-91    
ref|XP_010435407.1|  PREDICTED: putative clathrin assembly protei...    295   3e-91    
ref|XP_010541947.1|  PREDICTED: putative clathrin assembly protei...    291   4e-90    
ref|XP_008659222.1|  PREDICTED: putative clathrin assembly protei...    291   7e-90    
gb|EAZ37894.1|  hypothetical protein OsJ_22244                          288   3e-89    
ref|XP_007227140.1|  hypothetical protein PRUPE_ppa026257mg             275   2e-88    
dbj|BAJ92774.1|  predicted protein                                      275   4e-88    
ref|XP_010533128.1|  PREDICTED: putative clathrin assembly protei...    286   1e-87    
emb|CBI36596.3|  unnamed protein product                                284   1e-87    
gb|KHG01486.1|  hypothetical protein F383_22177                         285   1e-87    
ref|XP_002271781.2|  PREDICTED: putative clathrin assembly protei...    284   2e-87    
ref|XP_010533127.1|  PREDICTED: putative clathrin assembly protei...    285   2e-87    
ref|XP_002533433.1|  clathrin assembly protein, putative                282   1e-86    
ref|XP_003570337.1|  PREDICTED: putative clathrin assembly protei...    281   4e-86    
ref|NP_001048425.1|  Os02g0803300                                       280   2e-85    
gb|EEC74189.1|  hypothetical protein OsI_09327                          280   2e-85    
ref|XP_006474617.1|  PREDICTED: putative clathrin assembly protei...    280   2e-85    
ref|XP_006453525.1|  hypothetical protein CICLE_v10010196mg             279   3e-85    
emb|CDP02870.1|  unnamed protein product                                278   5e-85    
gb|KDO62335.1|  hypothetical protein CISIN_1g037435mg                   279   6e-85    
ref|XP_010927972.1|  PREDICTED: putative clathrin assembly protei...    277   8e-85    
gb|KHG06012.1|  hypothetical protein F383_02907                         281   1e-84    
ref|XP_004954262.1|  PREDICTED: putative clathrin assembly protei...    276   2e-84    
ref|XP_004954260.1|  PREDICTED: putative clathrin assembly protei...    276   2e-84    
ref|XP_006648067.1|  PREDICTED: putative clathrin assembly protei...    275   8e-84    
gb|EMT06005.1|  Putative clathrin assembly protein                      275   1e-83    
ref|XP_008679209.1|  PREDICTED: putative clathrin assembly protei...    274   2e-83    
gb|EAY99883.1|  hypothetical protein OsI_21879                          274   3e-83    
ref|XP_002452995.1|  hypothetical protein SORBIDRAFT_04g036280          269   7e-82    
ref|XP_001782839.1|  predicted protein                                  267   1e-81    
gb|EPS72007.1|  hypothetical protein M569_02752                         261   3e-81    
gb|EPS74138.1|  hypothetical protein M569_00617                         252   2e-80    
gb|EYU34309.1|  hypothetical protein MIMGU_mgv1a020331mg                260   5e-80    
gb|EMT24265.1|  Putative clathrin assembly protein                      267   6e-80    
ref|XP_007013936.1|  Clathrin assembly protein, putative                264   8e-80    
ref|XP_011079347.1|  PREDICTED: putative clathrin assembly protei...    265   2e-79    
ref|XP_009600707.1|  PREDICTED: putative clathrin assembly protei...    260   1e-77    
ref|XP_006350141.1|  PREDICTED: putative clathrin assembly protei...    259   2e-77    
ref|XP_012071593.1|  PREDICTED: putative clathrin assembly protei...    257   6e-77    
ref|XP_004252088.1|  PREDICTED: putative clathrin assembly protei...    258   1e-76    
ref|XP_009786917.1|  PREDICTED: putative clathrin assembly protei...    254   3e-75    
ref|XP_006856558.2|  PREDICTED: putative clathrin assembly protei...    251   2e-74    
gb|EMT14615.1|  Putative clathrin assembly protein                      251   3e-74    
ref|XP_011471067.1|  PREDICTED: putative clathrin assembly protei...    240   4e-70    
ref|XP_004309778.1|  PREDICTED: putative clathrin assembly protei...    240   4e-70    
ref|XP_008223645.1|  PREDICTED: putative clathrin assembly protei...    235   2e-68    
ref|XP_009351158.1|  PREDICTED: putative clathrin assembly protei...    235   2e-68    
ref|XP_007224156.1|  hypothetical protein PRUPE_ppa016814mg             220   7e-63    
gb|EPS73460.1|  hypothetical protein M569_01297                         201   2e-60    
gb|ERN18026.1|  hypothetical protein AMTR_s00046p00180850               204   4e-60    
gb|KJB59299.1|  hypothetical protein B456_009G248400                    199   1e-59    
ref|XP_004514138.1|  PREDICTED: putative clathrin assembly protei...    204   4e-57    
gb|KCW53491.1|  hypothetical protein EUGRSUZ_J02757                     191   2e-56    
gb|KEH15812.1|  clathrin assembly protein                               202   2e-56    
ref|XP_006358317.1|  PREDICTED: putative clathrin assembly protei...    199   1e-55    
gb|EPS70597.1|  hypothetical protein M569_04158                         197   3e-55    
gb|KJB64690.1|  hypothetical protein B456_010G060800                    198   4e-55    
ref|XP_010314099.1|  PREDICTED: putative clathrin assembly protei...    187   7e-55    
gb|EYU33130.1|  hypothetical protein MIMGU_mgv1a0037701mg               172   9e-50    
ref|XP_001694668.1|  clathrin assembly factor-like protein              184   2e-49    
ref|XP_007043039.1|  ENTH/ANTH/VHS superfamily protein                  184   3e-49    
ref|XP_009629510.1|  PREDICTED: putative clathrin assembly protei...    183   7e-49    
ref|XP_010260538.1|  PREDICTED: putative clathrin assembly protei...    183   7e-49    
ref|XP_006494069.1|  PREDICTED: putative clathrin assembly protei...    182   1e-48    
ref|XP_006432449.1|  hypothetical protein CICLE_v10000680mg             182   1e-48    
emb|CDO97491.1|  unnamed protein product                                182   1e-48    
ref|XP_007222060.1|  hypothetical protein PRUPE_ppa003194mg             182   2e-48    
ref|XP_008218828.1|  PREDICTED: putative clathrin assembly protei...    182   2e-48    
ref|XP_009787969.1|  PREDICTED: putative clathrin assembly protei...    181   4e-48    
ref|XP_002523765.1|  clathrin assembly protein, putative                181   4e-48    
ref|XP_006351813.1|  PREDICTED: putative clathrin assembly protei...    180   8e-48    
gb|KJB47131.1|  hypothetical protein B456_008G014400                    180   9e-48    
ref|XP_010270464.1|  PREDICTED: putative clathrin assembly protei...    178   3e-47    
emb|CBI20038.3|  unnamed protein product                                176   6e-47    
ref|XP_010103874.1|  Putative clathrin assembly protein                 177   7e-47    
gb|KJB12345.1|  hypothetical protein B456_002G013400                    177   7e-47    
ref|XP_004230562.1|  PREDICTED: putative clathrin assembly protei...    177   8e-47    
ref|XP_010920611.1|  PREDICTED: probable clathrin assembly protei...    177   1e-46    
ref|XP_009354070.1|  PREDICTED: putative clathrin assembly protei...    177   1e-46    
ref|XP_002270803.1|  PREDICTED: putative clathrin assembly protei...    176   2e-46    
ref|XP_009405274.1|  PREDICTED: putative clathrin assembly protei...    175   4e-46    
ref|XP_008793594.1|  PREDICTED: putative clathrin assembly protei...    173   5e-46    
ref|XP_006381338.1|  clathrin assembly family protein                   175   5e-46    
ref|XP_009382940.1|  PREDICTED: LOW QUALITY PROTEIN: putative cla...    175   5e-46    
ref|XP_012072850.1|  PREDICTED: putative clathrin assembly protei...    175   5e-46    
ref|XP_002983358.1|  hypothetical protein SELMODRAFT_234210             174   7e-46    
gb|EPS68909.1|  hypothetical protein M569_05859                         172   9e-46    
ref|XP_008339314.1|  PREDICTED: putative clathrin assembly protei...    174   1e-45    
ref|XP_003593137.1|  hypothetical protein MTR_2g008170                  174   2e-45    
ref|XP_010911649.1|  PREDICTED: putative clathrin assembly protei...    173   3e-45    
ref|XP_008810593.1|  PREDICTED: putative clathrin assembly protei...    173   3e-45    
ref|XP_006851331.1|  PREDICTED: putative clathrin assembly protei...    173   4e-45    
ref|XP_011087830.1|  PREDICTED: putative clathrin assembly protei...    172   4e-45    
ref|XP_006585453.1|  PREDICTED: putative clathrin assembly protei...    172   4e-45    
emb|CDX76976.1|  BnaC04g37710D                                          172   5e-45    
ref|XP_011018854.1|  PREDICTED: putative clathrin assembly protei...    172   5e-45    
ref|XP_003547072.1|  PREDICTED: putative clathrin assembly protei...    172   5e-45    
gb|KHN33498.1|  Putative clathrin assembly protein                      172   6e-45    
ref|XP_002960679.1|  hypothetical protein SELMODRAFT_437722             172   6e-45    
gb|KJB79714.1|  hypothetical protein B456_013G063600                    172   7e-45    
ref|XP_004136352.1|  PREDICTED: putative clathrin assembly protei...    172   7e-45    
ref|XP_008784532.1|  PREDICTED: putative clathrin assembly protei...    172   8e-45    
ref|XP_009333624.1|  PREDICTED: putative clathrin assembly protei...    171   1e-44    
ref|XP_008391377.1|  PREDICTED: putative clathrin assembly protei...    171   1e-44    
ref|XP_009420267.1|  PREDICTED: putative clathrin assembly protei...    172   1e-44    
ref|XP_009597476.1|  PREDICTED: putative clathrin assembly protei...    171   1e-44    
ref|XP_004485543.1|  PREDICTED: putative clathrin assembly protei...    171   1e-44    
ref|XP_006396479.1|  hypothetical protein EUTSA_v10028524mg             171   1e-44    
ref|XP_006655342.1|  PREDICTED: putative clathrin assembly protei...    168   2e-44    
gb|KJB64693.1|  hypothetical protein B456_010G060800                    166   4e-44    
ref|XP_008455244.1|  PREDICTED: putative clathrin assembly protei...    170   4e-44    
emb|CDY11530.1|  BnaA09g40960D                                          169   5e-44    
ref|XP_010030073.1|  PREDICTED: putative clathrin assembly protei...    169   5e-44    
ref|XP_010911081.1|  PREDICTED: putative clathrin assembly protei...    169   6e-44    
ref|XP_010313086.1|  PREDICTED: putative clathrin assembly protei...    169   9e-44    
ref|XP_006418272.1|  hypothetical protein EUTSA_v10007148mg             169   1e-43    
ref|XP_006849059.1|  PREDICTED: clathrin coat assembly protein AP180    167   1e-43    
gb|KHN28501.1|  Putative clathrin assembly protein                      168   1e-43    
ref|XP_002954748.1|  hypothetical protein VOLCADRAFT_106528             169   1e-43    
ref|XP_003524077.1|  PREDICTED: putative clathrin assembly protei...    168   1e-43    
ref|XP_010696359.1|  PREDICTED: probable clathrin assembly protei...    169   1e-43    
emb|CDY35361.1|  BnaA04g14860D                                          168   1e-43    
ref|XP_008449479.1|  PREDICTED: clathrin coat assembly protein AP180    168   2e-43    
ref|XP_004240592.1|  PREDICTED: putative clathrin assembly protei...    168   2e-43    
ref|NP_001146051.1|  uncharacterized protein LOC100279582               167   3e-43    
ref|XP_009759128.1|  PREDICTED: putative clathrin assembly protei...    167   4e-43    
ref|XP_009416237.1|  PREDICTED: probable clathrin assembly protei...    167   6e-43    
emb|CDY32494.1|  BnaA09g51020D                                          166   6e-43    
ref|XP_006352083.1|  PREDICTED: putative clathrin assembly protei...    166   6e-43    
ref|XP_002889433.1|  hypothetical protein ARALYDRAFT_470282             166   6e-43    
ref|XP_009118718.1|  PREDICTED: putative clathrin assembly protei...    166   6e-43    
ref|XP_006649844.1|  PREDICTED: putative clathrin assembly protei...    166   7e-43    
ref|XP_004984734.1|  PREDICTED: putative clathrin assembly protei...    166   7e-43    
ref|XP_009794065.1|  PREDICTED: putative clathrin assembly protei...    166   7e-43    
ref|XP_004140244.1|  PREDICTED: clathrin coat assembly protein AP180    166   8e-43    
emb|CDY15448.1|  BnaA08g27320D                                          166   8e-43    
ref|XP_009794064.1|  PREDICTED: putative clathrin assembly protei...    166   1e-42    
ref|XP_010522755.1|  PREDICTED: putative clathrin assembly protei...    166   1e-42    
ref|XP_009794063.1|  PREDICTED: probable clathrin assembly protei...    166   1e-42    
ref|XP_009794059.1|  PREDICTED: probable clathrin assembly protei...    166   1e-42    
ref|XP_002465482.1|  hypothetical protein SORBIDRAFT_01g039590          166   1e-42    
ref|NP_001168322.1|  putative ENTH/ANTH/VHS superfamily protein i...    165   2e-42    
ref|XP_010250161.1|  PREDICTED: probable clathrin assembly protei...    165   2e-42    
ref|XP_006483372.1|  PREDICTED: putative clathrin assembly protei...    165   3e-42    
gb|EAY98116.1|  hypothetical protein OsI_20032                          165   3e-42    
ref|XP_009794823.1|  PREDICTED: putative clathrin assembly protei...    164   3e-42    
ref|XP_010481505.1|  PREDICTED: putative clathrin assembly protei...    164   3e-42    
ref|XP_010474909.1|  PREDICTED: putative clathrin assembly protei...    164   3e-42    
gb|EEE63786.1|  hypothetical protein OsJ_18609                          164   3e-42    
emb|CBI21050.3|  unnamed protein product                                164   3e-42    
ref|XP_009621781.1|  PREDICTED: putative clathrin assembly protei...    164   3e-42    
emb|CDY21904.1|  BnaC09g00100D                                          164   3e-42    
ref|XP_006343526.1|  PREDICTED: putative clathrin assembly protei...    164   5e-42    
ref|XP_011081548.1|  PREDICTED: putative clathrin assembly protei...    164   5e-42    
ref|XP_010038590.1|  PREDICTED: clathrin coat assembly protein AP180    164   5e-42    
ref|XP_006307040.1|  hypothetical protein CARUB_v10008628mg             164   5e-42    
gb|KFK42666.1|  hypothetical protein AALP_AA1G024000                    164   5e-42    
ref|XP_006858414.1|  PREDICTED: putative clathrin assembly protei...    164   5e-42    
ref|XP_009111170.1|  PREDICTED: putative clathrin assembly protei...    164   6e-42    
ref|XP_006358291.1|  PREDICTED: putative clathrin assembly protei...    164   6e-42    
ref|XP_002302859.1|  clathrin assembly family protein                   164   6e-42    
gb|AAV25008.1|  putative clathrin assembly protein                      164   6e-42    
ref|XP_002302860.2|  clathrin assembly family protein                   163   7e-42    
ref|XP_009119580.1|  PREDICTED: putative clathrin assembly protei...    163   9e-42    
ref|XP_009119579.1|  PREDICTED: putative clathrin assembly protei...    163   1e-41    
ref|XP_011009685.1|  PREDICTED: clathrin coat assembly protein AP...    163   1e-41    



>ref|XP_009777394.1| PREDICTED: putative clathrin assembly protein At2g01600 [Nicotiana 
sylvestris]
Length=562

 Score =   486 bits (1252),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 239/252 (95%), Positives = 248/252 (98%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPK+RHLRKI+VYTS
Sbjct  1    MGTLQSWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKDRHLRKILVYTS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNF QRGR+L
Sbjct  61   AMRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFHQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRV+KYDIE ERLPK PAQGQEKGYSK
Sbjct  121  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVMKYDIEGERLPK-PAQGQEKGYSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL SEELL+QLPALQQLLYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRELPSEELLEQLPALQQLLYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INL+DKFF+MPR
Sbjct  240  INLIDKFFDMPR  251



>ref|XP_009627948.1| PREDICTED: putative clathrin assembly protein At2g01600 [Nicotiana 
tomentosiformis]
Length=562

 Score =   486 bits (1250),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 239/252 (95%), Positives = 248/252 (98%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPK+RHLRKI+VYTS
Sbjct  1    MGTLQSWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKDRHLRKILVYTS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNF QRGR+L
Sbjct  61   AMRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFHQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRV+KYDIE ERLPK PAQGQEKGYSK
Sbjct  121  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVMKYDIEGERLPK-PAQGQEKGYSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL SEELL+QLPALQQLLYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRELPSEELLEQLPALQQLLYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INL+DKFF+MPR
Sbjct  240  INLIDKFFDMPR  251



>ref|XP_011070604.1| PREDICTED: putative clathrin assembly protein At2g01600 [Sesamum 
indicum]
Length=564

 Score =   484 bits (1247),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 240/252 (95%), Positives = 249/252 (99%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKDHT+VGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKI+V TS
Sbjct  1    MGTLQTWRKAYGALKDHTRVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKILVATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHALARRLAKTHNWTVALKTLIVIHR LREGDPTFREELLNFQQRGRVL
Sbjct  61   AMRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRALREGDPTFREELLNFQQRGRVL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ PAQGQ+KGYS+
Sbjct  121  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PAQGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+SEELLDQLPALQQLLYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRDLDSEELLDQLPALQQLLYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_006355077.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Solanum tuberosum]
Length=563

 Score =   482 bits (1240),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 238/252 (94%), Positives = 246/252 (98%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKDHT VGLAHVNSDFKDVDVAIVKATNHVECPPK+RHLRKI+VYTS
Sbjct  1    MGTLQTWRKAYGALKDHTTVGLAHVNSDFKDVDVAIVKATNHVECPPKDRHLRKILVYTS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRG VL
Sbjct  61   AMRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGHVL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIE ERLPK PAQGQEKGYS+
Sbjct  121  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEGERLPK-PAQGQEKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL SEELL+QLPALQQLLYRLIGCRPEG A+GNYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRELPSEELLEQLPALQQLLYRLIGCRPEGVALGNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INL+DKFF+MPR
Sbjct  240  INLIDKFFDMPR  251



>ref|NP_001265941.1| Hop-interacting protein THI028 [Solanum lycopersicum]
 ref|XP_010319119.1| PREDICTED: hop-interacting protein THI028 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69791.1| Hop-interacting protein THI028 [Solanum lycopersicum]
Length=563

 Score =   481 bits (1238),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 237/252 (94%), Positives = 247/252 (98%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKDHT VGLAHVNSDFKDVDVAIVKATNHVECPPK+RHLRK++V+TS
Sbjct  1    MGTLQTWRKAYGALKDHTTVGLAHVNSDFKDVDVAIVKATNHVECPPKDRHLRKLLVFTS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRG VL
Sbjct  61   AMRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGHVL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIE ERLPK PAQGQEKGYS+
Sbjct  121  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEGERLPK-PAQGQEKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL SEELL+QLPALQQLLYRLIGCRPEGAA+GNYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRELPSEELLEQLPALQQLLYRLIGCRPEGAALGNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INL+DKFF+MPR
Sbjct  240  INLIDKFFDMPR  251



>gb|EYU30088.1| hypothetical protein MIMGU_mgv1a0050552mg, partial [Erythranthe 
guttata]
Length=322

 Score =   465 bits (1197),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 232/252 (92%), Positives = 243/252 (96%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQTWRKAYGALKD TKVGLAHVNSDFKDVDVAIVKATNHVECPPKERH+RKI+V TS
Sbjct  1    MATLQTWRKAYGALKDQTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHIRKILVATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            ++RPRADV YCIHALARRLAKTHNWTVALKTL+VIHRTLREGDPTFREEL+NFQQRGR L
Sbjct  61   SIRPRADVQYCIHALARRLAKTHNWTVALKTLVVIHRTLREGDPTFREELVNFQQRGRFL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLP+ PAQ Q+KGYSK
Sbjct  121  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPR-PAQAQDKGYSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+SEELLD LPALQQLLYRLIGCRPEGAA+GNYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRDLDSEELLDHLPALQQLLYRLIGCRPEGAAMGNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEM R
Sbjct  240  INLVDKFFEMAR  251



>gb|EYU21032.1| hypothetical protein MIMGU_mgv1a020579mg [Erythranthe guttata]
Length=565

 Score =   472 bits (1215),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 232/252 (92%), Positives = 246/252 (98%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WRKAYGALKD TKVGLAHVNSDFKDVDVAIVKATNHVECPPK+RHLRKIMV TS
Sbjct  1    MGTLQSWRKAYGALKDQTKVGLAHVNSDFKDVDVAIVKATNHVECPPKDRHLRKIMVATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPR DVAYC+HALARRLAKTHNWTVALKTLIVIHRT+REGDPTFREELLNFQQRGRVL
Sbjct  61   AMRPRVDVAYCVHALARRLAKTHNWTVALKTLIVIHRTIREGDPTFREELLNFQQRGRVL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            QMSNFKDDSSPIAWDCSAWVRTY +FLEERLECF++LKYDIEAERLP+ PAQG++KGY +
Sbjct  121  QMSNFKDDSSPIAWDCSAWVRTYGVFLEERLECFKILKYDIEAERLPR-PAQGEDKGYGR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+SEELLDQLPALQQLLYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRDLDSEELLDQLPALQQLLYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_007222905.1| hypothetical protein PRUPE_ppa003610mg [Prunus persica]
 gb|EMJ24104.1| hypothetical protein PRUPE_ppa003610mg [Prunus persica]
Length=562

 Score =   470 bits (1210),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 232/252 (92%), Positives = 245/252 (97%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSD+ D+DVAIVKATNHVECPPKERHLRKI++ TS
Sbjct  1    MGTLQTWRKAYGALKDTTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKILIATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHAL+RRL KTHNWTVALKTLIVIHRTLREGDPTFREELLNF QRGR+L
Sbjct  61   AIRPRADVAYCIHALSRRLNKTHNWTVALKTLIVIHRTLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLP+ PAQGQEKGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPR-PAQGQEKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+SEELL+QLPALQQLLYRLIGCRPEGAAV NYVIQYALALVLKESFKIYCA+NDGI
Sbjct  180  TRELDSEELLEQLPALQQLLYRLIGCRPEGAAVVNYVIQYALALVLKESFKIYCAVNDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_007045208.1| ENTH/ANTH/VHS superfamily protein [Theobroma cacao]
 gb|EOY01040.1| ENTH/ANTH/VHS superfamily protein [Theobroma cacao]
Length=565

 Score =   470 bits (1210),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 231/252 (92%), Positives = 244/252 (97%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSD+ D+DVAIVKATNHVECPPKERHLRKI + TS
Sbjct  1    MGTLQTWRKAYGALKDTTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKIFMATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHALARRLAKTHNWTVALKTLIVIHR LREGDPTFREELLNF QR R+L
Sbjct  61   AIRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRALREGDPTFREELLNFSQRARIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ PAQGQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PAQGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+SEELL+QLPALQQLLYRLIGCRPEGAA+GNYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSEELLEQLPALQQLLYRLIGCRPEGAAIGNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_010654389.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X1 [Vitis vinifera]
Length=568

 Score =   470 bits (1209),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 230/252 (91%), Positives = 245/252 (97%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQTWRKAYGALKD TKVGLAHVNSDF D+DVA+VKATNHVECPPKERH+RKI+V TS
Sbjct  1    MATLQTWRKAYGALKDSTKVGLAHVNSDFADLDVAVVKATNHVECPPKERHIRKILVATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHAL+RRLAKTHNWTVALKTLIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   AIRPRADVAYCIHALSRRLAKTHNWTVALKTLIVIHRALREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ PAQGQEKGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PAQGQEKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+SEELL+QLPALQQLL+RLIGCRPEGAA+GNYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSEELLEQLPALQQLLHRLIGCRPEGAAIGNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_002284689.2| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X2 [Vitis vinifera]
 emb|CBI26868.3| unnamed protein product [Vitis vinifera]
Length=567

 Score =   469 bits (1208),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 230/252 (91%), Positives = 245/252 (97%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQTWRKAYGALKD TKVGLAHVNSDF D+DVA+VKATNHVECPPKERH+RKI+V TS
Sbjct  1    MATLQTWRKAYGALKDSTKVGLAHVNSDFADLDVAVVKATNHVECPPKERHIRKILVATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHAL+RRLAKTHNWTVALKTLIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   AIRPRADVAYCIHALSRRLAKTHNWTVALKTLIVIHRALREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ PAQGQEKGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PAQGQEKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+SEELL+QLPALQQLL+RLIGCRPEGAA+GNYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSEELLEQLPALQQLLHRLIGCRPEGAAIGNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_008221433.1| PREDICTED: putative clathrin assembly protein At2g01600 [Prunus 
mume]
Length=562

 Score =   469 bits (1207),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 231/252 (92%), Positives = 244/252 (97%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSD+ D+DVAIVKATNHVECPPKERHLRKI++ TS
Sbjct  1    MGTLQTWRKAYGALKDTTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKILIATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHAL+RRL KTHNWTVALKTLIVIHRTLREGDPTFREELLNF QRGR+L
Sbjct  61   AIRPRADVAYCIHALSRRLNKTHNWTVALKTLIVIHRTLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLP+ PAQGQEKGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPR-PAQGQEKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+SEELL+QLPALQQLLY LIGCRPEGAAV NYVIQYALALVLKESFKIYCA+NDGI
Sbjct  180  TRELDSEELLEQLPALQQLLYHLIGCRPEGAAVANYVIQYALALVLKESFKIYCAVNDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_008389195.1| PREDICTED: putative clathrin assembly protein At2g01600 [Malus 
domestica]
Length=561

 Score =   466 bits (1199),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 229/252 (91%), Positives = 245/252 (97%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSD+ D+DVAIVKATNHVECPPKERHLRKI++ TS
Sbjct  1    MGTLQTWRKAYGALKDSTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKILIATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            ++RPRADVAYCIHAL+RRL+KTHNWTVALKTLIVIHRTLREGDPTFREELLNF QRGR+L
Sbjct  61   SMRPRADVAYCIHALSRRLSKTHNWTVALKTLIVIHRTLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKD+SSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLP+ PAQGQEKGYS+
Sbjct  121  QLSNFKDESSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPR-PAQGQEKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+SEELL+QLPALQQLLYRLIGCRPEGAA  NYVIQYALALVLKESFKIYC+INDGI
Sbjct  180  TRELDSEELLEQLPALQQLLYRLIGCRPEGAASINYVIQYALALVLKESFKIYCSINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_009351512.1| PREDICTED: putative clathrin assembly protein At2g01600 [Pyrus 
x bretschneideri]
Length=563

 Score =   466 bits (1198),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 227/252 (90%), Positives = 245/252 (97%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSD+ D+DVAIVKATNHVECPPKERHLRKI++ TS
Sbjct  1    MGTLQTWRKAYGALKDSTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKILIATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            ++RPRADVAYCIHAL+RRL+KTHNWTVALKTLIVIHRTLREGDPTFREELL+F QRGR+L
Sbjct  61   SIRPRADVAYCIHALSRRLSKTHNWTVALKTLIVIHRTLREGDPTFREELLSFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECF+VL+YDIEAERLP+ PAQGQEKGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFKVLRYDIEAERLPR-PAQGQEKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+SEELL+QLPALQQLLYRLIGCRPEGAA  NYVIQYALALVLKESFKIYC+INDGI
Sbjct  180  TRELDSEELLEQLPALQQLLYRLIGCRPEGAASSNYVIQYALALVLKESFKIYCSINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_002527787.1| clathrin assembly protein, putative [Ricinus communis]
 gb|EEF34597.1| clathrin assembly protein, putative [Ricinus communis]
Length=567

 Score =   466 bits (1198),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 228/252 (90%), Positives = 244/252 (97%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSDF ++DVAIVKATNHVECPPKERHLRKI+V TS
Sbjct  1    MGTLQTWRKAYGALKDSTKVGLAHVNSDFAELDVAIVKATNHVECPPKERHLRKILVATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADV YCIHAL+RRLAKTHNWTVALKTLIVIHR LREGDPTF+EEL+NF QRGR+L
Sbjct  61   AIRPRADVQYCIHALSRRLAKTHNWTVALKTLIVIHRLLREGDPTFKEELVNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ P QGQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PVQGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+SEELL+QLPALQQLLYRL+GCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSEELLEQLPALQQLLYRLVGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>gb|KJB60905.1| hypothetical protein B456_009G330700 [Gossypium raimondii]
 gb|KJB60909.1| hypothetical protein B456_009G330700 [Gossypium raimondii]
Length=562

 Score =   464 bits (1195),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 226/252 (90%), Positives = 244/252 (97%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSD+ D+DVAIVKATNHVECPPKERHLRKI++ TS
Sbjct  1    MGTLQTWRKAYGALKDSTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKILLATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHAL+RRLAKTHNWTVALKTLIVIHR LREGDPTFREE+LNF QR R+L
Sbjct  61   AIRPRADVAYCIHALSRRLAKTHNWTVALKTLIVIHRALREGDPTFREEILNFSQRARIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ P+QGQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PSQGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L SEELL+QLPALQQLL+RLIGCRPEGAA+GNYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRDLGSEELLEQLPALQQLLHRLIGCRPEGAAIGNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_002311513.1| clathrin assembly family protein [Populus trichocarpa]
 gb|EEE88880.1| clathrin assembly family protein [Populus trichocarpa]
Length=562

 Score =   464 bits (1194),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 227/252 (90%), Positives = 244/252 (97%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSD+ ++DVAIVKATNHVECPPKERHLRKI+  TS
Sbjct  1    MGTLQTWRKAYGALKDSTKVGLAHVNSDYAELDVAIVKATNHVECPPKERHLRKILAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHAL+RRLAKTHNWTVALK LIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   AIRPRADVAYCIHALSRRLAKTHNWTVALKILIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ PAQGQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PAQGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+SE+LL+QLPALQQLLYRL+GCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRDLDSEDLLEQLPALQQLLYRLVGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>emb|CDP00810.1| unnamed protein product [Coffea canephora]
Length=558

 Score =   464 bits (1193),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 233/252 (92%), Positives = 244/252 (97%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSDFKD+DVAIVKATNHVECPPKERHLRKI++ TS
Sbjct  1    MGTLQTWRKAYGALKDQTKVGLAHVNSDFKDLDVAIVKATNHVECPPKERHLRKILLATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHR LREGDPTFREELLNFQQRGRVL
Sbjct  61   AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRALREGDPTFREELLNFQQRGRVL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            QMSNFKDDSSPIAWDCS WVRTYALFLEERLECF++L+YDIEAERLP+ PAQGQEKGYS+
Sbjct  121  QMSNFKDDSSPIAWDCSGWVRTYALFLEERLECFKILRYDIEAERLPR-PAQGQEKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL SEELL+ LP+LQQLLYRLIGCRPEGAAV NYVIQYALALVLKESFKIYCA+NDGI
Sbjct  180  TRELESEELLEHLPSLQQLLYRLIGCRPEGAAVHNYVIQYALALVLKESFKIYCAVNDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_004142277.1| PREDICTED: putative clathrin assembly protein At2g01600 [Cucumis 
sativus]
 gb|KGN49630.1| hypothetical protein Csa_5G033480 [Cucumis sativus]
Length=566

 Score =   462 bits (1190),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 226/252 (90%), Positives = 242/252 (96%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQTWRKAYGALKD TKVGLAHVNSD+ D+DVAIVKATNHVECPPKERHLRKI++ TS
Sbjct  1    MATLQTWRKAYGALKDSTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKILIATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHALARRL+KT NWTVALK LIVIHRTLREGDPTFREELLNF QR R+L
Sbjct  61   AIRPRADVAYCIHALARRLSKTRNWTVALKALIVIHRTLREGDPTFREELLNFTQRARIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIE+ERLP+ PAQGQEKGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIESERLPR-PAQGQEKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+SEELL+ LPALQQLLYRLIGC+PEGAA+GNYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSEELLEHLPALQQLLYRLIGCKPEGAAIGNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_011463190.1| PREDICTED: putative clathrin assembly protein At2g01600 [Fragaria 
vesca subsp. vesca]
Length=557

 Score =   462 bits (1189),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 227/252 (90%), Positives = 243/252 (96%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WRKAYGA+KD TKVGLAHVNSD+ D+DVAIVKATNHVECPPKERHLRKI+  TS
Sbjct  1    MGTLQSWRKAYGAIKDTTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKILFATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCI+AL+RRL+KTHNWTVALKTLIVIHRTLREGDPTFREEL+NF QRGR+L
Sbjct  61   AIRPRADVAYCINALSRRLSKTHNWTVALKTLIVIHRTLREGDPTFREELVNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLP+ PAQ QEKGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPR-PAQAQEKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+SEELLD LPALQQLLYRLIGCRPEGAAV NYVIQYALALVLKESFKIYCA+NDGI
Sbjct  180  TRELDSEELLDHLPALQQLLYRLIGCRPEGAAVMNYVIQYALALVLKESFKIYCAVNDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>gb|KHN12469.1| Putative clathrin assembly protein [Glycine soja]
Length=568

 Score =   462 bits (1190),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 228/252 (90%), Positives = 242/252 (96%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WR+AYGA+KD TKVGLAHVNSD+ D+DVAIVKATNHVECPPKERHLRKI+  TS
Sbjct  1    MGTLQSWRRAYGAIKDTTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKILFATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            AVRPRADVAYCIHAL+RRL KT NWTVALKTLIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   AVRPRADVAYCIHALSRRLTKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLPK PAQGQEKGYSK
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPK-PAQGQEKGYSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+SEELL+QLPALQQLLYRL+GCRPEGAAV NYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRDLDSEELLEQLPALQQLLYRLVGCRPEGAAVSNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_010101968.1| Putative clathrin assembly protein [Morus notabilis]
 gb|EXB90892.1| Putative clathrin assembly protein [Morus notabilis]
Length=584

 Score =   462 bits (1190),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 227/252 (90%), Positives = 243/252 (96%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSD+ D+DVAIVKATNHVECPPKERHLRKI++ TS
Sbjct  1    MGTLQTWRKAYGALKDSTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKILIATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            AVRPRADVAYCI AL+RRLAKTHNWTVALKTLIVIHRTLREGDPTFREE LN+ Q+G +L
Sbjct  61   AVRPRADVAYCIRALSRRLAKTHNWTVALKTLIVIHRTLREGDPTFREEFLNYSQKGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ PAQGQEKGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PAQGQEKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+SEELL+QLPALQQLLYRLI CRPEGAAVGNYVIQYALALVLKESFKIYC++NDGI
Sbjct  180  TRELDSEELLEQLPALQQLLYRLISCRPEGAAVGNYVIQYALALVLKESFKIYCSVNDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>gb|KJB30771.1| hypothetical protein B456_005G159800 [Gossypium raimondii]
Length=539

 Score =   460 bits (1184),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 225/252 (89%), Positives = 239/252 (95%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQTWRKAYGALKD TKVGLAHVNSD+ D+DVA+VKATNHVECPPKERHLRKI + TS
Sbjct  1    MATLQTWRKAYGALKDTTKVGLAHVNSDYADLDVAVVKATNHVECPPKERHLRKIFIATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHAL RRL KTHNWTVALKTLIVIHR LREGDPTFREELLNF QR R+L
Sbjct  61   AIRPRADVAYCIHALGRRLTKTHNWTVALKTLIVIHRALREGDPTFREELLNFSQRARIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ P QGQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PDQGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+SEELL QLPALQQLL+RLIGCRPEGAA+GNYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSEELLTQLPALQQLLHRLIGCRPEGAAIGNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>gb|KJB30768.1| hypothetical protein B456_005G159800 [Gossypium raimondii]
Length=566

 Score =   461 bits (1186),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 225/252 (89%), Positives = 239/252 (95%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQTWRKAYGALKD TKVGLAHVNSD+ D+DVA+VKATNHVECPPKERHLRKI + TS
Sbjct  1    MATLQTWRKAYGALKDTTKVGLAHVNSDYADLDVAVVKATNHVECPPKERHLRKIFIATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHAL RRL KTHNWTVALKTLIVIHR LREGDPTFREELLNF QR R+L
Sbjct  61   AIRPRADVAYCIHALGRRLTKTHNWTVALKTLIVIHRALREGDPTFREELLNFSQRARIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ P QGQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PDQGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+SEELL QLPALQQLL+RLIGCRPEGAA+GNYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSEELLTQLPALQQLLHRLIGCRPEGAAIGNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_003531146.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
isoform 1 [Glycine max]
Length=568

 Score =   461 bits (1185),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 227/252 (90%), Positives = 241/252 (96%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WR+AYGA+KD TKVGLAHVNSD+ D+DVAIVKATNHVECPPKERHLRKI+  TS
Sbjct  1    MGTLQSWRRAYGAIKDTTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKILFATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            AVRPRADVAYCIHAL+RRL KT NWTVALKTLIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   AVRPRADVAYCIHALSRRLTKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLPK P QGQEKGYSK
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPK-PVQGQEKGYSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+SEELL+QLPALQQLLYRL+GCRPEGAAV NYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRDLDSEELLEQLPALQQLLYRLVGCRPEGAAVSNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_011023792.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X2 [Populus euphratica]
Length=562

 Score =   460 bits (1184),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 226/252 (90%), Positives = 243/252 (96%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSD+ ++DVAIVKATNHVECPPKERHLRKI+  TS
Sbjct  1    MGTLQTWRKAYGALKDSTKVGLAHVNSDYAELDVAIVKATNHVECPPKERHLRKILAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAY IHAL+RRLAKTHNWTVALK LIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   AIRPRADVAYFIHALSRRLAKTHNWTVALKILIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ PAQGQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PAQGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+SE+LL+QLPALQQLLYRL+GCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRDLDSEDLLEQLPALQQLLYRLVGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_004504573.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Cicer arietinum]
Length=564

 Score =   460 bits (1184),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 226/252 (90%), Positives = 241/252 (96%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WR+AYGA+KD TKVGLAHVNSD+ D+DVAIVKATNHVECPPKERHLRKI+  TS
Sbjct  1    MGTLQSWRRAYGAIKDTTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKILFATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            AVRPRADVAYCIHAL+RRLAKT NWTVALKTLIVIHR LREGDPT REE+LNF QRGR+L
Sbjct  61   AVRPRADVAYCIHALSRRLAKTRNWTVALKTLIVIHRLLREGDPTLREEILNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLPK PAQGQEKGYSK
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPK-PAQGQEKGYSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+SEELL+ LPALQQLLYRL+GCRPEGAAV NYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRDLDSEELLEHLPALQQLLYRLVGCRPEGAAVSNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_007158803.1| hypothetical protein PHAVU_002G183100g [Phaseolus vulgaris]
 gb|ESW30797.1| hypothetical protein PHAVU_002G183100g [Phaseolus vulgaris]
Length=563

 Score =   459 bits (1181),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 226/252 (90%), Positives = 243/252 (96%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WR+AYGA+KD TKVGLAHVNSD+ D+DVAIVKA+NHVECPPKERHLRKI+  TS
Sbjct  1    MGTLQSWRRAYGAIKDTTKVGLAHVNSDYADLDVAIVKASNHVECPPKERHLRKILFATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            AVRPRADVAYCIHAL+RRLAKT NWTVALKTLIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   AVRPRADVAYCIHALSRRLAKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLPK PAQGQEKGYSK
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPK-PAQGQEKGYSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+S+ELL+QLPALQQLL+RL+GCRPEGAAV NYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRDLDSDELLEQLPALQQLLHRLVGCRPEGAAVSNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_003524854.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
isoform 1 [Glycine max]
 gb|KHN46088.1| Putative clathrin assembly protein [Glycine soja]
Length=569

 Score =   459 bits (1181),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 227/252 (90%), Positives = 242/252 (96%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WR+AYGA+KD TKVGLAHVNSD+ D+DVAIVKATNHVECPPKERHLRKI+  TS
Sbjct  1    MGTLQSWRRAYGAIKDTTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKILFATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            AVRPRADVAYCIHAL+RRLAKT NWTVALKTLIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   AVRPRADVAYCIHALSRRLAKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLPK PA+GQEKG SK
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPK-PAEGQEKGCSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+SEELL+QLPALQQLLYRL+GCRPEGAAV NYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRDLDSEELLEQLPALQQLLYRLVGCRPEGAAVSNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>gb|KJB30770.1| hypothetical protein B456_005G159800 [Gossypium raimondii]
Length=592

 Score =   459 bits (1180),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 225/252 (89%), Positives = 239/252 (95%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQTWRKAYGALKD TKVGLAHVNSD+ D+DVA+VKATNHVECPPKERHLRKI + TS
Sbjct  1    MATLQTWRKAYGALKDTTKVGLAHVNSDYADLDVAVVKATNHVECPPKERHLRKIFIATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHAL RRL KTHNWTVALKTLIVIHR LREGDPTFREELLNF QR R+L
Sbjct  61   AIRPRADVAYCIHALGRRLTKTHNWTVALKTLIVIHRALREGDPTFREELLNFSQRARIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ P QGQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PDQGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+SEELL QLPALQQLL+RLIGCRPEGAA+GNYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSEELLTQLPALQQLLHRLIGCRPEGAAIGNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_010274743.1| PREDICTED: putative clathrin assembly protein At2g01600 [Nelumbo 
nucifera]
Length=564

 Score =   457 bits (1177),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 226/252 (90%), Positives = 241/252 (96%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQTWRKAYGA+KD TKVGLA VNS+FKDVDVAIVKATNHVE PPKERHLRKI+  TS
Sbjct  1    MATLQTWRKAYGAIKDSTKVGLAKVNSEFKDVDVAIVKATNHVESPPKERHLRKILAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             +RPRADVAYCI ALA RLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNF QRGR+L
Sbjct  61   VMRPRADVAYCIRALASRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYD+EAERLP+ PAQGQEKGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDVEAERLPR-PAQGQEKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+SEELL+QLPALQQLL+RLIGCRPEGAA+GNYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRDLDSEELLEQLPALQQLLHRLIGCRPEGAAIGNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_010681909.1| PREDICTED: putative clathrin assembly protein At2g01600 [Beta 
vulgaris subsp. vulgaris]
Length=567

 Score =   457 bits (1177),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 226/252 (90%), Positives = 242/252 (96%), Gaps = 2/252 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TL TWRKAYGA+KDHTKVGLA +NSD+KD+DVAIVKATNHVECPPKERHLRKI++ TS
Sbjct  1    MATL-TWRKAYGAIKDHTKVGLAQINSDYKDLDVAIVKATNHVECPPKERHLRKILLATS  59

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            AVRPRADVAYC+HALARRL KT NWTVALKTLIV+HR LREGDPTFREELLNF QRGRVL
Sbjct  60   AVRPRADVAYCLHALARRLEKTRNWTVALKTLIVVHRLLREGDPTFREELLNFSQRGRVL  119

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERL+C+RVLKYDIEAERLPK PAQGQEKGYS+
Sbjct  120  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLQCYRVLKYDIEAERLPK-PAQGQEKGYSR  178

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+SEELL+QLPALQQ LYRLIGCRPEGAA+GNYVIQYALALVLKESFKIYCAINDGI
Sbjct  179  TRDLDSEELLEQLPALQQFLYRLIGCRPEGAALGNYVIQYALALVLKESFKIYCAINDGI  238

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  239  INLVDKFFEMPR  250



>ref|XP_008464707.1| PREDICTED: putative clathrin assembly protein At2g01600 [Cucumis 
melo]
Length=657

 Score =   460 bits (1184),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 226/257 (88%), Positives = 244/257 (95%), Gaps = 1/257 (0%)
 Frame = +1

Query  205  GVEREMGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKI  384
             V + M TLQTWRKAYGALKD TKVGLAHVNSD+ D+DVAIVKATNHVECPPKERHLRKI
Sbjct  88   SVFQPMATLQTWRKAYGALKDSTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKI  147

Query  385  MVYTSAVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQ  564
            ++ TSA+RPRADVAYCIHALARRL+KT NWTVALK LIVIHRTLREGDPTFREELLNF Q
Sbjct  148  LIATSAIRPRADVAYCIHALARRLSKTRNWTVALKALIVIHRTLREGDPTFREELLNFTQ  207

Query  565  RGRVLQMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQE  744
            R R+LQ+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIE+ERLP+ PAQGQE
Sbjct  208  RSRILQLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIESERLPR-PAQGQE  266

Query  745  KGYSKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCA  924
            KGYS+TREL+SEELL+ LPALQQLLYRLIGC+PEGAA+GNYVIQYALALVLKESFKIYCA
Sbjct  267  KGYSRTRELDSEELLEHLPALQQLLYRLIGCKPEGAAIGNYVIQYALALVLKESFKIYCA  326

Query  925  INDGIINLVDKFFEMPR  975
            INDGIINLV+KFFEMPR
Sbjct  327  INDGIINLVEKFFEMPR  343



>ref|XP_011038608.1| PREDICTED: putative clathrin assembly protein At2g01600 [Populus 
euphratica]
Length=558

 Score =   457 bits (1175),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 221/252 (88%), Positives = 242/252 (96%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSD+ D+DVA+VKATNHVECPPKERHLRKI+V TS
Sbjct  1    MGTLQTWRKAYGALKDSTKVGLAHVNSDYADLDVAVVKATNHVECPPKERHLRKILVATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             +RPRADVAYCIHAL+RRLAKTH+WTVALK LIVIHR LREGDPTFREELLNF QRG +L
Sbjct  61   TIRPRADVAYCIHALSRRLAKTHSWTVALKILIVIHRLLREGDPTFREELLNFSQRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECF++LKYDIEAERLP+ P QGQ+KG+S+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFKILKYDIEAERLPR-PGQGQDKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+SEELL+QLPALQQLLYRL+GCRPEGAAVGNYVIQYALALVLKESFKIYC++NDGI
Sbjct  180  TRDLDSEELLEQLPALQQLLYRLVGCRPEGAAVGNYVIQYALALVLKESFKIYCSVNDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_011023782.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X1 [Populus euphratica]
Length=563

 Score =   456 bits (1172),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 226/253 (89%), Positives = 243/253 (96%), Gaps = 2/253 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSD+ ++DVAIVKATNHVECPPKERHLRKI+  TS
Sbjct  1    MGTLQTWRKAYGALKDSTKVGLAHVNSDYAELDVAIVKATNHVECPPKERHLRKILAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAY IHAL+RRLAKTHNWTVALK LIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   AIRPRADVAYFIHALSRRLAKTHNWTVALKILIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEK-GYS  756
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ PAQGQ+K GYS
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PAQGQDKQGYS  179

Query  757  KTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDG  936
            +TR+L+SE+LL+QLPALQQLLYRL+GCRPEGAAVGNYVIQYALALVLKESFKIYCAINDG
Sbjct  180  RTRDLDSEDLLEQLPALQQLLYRLVGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDG  239

Query  937  IINLVDKFFEMPR  975
            IINLVDKFFEMPR
Sbjct  240  IINLVDKFFEMPR  252



>ref|XP_012072261.1| PREDICTED: putative clathrin assembly protein At2g01600 [Jatropha 
curcas]
 gb|KDP38084.1| hypothetical protein JCGZ_04727 [Jatropha curcas]
Length=564

 Score =   456 bits (1172),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 228/252 (90%), Positives = 243/252 (96%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSD+ ++DVAIVKATNHVECPPKERHLRKI+V TS
Sbjct  1    MGTLQTWRKAYGALKDSTKVGLAHVNSDYAELDVAIVKATNHVECPPKERHLRKILVATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHAL+RRLAKTHNWTVALKTLIVIHR LREGDPTFREELLNF QRG +L
Sbjct  61   AIRPRADVAYCIHALSRRLAKTHNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ P QGQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PVQGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L SEELL+QLPALQQLLYRL+GCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRDLESEELLEQLPALQQLLYRLVGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_010265534.1| PREDICTED: putative clathrin assembly protein At2g01600 [Nelumbo 
nucifera]
Length=559

 Score =   453 bits (1165),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 222/252 (88%), Positives = 242/252 (96%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQTWRKAYGA+KD TKVGLA VNS++KDVDVAIVKATNHVECPPKERHLRKI+  TS
Sbjct  1    MATLQTWRKAYGAIKDSTKVGLAKVNSEYKDVDVAIVKATNHVECPPKERHLRKILAVTS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             +RPRADVAYCI ALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLN+ QRG +L
Sbjct  61   VMRPRADVAYCIRALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNYSQRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ PAQG++KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PAQGEDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+SEELL+QLPALQQLL+RL+GCRPEGAAVGNYVIQYALALVLKESFK+YCA+NDGI
Sbjct  180  TRDLHSEELLEQLPALQQLLHRLVGCRPEGAAVGNYVIQYALALVLKESFKVYCAVNDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_010044208.1| PREDICTED: putative clathrin assembly protein At2g01600 [Eucalyptus 
grandis]
 gb|KCW86254.1| hypothetical protein EUGRSUZ_B02940 [Eucalyptus grandis]
Length=568

 Score =   453 bits (1166),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 223/252 (88%), Positives = 239/252 (95%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTL+TWRKAYGALKD TKVGLAHVNSD+ ++DVAIVKATNHVECPPKERHLRKI   TS
Sbjct  1    MGTLKTWRKAYGALKDSTKVGLAHVNSDYAELDVAIVKATNHVECPPKERHLRKIAFATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            AVRPRADVAYCI AL+RRL KTHNWTVALKTLIVIHR LREGDPTFREELL F QRGR+L
Sbjct  61   AVRPRADVAYCIQALSRRLTKTHNWTVALKTLIVIHRLLREGDPTFREELLAFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALF+EERLECFR++KYDIEAERLPK PAQGQEKGY K
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFIEERLECFRIIKYDIEAERLPK-PAQGQEKGYGK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+S+ELL+QLPALQ LL+RLIGC+PEGAAVGNY+IQYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSQELLEQLPALQNLLHRLIGCQPEGAAVGNYLIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>gb|KCW86255.1| hypothetical protein EUGRSUZ_B02940 [Eucalyptus grandis]
Length=515

 Score =   451 bits (1160),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 223/252 (88%), Positives = 239/252 (95%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTL+TWRKAYGALKD TKVGLAHVNSD+ ++DVAIVKATNHVECPPKERHLRKI   TS
Sbjct  1    MGTLKTWRKAYGALKDSTKVGLAHVNSDYAELDVAIVKATNHVECPPKERHLRKIAFATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            AVRPRADVAYCI AL+RRL KTHNWTVALKTLIVIHR LREGDPTFREELL F QRGR+L
Sbjct  61   AVRPRADVAYCIQALSRRLTKTHNWTVALKTLIVIHRLLREGDPTFREELLAFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALF+EERLECFR++KYDIEAERLPK PAQGQEKGY K
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFIEERLECFRIIKYDIEAERLPK-PAQGQEKGYGK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+S+ELL+QLPALQ LL+RLIGC+PEGAAVGNY+IQYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSQELLEQLPALQNLLHRLIGCQPEGAAVGNYLIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>gb|KCW86253.1| hypothetical protein EUGRSUZ_B02940 [Eucalyptus grandis]
Length=574

 Score =   452 bits (1164),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 223/252 (88%), Positives = 239/252 (95%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTL+TWRKAYGALKD TKVGLAHVNSD+ ++DVAIVKATNHVECPPKERHLRKI   TS
Sbjct  1    MGTLKTWRKAYGALKDSTKVGLAHVNSDYAELDVAIVKATNHVECPPKERHLRKIAFATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            AVRPRADVAYCI AL+RRL KTHNWTVALKTLIVIHR LREGDPTFREELL F QRGR+L
Sbjct  61   AVRPRADVAYCIQALSRRLTKTHNWTVALKTLIVIHRLLREGDPTFREELLAFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALF+EERLECFR++KYDIEAERLPK PAQGQEKGY K
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFIEERLECFRIIKYDIEAERLPK-PAQGQEKGYGK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+S+ELL+QLPALQ LL+RLIGC+PEGAAVGNY+IQYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSQELLEQLPALQNLLHRLIGCQPEGAAVGNYLIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_008803559.1| PREDICTED: putative clathrin assembly protein At2g01600 [Phoenix 
dactylifera]
Length=557

 Score =   449 bits (1156),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 223/252 (88%), Positives = 238/252 (94%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQ+WRKAYGALKD T VGLA++NSDFKD+DVAIVK+TNHVECPPKERHLRKI+  TS
Sbjct  1    MATLQSWRKAYGALKDTTTVGLANLNSDFKDLDVAIVKSTNHVECPPKERHLRKILAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALARRLAKTHNWTVALKTLIVIHR LREGDP+FREELLNF QRGR+L
Sbjct  61   MARPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRLLREGDPSFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYD+EAERL K PAQG EKG+SK
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDVEAERLTK-PAQGPEKGHSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+SE+LL+QLPALQQLLYRLIGC PEGAAV NYV+QYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSEDLLEQLPALQQLLYRLIGCHPEGAAVSNYVVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_010924074.1| PREDICTED: putative clathrin assembly protein At2g01600 [Elaeis 
guineensis]
Length=562

 Score =   448 bits (1152),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 223/252 (88%), Positives = 237/252 (94%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQ+ RKAYGALKD T VGLA++NSDFKD+DVAIVKATNHVECPPKERHLRKI+  TS
Sbjct  1    MATLQSLRKAYGALKDSTTVGLANLNSDFKDLDVAIVKATNHVECPPKERHLRKILAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHAL+RRLAKTHNWTVALKTLIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   IARPRADVAYCIHALSRRLAKTHNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYD+EAERL KPP QG EKG+SK
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDVEAERLTKPP-QGSEKGHSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+SE+LL+QLPALQQLLYRLIGC PEGAAV NYV+QYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSEDLLEQLPALQQLLYRLIGCHPEGAAVSNYVVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_006448214.1| hypothetical protein CICLE_v10014774mg [Citrus clementina]
 gb|ESR61454.1| hypothetical protein CICLE_v10014774mg [Citrus clementina]
Length=561

 Score =   447 bits (1150),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 224/252 (89%), Positives = 242/252 (96%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSD+ D+DVAIVKATNHVECPPKERHLRKI++ TS
Sbjct  1    MGTLQTWRKAYGALKDTTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKILIATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            ++RPRADVAYCIHAL RRLAKT NWTVALKTLIVIHRTLREGDPTFREELLNFQ RGR+L
Sbjct  61   SIRPRADVAYCIHALGRRLAKTRNWTVALKTLIVIHRTLREGDPTFREELLNFQLRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ P QG++KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PVQGEDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L SEELL+QLPALQQLL+RL+GC+PEGAAV NYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRDLESEELLEQLPALQQLLHRLVGCQPEGAAVHNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_006469211.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Citrus sinensis]
Length=561

 Score =   447 bits (1150),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 224/252 (89%), Positives = 242/252 (96%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSD+ D+DVAIVKATNHVECPPKERHLRKI++ TS
Sbjct  1    MGTLQTWRKAYGALKDTTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKILIATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            ++RPRADVAYCIHAL RRLAKT NWTVALKTLIVIHRTLREGDPTFREELLNFQ RGR+L
Sbjct  61   SIRPRADVAYCIHALGRRLAKTRNWTVALKTLIVIHRTLREGDPTFREELLNFQLRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ P QG++KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PVQGEDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L SEELL+QLPALQQLL+RL+GC+PEGAAV NYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRDLESEELLEQLPALQQLLHRLVGCQPEGAAVHNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>gb|KDO64585.1| hypothetical protein CISIN_1g008579mg [Citrus sinensis]
Length=561

 Score =   447 bits (1149),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 224/252 (89%), Positives = 242/252 (96%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSD+ D+DVAIVKATNHVECPPKERHLRKI++ TS
Sbjct  1    MGTLQTWRKAYGALKDTTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKILIATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            ++RPRADVAYCIHAL RRLAKT NWTVALKTLIVIHRTLREGDPTFREELLNFQ RGR+L
Sbjct  61   SIRPRADVAYCIHALGRRLAKTRNWTVALKTLIVIHRTLREGDPTFREELLNFQLRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ P QG++KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PVQGEDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L SEELL+QLPALQQLL+RL+GC+PEGAAV NYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRDLESEELLEQLPALQQLLHRLVGCQPEGAAVHNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_008799224.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X2 [Phoenix dactylifera]
Length=555

 Score =   446 bits (1146),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 221/252 (88%), Positives = 238/252 (94%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MG+LQ+WRKAYGALKD T VGLA++NSDFKD+DVAIVKATNHVECPPKERHLRKI+  TS
Sbjct  1    MGSLQSWRKAYGALKDTTTVGLANLNSDFKDLDVAIVKATNHVECPPKERHLRKIVAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALARRLAKTHNWTVALK+LIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   IARPRADVAYCIHALARRLAKTHNWTVALKSLIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWV +YALFLEERLECFR+LKYD+EAERL K PAQG EKG+SK
Sbjct  121  QLSNFKDDSSPIAWDCSAWVCSYALFLEERLECFRILKYDVEAERLIK-PAQGSEKGHSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL++EELL+QLPALQQLLYRLIGC PEGAAV NYV+QYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDTEELLEQLPALQQLLYRLIGCHPEGAAVSNYVVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_011621339.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X2 [Amborella trichopoda]
Length=562

 Score =   446 bits (1147),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 219/252 (87%), Positives = 237/252 (94%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MG+LQTWRKAYGALKD TKVGLA VNSDFKDVDVAIVKATNHVECPPKERH+RKI+  TS
Sbjct  1    MGSLQTWRKAYGALKDTTKVGLAKVNSDFKDVDVAIVKATNHVECPPKERHVRKILAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             +RPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNF  R  +L
Sbjct  61   VIRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFSHRAHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDS PIAWDCSAWVRTYALFLEERLECFRVLKYD+EAER  K PA+G EKG+S+
Sbjct  121  QLSNFKDDSGPIAWDCSAWVRTYALFLEERLECFRVLKYDVEAERFTK-PAEGHEKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+SEELL+Q+PALQQLLYRL+GC+PEG AVGNYVIQ+ALALVLKESFK+YCAINDGI
Sbjct  180  TRDLDSEELLEQMPALQQLLYRLVGCQPEGGAVGNYVIQHALALVLKESFKVYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_006838117.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X1 [Amborella trichopoda]
 gb|ERN00686.1| hypothetical protein AMTR_s00106p00058730 [Amborella trichopoda]
Length=563

 Score =   446 bits (1146),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 219/252 (87%), Positives = 237/252 (94%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MG+LQTWRKAYGALKD TKVGLA VNSDFKDVDVAIVKATNHVECPPKERH+RKI+  TS
Sbjct  1    MGSLQTWRKAYGALKDTTKVGLAKVNSDFKDVDVAIVKATNHVECPPKERHVRKILAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             +RPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNF  R  +L
Sbjct  61   VIRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFSHRAHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDS PIAWDCSAWVRTYALFLEERLECFRVLKYD+EAER  K PA+G EKG+S+
Sbjct  121  QLSNFKDDSGPIAWDCSAWVRTYALFLEERLECFRVLKYDVEAERFTK-PAEGHEKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+SEELL+Q+PALQQLLYRL+GC+PEG AVGNYVIQ+ALALVLKESFK+YCAINDGI
Sbjct  180  TRDLDSEELLEQMPALQQLLYRLVGCQPEGGAVGNYVIQHALALVLKESFKVYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_008799223.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X1 [Phoenix dactylifera]
Length=558

 Score =   446 bits (1146),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 221/252 (88%), Positives = 238/252 (94%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MG+LQ+WRKAYGALKD T VGLA++NSDFKD+DVAIVKATNHVECPPKERHLRKI+  TS
Sbjct  1    MGSLQSWRKAYGALKDTTTVGLANLNSDFKDLDVAIVKATNHVECPPKERHLRKIVAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALARRLAKTHNWTVALK+LIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   IARPRADVAYCIHALARRLAKTHNWTVALKSLIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWV +YALFLEERLECFR+LKYD+EAERL K PAQG EKG+SK
Sbjct  121  QLSNFKDDSSPIAWDCSAWVCSYALFLEERLECFRILKYDVEAERLIK-PAQGSEKGHSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL++EELL+QLPALQQLLYRLIGC PEGAAV NYV+QYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDTEELLEQLPALQQLLYRLIGCHPEGAAVSNYVVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_002315872.2| hypothetical protein POPTR_0010s12020g [Populus trichocarpa]
 gb|EEF02043.2| hypothetical protein POPTR_0010s12020g [Populus trichocarpa]
Length=549

 Score =   445 bits (1145),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 217/252 (86%), Positives = 239/252 (95%), Gaps = 4/252 (2%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSD+ D+DVA+VKATNHVECPPKERHLRKI+V TS
Sbjct  1    MGTLQTWRKAYGALKDSTKVGLAHVNSDYADLDVAVVKATNHVECPPKERHLRKILVATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             +RPRADVAYCIHAL+RRLAKTH+WTVALK LIVIHR LREGDPTFREELLNF QRG +L
Sbjct  61   TIRPRADVAYCIHALSRRLAKTHSWTVALKILIVIHRLLREGDPTFREELLNFSQRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECF++LKYDIEAERLP+ P QGQ+KG+S+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFKILKYDIEAERLPR-PGQGQDKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+SEELL+QLPALQQLLYRL+GCRPEGAAVGNY+IQYALALVLKESFKIYC++NDGI
Sbjct  180  TRDLDSEELLEQLPALQQLLYRLVGCRPEGAAVGNYIIQYALALVLKESFKIYCSVNDGI  239

Query  940  INLVDKFFEMPR  975
            INL   FFEMPR
Sbjct  240  INL---FFEMPR  248



>ref|XP_002315925.2| hypothetical protein POPTR_0010s12020g [Populus trichocarpa]
 gb|EEF02096.2| hypothetical protein POPTR_0010s12020g [Populus trichocarpa]
Length=555

 Score =   445 bits (1145),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 217/252 (86%), Positives = 239/252 (95%), Gaps = 4/252 (2%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSD+ D+DVA+VKATNHVECPPKERHLRKI+V TS
Sbjct  1    MGTLQTWRKAYGALKDSTKVGLAHVNSDYADLDVAVVKATNHVECPPKERHLRKILVATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             +RPRADVAYCIHAL+RRLAKTH+WTVALK LIVIHR LREGDPTFREELLNF QRG +L
Sbjct  61   TIRPRADVAYCIHALSRRLAKTHSWTVALKILIVIHRLLREGDPTFREELLNFSQRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECF++LKYDIEAERLP+ P QGQ+KG+S+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFKILKYDIEAERLPR-PGQGQDKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+SEELL+QLPALQQLLYRL+GCRPEGAAVGNY+IQYALALVLKESFKIYC++NDGI
Sbjct  180  TRDLDSEELLEQLPALQQLLYRLVGCRPEGAAVGNYIIQYALALVLKESFKIYCSVNDGI  239

Query  940  INLVDKFFEMPR  975
            INL   FFEMPR
Sbjct  240  INL---FFEMPR  248



>gb|KHG06013.1| hypothetical protein F383_02907 [Gossypium arboreum]
 gb|KHG17498.1| hypothetical protein F383_05122 [Gossypium arboreum]
Length=561

 Score =   445 bits (1144),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 222/252 (88%), Positives = 234/252 (93%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSDF D+DVAIVKATNHVECPPKERHLRKI V TS
Sbjct  1    MGTLQTWRKAYGALKDTTKVGLAHVNSDFADLDVAIVKATNHVECPPKERHLRKIFVATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             +RPRADVAYCIHAL+RRLAKT NWTVALKTLIVIHR LREGDPTFREELLNF QR  +L
Sbjct  61   MIRPRADVAYCIHALSRRLAKTRNWTVALKTLIVIHRALREGDPTFREELLNFSQRAGIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLEC+ +LKYDIEAERLP+ P  GQ+K YS+
Sbjct  121  QISNFKDDSSPIAWDCSAWVRTYALFLEERLECYSILKYDIEAERLPR-PVLGQDKDYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            T EL+SEELL+QLPALQQLLYRLIGCRPEGAAV NYVIQYALALVLKESFKIYCAIN GI
Sbjct  180  TTELDSEELLEQLPALQQLLYRLIGCRPEGAAVANYVIQYALALVLKESFKIYCAINGGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_009396332.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=566

 Score =   444 bits (1142),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 217/252 (86%), Positives = 238/252 (94%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQ+WRKA GALKD T VGLA++NSDFKD+DVAIVKATNHVECPPKERHLRKI++ TS
Sbjct  1    MATLQSWRKAVGALKDTTTVGLANLNSDFKDLDVAIVKATNHVECPPKERHLRKILLATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNF QR ++L
Sbjct  61   ITRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFSQRAKIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPI WDCSAWVRTYALFLEERLECFR+LKYD+EAERL + P+QG EKG+SK
Sbjct  121  QLSNFKDDSSPIGWDCSAWVRTYALFLEERLECFRILKYDVEAERLIR-PSQGSEKGHSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TRE++SE+LL+QLPALQQLLYRLIGCRPEGAA+ NYV+QYALAL+LKESFKIYCAINDGI
Sbjct  180  TREVDSEDLLEQLPALQQLLYRLIGCRPEGAAISNYVVQYALALILKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_010553785.1| PREDICTED: putative clathrin assembly protein At2g01600 [Tarenaya 
hassleriana]
Length=578

 Score =   444 bits (1143),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 222/252 (88%), Positives = 236/252 (94%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWR+AYGALKD TKVGL  VNSD+ D+DVAIVKATNHVECPPKERHLRKI + TS
Sbjct  1    MGTLQTWRRAYGALKDTTKVGLVRVNSDYADLDVAIVKATNHVECPPKERHLRKIFIATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A RPRADVAYCIHAL+RRL KT NWTVALKTLIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   ATRPRADVAYCIHALSRRLHKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPK PA GQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPK-PAPGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+SEELL+QLPALQQLLYRLIGC+PEGAA  N VIQYALALVLKESFK+YCAINDGI
Sbjct  180  TRDLDSEELLEQLPALQQLLYRLIGCKPEGAANLNRVIQYALALVLKESFKVYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_009396331.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=569

 Score =   444 bits (1142),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 217/252 (86%), Positives = 238/252 (94%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQ+WRKA GALKD T VGLA++NSDFKD+DVAIVKATNHVECPPKERHLRKI++ TS
Sbjct  1    MATLQSWRKAVGALKDTTTVGLANLNSDFKDLDVAIVKATNHVECPPKERHLRKILLATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNF QR ++L
Sbjct  61   ITRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFSQRAKIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPI WDCSAWVRTYALFLEERLECFR+LKYD+EAERL + P+QG EKG+SK
Sbjct  121  QLSNFKDDSSPIGWDCSAWVRTYALFLEERLECFRILKYDVEAERLIR-PSQGSEKGHSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TRE++SE+LL+QLPALQQLLYRLIGCRPEGAA+ NYV+QYALAL+LKESFKIYCAINDGI
Sbjct  180  TREVDSEDLLEQLPALQQLLYRLIGCRPEGAAISNYVVQYALALILKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>gb|EPS60394.1| hypothetical protein M569_14409, partial [Genlisea aurea]
Length=294

 Score =   432 bits (1110),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 220/252 (87%), Positives = 234/252 (93%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGA+KDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERH+RKI+  TS
Sbjct  1    MGTLQTWRKAYGAIKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHIRKILFATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCI ALARRLAKT NWTVALKTLIVIHRTLREG P F EELLNFQQRG  L
Sbjct  61   AIRPRADVAYCIRALARRLAKTRNWTVALKTLIVIHRTLREGGPAFPEELLNFQQRGCFL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            QMSNFKDDSSPIAWDCS WVRTYALFLEERLECF++LKYD+EAERLPK P+ GQ KGYS+
Sbjct  121  QMSNFKDDSSPIAWDCSGWVRTYALFLEERLECFKILKYDVEAERLPK-PSNGQAKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L SEELL+ LPALQQLLYRLIGCRPEGAA  NYVIQ ALALVLKESFKIYC++NDGI
Sbjct  180  TRDLLSEELLEHLPALQQLLYRLIGCRPEGAASNNYVIQSALALVLKESFKIYCSVNDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMP+
Sbjct  240  INLVDKFFEMPK  251



>gb|KJB78156.1| hypothetical protein B456_012G181700 [Gossypium raimondii]
Length=561

 Score =   439 bits (1130),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 220/252 (87%), Positives = 232/252 (92%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSDF D+DVAIVKATNHVECPPKERHLRKI V TS
Sbjct  1    MGTLQTWRKAYGALKDTTKVGLAHVNSDFADLDVAIVKATNHVECPPKERHLRKIFVATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHAL+RRLAKT NWTVALKTLIVIHR LREGDPTFREELLNF QR  +L
Sbjct  61   MFRPRADVAYCIHALSRRLAKTRNWTVALKTLIVIHRALREGDPTFREELLNFSQRAGIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLEC+ +LKYDIEAERLP+ P  GQ+K YS+
Sbjct  121  QISNFKDDSSPIAWDCSAWVRTYALFLEERLECYSILKYDIEAERLPR-PVLGQDKDYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            T EL++EELL+QLPALQQLLYRLIGC PEGAAV NYVIQYALALVLKESFKIYCAIN GI
Sbjct  180  TTELDNEELLEQLPALQQLLYRLIGCLPEGAAVANYVIQYALALVLKESFKIYCAINGGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>gb|KJB78154.1| hypothetical protein B456_012G181700 [Gossypium raimondii]
Length=560

 Score =   439 bits (1130),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 220/252 (87%), Positives = 232/252 (92%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSDF D+DVAIVKATNHVECPPKERHLRKI V TS
Sbjct  1    MGTLQTWRKAYGALKDTTKVGLAHVNSDFADLDVAIVKATNHVECPPKERHLRKIFVATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHAL+RRLAKT NWTVALKTLIVIHR LREGDPTFREELLNF QR  +L
Sbjct  61   MFRPRADVAYCIHALSRRLAKTRNWTVALKTLIVIHRALREGDPTFREELLNFSQRAGIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLEC+ +LKYDIEAERLP+ P  GQ+K YS+
Sbjct  121  QISNFKDDSSPIAWDCSAWVRTYALFLEERLECYSILKYDIEAERLPR-PVLGQDKDYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            T EL++EELL+QLPALQQLLYRLIGC PEGAAV NYVIQYALALVLKESFKIYCAIN GI
Sbjct  180  TTELDNEELLEQLPALQQLLYRLIGCLPEGAAVANYVIQYALALVLKESFKIYCAINGGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_010921255.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X2 [Elaeis guineensis]
Length=558

 Score =   439 bits (1128),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 220/252 (87%), Positives = 235/252 (93%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M +LQ+WRKAYGALKD T VGLA++NSDFKD+DVAIVKATNHVE PPKERHLRKI+  TS
Sbjct  1    MASLQSWRKAYGALKDTTTVGLANLNSDFKDLDVAIVKATNHVERPPKERHLRKILAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALARRLAKTHNWTVALKTLIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   IARPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWD SAWVR+YALFLEERLECFRVLKYD+EAERL K PAQG EKG+S+
Sbjct  121  QLSNFKDDSSPIAWDFSAWVRSYALFLEERLECFRVLKYDVEAERLTK-PAQGSEKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+ EELL+QLPALQQLLYRLIGC PEGAAV NYV+QYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDIEELLEQLPALQQLLYRLIGCHPEGAAVSNYVVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_010527791.1| PREDICTED: putative clathrin assembly protein At2g01600 [Tarenaya 
hassleriana]
Length=572

 Score =   439 bits (1129),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 218/252 (87%), Positives = 234/252 (93%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWR+AYGALKD TKVGL  VNSD+ D+DVA+VKATNHVECPPKERHLRKI   TS
Sbjct  1    MGTLQTWRRAYGALKDTTKVGLVRVNSDYADLDVAVVKATNHVECPPKERHLRKIFFATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A RPRADVAYCIHAL+RRL KT NWTVALKTLIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   ATRPRADVAYCIHALSRRLHKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVL+YDIEAERLPK PA GQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLRYDIEAERLPK-PAPGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+SEELL+QLPALQQLLYRLI C+PEGAA  N+VIQYALALVLKESFK+YC INDGI
Sbjct  180  TRDLDSEELLEQLPALQQLLYRLIACKPEGAANHNHVIQYALALVLKESFKVYCTINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_009418441.1| PREDICTED: putative clathrin assembly protein At2g01600 [Musa 
acuminata subsp. malaccensis]
Length=560

 Score =   437 bits (1125),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 219/252 (87%), Positives = 235/252 (93%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQ+WRKA GALKD T VGLA++NSDFKD+DVAIVKATNHVE PPKERHLRKI+  TS
Sbjct  1    MATLQSWRKAVGALKDTTTVGLANINSDFKDLDVAIVKATNHVEHPPKERHLRKILAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALARRLAKT NWTVALKTLIVIHRTLREGDPTFREELLNF QR R+L
Sbjct  61   ITRPRADVAYCIHALARRLAKTRNWTVALKTLIVIHRTLREGDPTFREELLNFSQRARIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYD+EAERL +  AQG EKG+SK
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDVEAERLVR-AAQGPEKGHSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+SE+LL+QLPALQQLLYRLIGCRPEGAAV NYV+QYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSEDLLEQLPALQQLLYRLIGCRPEGAAVSNYVVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFF+MPR
Sbjct  240  INLVDKFFDMPR  251



>gb|KHN03156.1| Putative clathrin assembly protein [Glycine soja]
Length=554

 Score =   435 bits (1118),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 216/252 (86%), Positives = 235/252 (93%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQ+WRKAYGA+KD TKVGLAHVNSDF ++DVA+VKATNHVE PPK+RHLRKI+  TS
Sbjct  1    MATLQSWRKAYGAIKDTTKVGLAHVNSDFAELDVAVVKATNHVERPPKDRHLRKILFATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            AVRPRADVAYCIHA+ARRLAKT NWTVALKTLIVIHR LREGDPT REE LNF QRGR+L
Sbjct  61   AVRPRADVAYCIHAIARRLAKTRNWTVALKTLIVIHRMLREGDPTLREEFLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q SNFKDDSSPIAWDCSAWVRTYAL+LEERLECF+VL YDIEAERL KP A G++KGYS+
Sbjct  121  QPSNFKDDSSPIAWDCSAWVRTYALYLEERLECFQVLNYDIEAERLAKPVA-GEDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+LNSE+LL+QLPALQQLLYRL+GCRPEGAA+ NYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRDLNSEKLLEQLPALQQLLYRLVGCRPEGAAISNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_010921261.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X3 [Elaeis guineensis]
Length=533

 Score =   434 bits (1116),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 220/254 (87%), Positives = 235/254 (93%), Gaps = 3/254 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFK--DVDVAIVKATNHVECPPKERHLRKIMVY  393
            M +LQ+WRKAYGALKD T VGLA++NSDFK  D+DVAIVKATNHVE PPKERHLRKI+  
Sbjct  1    MASLQSWRKAYGALKDTTTVGLANLNSDFKVKDLDVAIVKATNHVERPPKERHLRKILAA  60

Query  394  TSAVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGR  573
            TS  RPRADVAYCIHALARRLAKTHNWTVALKTLIVIHR LREGDPTFREELLNF QRGR
Sbjct  61   TSIARPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGR  120

Query  574  VLQMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGY  753
            +LQ+SNFKDDSSPIAWD SAWVR+YALFLEERLECFRVLKYD+EAERL K PAQG EKG+
Sbjct  121  ILQLSNFKDDSSPIAWDFSAWVRSYALFLEERLECFRVLKYDVEAERLTK-PAQGSEKGH  179

Query  754  SKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAIND  933
            S+TREL+ EELL+QLPALQQLLYRLIGC PEGAAV NYV+QYALALVLKESFKIYCAIND
Sbjct  180  SRTRELDIEELLEQLPALQQLLYRLIGCHPEGAAVSNYVVQYALALVLKESFKIYCAIND  239

Query  934  GIINLVDKFFEMPR  975
            GIINLVDKFFEMPR
Sbjct  240  GIINLVDKFFEMPR  253



>gb|KJB78157.1| hypothetical protein B456_012G181700 [Gossypium raimondii]
Length=561

 Score =   435 bits (1118),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 220/253 (87%), Positives = 232/253 (92%), Gaps = 2/253 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSDF D+DVAIVKATNHVECPPKERHLRKI V TS
Sbjct  1    MGTLQTWRKAYGALKDTTKVGLAHVNSDFADLDVAIVKATNHVECPPKERHLRKIFVATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHAL+RRLAKT NWTVALKTLIVIHR LREGDPTFREELLNF QR  +L
Sbjct  61   MFRPRADVAYCIHALSRRLAKTRNWTVALKTLIVIHRALREGDPTFREELLNFSQRAGIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLEC+ +LKYDIEAERLP+ P  GQ+K YS+
Sbjct  121  QISNFKDDSSPIAWDCSAWVRTYALFLEERLECYSILKYDIEAERLPR-PVLGQDKDYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCR-PEGAAVGNYVIQYALALVLKESFKIYCAINDG  936
            T EL++EELL+QLPALQQLLYRLIGC  PEGAAV NYVIQYALALVLKESFKIYCAIN G
Sbjct  180  TTELDNEELLEQLPALQQLLYRLIGCLVPEGAAVANYVIQYALALVLKESFKIYCAINGG  239

Query  937  IINLVDKFFEMPR  975
            IINLVDKFFEMPR
Sbjct  240  IINLVDKFFEMPR  252



>ref|XP_010921252.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X1 [Elaeis guineensis]
Length=560

 Score =   433 bits (1114),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 220/254 (87%), Positives = 235/254 (93%), Gaps = 3/254 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFK--DVDVAIVKATNHVECPPKERHLRKIMVY  393
            M +LQ+WRKAYGALKD T VGLA++NSDFK  D+DVAIVKATNHVE PPKERHLRKI+  
Sbjct  1    MASLQSWRKAYGALKDTTTVGLANLNSDFKVKDLDVAIVKATNHVERPPKERHLRKILAA  60

Query  394  TSAVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGR  573
            TS  RPRADVAYCIHALARRLAKTHNWTVALKTLIVIHR LREGDPTFREELLNF QRGR
Sbjct  61   TSIARPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGR  120

Query  574  VLQMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGY  753
            +LQ+SNFKDDSSPIAWD SAWVR+YALFLEERLECFRVLKYD+EAERL K PAQG EKG+
Sbjct  121  ILQLSNFKDDSSPIAWDFSAWVRSYALFLEERLECFRVLKYDVEAERLTK-PAQGSEKGH  179

Query  754  SKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAIND  933
            S+TREL+ EELL+QLPALQQLLYRLIGC PEGAAV NYV+QYALALVLKESFKIYCAIND
Sbjct  180  SRTRELDIEELLEQLPALQQLLYRLIGCHPEGAAVSNYVVQYALALVLKESFKIYCAIND  239

Query  934  GIINLVDKFFEMPR  975
            GIINLVDKFFEMPR
Sbjct  240  GIINLVDKFFEMPR  253



>ref|XP_003533950.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Glycine max]
Length=554

 Score =   433 bits (1113),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 215/252 (85%), Positives = 234/252 (93%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQ+WRKAYGA+KD TKVGLAHVNSDF ++DVA+VKATNHVE PPK+RHLRKI+  TS
Sbjct  1    MATLQSWRKAYGAIKDTTKVGLAHVNSDFAELDVAVVKATNHVERPPKDRHLRKILFATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             VRPRADVAYCIHA+ARRLAKT NWTVALKTLIVIHR LREGDPT REE LNF QRGR+L
Sbjct  61   VVRPRADVAYCIHAIARRLAKTRNWTVALKTLIVIHRMLREGDPTLREEFLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q SNFKDDSSPIAWDCSAWVRTYAL+LEERLECF+VL YDIEAERL KP A G++KGYS+
Sbjct  121  QPSNFKDDSSPIAWDCSAWVRTYALYLEERLECFQVLNYDIEAERLAKPVA-GEDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+LNSE+LL+QLPALQQLLYRL+GCRPEGAA+ NYVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRDLNSEKLLEQLPALQQLLYRLVGCRPEGAAISNYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_006395874.1| hypothetical protein EUTSA_v10003910mg [Eutrema salsugineum]
 gb|ESQ33160.1| hypothetical protein EUTSA_v10003910mg [Eutrema salsugineum]
Length=571

 Score =   428 bits (1101),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 214/252 (85%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WRKAYGALKD TKVGL  VNSD+ D+DVAIVKATNHVECPPK+RHLRKI   TS
Sbjct  1    MGTLQSWRKAYGALKDTTKVGLVRVNSDYADLDVAIVKATNHVECPPKDRHLRKIFAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              R RADVAYCIHAL+RRL KT NWTVALKTLIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   VTRARADVAYCIHALSRRLHKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYD EAERLPK    GQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDTEAERLPK-STPGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ EELL+QLPALQQLLYRLIGCRPEGAA  N+VIQYALALVLKESFK+YCAINDGI
Sbjct  180  TRDLDGEELLEQLPALQQLLYRLIGCRPEGAANHNHVIQYALALVLKESFKVYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INL+DKFFEMP+
Sbjct  240  INLIDKFFEMPK  251



>ref|XP_002441469.1| hypothetical protein SORBIDRAFT_09g027370 [Sorghum bicolor]
 gb|EES19899.1| hypothetical protein SORBIDRAFT_09g027370 [Sorghum bicolor]
Length=564

 Score =   427 bits (1099),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 210/252 (83%), Positives = 232/252 (92%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M ++Q+WRKAYGA+KD T V LA++NSDFKD+DVAIVKATNHVECPPKERHLRK++  TS
Sbjct  1    MASMQSWRKAYGAIKDTTTVSLANLNSDFKDLDVAIVKATNHVECPPKERHLRKVVAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALARRLAKT NW VALKTL+VIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   IARPRADVAYCIHALARRLAKTRNWIVALKTLVVIHRLLREGDPTFREELLNFTQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTY LFLEERLECFRVLKYD+EAERL K   QG EKG+S+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYGLFLEERLECFRVLKYDVEAERLSK-QGQGPEKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+S++LL+QLPALQQLLYRL+GCRPEGAA  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSQDLLEQLPALQQLLYRLVGCRPEGAANSNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>gb|EAY98914.1| hypothetical protein OsI_20869 [Oryza sativa Indica Group]
Length=567

 Score =   427 bits (1097),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 211/252 (84%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M  +Q+WRKAYGALKD T V LA++NSDFKD+DVAIVKATNHVECPPKERHLRKI+  TS
Sbjct  1    MAAMQSWRKAYGALKDSTTVSLANLNSDFKDLDVAIVKATNHVECPPKERHLRKIVAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHAL+RRLAKT NW VALKTL+VIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   IARPRADVAYCIHALSRRLAKTRNWIVALKTLVVIHRLLREGDPTFREELLNFAQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTY LFLEERLECFRVLKYD+EAERL K   QG EKG+S+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYGLFLEERLECFRVLKYDVEAERLSK-QGQGPEKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL S++LL+QLPALQQLLYRL+GCRPEGAA  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRELESQDLLEQLPALQQLLYRLVGCRPEGAANNNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|NP_001056232.1| Os05g0549000 [Oryza sativa Japonica Group]
 dbj|BAF18146.1| Os05g0549000 [Oryza sativa Japonica Group]
 gb|EEE64590.1| hypothetical protein OsJ_19442 [Oryza sativa Japonica Group]
Length=567

 Score =   427 bits (1097),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 211/252 (84%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M  +Q+WRKAYGALKD T V LA++NSDFKD+DVAIVKATNHVECPPKERHLRKI+  TS
Sbjct  1    MAAMQSWRKAYGALKDSTTVSLANLNSDFKDLDVAIVKATNHVECPPKERHLRKIVAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHAL+RRLAKT NW VALKTL+VIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   IARPRADVAYCIHALSRRLAKTRNWIVALKTLVVIHRLLREGDPTFREELLNFAQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTY LFLEERLECFRVLKYD+EAERL K   QG EKG+S+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYGLFLEERLECFRVLKYDVEAERLSK-QGQGPEKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL S++LL+QLPALQQLLYRL+GCRPEGAA  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRELESQDLLEQLPALQQLLYRLVGCRPEGAANNNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_004961341.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Setaria italica]
Length=564

 Score =   426 bits (1095),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/252 (83%), Positives = 232/252 (92%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M ++Q+WRKAYGA+KD T V LA++NSDFKD+DVAIVKATNHVECPPKERHLRK++  TS
Sbjct  1    MASMQSWRKAYGAIKDSTTVSLANLNSDFKDLDVAIVKATNHVECPPKERHLRKVVAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALARRLAKT NW VALKTL+VIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   IARPRADVAYCIHALARRLAKTRNWIVALKTLVVIHRLLREGDPTFREELLNFTQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTY LFLEERLECFRVLKYD+EAERL K   QG EKG+S+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYGLFLEERLECFRVLKYDVEAERLSK-QGQGPEKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+S++LL+QLPALQQLLYRL+GCRPEGAA  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSQDLLEQLPALQQLLYRLVGCRPEGAANNNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|NP_001136989.1| uncharacterized protein LOC100217151 [Zea mays]
 gb|ACF83027.1| unknown [Zea mays]
 gb|AFW78996.1| hypothetical protein ZEAMMB73_223268 [Zea mays]
Length=563

 Score =   425 bits (1093),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 209/252 (83%), Positives = 231/252 (92%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M ++Q+WRKAYGA+KD T V LA++NSDFKD+DVAIVKATNHVECPPKERHLRK++  TS
Sbjct  1    MASMQSWRKAYGAIKDTTTVSLANLNSDFKDLDVAIVKATNHVECPPKERHLRKVVAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALARRLAKT NW VALK L+VIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   IARPRADVAYCIHALARRLAKTRNWIVALKALVVIHRLLREGDPTFREELLNFTQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTY LFLEERLECFRVLKYD+EAERL K   QG EKG+S+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYGLFLEERLECFRVLKYDVEAERLSK-QGQGPEKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+S++LL+QLPALQQLLYRL+GCRPEGAA  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSQDLLEQLPALQQLLYRLVGCRPEGAANNNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_006292297.1| hypothetical protein CARUB_v10018506mg [Capsella rubella]
 gb|EOA25195.1| hypothetical protein CARUB_v10018506mg [Capsella rubella]
Length=572

 Score =   426 bits (1094),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 212/252 (84%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WRKAYGALKD TKVGL  VNSD+ D+DVAIVKATNHVECPPK+RHLRKI   TS
Sbjct  1    MGTLQSWRKAYGALKDSTKVGLVRVNSDYADLDVAIVKATNHVECPPKDRHLRKIFAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              R RADVAYCIHAL+RRL KT NWTVALKT+IVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   VTRARADVAYCIHALSRRLHKTRNWTVALKTVIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYD EAERLPK    GQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDTEAERLPK-SNPGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ EELL+QLPALQQLLYRLIGCRPEGAA  N+VIQYALALVLKESFK+YCA+NDGI
Sbjct  180  TRDLDGEELLEQLPALQQLLYRLIGCRPEGAANHNHVIQYALALVLKESFKVYCAVNDGI  239

Query  940  INLVDKFFEMPR  975
            INL+DKFFEMP+
Sbjct  240  INLIDKFFEMPK  251



>ref|XP_006655551.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Oryza brachyantha]
Length=566

 Score =   425 bits (1093),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 210/252 (83%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M  +Q+WRKAYGALKD T V LA++NSDFKD+DVAIVKATNHVECPPKERHLRKI+  TS
Sbjct  1    MAAMQSWRKAYGALKDTTTVSLANLNSDFKDLDVAIVKATNHVECPPKERHLRKIVAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHAL+RRLAKT NW VALKTL+VIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   IARPRADVAYCIHALSRRLAKTRNWIVALKTLVVIHRLLREGDPTFREELLNFAQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTY LFLEERLECFRVLKYD+EAERL K   QG EKG+S+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYGLFLEERLECFRVLKYDVEAERLSK-QGQGPEKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL S++LL+QLPALQQLLYRL+GCRPEGAA  NY++QYALALVLKESFKIYCA+NDGI
Sbjct  180  TRELESQDLLEQLPALQQLLYRLVGCRPEGAANNNYLVQYALALVLKESFKIYCAVNDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_010513887.1| PREDICTED: putative clathrin assembly protein At2g01600 [Camelina 
sativa]
Length=573

 Score =   424 bits (1090),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 212/252 (84%), Positives = 229/252 (91%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WRKAYGALKD TKVGL  VNSD+ ++DVAIVKATNHVECPPK+RHLRKI   TS
Sbjct  1    MGTLQSWRKAYGALKDSTKVGLVRVNSDYAELDVAIVKATNHVECPPKDRHLRKIFAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              R RADVAYCIHAL+RRL KT NWTVALKTLIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   VTRARADVAYCIHALSRRLHKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYD EAERLPK    GQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDTEAERLPK-STPGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ EELL+QLPALQQLLYRLIGCRPEGAA  N+V QYALALVLKESFK+YCAINDGI
Sbjct  180  TRDLDGEELLEQLPALQQLLYRLIGCRPEGAANHNHVTQYALALVLKESFKVYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INL+DKFFEMP+
Sbjct  240  INLIDKFFEMPK  251



>ref|XP_002875082.1| hypothetical protein ARALYDRAFT_904366 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51341.1| hypothetical protein ARALYDRAFT_904366 [Arabidopsis lyrata subsp. 
lyrata]
Length=562

 Score =   423 bits (1088),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 212/250 (85%), Positives = 228/250 (91%), Gaps = 1/250 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WRKAYGALKD TKVGL  VNS++ D+DVAIVKATNHVECPPK+RHLRKI   TS
Sbjct  1    MGTLQSWRKAYGALKDSTKVGLVRVNSEYADLDVAIVKATNHVECPPKDRHLRKIFAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              R RADVAYCIHAL+RRL KT NWTVALKTLIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   VTRARADVAYCIHALSRRLHKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYD EAERLPK    GQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDTEAERLPK-STPGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ EELL+QLPALQQLLYRLIGCRPEGAA  N+VIQYALALVLKESFK+YCAINDGI
Sbjct  180  TRDLDGEELLEQLPALQQLLYRLIGCRPEGAANHNHVIQYALALVLKESFKVYCAINDGI  239

Query  940  INLVDKFFEM  969
            INL+DKFFEM
Sbjct  240  INLIDKFFEM  249



>ref|NP_565267.1| putative clathrin assembly protein [Arabidopsis thaliana]
 sp|Q8LBH2.2|CAP8_ARATH RecName: Full=Putative clathrin assembly protein At2g01600 [Arabidopsis 
thaliana]
 gb|AAL11587.1|AF424593_1 At2g01600/F2I9.22 [Arabidopsis thaliana]
 gb|AAM15059.1| expressed protein [Arabidopsis thaliana]
 gb|AAM20138.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91762.1| unknown protein [Arabidopsis thaliana]
 gb|AEC05472.1| putative clathrin assembly protein [Arabidopsis thaliana]
Length=571

 Score =   422 bits (1085),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 212/250 (85%), Positives = 228/250 (91%), Gaps = 1/250 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WRKAYGALKD TKVGL  VNS++ D+DVAIVKATNHVECPPK+RHLRKI   TS
Sbjct  1    MGTLQSWRKAYGALKDSTKVGLVRVNSEYADLDVAIVKATNHVECPPKDRHLRKIFAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              R RADVAYCIHAL+RRL KT NWTVALKTLIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   VTRARADVAYCIHALSRRLHKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYD EAERLPK    GQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDTEAERLPK-SNPGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ EELL+QLPALQQLLYRLIGCRPEGAA  N+VIQYALALVLKESFK+YCAINDGI
Sbjct  180  TRDLDGEELLEQLPALQQLLYRLIGCRPEGAANHNHVIQYALALVLKESFKVYCAINDGI  239

Query  940  INLVDKFFEM  969
            INL+DKFFEM
Sbjct  240  INLIDKFFEM  249



>ref|XP_006850889.1| PREDICTED: putative clathrin assembly protein At5g57200 [Amborella 
trichopoda]
 gb|ERN12470.1| hypothetical protein AMTR_s00025p00161520 [Amborella trichopoda]
Length=546

 Score =   421 bits (1083),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 211/252 (84%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQ+WRKAYGALKD TKVGLA VNS++KD+D+AIVKATNHVECP KERH+RKI   TS
Sbjct  1    MATLQSWRKAYGALKDSTKVGLAKVNSEYKDLDIAIVKATNHVECPAKERHVRKIFAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             VRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLN+  RG +L
Sbjct  61   IVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNYSHRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFRVLKYD EAERL K   QG  KG+SK
Sbjct  121  QLSNFKDDSSPLAWDCSAWVRTYALFLEERLECFRVLKYDTEAERLMK-SVQGPAKGHSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL S++LL+ LPALQQLLYRL+GC+PEGAA  N +IQYALALVLKESFKIYCAINDGI
Sbjct  180  TRELGSDDLLEHLPALQQLLYRLVGCQPEGAAFSNCLIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEM R
Sbjct  240  INLVDKFFEMSR  251



>gb|AFW80976.1| hypothetical protein ZEAMMB73_079219 [Zea mays]
Length=564

 Score =   422 bits (1084),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 206/252 (82%), Positives = 231/252 (92%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M ++Q+WRKAYGA+KD T V +A++NSDFKD+DVAIVKATNHVECPPKERHLR+++  TS
Sbjct  1    MASMQSWRKAYGAIKDTTTVSIANLNSDFKDLDVAIVKATNHVECPPKERHLRRVVAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALARRLAKT NW VALK L+VIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   ITRPRADVAYCIHALARRLAKTRNWIVALKALVVIHRLLREGDPTFREELLNFTQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTY L+LEERLECFRVLKYD+EAERL K   QG EKG+S+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYGLYLEERLECFRVLKYDVEAERLSK-QGQGPEKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+S++LL+QLPALQQLLYRL+GCRPEGAA  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSQDLLEQLPALQQLLYRLVGCRPEGAANNNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>gb|KJB60906.1| hypothetical protein B456_009G330700 [Gossypium raimondii]
Length=531

 Score =   420 bits (1080),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 214/252 (85%), Gaps = 32/252 (13%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSD+ D+DVAIVKATNHVECPPKERHLRKI++ TS
Sbjct  1    MGTLQTWRKAYGALKDSTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKILLATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHAL+RRLAKTHNWTVALKTLIVIHR LREGDPTFREE+LNF QR R+L
Sbjct  61   AIRPRADVAYCIHALSRRLAKTHNWTVALKTLIVIHRALREGDPTFREEILNFSQRARIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ P+QGQ+K    
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PSQGQDK----  175

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
                                       PEGAA+GNYVIQYALALVLKESFKIYCAINDGI
Sbjct  176  ---------------------------PEGAAIGNYVIQYALALVLKESFKIYCAINDGI  208

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  209  INLVDKFFEMPR  220



>gb|KJB60907.1| hypothetical protein B456_009G330700 [Gossypium raimondii]
Length=545

 Score =   421 bits (1081),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/252 (83%), Positives = 227/252 (90%), Gaps = 18/252 (7%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSD+ D+DVAIVKATNHVECPPKERHLRKI++ TS
Sbjct  1    MGTLQTWRKAYGALKDSTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKILLATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHAL+RRLAKTHNWTVALKTLIVIHR LREGDPTFREE+LNF QR R+L
Sbjct  61   AIRPRADVAYCIHALSRRLAKTHNWTVALKTLIVIHRALREGDPTFREEILNFSQRARIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ P+QGQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PSQGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L SEELL+QLPALQQLL+RLIGCR                 VLKESFKIYCAINDGI
Sbjct  180  TRDLGSEELLEQLPALQQLLHRLIGCR-----------------VLKESFKIYCAINDGI  222

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  223  INLVDKFFEMPR  234



>ref|XP_007153280.1| hypothetical protein PHAVU_003G022000g [Phaseolus vulgaris]
 gb|ESW25274.1| hypothetical protein PHAVU_003G022000g [Phaseolus vulgaris]
Length=552

 Score =   420 bits (1079),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 209/252 (83%), Positives = 232/252 (92%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQ+WRKAYGALKD TKVGLAHVNS + +++VA+VKATNHV CPPKER+LRKI++ TS
Sbjct  1    MATLQSWRKAYGALKDSTKVGLAHVNSSYAELEVAVVKATNHVVCPPKERYLRKILLATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A RPRADVA+CIHAL+RRLAKT NWTVALKTLIVIHR LREGDPT REE LNF QRGR+L
Sbjct  61   AARPRADVAFCIHALSRRLAKTRNWTVALKTLIVIHRLLREGDPTLREEFLNFAQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNF+DDSSPIAW+CSAWVRTYAL+LEERLECF +LKYDIEAERLPKP A GQEKGYS+
Sbjct  121  QLSNFRDDSSPIAWECSAWVRTYALYLEERLECFWILKYDIEAERLPKPVA-GQEKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+LNSEELL+ LPALQ+LLY L+GCRPEGAA  +YVIQYALALVLKESFKIYCAINDGI
Sbjct  180  TRDLNSEELLEHLPALQRLLYCLVGCRPEGAAFSSYVIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEM R
Sbjct  240  INLVDKFFEMLR  251



>ref|NP_001145773.1| uncharacterized protein LOC100279280 [Zea mays]
 gb|ACL52564.1| unknown [Zea mays]
Length=564

 Score =   420 bits (1079),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 231/252 (92%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M ++Q+WRKAYGA+KD T V +A++NSDFKD+DVAIVKATNHVECPPKERHLR+++  TS
Sbjct  1    MASMQSWRKAYGAIKDTTTVSIANLNSDFKDLDVAIVKATNHVECPPKERHLRRVVAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALARRLAKT +W VALK L+VIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   ITRPRADVAYCIHALARRLAKTRSWIVALKALVVIHRLLREGDPTFREELLNFTQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTY L+LEERLECFRVLKYD+EAERL K   QG EKG+S+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYGLYLEERLECFRVLKYDVEAERLSK-QGQGPEKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+S++LL+QLPALQQLLYRL+GCRPEGAA  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSQDLLEQLPALQQLLYRLVGCRPEGAANNNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|NP_172944.1| putative clathrin assembly protein [Arabidopsis thaliana]
 sp|P94017.2|CAP9_ARATH RecName: Full=Putative clathrin assembly protein At1g14910 [Arabidopsis 
thaliana]
 gb|AAM20134.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29241.1| putative clathrin assembly protein [Arabidopsis thaliana]
Length=692

 Score =   422 bits (1084),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 234/252 (93%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WR+AYGALKD TKVGL  VNSD+ ++DVAIVKATNHVECPPK+RHLRKI + TS
Sbjct  1    MGTLQSWRRAYGALKDTTKVGLVRVNSDYAELDVAIVKATNHVECPPKDRHLRKIFLATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHAL+RRL KT NWTVALK L+VIHR LR+GDPTFREELLNF Q+GR++
Sbjct  61   AIRPRADVAYCIHALSRRLHKTRNWTVALKALLVIHRLLRDGDPTFREELLNFSQKGRIM  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCS WVRTYALFLEERLECFRVLKYDIEAERLPK  + GQEKGYSK
Sbjct  121  QISNFKDDSSPVAWDCSGWVRTYALFLEERLECFRVLKYDIEAERLPK-VSPGQEKGYSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ E+LL+QLPALQQLL+RLIGC+PEGAA  N++IQYAL+LVLKESFK+YCAIN+GI
Sbjct  180  TRDLDGEKLLEQLPALQQLLHRLIGCKPEGAAKHNHIIQYALSLVLKESFKVYCAINEGI  239

Query  940  INLVDKFFEMPR  975
            INLV+KFFEMPR
Sbjct  240  INLVEKFFEMPR  251



>ref|XP_009129221.1| PREDICTED: putative clathrin assembly protein At2g01600 [Brassica 
rapa]
Length=577

 Score =   417 bits (1072),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 214/252 (85%), Positives = 229/252 (91%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGL  VNSD+ D+DVAIVKATNHVECPPK+RHLRKI   T+
Sbjct  1    MGTLQTWRKAYGALKDTTKVGLVRVNSDYADLDVAIVKATNHVECPPKDRHLRKIFAATA  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              R RADVAYCIHAL+RRL KT NWTVALKTLIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   VTRARADVAYCIHALSRRLHKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYD EAERLPK    GQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDTEAERLPK-ATPGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ EELL QLPALQQLLYRLIGCRPEGAA  N+VIQYALALVLKESFK+YCAINDGI
Sbjct  180  TRDLDGEELLVQLPALQQLLYRLIGCRPEGAANHNHVIQYALALVLKESFKVYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INL+DKFFEMP+
Sbjct  240  INLIDKFFEMPK  251



>emb|CDY09433.1| BnaA02g25770D [Brassica napus]
Length=577

 Score =   417 bits (1072),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 214/252 (85%), Positives = 229/252 (91%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGL  VNSD+ D+DVAIVKATNHVECPPK+RHLRKI   T+
Sbjct  1    MGTLQTWRKAYGALKDTTKVGLVRVNSDYADLDVAIVKATNHVECPPKDRHLRKIFAATA  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              R RADVAYCIHAL+RRL KT NWTVALKTLIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   VTRARADVAYCIHALSRRLHKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYD EAERLPK    GQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDTEAERLPK-ATPGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ EELL QLPALQQLLYRLIGCRPEGAA  N+VIQYALALVLKESFK+YCAINDGI
Sbjct  180  TRDLDGEELLVQLPALQQLLYRLIGCRPEGAANHNHVIQYALALVLKESFKVYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INL+DKFFEMP+
Sbjct  240  INLIDKFFEMPK  251



>emb|CDY48813.1| BnaC02g34010D [Brassica napus]
Length=583

 Score =   417 bits (1072),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 214/252 (85%), Positives = 229/252 (91%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGL  VNSD+ D+DVAIVKATNHVECPPK+RHLRKI   T+
Sbjct  1    MGTLQTWRKAYGALKDTTKVGLVRVNSDYADLDVAIVKATNHVECPPKDRHLRKIFAATA  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              R RADVAYCIHAL+RRL KT NWTVALKTLIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   VTRARADVAYCIHALSRRLHKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYD EAERLPK    GQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDTEAERLPK-ATPGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ EELL QLPALQQLLYRLIGCRPEGAA  N+VIQYALALVLKESFK+YCAINDGI
Sbjct  180  TRDLDGEELLVQLPALQQLLYRLIGCRPEGAANHNHVIQYALALVLKESFKVYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INL+DKFFEMP+
Sbjct  240  INLIDKFFEMPK  251



>gb|AFW80975.1| hypothetical protein ZEAMMB73_079219 [Zea mays]
Length=568

 Score =   416 bits (1068),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 206/256 (80%), Positives = 231/256 (90%), Gaps = 5/256 (2%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M ++Q+WRKAYGA+KD T V +A++NSDFKD+DVAIVKATNHVECPPKERHLR+++  TS
Sbjct  1    MASMQSWRKAYGAIKDTTTVSIANLNSDFKDLDVAIVKATNHVECPPKERHLRRVVAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALARRLAKT NW VALK L+VIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   ITRPRADVAYCIHALARRLAKTRNWIVALKALVVIHRLLREGDPTFREELLNFTQRGRIL  120

Query  580  QMSNFKDDSSPI----AWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEK  747
            Q+SNFKDDSSPI    AWDCSAWVRTY L+LEERLECFRVLKYD+EAERL K   QG EK
Sbjct  121  QLSNFKDDSSPIGLCAAWDCSAWVRTYGLYLEERLECFRVLKYDVEAERLSK-QGQGPEK  179

Query  748  GYSKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAI  927
            G+S+TREL+S++LL+QLPALQQLLYRL+GCRPEGAA  NY++QYALALVLKESFKIYCAI
Sbjct  180  GHSRTRELDSQDLLEQLPALQQLLYRLVGCRPEGAANNNYLVQYALALVLKESFKIYCAI  239

Query  928  NDGIINLVDKFFEMPR  975
            NDGIINLVDKFFEMPR
Sbjct  240  NDGIINLVDKFFEMPR  255



>gb|KFK32949.1| hypothetical protein AALP_AA6G310300 [Arabis alpina]
Length=705

 Score =   420 bits (1079),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 207/252 (82%), Positives = 229/252 (91%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WR+AYGALKD TKVGL  VNSD+ ++DVAIVKATNHVECPPK+RHL+KI V TS
Sbjct  1    MGTLQSWRRAYGALKDTTKVGLVRVNSDYAEIDVAIVKATNHVECPPKDRHLKKIFVATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A RPRADVAYCIH L+RRL KT NWTVALK L+VIHR LREGDPTFREELLNF QRGR L
Sbjct  61   ATRPRADVAYCIHTLSRRLHKTRNWTVALKALLVIHRLLREGDPTFREELLNFAQRGRFL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVR YALFLEERLECFRVLKYDIEAERLPK    GQEKGYSK
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRAYALFLEERLECFRVLKYDIEAERLPK-LTPGQEKGYSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+++ E+LL+QLPALQQLL+RLIGC+PEG A  N++IQYALALVLKESFK+YCAIN+GI
Sbjct  180  TRDIDGEKLLEQLPALQQLLHRLIGCKPEGGANHNHIIQYALALVLKESFKVYCAINEGI  239

Query  940  INLVDKFFEMPR  975
            INLV+KFFEMPR
Sbjct  240  INLVEKFFEMPR  251



>ref|XP_006646232.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Oryza brachyantha]
Length=574

 Score =   416 bits (1068),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 208/252 (83%), Positives = 226/252 (90%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M  LQ+WRKAYGALKD T V LA++NSDFKD+DVAIVKATNHVECPPKERHLRKI+  TS
Sbjct  1    MSALQSWRKAYGALKDTTTVSLANLNSDFKDLDVAIVKATNHVECPPKERHLRKIVAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALARRLAKT NW VALKTL+VIHR LREGDPTFREE L F QR R+L
Sbjct  61   IARPRADVAYCIHALARRLAKTRNWIVALKTLVVIHRLLREGDPTFREEFLTFTQRVRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDS+P+AWD S+WVRTY LFLEERLECFRVLKYDIEAERL K   QG EKG+S+
Sbjct  121  QLSNFKDDSTPVAWDYSSWVRTYGLFLEERLECFRVLKYDIEAERLSK-QGQGPEKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+S +LL+QLPALQQLLYRLIGCRPEGAA  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSPDLLEQLPALQQLLYRLIGCRPEGAANSNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_010913847.1| PREDICTED: LOW QUALITY PROTEIN: putative clathrin assembly protein 
At5g57200 [Elaeis guineensis]
Length=561

 Score =   414 bits (1063),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 231/252 (92%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGA+KD TKVGLA VNS+FK++D+AIVKATNHVECPPKERH+RKI   TS
Sbjct  1    MGTLQTWRKAYGAIKDSTKVGLAKVNSEFKELDIAIVKATNHVECPPKERHVRKIFAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            AVRPRAD+AYCI+ALARRL+KT NWTVALKTLIVIHRTLREGDPTF+EE+L++  RG +L
Sbjct  61   AVRPRADIAYCIYALARRLSKTRNWTVALKTLIVIHRTLREGDPTFKEEMLSYSHRGNIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFRVLKYDIE+ERL +  AQG  KG+S+
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECFRVLKYDIESERLMR-SAQGAPKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L   +LL+QLPALQQLL+RLIGC+PEGAA GNY+IQYALALVLKESFKIYCAINDGI
Sbjct  180  TRTLGCVDLLEQLPALQQLLFRLIGCQPEGAACGNYLIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FFEM +
Sbjct  240  INLVDMFFEMSK  251



>emb|CDY17660.1| BnaA06g34790D [Brassica napus]
Length=571

 Score =   414 bits (1064),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 212/252 (84%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WRKAYGALKD TKVGL  VNSD+ D+DVAIVKATNHVECPPK+RHLRKI   T+
Sbjct  1    MGTLQSWRKAYGALKDTTKVGLVRVNSDYADLDVAIVKATNHVECPPKDRHLRKIFAATA  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              R RADVAYCIHAL+RRL KT NWTVALKTLIVIHR LREGDPTFREELLNF QR R+L
Sbjct  61   VTRARADVAYCIHALSRRLHKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRARIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYD EAERLPK    GQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDTEAERLPK-STPGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ EELL QLPALQQLLYRLIGCRPEGAA  N+VIQYALALVLKESFK+YCAINDGI
Sbjct  180  TRDLDGEELLVQLPALQQLLYRLIGCRPEGAANHNHVIQYALALVLKESFKVYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INL+DKFFEMP+
Sbjct  240  INLIDKFFEMPK  251



>ref|XP_009101331.1| PREDICTED: putative clathrin assembly protein At2g01600 [Brassica 
rapa]
Length=571

 Score =   414 bits (1064),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 212/252 (84%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WRKAYGALKD TKVGL  VNSD+ D+DVAIVKATNHVECPPK+RHLRKI   T+
Sbjct  1    MGTLQSWRKAYGALKDTTKVGLVRVNSDYADLDVAIVKATNHVECPPKDRHLRKIFAATA  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              R RADVAYCIHAL+RRL KT NWTVALKTLIVIHR LREGDPTFREELLNF QR R+L
Sbjct  61   VTRARADVAYCIHALSRRLHKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRARIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYD EAERLPK    GQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDTEAERLPK-STPGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ EELL QLPALQQLLYRLIGCRPEGAA  N+VIQYALALVLKESFK+YCAINDGI
Sbjct  180  TRDLDGEELLVQLPALQQLLYRLIGCRPEGAANHNHVIQYALALVLKESFKVYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INL+DKFFEMP+
Sbjct  240  INLIDKFFEMPK  251



>emb|CDY36239.1| BnaC07g20930D [Brassica napus]
Length=571

 Score =   413 bits (1062),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 211/252 (84%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WRKAYGALKD TKVGL  VNSD+ D+DVAIVKATNHVECPPK+RHLRKI   T+
Sbjct  1    MGTLQSWRKAYGALKDTTKVGLVRVNSDYADLDVAIVKATNHVECPPKDRHLRKIFAATA  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              R RADVAYCIHAL+RRL KT NWTVALKTLIVIHR LREGDPTFREELLNF QR R+L
Sbjct  61   VTRARADVAYCIHALSRRLHKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRARIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTY+LFLEERLECFRVLKYD EAERLPK    GQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYSLFLEERLECFRVLKYDTEAERLPK-STPGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ EELL QLPALQQLLYRLIGCRPEGAA  N+VIQYALALVLKESFK+YCAINDGI
Sbjct  180  TRDLDGEELLVQLPALQQLLYRLIGCRPEGAANHNHVIQYALALVLKESFKVYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INL+DKFFEMP+
Sbjct  240  INLIDKFFEMPK  251



>gb|EEC71324.1| hypothetical protein OsI_03369 [Oryza sativa Indica Group]
Length=568

 Score =   412 bits (1060),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 207/252 (82%), Positives = 225/252 (89%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M  LQ+WRKAYGALKD T V LA++NSDFKD+DVAIVKATNHVECPPKERHLRKI   TS
Sbjct  1    MSALQSWRKAYGALKDTTTVSLANLNSDFKDLDVAIVKATNHVECPPKERHLRKIAAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALARRLAKT NW VALKTL+VIHR LR+GDPTFREE L F QR R+L
Sbjct  61   IARPRADVAYCIHALARRLAKTRNWIVALKTLVVIHRLLRDGDPTFREEFLTFTQRVRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDS+P+AWD S+WVRTY LFLEERLECFRVLKYDIEAERL K   QG EKG+S+
Sbjct  121  QLSNFKDDSTPVAWDYSSWVRTYGLFLEERLECFRVLKYDIEAERLSK-QGQGPEKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+S +LL+QLPALQQLLYRLIGCRPEGAA  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSPDLLEQLPALQQLLYRLIGCRPEGAANSNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_002269299.1| PREDICTED: putative clathrin assembly protein At5g57200 [Vitis 
vinifera]
 emb|CBI40102.3| unnamed protein product [Vitis vinifera]
Length=591

 Score =   412 bits (1060),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 209/252 (83%), Positives = 227/252 (90%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT +++RKAYGALKD T VGLA VNS+FKD+D+AIVKATNHVECPPKERH+RKI   TS
Sbjct  1    MGTFESFRKAYGALKDSTMVGLAKVNSEFKDLDIAIVKATNHVECPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             VRPR+DVAYCIHALARRLAKT NW VALKTLIVIHRTLREGDPTFREELLN+  RG VL
Sbjct  61   VVRPRSDVAYCIHALARRLAKTKNWIVALKTLIVIHRTLREGDPTFREELLNYSNRGHVL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFRVLKYDIE+ERL K  +QG  K +S+
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECFRVLKYDIESERLTK-SSQGATKTHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L SE+LLDQLPALQQLLYRLI C PEGAA GNY+IQYALALVLKESFKIYCAINDGI
Sbjct  180  TRHLASEDLLDQLPALQQLLYRLICCLPEGAAFGNYLIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+MPR
Sbjct  240  INLVDMFFDMPR  251



>ref|NP_001043956.1| Os01g0694900 [Oryza sativa Japonica Group]
 dbj|BAD81807.1| clathrin assembly protein AP180 short form-like [Oryza sativa 
Japonica Group]
 dbj|BAF05870.1| Os01g0694900 [Oryza sativa Japonica Group]
 dbj|BAG88648.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55230.1| hypothetical protein OsJ_03107 [Oryza sativa Japonica Group]
Length=568

 Score =   411 bits (1057),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 207/252 (82%), Positives = 225/252 (89%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M  LQ+WRKAYGALKD T V LA++NSDFKD+DVAIVKATNHVECPPKERHLRKI   TS
Sbjct  1    MSALQSWRKAYGALKDTTTVSLANLNSDFKDLDVAIVKATNHVECPPKERHLRKIAAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALARRLAKT NW VALKTL+VIHR LR+GDPTFREE L F QR R+L
Sbjct  61   IGRPRADVAYCIHALARRLAKTRNWIVALKTLVVIHRLLRDGDPTFREEFLTFTQRVRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDS+P+AWD S+WVRTY LFLEERLECFRVLKYDIEAERL K   QG EKG+S+
Sbjct  121  QLSNFKDDSTPVAWDYSSWVRTYGLFLEERLECFRVLKYDIEAERLSK-QGQGPEKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+S +LL+QLPALQQLLYRLIGCRPEGAA  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSPDLLEQLPALQQLLYRLIGCRPEGAANSNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_008781765.1| PREDICTED: putative clathrin assembly protein At5g57200 [Phoenix 
dactylifera]
Length=565

 Score =   411 bits (1056),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 202/252 (80%), Positives = 227/252 (90%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGA+KD TKVGLA VNS+FKD+D+AIVKATNHVECPPKERH+RKI   TS
Sbjct  1    MGTLQTWRKAYGAIKDSTKVGLAKVNSEFKDLDIAIVKATNHVECPPKERHVRKIFAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            AVRPR D+AYCI+ALARRL+KT NWTVALK LIVIHR LREGDPTFREE+LN+  RG +L
Sbjct  61   AVRPRGDIAYCIYALARRLSKTRNWTVALKALIVIHRILREGDPTFREEMLNYSHRGNIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFRVLKYDIE+ERL + P QG  KG+S+
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECFRVLKYDIESERLMRSP-QGAPKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L   +LL+QLPALQ+LL+RL+ C+PEGAA GNY+IQYALALVLKESFKIYCAINDGI
Sbjct  180  TRTLGCVDLLEQLPALQKLLFRLVSCQPEGAACGNYLIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FFEM +
Sbjct  240  INLVDMFFEMSK  251



>ref|XP_003567959.1| PREDICTED: putative clathrin assembly protein At2g01600 [Brachypodium 
distachyon]
Length=567

 Score =   410 bits (1055),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 202/252 (80%), Positives = 227/252 (90%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M ++Q+WRKAYGA+KD T V LA++NSDFKD+DVAIVKATNHVECPPKERHLRKI   TS
Sbjct  1    MASMQSWRKAYGAIKDTTTVSLANLNSDFKDLDVAIVKATNHVECPPKERHLRKIAAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRAD+AYCIHAL+RRL KT NW VALKTL+V+HR +REGDPTFREELLNF QRGR+L
Sbjct  61   IARPRADIAYCIHALSRRLNKTRNWIVALKTLVVVHRLIREGDPTFREELLNFTQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+A DCSAWVRTY  FLEERLECFRVLKYD+EAERL K   QG EKG+S+
Sbjct  121  QLSNFKDDSSPVALDCSAWVRTYGQFLEERLECFRVLKYDVEAERLSK-QGQGPEKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TRELN+++LL+QLPALQQLLYRL+GCRPEGAA  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRELNTQDLLEQLPALQQLLYRLVGCRPEGAANNNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEM R
Sbjct  240  INLVDKFFEMAR  251



>ref|XP_010459008.1| PREDICTED: putative clathrin assembly protein At1g14910 [Camelina 
sativa]
Length=454

 Score =   407 bits (1045),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 201/252 (80%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQ+WR+AYGALKD TKVGL  VNSD+ ++DVAIVKATNHVECPPK+RHL+KI + TS
Sbjct  1    MATLQSWRRAYGALKDTTKVGLVRVNSDYAELDVAIVKATNHVECPPKDRHLKKIFLATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            AVRPRADVAYCIHAL+RRL KT NWTVALK L+V+HR LR+GDPTFREELLNF Q+GR++
Sbjct  61   AVRPRADVAYCIHALSRRLHKTRNWTVALKALLVLHRLLRDGDPTFREELLNFSQKGRIM  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKD+SSP AWDCS WVR YALFLEERLECFRVLKYD+EAERLPK  + GQEKGYSK
Sbjct  121  QISNFKDESSPTAWDCSGWVRAYALFLEERLECFRVLKYDMEAERLPK-VSPGQEKGYSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ E+LL+QLPALQQLL+RLIGC+PEGAA  N +IQYALALVLKESFK+YCAIN+GI
Sbjct  180  TRDLDGEKLLEQLPALQQLLHRLIGCKPEGAAKHNRIIQYALALVLKESFKVYCAINEGI  239

Query  940  INLVDKFFEMPR  975
            INLV+KFFEMPR
Sbjct  240  INLVEKFFEMPR  251



>ref|XP_006306843.1| hypothetical protein CARUB_v10008396mg [Capsella rubella]
 gb|EOA39741.1| hypothetical protein CARUB_v10008396mg [Capsella rubella]
Length=742

 Score =   416 bits (1069),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 206/252 (82%), Positives = 233/252 (92%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WR+AYGALKD TKVGL  VNSD+ ++DVAIVKATNHVECPPK+RHLRKI + TS
Sbjct  1    MGTLQSWRRAYGALKDTTKVGLVRVNSDYAELDVAIVKATNHVECPPKDRHLRKIFLATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            AVRPRADVAYCIHAL+RRL KT NWTVALK L+V+HR LR+GDPTFREELLNF Q+GR++
Sbjct  61   AVRPRADVAYCIHALSRRLHKTRNWTVALKALLVLHRLLRDGDPTFREELLNFNQKGRIM  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKD+SSPIAWDCS WVRTYALFLEERLECFRVLKYDIEAERLPK  + GQEKGYSK
Sbjct  121  QISNFKDESSPIAWDCSGWVRTYALFLEERLECFRVLKYDIEAERLPK-VSPGQEKGYSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ E+LL+QLPALQQLL RLIGC+PEGAA  N++IQYALALVLKESFK+YCAIN+GI
Sbjct  180  TRDLDGEKLLEQLPALQQLLQRLIGCKPEGAAKHNHIIQYALALVLKESFKVYCAINEGI  239

Query  940  INLVDKFFEMPR  975
            INLV+KFFEMPR
Sbjct  240  INLVEKFFEMPR  251



>gb|KFK33381.1| hypothetical protein AALP_AA5G005800 [Arabis alpina]
Length=572

 Score =   410 bits (1055),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 210/252 (83%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WRKAYGALKD TKVGL  VNSD+ D+DVAIVKATNHVECPPK+RHLRKI   T+
Sbjct  1    MGTLQSWRKAYGALKDTTKVGLVRVNSDYADLDVAIVKATNHVECPPKDRHLRKIFAATA  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              R RADVAYCIHAL+RRL KT NWTVALKTLIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   VTRARADVAYCIHALSRRLHKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYD EAERLPK    GQ+KGYS+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDTEAERLPK-STPGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ EELL+QLPALQ+LL RLIGC PEGAA  N+VIQYALALVLKESFK+YCAINDGI
Sbjct  180  TRDLDGEELLEQLPALQKLLSRLIGCMPEGAANHNHVIQYALALVLKESFKVYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INL+DKFFEMP+
Sbjct  240  INLIDKFFEMPK  251



>ref|XP_004969636.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Setaria italica]
Length=565

 Score =   409 bits (1050),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 225/252 (89%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M  LQ+WRKAYGALKD T V LA+++SDFKD+DVAIV+ATNHVE PPKERHLRKI+  TS
Sbjct  1    MSALQSWRKAYGALKDSTTVSLANLSSDFKDLDVAIVRATNHVETPPKERHLRKIVAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALARRLAKT NW VALKTL+VIHR LREGDPTFREE L F QR R+L
Sbjct  61   LARPRADVAYCIHALARRLAKTRNWIVALKTLVVIHRLLREGDPTFREEFLAFTQRVRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWD S+WVRTY LFLEE+LECFRVLKYDIEAER  K   QG EKG+S+
Sbjct  121  QLSNFKDDSSPIAWDYSSWVRTYGLFLEEKLECFRVLKYDIEAERSSK-QGQGPEKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TRELNS++LL+QLPALQQLLYRLIGCRPEGAA  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRELNSQDLLEQLPALQQLLYRLIGCRPEGAANNNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMP+
Sbjct  240  INLVDKFFEMPK  251



>ref|XP_011648957.1| PREDICTED: putative clathrin assembly protein At5g57200 [Cucumis 
sativus]
 gb|KGN61174.1| hypothetical protein Csa_2G061530 [Cucumis sativus]
Length=596

 Score =   409 bits (1052),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT Q++RKAYGALKD TKVGLA VNS+FKD+D+AIVKATNHVECPPKERH+RKI   TS
Sbjct  1    MGTFQSFRKAYGALKDSTKVGLAKVNSEFKDLDIAIVKATNHVECPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             VRPRADVAYCIHALA+RL+KT NW VALKTLIV+HRTLREGDPTFREELLN+  RG +L
Sbjct  61   VVRPRADVAYCIHALAKRLSKTRNWIVALKTLIVVHRTLREGDPTFREELLNYSHRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLEC+R+LKYDIE+ERL K  + G  K +S+
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECYRILKYDIESERLTK-TSPGSTKVHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR LNS+ELL+QLPALQQLLYRL+GC+PEG A  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  180  TRLLNSDELLEQLPALQQLLYRLMGCQPEGGAYSNYLIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+MPR
Sbjct  240  INLVDMFFDMPR  251



>ref|XP_006416959.1| hypothetical protein EUTSA_v10007171mg [Eutrema salsugineum]
 gb|ESQ35312.1| hypothetical protein EUTSA_v10007171mg [Eutrema salsugineum]
Length=586

 Score =   409 bits (1051),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 204/252 (81%), Positives = 227/252 (90%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWR+AYGALKD TKVGL  VNSD+ D+DVAIVKATNHVECPPK+RHLRKI V TS
Sbjct  1    MGTLQTWRRAYGALKDTTKVGLVRVNSDYADIDVAIVKATNHVECPPKDRHLRKIFVATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A RPRADVAYCIH L+RRL KT NWTVALK L+V+HR LREGDPTFREEL NF Q+GR L
Sbjct  61   ATRPRADVAYCIHKLSRRLHKTRNWTVALKGLLVLHRLLREGDPTFREELSNFSQKGRFL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSS IAWDCSAWVR YALFLEERL+CFRVLKYD EAERLPK  + GQEKGYS+
Sbjct  121  QLSNFKDDSSTIAWDCSAWVRAYALFLEERLQCFRVLKYDTEAERLPK-LSPGQEKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR ++ E+LL+QLPALQQLL+RLIGC+PEGAA  N++IQYALALVLKESFK+YCAIN+GI
Sbjct  180  TRGIDGEKLLEQLPALQQLLHRLIGCKPEGAANHNHIIQYALALVLKESFKVYCAINEGI  239

Query  940  INLVDKFFEMPR  975
            INLV+KFFEMPR
Sbjct  240  INLVEKFFEMPR  251



>ref|XP_010273537.1| PREDICTED: putative clathrin assembly protein At5g57200 [Nelumbo 
nucifera]
Length=581

 Score =   408 bits (1049),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 204/252 (81%), Positives = 227/252 (90%), Gaps = 0/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT+Q+ RKAYGALKD TKVGLA VNS+FKD+D+AIVKATNHVECPPKERH+RKI   TS
Sbjct  1    MGTMQSLRKAYGALKDSTKVGLAKVNSEFKDLDIAIVKATNHVECPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             VRPRADVAYCIHALARRLAKTHNW VALKTLIVIHRTLREGDPTFREELLN+  RG +L
Sbjct  61   IVRPRADVAYCIHALARRLAKTHNWIVALKTLIVIHRTLREGDPTFREELLNYSHRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFRVLKYDIE+ERL K      ++G+S+
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECFRVLKYDIESERLTKSSQGIIKQGHSR  180

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L S++LL+QLPALQQLLYRL+GC+PEG A  NY++QYALALVLKESFKIYCAINDGI
Sbjct  181  TRLLGSDDLLEQLPALQQLLYRLVGCQPEGLAYNNYLVQYALALVLKESFKIYCAINDGI  240

Query  940  INLVDKFFEMPR  975
            INLVD FF+M R
Sbjct  241  INLVDMFFDMTR  252



>ref|XP_008451229.1| PREDICTED: putative clathrin assembly protein At5g57200, partial 
[Cucumis melo]
Length=596

 Score =   408 bits (1049),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 202/252 (80%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            +GT Q++RKAYGALKD TKVGLA VNS+FKD+D+AIVKATNHVECPPKERH+RKI   TS
Sbjct  5    LGTFQSFRKAYGALKDSTKVGLAKVNSEFKDLDIAIVKATNHVECPPKERHVRKIFSATS  64

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             VRPRADVAYCIHALA+RL+KT NW VALKTLIV+HRTLREGDPTFREELLN+  RG +L
Sbjct  65   VVRPRADVAYCIHALAKRLSKTRNWIVALKTLIVVHRTLREGDPTFREELLNYSHRGHIL  124

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLEC+R+LKYDIE+ERL K  + G  K +S+
Sbjct  125  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECYRILKYDIESERLTK-TSPGSTKVHSR  183

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR LNS+ELL+QLPALQQLLYRL+GC+PEG A  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  184  TRLLNSDELLEQLPALQQLLYRLMGCQPEGGAYSNYLIQYALALVLKESFKIYCAINDGI  243

Query  940  INLVDKFFEMPR  975
            INLVD FF+MPR
Sbjct  244  INLVDMFFDMPR  255



>emb|CDM83847.1| unnamed protein product [Triticum aestivum]
Length=558

 Score =   407 bits (1046),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 201/252 (80%), Positives = 226/252 (90%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M  LQ+WRKAYGALKD T V LA +NSDFKD+DVAIVKATNHVECPPK+RHLRKI+  +S
Sbjct  1    MSALQSWRKAYGALKDTTTVSLASLNSDFKDLDVAIVKATNHVECPPKDRHLRKIVAASS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RP+ADVAYCIHALARRL KT +W VALKTL+VIHR LR+GDPTFREELLNF QR ++L
Sbjct  61   IARPQADVAYCIHALARRLTKTRSWIVALKTLVVIHRLLRDGDPTFREELLNFTQRVQIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKD+SSPIAWD S+WVRTY LFLEERL+CFR+LKYDIEAERLPK   QG EK +S+
Sbjct  121  QLSNFKDNSSPIAWDYSSWVRTYGLFLEERLQCFRILKYDIEAERLPK-QGQGSEKAHSQ  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+S+ LL+Q+PALQQLLYRLIGCRPEGAA  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSQALLEQMPALQQLLYRLIGCRPEGAANTNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_002456192.1| hypothetical protein SORBIDRAFT_03g031930 [Sorghum bicolor]
 gb|EES01312.1| hypothetical protein SORBIDRAFT_03g031930 [Sorghum bicolor]
Length=563

 Score =   407 bits (1046),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 204/252 (81%), Positives = 224/252 (89%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M  LQ+WRKAYGALKD T V LA++NSDFKD+DVAIV+ATNHVE PPKERHLRKI+  TS
Sbjct  1    MAALQSWRKAYGALKDTTTVSLANLNSDFKDLDVAIVRATNHVESPPKERHLRKIVAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALARRLAKT NW VALKTL+VIHR LREGDP FREE L F QR ++L
Sbjct  61   IARPRADVAYCIHALARRLAKTRNWIVALKTLVVIHRLLREGDPAFREEFLTFTQRVQIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCS+WVRTY LFLEE+LECFRVLKYDIEAERL K   QG EKG+S+
Sbjct  121  QLSNFKDDSSPIAWDCSSWVRTYGLFLEEKLECFRVLKYDIEAERLSK-QGQGPEKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TRELNS++LL+QLPALQQLLYRLIGCR EGAA  NY++QYALA VLKESFKIYCAINDGI
Sbjct  180  TRELNSQDLLEQLPALQQLLYRLIGCRAEGAANNNYLVQYALAQVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMP+
Sbjct  240  INLVDKFFEMPK  251



>dbj|BAK06048.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=564

 Score =   407 bits (1046),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 201/252 (80%), Positives = 226/252 (90%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M  LQ+WRKAYGALKD T V LA +NSDFKD+DVAIVKATNHVECPPK+RHLRKI+  +S
Sbjct  1    MSALQSWRKAYGALKDTTTVSLASLNSDFKDLDVAIVKATNHVECPPKDRHLRKIVAASS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RP+ADVAYCIHALARRL KT +W VALKTL+VIHR LR+GDPTFREELLNF QR ++L
Sbjct  61   IARPQADVAYCIHALARRLTKTRSWIVALKTLVVIHRLLRDGDPTFREELLNFTQRVQIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKD+SSPIAWD S+WVRTY LFLEERL+CFR+LKYDIEAERLPK   QG EK +S+
Sbjct  121  QLSNFKDNSSPIAWDYSSWVRTYGLFLEERLQCFRILKYDIEAERLPK-QGQGPEKAHSQ  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL+S+ LL+Q+PALQQLLYRLIGCRPEGAA  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRELDSQALLEQMPALQQLLYRLIGCRPEGAANNNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVDKFFEMPR
Sbjct  240  INLVDKFFEMPR  251



>ref|XP_010476568.1| PREDICTED: putative clathrin assembly protein At1g14910 [Camelina 
sativa]
Length=707

 Score =   410 bits (1054),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 201/252 (80%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQ+WR+AYGALKD TKVGL  VNSD+ ++DVAIVKATNHVECPPK+RHL+KI + TS
Sbjct  1    MATLQSWRRAYGALKDTTKVGLVRVNSDYAELDVAIVKATNHVECPPKDRHLKKIFLATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            AVRPRADVAYCIHAL+RRL KT NWTVALK L+V+HR LR+GDPTFREELLNF Q+GR++
Sbjct  61   AVRPRADVAYCIHALSRRLHKTRNWTVALKALLVLHRLLRDGDPTFREELLNFSQKGRIM  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKD+SSP AWDCS WVR YALFLEERLECFRVLKYD+EAERLPK  + GQEKGYSK
Sbjct  121  QISNFKDESSPTAWDCSGWVRAYALFLEERLECFRVLKYDMEAERLPK-VSPGQEKGYSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ E+LL+QLPALQQLL+RLIGC+PEGAA  N +IQYALALVLKESFK+YCAIN+GI
Sbjct  180  TRDLDGEKLLEQLPALQQLLHRLIGCKPEGAAKHNRIIQYALALVLKESFKVYCAINEGI  239

Query  940  INLVDKFFEMPR  975
            INLV+KFFEMPR
Sbjct  240  INLVEKFFEMPR  251



>ref|XP_010496638.1| PREDICTED: putative clathrin assembly protein At1g14910 [Camelina 
sativa]
Length=720

 Score =   410 bits (1055),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 201/252 (80%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQ+WR+AYGALKD TKVGL  VNSD+ ++DVAIVKATNHVECPPK+RHL+KI + TS
Sbjct  1    MATLQSWRRAYGALKDTTKVGLVRVNSDYAELDVAIVKATNHVECPPKDRHLKKIFLATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            AVRPRADVAYCIHAL+RRL KT NWTVALK L+V+HR LR+GDPTFREELLNF Q+GR++
Sbjct  61   AVRPRADVAYCIHALSRRLHKTRNWTVALKALLVLHRLLRDGDPTFREELLNFSQKGRIM  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKD+SSP AWDCS WVR YALFLEERLECFRVLKYD+EAERLPK  + GQEKGYSK
Sbjct  121  QISNFKDESSPTAWDCSGWVRAYALFLEERLECFRVLKYDMEAERLPK-VSPGQEKGYSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ E+LL+QLPALQQLL+RLIGC+PEGAA  N +IQYALALVLKESFK+YCAIN+GI
Sbjct  180  TRDLDGEKLLEQLPALQQLLHRLIGCKPEGAAKHNRIIQYALALVLKESFKVYCAINEGI  239

Query  940  INLVDKFFEMPR  975
            INLV+KFFEMPR
Sbjct  240  INLVEKFFEMPR  251



>ref|XP_010459007.1| PREDICTED: putative clathrin assembly protein At1g14910 [Camelina 
sativa]
Length=721

 Score =   410 bits (1054),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 201/252 (80%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M TLQ+WR+AYGALKD TKVGL  VNSD+ ++DVAIVKATNHVECPPK+RHL+KI + TS
Sbjct  1    MATLQSWRRAYGALKDTTKVGLVRVNSDYAELDVAIVKATNHVECPPKDRHLKKIFLATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            AVRPRADVAYCIHAL+RRL KT NWTVALK L+V+HR LR+GDPTFREELLNF Q+GR++
Sbjct  61   AVRPRADVAYCIHALSRRLHKTRNWTVALKALLVLHRLLRDGDPTFREELLNFSQKGRIM  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKD+SSP AWDCS WVR YALFLEERLECFRVLKYD+EAERLPK  + GQEKGYSK
Sbjct  121  QISNFKDESSPTAWDCSGWVRAYALFLEERLECFRVLKYDMEAERLPK-VSPGQEKGYSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ E+LL+QLPALQQLL+RLIGC+PEGAA  N +IQYALALVLKESFK+YCAIN+GI
Sbjct  180  TRDLDGEKLLEQLPALQQLLHRLIGCKPEGAAKHNRIIQYALALVLKESFKVYCAINEGI  239

Query  940  INLVDKFFEMPR  975
            INLV+KFFEMPR
Sbjct  240  INLVEKFFEMPR  251



>emb|CDY17459.1| BnaC09g20780D [Brassica napus]
Length=570

 Score =   404 bits (1039),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 208/252 (83%), Positives = 225/252 (89%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WRKAYGALKD TKVGL  VNSD+ D+DVAIVKATNHVECPPK+RHLRKI   T+
Sbjct  1    MGTLQSWRKAYGALKDTTKVGLVRVNSDYADLDVAIVKATNHVECPPKDRHLRKIFAATA  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              R RADVAYCIHAL RRL KT NWTVALKTLIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   VTRARADVAYCIHALTRRLHKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDS PIAWDCSAWVRTYALFLEERLECFRVL+YD EAE L K    GQ+KGYS+
Sbjct  121  QISNFKDDSGPIAWDCSAWVRTYALFLEERLECFRVLRYDTEAEPLTK-ATPGQDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ EELL QLPALQQLLYRLIGC+PEGAA  N+VIQYALALVLKESFK+YCAINDGI
Sbjct  180  TRDLDGEELLLQLPALQQLLYRLIGCKPEGAANHNHVIQYALALVLKESFKVYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INL+DKFFEMP+
Sbjct  240  INLIDKFFEMPK  251



>ref|XP_010424932.1| PREDICTED: putative clathrin assembly protein At2g01600 [Camelina 
sativa]
Length=576

 Score =   404 bits (1038),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 207/255 (81%), Positives = 225/255 (88%), Gaps = 4/255 (2%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WRKAYGALKD TKVGL  VNSD+ ++DVAIVKATNHVECPPK+RHLRKI   TS
Sbjct  1    MGTLQSWRKAYGALKDSTKVGLVRVNSDYAELDVAIVKATNHVECPPKDRHLRKIFAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              R RADVAYCIHAL+RRL KT NWTVALKTLIVIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   VTRARADVAYCIHALSRRLHKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGRIL  120

Query  580  QMSNFKDDSSPIA---WDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKG  750
            Q+SNFKDDSSPI    +  SA  RTYALFLEERLECFRVLKYD EAERLPK    GQ+KG
Sbjct  121  QLSNFKDDSSPIGKLKFSVSAXXRTYALFLEERLECFRVLKYDTEAERLPK-STPGQDKG  179

Query  751  YSKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAIN  930
            YS+TR+L+ EELL+QLPALQQLLYRLIGCRPEGAA  N+VIQYALALVLKESFK+YCAIN
Sbjct  180  YSRTRDLDGEELLEQLPALQQLLYRLIGCRPEGAANHNHVIQYALALVLKESFKVYCAIN  239

Query  931  DGIINLVDKFFEMPR  975
            DGIINL+DKFFEMP+
Sbjct  240  DGIINLIDKFFEMPK  254



>ref|XP_010050955.1| PREDICTED: putative clathrin assembly protein At5g57200 [Eucalyptus 
grandis]
 gb|KCW80963.1| hypothetical protein EUGRSUZ_C02326 [Eucalyptus grandis]
Length=590

 Score =   403 bits (1035),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 202/252 (80%), Positives = 225/252 (89%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT +++RKAYGALKD TKVGLA VNS+FKD+D+AIVKATNHVECPPKERH+RKI   TS
Sbjct  1    MGTFESFRKAYGALKDSTKVGLAKVNSEFKDLDIAIVKATNHVECPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             VRPRADVAYCIHAL++RL+KT NW VALKTLIVIHRTLREGDPTFREELLN+  RG++L
Sbjct  61   VVRPRADVAYCIHALSKRLSKTRNWIVALKTLIVIHRTLREGDPTFREELLNYSHRGQIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+S FKDDSSP+AWDCSAWVRTYALFLEERLECFR+LKYDIE ERL K  + G  K +S+
Sbjct  121  QISYFKDDSSPLAWDCSAWVRTYALFLEERLECFRILKYDIETERLTK-SSPGSTKAHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR LN EELL+QLPALQQLLYRLIGC PEG+A  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  180  TRLLNGEELLEQLPALQQLLYRLIGCHPEGSAYCNYLIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+M R
Sbjct  240  INLVDMFFDMSR  251



>ref|XP_009114226.1| PREDICTED: putative clathrin assembly protein At2g01600 [Brassica 
rapa]
 emb|CDY04095.1| BnaA09g18730D [Brassica napus]
Length=571

 Score =   402 bits (1033),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 207/252 (82%), Positives = 224/252 (89%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGL  VNSD+ D+DVAIVKATNHVECPPK+RHLRKI   T+
Sbjct  1    MGTLQTWRKAYGALKDTTKVGLVRVNSDYADLDVAIVKATNHVECPPKDRHLRKIFAATA  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              R RADVAYCIHAL+RRL KT NWTVALKTLIVIHR LREGDPTFREELLNF QR R+L
Sbjct  61   VTRARADVAYCIHALSRRLHKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRVRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDS PIAWDCSAWVRTYALFLEERLECFRVL+YD EAE L K    G +KGYS+
Sbjct  121  QISNFKDDSGPIAWDCSAWVRTYALFLEERLECFRVLRYDTEAEPLTK-ATPGHDKGYSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ EE+L QLPALQQLLYRLIGCRPEGAA  N+VIQYALALVLKESFK+YCAINDGI
Sbjct  180  TRDLDGEEILLQLPALQQLLYRLIGCRPEGAANHNHVIQYALALVLKESFKVYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INL+DKFFEMP+
Sbjct  240  INLIDKFFEMPK  251



>ref|XP_003569612.1| PREDICTED: putative clathrin assembly protein At2g01600 [Brachypodium 
distachyon]
Length=567

 Score =   401 bits (1031),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 202/254 (80%), Positives = 225/254 (89%), Gaps = 5/254 (2%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M  L +WR+AYGALKD T VGLA++NSDFKD+DVAIVKATNHVECPPK+RHLRKI+   S
Sbjct  1    MSALPSWRRAYGALKDTTTVGLANLNSDFKDLDVAIVKATNHVECPPKDRHLRKIVAAAS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALARRL KT NW VALKTL+VIHR LR+GDP FR+ELLNF QR ++L
Sbjct  61   ISRPRADVAYCIHALARRLTKTRNWIVALKTLVVIHRLLRDGDPIFRDELLNFTQRVQIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQ--EKGY  753
            Q+SNFKDDSSPIAWD S+WVRTY LFLEERL+CFRVLKYD EAERL K   QGQ  EKG+
Sbjct  121  QLSNFKDDSSPIAWDYSSWVRTYGLFLEERLQCFRVLKYDAEAERLSK---QGQEAEKGH  177

Query  754  SKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAIND  933
            S+TREL+S++LL+QLPALQQLLYRL GCRPEGAA  NY++QYALALVLKESFKIYCAIND
Sbjct  178  SRTRELDSQDLLEQLPALQQLLYRLTGCRPEGAASSNYLVQYALALVLKESFKIYCAIND  237

Query  934  GIINLVDKFFEMPR  975
            GIINLVDKFFEMPR
Sbjct  238  GIINLVDKFFEMPR  251



>ref|XP_006453261.1| hypothetical protein CICLE_v10010653mg [Citrus clementina]
 ref|XP_006474644.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Citrus sinensis]
 gb|ESR66501.1| hypothetical protein CICLE_v10010653mg [Citrus clementina]
Length=590

 Score =   401 bits (1030),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 199/252 (79%), Positives = 226/252 (90%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT Q++RKAYGALKD TKVGLA VNS+FKD+D+AIVKATNHVECPPKERH+RK+   TS
Sbjct  1    MGTFQSFRKAYGALKDSTKVGLAKVNSEFKDLDIAIVKATNHVECPPKERHVRKLFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             +RPRADVAYCIHALA+RL+KT NW VA+KTLIVIHRTLREGDPTFREELLN+  RG +L
Sbjct  61   VIRPRADVAYCIHALAKRLSKTRNWIVAIKTLIVIHRTLREGDPTFREELLNYSHRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFR+L+YDIE+ERL K  + G  K +S+
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECFRILRYDIESERLTK-SSPGATKVHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR LN +ELL+QLPALQQLL+RLIGC PEGAA  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRLLNCDELLEQLPALQQLLFRLIGCSPEGAAYHNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+M R
Sbjct  240  INLVDMFFDMSR  251



>ref|XP_008811452.1| PREDICTED: putative clathrin assembly protein At5g57200 [Phoenix 
dactylifera]
Length=559

 Score =   400 bits (1027),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 198/252 (79%), Positives = 224/252 (89%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT Q+WR+AYGALKD TKVGLA VNS+FK++D+A+VKATNHVECPPKERH+RKI V T+
Sbjct  1    MGTFQSWRQAYGALKDTTKVGLAKVNSEFKELDIAVVKATNHVECPPKERHVRKIFVATA  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPR DVAYC+H LARRLAKT NW VALKTLIVIHR LREGDPTFRE+LLN+ +RG VL
Sbjct  61   VDRPRTDVAYCVHILARRLAKTRNWVVALKTLIVIHRALREGDPTFREDLLNYSRRGNVL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNFKDDSS +AWDCSAWVRTYALFLEERLECFR+LKYDIEAERL K  + G  KG S+
Sbjct  121  RISNFKDDSSSLAWDCSAWVRTYALFLEERLECFRILKYDIEAERLRK-VSDGAAKGQSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            T+ L  ++LLDQLPALQ LLYRL+GC+PEGAA+GNY+IQYALALVLKESFKIYCAINDGI
Sbjct  180  TKNLGCQDLLDQLPALQNLLYRLVGCQPEGAAIGNYLIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FFEM R
Sbjct  240  INLVDLFFEMSR  251



>emb|CDY53525.1| BnaC05g11150D [Brassica napus]
Length=697

 Score =   404 bits (1038),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 198/252 (79%), Positives = 227/252 (90%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ++R+AYGALKD TKVGL  VNSD+ D++VAIVKATNHVECPPK+RHL KI + TS
Sbjct  1    MGTLQSFRRAYGALKDTTKVGLVRVNSDYADIEVAIVKATNHVECPPKDRHLTKIFIATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A RPRADVAYCIH L+RRL KT NWTVALK L+V+HR +REGDPTFREELLNF ++GR L
Sbjct  61   ATRPRADVAYCIHTLSRRLHKTRNWTVALKALVVLHRLVREGDPTFREELLNFSRKGRFL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSS  AWDCS WVR YALFLEERL+CFRVLKYDIEAERLPK  + GQEKGYSK
Sbjct  121  QLSNFKDDSSTAAWDCSVWVRAYALFLEERLQCFRVLKYDIEAERLPK-VSPGQEKGYSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ E+LL+QLPALQQLL+RL+GC+PEGAA  N++IQYALALVLKESFK+YCAIN+GI
Sbjct  180  TRDLDGEQLLEQLPALQQLLHRLMGCKPEGAAKHNHIIQYALALVLKESFKVYCAINEGI  239

Query  940  INLVDKFFEMPR  975
            INLV+KFFEMPR
Sbjct  240  INLVEKFFEMPR  251



>gb|KDO61895.1| hypothetical protein CISIN_1g040258mg [Citrus sinensis]
Length=590

 Score =   400 bits (1028),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 199/252 (79%), Positives = 226/252 (90%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT Q++RKAYGALKD TKVGLA VNS+FKD+D+AIVKATNHVECPPKERH+RK+   TS
Sbjct  1    MGTFQSFRKAYGALKDSTKVGLAKVNSEFKDLDIAIVKATNHVECPPKERHVRKLFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             +RPRADVAYCIHALA+RL+KT NW VA+KTLIVIHRTLREGDPTFREELLN+  RG +L
Sbjct  61   VIRPRADVAYCIHALAKRLSKTRNWIVAIKTLIVIHRTLREGDPTFREELLNYSHRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFR+L+YDIE+ERL K  + G  K +S+
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECFRILRYDIESERLTK-SSPGATKVHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR LN +ELL+QLPALQQLL+RLIGC PEGAA  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRLLNCDELLEQLPALQQLLFRLIGCSPEGAAYHNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+M R
Sbjct  240  INLVDMFFDMSR  251



>ref|XP_009408060.1| PREDICTED: putative clathrin assembly protein At5g57200 [Musa 
acuminata subsp. malaccensis]
Length=570

 Score =   398 bits (1023),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 199/249 (80%), Positives = 224/249 (90%), Gaps = 1/249 (0%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            + TWRKAYGALKD TKVGLA VNS+FKD+DVAIVKATNHVECPPKERH+RKI   T+A R
Sbjct  1    MGTWRKAYGALKDSTKVGLAKVNSEFKDLDVAIVKATNHVECPPKERHVRKIFAATAASR  60

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRADVAYCI+AL RRL+KT NWTVALKTLIV+HRTLREGDPTFREELL++ +RG VLQ+S
Sbjct  61   PRADVAYCIYALGRRLSKTRNWTVALKTLIVMHRTLREGDPTFREELLSYSRRGSVLQIS  120

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKDDS P+AWDCSAWVRTYAL+LEERLECFR+LKYDIEAERL K P Q   KG+S+TR 
Sbjct  121  NFKDDSGPLAWDCSAWVRTYALYLEERLECFRILKYDIEAERLMKSP-QHSAKGHSRTRS  179

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            L   +LL+QLPALQQLL+RLIGC+PEGAA GN+++QYALALVLKESFKIYCAINDGIINL
Sbjct  180  LCCPDLLEQLPALQQLLFRLIGCQPEGAAFGNFLVQYALALVLKESFKIYCAINDGIINL  239

Query  949  VDKFFEMPR  975
            VD FFEM +
Sbjct  240  VDMFFEMSK  248



>ref|XP_007014413.1| ENTH/ANTH/VHS superfamily protein [Theobroma cacao]
 gb|EOY32032.1| ENTH/ANTH/VHS superfamily protein [Theobroma cacao]
Length=572

 Score =   398 bits (1023),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 201/252 (80%), Positives = 223/252 (88%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT +++RKAY ALKD TKVGLA VNS+FKD+D+AIVKATNHVECPPKERH+RKI   TS
Sbjct  1    MGTFKSFRKAYEALKDSTKVGLAKVNSEFKDLDIAIVKATNHVECPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             VRPRADVAYCIHALA+RL+KT +W VA+K LIVIHRTLREGDPTFREELLN+  RG +L
Sbjct  61   VVRPRADVAYCIHALAKRLSKTRSWIVAIKILIVIHRTLREGDPTFREELLNYSHRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFRVLKYDIEAERL K  + G  K +S+
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLTK-SSPGTSKAHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L S ELLDQLPALQQLLYRL+GC PEGAA  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRLLASNELLDQLPALQQLLYRLVGCEPEGAAYSNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+M R
Sbjct  240  INLVDMFFDMSR  251



>emb|CDY45299.1| BnaA06g09690D [Brassica napus]
Length=688

 Score =   402 bits (1033),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 197/252 (78%), Positives = 227/252 (90%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ++R+AYGALKD TKVGL  VNSD+ D++VAIVKATNHVECPPK+RHL KI + TS
Sbjct  1    MGTLQSFRRAYGALKDTTKVGLVRVNSDYADIEVAIVKATNHVECPPKDRHLTKIFIATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A RPRADVAYCIH L+RR+ KT NWTVALK L+V+HR +REGDPTFREELLNF ++GR L
Sbjct  61   ATRPRADVAYCIHTLSRRVHKTRNWTVALKALLVLHRLVREGDPTFREELLNFSRKGRFL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSS  AWDCS WVR YALFLEERL+CFRVLKYDIEAERLPK  + GQEKGYSK
Sbjct  121  QLSNFKDDSSTAAWDCSVWVRAYALFLEERLQCFRVLKYDIEAERLPK-VSPGQEKGYSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ E+LL+QLPALQQLL+RL+GC+PEGAA  N++IQYALALVLKESFK+YCAIN+GI
Sbjct  180  TRDLDGEQLLEQLPALQQLLHRLMGCKPEGAAKHNHIIQYALALVLKESFKVYCAINEGI  239

Query  940  INLVDKFFEMPR  975
            INLV+KFFEMPR
Sbjct  240  INLVEKFFEMPR  251



>ref|XP_002324695.1| clathrin assembly family protein [Populus trichocarpa]
 gb|EEF03260.1| clathrin assembly family protein [Populus trichocarpa]
Length=580

 Score =   397 bits (1020),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 224/252 (89%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  + RKAYGALKD TKVGLA VNS++K++D+AIVKATNHVECPPKERH+RKI   TS
Sbjct  1    MGTFTSLRKAYGALKDTTKVGLAKVNSEYKELDIAIVKATNHVECPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHALARRLAKT NW VA+KTLIVIHRTLREGDPTFREELLN+  RG +L
Sbjct  61   AMRPRADVAYCIHALARRLAKTRNWIVAIKTLIVIHRTLREGDPTFREELLNYLYRGNIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECF+ LK+DIEAERL K  + G  K +SK
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECFKTLKFDIEAERLTK-TSPGATKVHSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR LN E+LL+QLPALQQLLYRL+GC+PEG A  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRLLNREDLLEQLPALQQLLYRLVGCQPEGGAYTNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FFEM +
Sbjct  240  INLVDMFFEMSK  251



>ref|XP_008223882.1| PREDICTED: putative clathrin assembly protein At5g57200 [Prunus 
mume]
Length=581

 Score =   397 bits (1020),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 198/252 (79%), Positives = 224/252 (89%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT Q++RKAYGALKD TKVGL  VNS+FKD+D+A VKAT+HVECPPKERH+RKI   TS
Sbjct  1    MGTFQSFRKAYGALKDSTKVGLIKVNSEFKDLDIATVKATSHVECPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALA+RL+KT +W VA+KTLIVIHRTLREGDPTFREELLN+ QRG +L
Sbjct  61   VTRPRADVAYCIHALAKRLSKTRSWIVAIKTLIVIHRTLREGDPTFREELLNYSQRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFRVLKYDIE+ERL K  + G  K +S+
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECFRVLKYDIESERLTK-TSPGSTKVHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L ++ELL+QLPALQQLLYRL+GC+PEG A  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  180  TRTLAADELLEQLPALQQLLYRLMGCQPEGTAFNNYLIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+M R
Sbjct  240  INLVDMFFDMSR  251



>ref|XP_002527806.1| clathrin assembly protein, putative [Ricinus communis]
 gb|EEF34578.1| clathrin assembly protein, putative [Ricinus communis]
Length=566

 Score =   397 bits (1019),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 222/252 (88%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  ++RKAYGALKD TKVGLA VNS+FK++D+AIVKATNHVECPPKERH+RKI   TS
Sbjct  1    MGTFTSFRKAYGALKDTTKVGLAKVNSEFKELDIAIVKATNHVECPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             +RPRADVAYCIHALA+RL+KT NW VA+KTLIVIHRTLREGDPTFREELLN+  RG +L
Sbjct  61   MIRPRADVAYCIHALAKRLSKTRNWIVAIKTLIVIHRTLREGDPTFREELLNYAHRGNIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFRVLKYDIEAERL K       K +S+
Sbjct  121  QISNFKDDSSPMAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLTKSSPMAT-KVHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR LN +ELL+QLPALQQLLYRLIGC PEG A  NY+IQYALAL+LKESFKIYCAINDGI
Sbjct  180  TRLLNRDELLEQLPALQQLLYRLIGCHPEGGAYCNYLIQYALALILKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+M R
Sbjct  240  INLVDMFFDMSR  251



>ref|XP_007222299.1| hypothetical protein PRUPE_ppa003361mg [Prunus persica]
 gb|EMJ23498.1| hypothetical protein PRUPE_ppa003361mg [Prunus persica]
Length=581

 Score =   397 bits (1019),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 197/252 (78%), Positives = 224/252 (89%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT Q++RKAYGALKD TKVGL  VNS+FKD+D+A VKAT+HVECPPKERH+RKI   TS
Sbjct  1    MGTFQSFRKAYGALKDSTKVGLIKVNSEFKDLDIATVKATSHVECPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALA+RL+KT +W VA+KTLIV+HRTLREGDPTFREELLN+ QRG +L
Sbjct  61   VTRPRADVAYCIHALAKRLSKTRSWIVAIKTLIVVHRTLREGDPTFREELLNYSQRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFRVLKYDIE+ERL K  + G  K +S+
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECFRVLKYDIESERLTK-TSPGSTKVHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L ++ELL+QLPALQQLLYRL+GC+PEG A  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  180  TRTLAADELLEQLPALQQLLYRLMGCQPEGTAFNNYLIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+M R
Sbjct  240  INLVDMFFDMSR  251



>ref|XP_011017657.1| PREDICTED: putative clathrin assembly protein At5g57200 [Populus 
euphratica]
Length=580

 Score =   396 bits (1018),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 223/252 (88%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  + RKAYGALKD TKVGLA VNS++K++D+AIVKATNHVECPPKERH+RKI   TS
Sbjct  1    MGTFTSLRKAYGALKDTTKVGLAKVNSEYKELDIAIVKATNHVECPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHALARRLAKT NW VA+KTLIVIHRTLREGDPTFREELLN+  RG +L
Sbjct  61   AMRPRADVAYCIHALARRLAKTRNWIVAIKTLIVIHRTLREGDPTFREELLNYLYRGNIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECF+ L +DIEAERL K  + G  K +SK
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECFKTLNFDIEAERLTK-TSPGATKVHSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR LN E+LL+QLPALQQLLYRLIGC+PEG A  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRLLNREDLLEQLPALQQLLYRLIGCQPEGGAYTNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FFEM +
Sbjct  240  INLVDMFFEMSK  251



>ref|XP_008672590.1| PREDICTED: uncharacterized protein LOC100276465 isoform X2 [Zea 
mays]
 gb|ACN29328.1| unknown [Zea mays]
 tpg|DAA57998.1| TPA: hypothetical protein ZEAMMB73_100643 [Zea mays]
Length=560

 Score =   395 bits (1014),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 197/252 (78%), Positives = 220/252 (87%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M  LQ+WRKAYGALKD T V LA++NSDFKD+DVAIV+ATNHVE PPKERHLRKI+  TS
Sbjct  1    MAALQSWRKAYGALKDTTTVSLANLNSDFKDLDVAIVRATNHVESPPKERHLRKIVAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RP+ADV YCIHALARRLAKT NW VALKTL+VIHR LREGDP FREE L F QR R+L
Sbjct  61   IARPQADVTYCIHALARRLAKTRNWIVALKTLVVIHRLLREGDPAFREEFLTFTQRVRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWD ++WVRTY LFLEE+LECFRVLKYDIEA RL K   QG EKG+S+
Sbjct  121  QLSNFKDDSSPVAWDYASWVRTYGLFLEEKLECFRVLKYDIEAARLSK-QGQGPEKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            T ELNS++LL+QLPALQQLLYRLIGCR EGAA  NY++QYALA VLKESFKIYCAINDGI
Sbjct  180  TTELNSQDLLEQLPALQQLLYRLIGCRAEGAAKNNYLVQYALAQVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INL+DKFFEMP+
Sbjct  240  INLIDKFFEMPK  251



>ref|XP_008672589.1| PREDICTED: uncharacterized protein LOC100276465 isoform X1 [Zea 
mays]
Length=566

 Score =   395 bits (1014),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 197/252 (78%), Positives = 220/252 (87%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M  LQ+WRKAYGALKD T V LA++NSDFKD+DVAIV+ATNHVE PPKERHLRKI+  TS
Sbjct  1    MAALQSWRKAYGALKDTTTVSLANLNSDFKDLDVAIVRATNHVESPPKERHLRKIVAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RP+ADV YCIHALARRLAKT NW VALKTL+VIHR LREGDP FREE L F QR R+L
Sbjct  61   IARPQADVTYCIHALARRLAKTRNWIVALKTLVVIHRLLREGDPAFREEFLTFTQRVRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWD ++WVRTY LFLEE+LECFRVLKYDIEA RL K   QG EKG+S+
Sbjct  121  QLSNFKDDSSPVAWDYASWVRTYGLFLEEKLECFRVLKYDIEAARLSK-QGQGPEKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            T ELNS++LL+QLPALQQLLYRLIGCR EGAA  NY++QYALA VLKESFKIYCAINDGI
Sbjct  180  TTELNSQDLLEQLPALQQLLYRLIGCRAEGAAKNNYLVQYALAQVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INL+DKFFEMP+
Sbjct  240  INLIDKFFEMPK  251



>ref|XP_009148877.1| PREDICTED: putative clathrin assembly protein At1g14910 [Brassica 
rapa]
Length=766

 Score =   401 bits (1030),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 195/252 (77%), Positives = 225/252 (89%), Gaps = 0/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ++R+AYGALKD TKVGL  VNSD+ D++VAIVKATNHVECPPK+RHL KI + TS
Sbjct  1    MGTLQSFRRAYGALKDTTKVGLVRVNSDYADIEVAIVKATNHVECPPKDRHLTKIFIATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A RPRADVAYCIH L+RR+ KT NWTVALK L+V+HR +REGDPTFREELLNF ++GR L
Sbjct  61   ATRPRADVAYCIHTLSRRVHKTRNWTVALKALLVLHRLVREGDPTFREELLNFSRKGRFL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSS  AWDCS WVR YALFLEERL+CFRVLKYDIEAERLPK     +EKGYSK
Sbjct  121  QLSNFKDDSSTAAWDCSVWVRAYALFLEERLQCFRVLKYDIEAERLPKVSPGQEEKGYSK  180

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR+L+ E+LL+QLPALQQLL+RL+GC+PEGAA  N++IQYALALVLKESFK+YCAIN+GI
Sbjct  181  TRDLDGEQLLEQLPALQQLLHRLMGCKPEGAAKHNHIIQYALALVLKESFKVYCAINEGI  240

Query  940  INLVDKFFEMPR  975
            INLV+KFFEMPR
Sbjct  241  INLVEKFFEMPR  252



>ref|XP_010688409.1| PREDICTED: putative clathrin assembly protein At5g57200 [Beta 
vulgaris subsp. vulgaris]
Length=598

 Score =   394 bits (1013),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 199/252 (79%), Positives = 222/252 (88%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT Q++RKAYGALKD T VGLA VNS+FKD+D+A+VKATNHVE PPKERH+RK+   TS
Sbjct  1    MGTFQSFRKAYGALKDSTTVGLAKVNSEFKDLDIAVVKATNHVEAPPKERHVRKVFAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             VRPRADVAYCIHALARRLAKT NW VA+K LIVIHRTLREGDPTFREELL +  RG +L
Sbjct  61   VVRPRADVAYCIHALARRLAKTKNWIVAIKVLIVIHRTLREGDPTFREELLAYSHRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFRVLKYDIEAERL +  + G  K +S+
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLTR-SSPGASKVHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L +EELLDQLPALQQLL+RL+GC+PEG A  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  180  TRLLTAEELLDQLPALQQLLFRLMGCQPEGVACTNYLIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+M R
Sbjct  240  INLVDMFFDMSR  251



>ref|XP_010536897.1| PREDICTED: putative clathrin assembly protein At5g57200 [Tarenaya 
hassleriana]
Length=600

 Score =   394 bits (1013),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 198/252 (79%), Positives = 222/252 (88%), Gaps = 2/252 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT Q++RKAYGALKD T VGLA VNS+FKD+D+AIVKATNHVECPPKERH+RKI   TS
Sbjct  1    MGTFQSFRKAYGALKDTTTVGLAKVNSEFKDLDIAIVKATNHVECPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             VRPRADVAYCIHAL++RL+KT NW VA+K LIVIHRTLREGDPTFREELLN+  RG +L
Sbjct  61   VVRPRADVAYCIHALSKRLSKTRNWIVAIKVLIVIHRTLREGDPTFREELLNYSHRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNFKDDSSP+AWDCSAWVRTYALFLEERLEC+RVLKYDIE+ERL K  A G      +
Sbjct  121  RISNFKDDSSPLAWDCSAWVRTYALFLEERLECYRVLKYDIESERLQK--ASGAASKTHR  178

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+ E+LL+QLPALQQLLYRL+GC+PEGAA  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  179  TRVLSGEDLLEQLPALQQLLYRLVGCQPEGAAYSNYLIQYALALVLKESFKIYCAINDGI  238

Query  940  INLVDKFFEMPR  975
            INLVD FFEM R
Sbjct  239  INLVDMFFEMSR  250



>ref|XP_004297901.1| PREDICTED: putative clathrin assembly protein At5g57200 [Fragaria 
vesca subsp. vesca]
Length=582

 Score =   393 bits (1010),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 195/252 (77%), Positives = 222/252 (88%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT   +RKAYGALKD TKVGL  VNS+FKD+D+A VKAT+HVECPPKERH+RKI   TS
Sbjct  1    MGTFSGFRKAYGALKDSTKVGLIKVNSEFKDLDIATVKATSHVECPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             VRPRADVAYCIHAL +RL+KT +W VA+KTLIVIHRTLREGDPTFREELLN+ QRG +L
Sbjct  61   VVRPRADVAYCIHALGKRLSKTRSWIVAIKTLIVIHRTLREGDPTFREELLNYSQRGHML  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCS+WVRTYALFLEERLECFR+LKYDIE+ERL K    G  K +S+
Sbjct  121  QISNFKDDSSPLAWDCSSWVRTYALFLEERLECFRILKYDIESERLTK-TNPGSTKVHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L ++ELL+QLPALQQLLYRL+GC+PEG A  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRMLGADELLEQLPALQQLLYRLVGCQPEGTAYNNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+MPR
Sbjct  240  INLVDMFFDMPR  251



>ref|XP_012068461.1| PREDICTED: LOW QUALITY PROTEIN: putative clathrin assembly protein 
At5g57200 [Jatropha curcas]
Length=581

 Score =   393 bits (1009),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 197/252 (78%), Positives = 221/252 (88%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  ++RKAYGALKD T VGLA VNS+FK++D+AIVKATNHVECPPKERH+RKI   TS
Sbjct  1    MGTFTSFRKAYGALKDSTTVGLAKVNSEFKELDIAIVKATNHVECPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             +RPRADVAYCIHALARRL+KT NW VA+KTLIVIHRTLREGDPTFREELLN+  RG +L
Sbjct  61   VIRPRADVAYCIHALARRLSKTRNWIVAIKTLIVIHRTLREGDPTFREELLNYAHRGNIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFR+LKYDIEAERL K  +    K +S+
Sbjct  121  QISNFKDDSSPMAWDCSAWVRTYALFLEERLECFRILKYDIEAERLTK-SSPAATKAHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR LN + LLDQLPALQQLL+RL+GC PEG A  NY++QYALALVLKESFKIYCAINDGI
Sbjct  180  TRLLNRDALLDQLPALQQLLFRLVGCHPEGTAYCNYLVQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+M R
Sbjct  240  INLVDMFFDMSR  251



>ref|XP_009359933.1| PREDICTED: putative clathrin assembly protein At5g57200 [Pyrus 
x bretschneideri]
Length=581

 Score =   392 bits (1008),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 196/252 (78%), Positives = 223/252 (88%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT Q++RKAYGALKD TKVGL  VNS+FKD+D+A VKAT+HVE PPKERH+RKI   TS
Sbjct  1    MGTFQSFRKAYGALKDSTKVGLIKVNSEFKDLDIATVKATSHVEYPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALA+RL+KT +W VA+KTLIVIHRTLREGDPTFREELLN+ QRG +L
Sbjct  61   VTRPRADVAYCIHALAKRLSKTRSWIVAIKTLIVIHRTLREGDPTFREELLNYSQRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFRVLKYDIEAERL K  + G  K +S+
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLTK-TSPGSTKVHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L ++ELL+QLPALQQLL+RL+GC+PEG A  NY+IQYALAL+LKESFKIYCAINDGI
Sbjct  180  TRTLGADELLEQLPALQQLLFRLMGCQPEGTAYNNYLIQYALALILKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+M R
Sbjct  240  INLVDMFFDMSR  251



>ref|XP_010087990.1| Putative clathrin assembly protein [Morus notabilis]
 gb|EXB31000.1| Putative clathrin assembly protein [Morus notabilis]
Length=577

 Score =   392 bits (1007),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 198/252 (79%), Positives = 221/252 (88%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT Q++RKAYGALKD TKVGLA VNS+FKD+D+AIVKATNHVECPPKERH+RKI   TS
Sbjct  1    MGTFQSFRKAYGALKDSTKVGLAKVNSEFKDLDIAIVKATNHVECPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             VRPRADVAYCIHALA+RL+KT NW VA+K LIVIHRTLREGDPT REEL+N+  R  V+
Sbjct  61   MVRPRADVAYCIHALAKRLSKTRNWIVAIKALIVIHRTLREGDPTSREELMNYSYRAHVI  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            QMSNFKD+SSP+AWDCSAWVRTY+LFLEER+ECFRVLKYD+E ERL K  A G  K +S+
Sbjct  121  QMSNFKDESSPLAWDCSAWVRTYSLFLEERMECFRVLKYDVETERLTK-YAPGASKVHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L   ELL+QLPALQQLLYRLIGC+PEGAA  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  180  TRMLGRIELLEQLPALQQLLYRLIGCQPEGAAYSNYLIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+M R
Sbjct  240  INLVDMFFDMSR  251



>gb|KJB53729.1| hypothetical protein B456_009G002600 [Gossypium raimondii]
Length=564

 Score =   391 bits (1005),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 189/255 (74%), Positives = 221/255 (87%), Gaps = 3/255 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MG+ +++R+AYGALKD T VGLA VNSDFKD+D+AIVKATNHVECPPKERH+RKI+  T+
Sbjct  1    MGSFKSFRQAYGALKDSTTVGLAKVNSDFKDLDIAIVKATNHVECPPKERHVRKILAATA  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRAD+AYCIHALA+RL+KT NW VA+K LIVIHRTLREGDPTFREEL+N+  RGR+L
Sbjct  61   VARPRADIAYCIHALAKRLSKTRNWIVAIKVLIVIHRTLREGDPTFREELMNYSHRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPK---PPAQGQEKG  750
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFRVLK+DIE ERLPK   P    + + 
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECFRVLKFDIETERLPKTSSPAGASKSRS  180

Query  751  YSKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAIN  930
             S+T    S+EL++QLP LQQLLYRLIGC+PEGAA  NY++QYALAL+LKESFKIYC IN
Sbjct  181  TSRTILSASDELIEQLPVLQQLLYRLIGCQPEGAAYSNYLVQYALALILKESFKIYCGIN  240

Query  931  DGIINLVDKFFEMPR  975
            DGIINLVD FF+M +
Sbjct  241  DGIINLVDMFFDMSK  255



>ref|XP_011020010.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X2 [Populus euphratica]
Length=469

 Score =   387 bits (995),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 196/252 (78%), Positives = 219/252 (87%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M T  ++RKAYGALKD TKVGLA VNS++K++D+AIVKATNHVECPPKERH+RKI   TS
Sbjct  1    MATFTSFRKAYGALKDTTKVGLAKVNSEYKELDIAIVKATNHVECPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             +RPR DVAYCIHAL +RLAKT +W VA+KTLIVIHRTLREGDPTFREELLN+  RG +L
Sbjct  61   VIRPRVDVAYCIHALCKRLAKTQDWIVAIKTLIVIHRTLREGDPTFREELLNYSHRGNIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            QMSNFKDDSS +AWDCSAWVRTYALFLEERLECF+VLKYDIEAERL K       K +SK
Sbjct  121  QMSNFKDDSSSLAWDCSAWVRTYALFLEERLECFKVLKYDIEAERLNKASPVAI-KVHSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR LN E+LL+QLPALQQLLYRL+GC+PEG A  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  180  TRLLNGEDLLEQLPALQQLLYRLLGCQPEGGAYNNYLIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FFEM +
Sbjct  240  INLVDLFFEMTK  251



>emb|CDP20659.1| unnamed protein product [Coffea canephora]
Length=570

 Score =   390 bits (1002),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 196/249 (79%), Positives = 221/249 (89%), Gaps = 1/249 (0%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            ++++RKAYGALKD TKVGLA VNSDFKD+D+AIVKATNHVE PPKERH+RKI   TS  R
Sbjct  1    MESFRKAYGALKDSTKVGLAKVNSDFKDLDIAIVKATNHVEYPPKERHVRKIYFATSVAR  60

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRADVAYCIHAL+RRLAKT NW VA+KTLIVIHRTLREGDPTFREELLN+  RG + Q+S
Sbjct  61   PRADVAYCIHALSRRLAKTKNWIVAIKTLIVIHRTLREGDPTFREELLNYSHRGHIFQLS  120

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKDDSSP+AWDCSAWVRTYALFLEERLECFR LKYDIEAERL K  A G  K +S+TR 
Sbjct  121  NFKDDSSPLAWDCSAWVRTYALFLEERLECFRALKYDIEAERLTKTSA-GTSKVHSRTRL  179

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            L+ EELL+QLPALQQLL+RL+ C+PEGAA  NY++QYALALVLKESFKIYCA+NDGIINL
Sbjct  180  LSGEELLEQLPALQQLLFRLVCCQPEGAACFNYLVQYALALVLKESFKIYCAVNDGIINL  239

Query  949  VDKFFEMPR  975
            VD FF+MP+
Sbjct  240  VDLFFDMPK  248



>ref|XP_010929364.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X3 [Elaeis guineensis]
Length=530

 Score =   388 bits (996),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 196/252 (78%), Positives = 221/252 (88%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT Q+WR+AYGALKD TKVGLA VNS+FK++D+A+VKATNHVECPPKERH+RKI V T+
Sbjct  1    MGTFQSWRQAYGALKDTTKVGLAKVNSEFKELDIAVVKATNHVECPPKERHVRKIFVATA  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPR DVAYC+H LARRLAKT NW VALKTLIVIHR LREGDPTFREELLN+ +RG VL
Sbjct  61   VDRPRTDVAYCVHILARRLAKTRNWVVALKTLIVIHRALREGDPTFREELLNYSRRGNVL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNF+DDSS +AWDCSAWVRTYALFLEERLECFR+LKYDIEAERL K  + G  KG S+
Sbjct  121  RISNFRDDSSSLAWDCSAWVRTYALFLEERLECFRILKYDIEAERLRK-FSDGDAKGQSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            T +L  ++LLDQLPALQ LLY L+GC+PE AA GNY+IQYALALVLKESFKIYCAINDGI
Sbjct  180  TGKLGCQDLLDQLPALQNLLYCLVGCQPERAAFGNYLIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FFEM R
Sbjct  240  INLVDLFFEMSR  251



>ref|XP_007154718.1| hypothetical protein PHAVU_003G141500g [Phaseolus vulgaris]
 gb|ESW26712.1| hypothetical protein PHAVU_003G141500g [Phaseolus vulgaris]
Length=569

 Score =   389 bits (999),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/252 (78%), Positives = 224/252 (89%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT ++ RKAYGALKD TKVGLA VNS++KD+D+AIVKAT+HVE PPKERH+RKI   TS
Sbjct  1    MGTFRSLRKAYGALKDSTKVGLAKVNSEYKDLDIAIVKATSHVEYPPKERHVRKIFYATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A +PRADVAYCIH LARRLAKT NW VA+KTLIVIHR LREGDPTF+E+L+N+ +RGR L
Sbjct  61   AHQPRADVAYCIHTLARRLAKTRNWIVAVKTLIVIHRILREGDPTFKEDLINYARRGRFL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP AWDCSAWVRTYALFLEERLECFR+LKYDIE+ERL K P+    KG+S+
Sbjct  121  QISNFKDDSSPQAWDCSAWVRTYALFLEERLECFRILKYDIESERLTK-PSPVITKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L SE LL+QLPALQQLLYRL+GC+PEG A+ NY+IQYALALVLKESFKIYCA+NDGI
Sbjct  180  TRSLTSEGLLEQLPALQQLLYRLVGCQPEGLALSNYLIQYALALVLKESFKIYCALNDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+MPR
Sbjct  240  INLVDVFFDMPR  251



>ref|XP_010929362.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X1 [Elaeis guineensis]
Length=557

 Score =   388 bits (997),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/252 (78%), Positives = 221/252 (88%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT Q+WR+AYGALKD TKVGLA VNS+FK++D+A+VKATNHVECPPKERH+RKI V T+
Sbjct  1    MGTFQSWRQAYGALKDTTKVGLAKVNSEFKELDIAVVKATNHVECPPKERHVRKIFVATA  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPR DVAYC+H LARRLAKT NW VALKTLIVIHR LREGDPTFREELLN+ +RG VL
Sbjct  61   VDRPRTDVAYCVHILARRLAKTRNWVVALKTLIVIHRALREGDPTFREELLNYSRRGNVL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNF+DDSS +AWDCSAWVRTYALFLEERLECFR+LKYDIEAERL K  + G  KG S+
Sbjct  121  RISNFRDDSSSLAWDCSAWVRTYALFLEERLECFRILKYDIEAERLRK-FSDGDAKGQSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            T +L  ++LLDQLPALQ LLY L+GC+PE AA GNY+IQYALALVLKESFKIYCAINDGI
Sbjct  180  TGKLGCQDLLDQLPALQNLLYCLVGCQPERAAFGNYLIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FFEM R
Sbjct  240  INLVDLFFEMSR  251



>ref|XP_002864505.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40764.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score =   389 bits (998),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/252 (77%), Positives = 220/252 (87%), Gaps = 2/252 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  ++RKAYGALKD T VGLA VNS+FKD+D+AIVKATNHVE PPKERH+RKI   TS
Sbjct  1    MGTFTSFRKAYGALKDTTTVGLAKVNSEFKDLDIAIVKATNHVESPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             ++PRADVAYCIHAL++RL+KT NW VA+K LIVIHRTLREGDPTFREELLN+  R  +L
Sbjct  61   VIQPRADVAYCIHALSKRLSKTRNWVVAMKVLIVIHRTLREGDPTFREELLNYSHRRHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNFKDD+SP+AWDCSAWVRTYALFLEERLEC+RVLKYDIEAERLPK  A G      +
Sbjct  121  RISNFKDDTSPLAWDCSAWVRTYALFLEERLECYRVLKYDIEAERLPK--ASGAASKTHR  178

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+ E+LL+QLPALQQLLYRLIGC+PEGAA  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  179  TRMLSGEDLLEQLPALQQLLYRLIGCQPEGAAYSNYLIQYALALVLKESFKIYCAINDGI  238

Query  940  INLVDKFFEMPR  975
            INLVD FFEM R
Sbjct  239  INLVDMFFEMSR  250



>ref|XP_006279508.1| hypothetical protein CARUB_v10027557mg [Capsella rubella]
 gb|EOA12406.1| hypothetical protein CARUB_v10027557mg [Capsella rubella]
Length=592

 Score =   389 bits (998),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/252 (77%), Positives = 220/252 (87%), Gaps = 2/252 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  ++RKAYGALKD T VGLA VNS+FKD+D+AIVKATNHVE PPKERH+RKI   TS
Sbjct  1    MGTFTSFRKAYGALKDTTTVGLAKVNSEFKDLDIAIVKATNHVESPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             ++PRADVAYCIHAL++RL+KT NW VA+K LIVIHRTLREGDPTFREELLN+  R  +L
Sbjct  61   VIQPRADVAYCIHALSKRLSKTRNWVVAMKVLIVIHRTLREGDPTFREELLNYSHRRHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNFKDD+SP+AWDCSAWVRTYALFLEERLEC+RVLKYDIEAERLPK  A G      +
Sbjct  121  RISNFKDDTSPLAWDCSAWVRTYALFLEERLECYRVLKYDIEAERLPK--ASGAASKTHR  178

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+ E+LL+QLPALQQLLYRLIGC+PEGAA  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  179  TRMLSGEDLLEQLPALQQLLYRLIGCQPEGAAYSNYLIQYALALVLKESFKIYCAINDGI  238

Query  940  INLVDKFFEMPR  975
            INLVD FFEM R
Sbjct  239  INLVDMFFEMSR  250



>ref|XP_002308116.2| hypothetical protein POPTR_0006s07540g [Populus trichocarpa]
 gb|EEE91639.2| hypothetical protein POPTR_0006s07540g [Populus trichocarpa]
Length=575

 Score =   388 bits (997),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 197/250 (79%), Positives = 220/250 (88%), Gaps = 1/250 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M T  ++RKAYGALKD TKVGLA VNS++K++D+AIVKATNHVECPPKERH+RKI   TS
Sbjct  1    MATFTSFRKAYGALKDTTKVGLAKVNSEYKELDIAIVKATNHVECPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             +RPRADVAYCIHAL +RLAKT +W VA+KTLIVIHRTLREGDPTFREELLN+  RG +L
Sbjct  61   VIRPRADVAYCIHALCKRLAKTQDWIVAIKTLIVIHRTLREGDPTFREELLNYSHRGNIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            QMSNFKDDSS +AWDCSAWVRTYALFLEERLECF+VLKYDIEAERL K  +    K +SK
Sbjct  121  QMSNFKDDSSSLAWDCSAWVRTYALFLEERLECFKVLKYDIEAERLNK-ASPVAIKVHSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR LN E+LL+QLPALQQLLYRL+GC+PEG A  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  180  TRLLNGEDLLEQLPALQQLLYRLLGCQPEGGAYNNYLIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEM  969
            INLVD FFEM
Sbjct  240  INLVDLFFEM  249



>ref|NP_200530.1| putative clathrin assembly protein [Arabidopsis thaliana]
 sp|Q9LVD8.1|CAP7_ARATH RecName: Full=Putative clathrin assembly protein At5g57200 [Arabidopsis 
thaliana]
 dbj|BAA96943.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96865.1| putative clathrin assembly protein [Arabidopsis thaliana]
Length=591

 Score =   388 bits (997),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 195/252 (77%), Positives = 220/252 (87%), Gaps = 2/252 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  ++RKAYGALKD T VGLA VNS+FKD+D+AIVKATNHVE PPKERH+RKI   TS
Sbjct  1    MGTFTSFRKAYGALKDTTTVGLAKVNSEFKDLDIAIVKATNHVESPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             ++PRADVAYCIHAL++RL+KT NW VA+K LIVIHRTLREGDPTFREELLN+  R  +L
Sbjct  61   VIQPRADVAYCIHALSKRLSKTRNWVVAMKVLIVIHRTLREGDPTFREELLNYSHRRHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNFKDD+SP+AWDCSAWVRTYALFLEERLEC+RVLKYDIEAERLPK  A G      +
Sbjct  121  RISNFKDDTSPLAWDCSAWVRTYALFLEERLECYRVLKYDIEAERLPK--ASGAASKTHR  178

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+ E+LL+QLPALQQLLYRLIGC+PEGAA  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  179  TRMLSGEDLLEQLPALQQLLYRLIGCQPEGAAYSNYLIQYALALVLKESFKIYCAINDGI  238

Query  940  INLVDKFFEMPR  975
            INLVD FFEM R
Sbjct  239  INLVDMFFEMSR  250



>ref|XP_011020009.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X1 [Populus euphratica]
Length=577

 Score =   387 bits (994),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 196/250 (78%), Positives = 219/250 (88%), Gaps = 1/250 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M T  ++RKAYGALKD TKVGLA VNS++K++D+AIVKATNHVECPPKERH+RKI   TS
Sbjct  1    MATFTSFRKAYGALKDTTKVGLAKVNSEYKELDIAIVKATNHVECPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             +RPR DVAYCIHAL +RLAKT +W VA+KTLIVIHRTLREGDPTFREELLN+  RG +L
Sbjct  61   VIRPRVDVAYCIHALCKRLAKTQDWIVAIKTLIVIHRTLREGDPTFREELLNYSHRGNIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            QMSNFKDDSS +AWDCSAWVRTYALFLEERLECF+VLKYDIEAERL K  +    K +SK
Sbjct  121  QMSNFKDDSSSLAWDCSAWVRTYALFLEERLECFKVLKYDIEAERLNK-ASPVAIKVHSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR LN E+LL+QLPALQQLLYRL+GC+PEG A  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  180  TRLLNGEDLLEQLPALQQLLYRLLGCQPEGGAYNNYLIQYALALVLKESFKIYCAINDGI  239

Query  940  INLVDKFFEM  969
            INLVD FFEM
Sbjct  240  INLVDLFFEM  249



>ref|XP_010451872.1| PREDICTED: putative clathrin assembly protein At5g57200 [Camelina 
sativa]
Length=590

 Score =   387 bits (995),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 195/252 (77%), Positives = 219/252 (87%), Gaps = 2/252 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  + RKAYGALKD T VGLA VNS+FKD+D+AIVKATNHVE PPKERH+RKI   TS
Sbjct  1    MGTFTSLRKAYGALKDTTTVGLAKVNSEFKDLDIAIVKATNHVESPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             ++PRADVAYCIHAL++RL+KT NW VA+K LIVIHRTLREGDPTFREELLN+  R  +L
Sbjct  61   VIQPRADVAYCIHALSKRLSKTRNWVVAMKVLIVIHRTLREGDPTFREELLNYSHRRHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNFKDD+SP+AWDCSAWVRTYALFLEERLEC+RVLKYDIEAERLPK  A G      +
Sbjct  121  RISNFKDDTSPLAWDCSAWVRTYALFLEERLECYRVLKYDIEAERLPK--ASGAASKTHR  178

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+ E+LL+QLPALQQLLYRLIGC+PEGAA  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  179  TRMLSGEDLLEQLPALQQLLYRLIGCQPEGAAYSNYLIQYALALVLKESFKIYCAINDGI  238

Query  940  INLVDKFFEMPR  975
            INLVD FFEM R
Sbjct  239  INLVDMFFEMSR  250



>ref|XP_010483224.1| PREDICTED: putative clathrin assembly protein At5g57200 [Camelina 
sativa]
Length=589

 Score =   387 bits (994),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 195/252 (77%), Positives = 219/252 (87%), Gaps = 2/252 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  + RKAYGALKD T VGLA VNS+FKD+D+AIVKATNHVE PPKERH+RKI   TS
Sbjct  1    MGTFTSLRKAYGALKDTTTVGLAKVNSEFKDLDIAIVKATNHVESPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             ++PRADVAYCIHAL++RL+KT NW VA+K LIVIHRTLREGDPTFREELLN+  R  +L
Sbjct  61   VIQPRADVAYCIHALSKRLSKTRNWVVAMKVLIVIHRTLREGDPTFREELLNYSHRRHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNFKDD+SP+AWDCSAWVRTYALFLEERLEC+RVLKYDIEAERLPK  A G      +
Sbjct  121  RISNFKDDTSPLAWDCSAWVRTYALFLEERLECYRVLKYDIEAERLPK--ASGAASKTHR  178

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+ E+LL+QLPALQQLLYRLIGC+PEGAA  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  179  TRMLSGEDLLEQLPALQQLLYRLIGCQPEGAAYSNYLIQYALALVLKESFKIYCAINDGI  238

Query  940  INLVDKFFEMPR  975
            INLVD FFEM R
Sbjct  239  INLVDMFFEMSR  250



>ref|XP_010443398.1| PREDICTED: putative clathrin assembly protein At5g57200 [Camelina 
sativa]
 ref|XP_010443399.1| PREDICTED: putative clathrin assembly protein At5g57200 [Camelina 
sativa]
Length=589

 Score =   387 bits (994),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 195/252 (77%), Positives = 219/252 (87%), Gaps = 2/252 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  + RKAYGALKD T VGLA VNS+FKD+D+AIVKATNHVE PPKERH+RKI   TS
Sbjct  1    MGTFTSLRKAYGALKDTTTVGLAKVNSEFKDLDIAIVKATNHVESPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             ++PRADVAYCIHAL++RL+KT NW VA+K LIVIHRTLREGDPTFREELLN+  R  +L
Sbjct  61   VIQPRADVAYCIHALSKRLSKTRNWVVAMKVLIVIHRTLREGDPTFREELLNYSHRRHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNFKDD+SP+AWDCSAWVRTYALFLEERLEC+RVLKYDIEAERLPK  A G      +
Sbjct  121  RISNFKDDTSPLAWDCSAWVRTYALFLEERLECYRVLKYDIEAERLPK--ASGAASKTHR  178

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+ E+LL+QLPALQQLLYRLIGC+PEGAA  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  179  TRMLSGEDLLEQLPALQQLLYRLIGCQPEGAAYSNYLIQYALALVLKESFKIYCAINDGI  238

Query  940  INLVDKFFEMPR  975
            INLVD FFEM R
Sbjct  239  INLVDMFFEMSR  250



>ref|XP_006401230.1| hypothetical protein EUTSA_v10013043mg [Eutrema salsugineum]
 gb|ESQ42683.1| hypothetical protein EUTSA_v10013043mg [Eutrema salsugineum]
Length=593

 Score =   387 bits (994),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/252 (77%), Positives = 219/252 (87%), Gaps = 2/252 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  ++RKAYGALKD T VGLA VNS+FKD+D+AIVKATNHVE PPKERH+RKI   TS
Sbjct  1    MGTFTSFRKAYGALKDSTTVGLAKVNSEFKDLDIAIVKATNHVESPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             ++PRADVAYCIHAL++RL+KT NW VA+K LIVIHRTLREGDPTFREELLN+  R  +L
Sbjct  61   VIQPRADVAYCIHALSKRLSKTRNWVVAMKVLIVIHRTLREGDPTFREELLNYSHRRHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNFKDD+SP+AWDCSAWVRTYALFLEERLEC+RVLKYDIEAERLPK    G      +
Sbjct  121  RISNFKDDTSPLAWDCSAWVRTYALFLEERLECYRVLKYDIEAERLPK--GSGAASKTHR  178

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+ E+LL+QLPALQQLLYRLIGC+PEGAA  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  179  TRMLSGEDLLEQLPALQQLLYRLIGCQPEGAAYSNYLIQYALALVLKESFKIYCAINDGI  238

Query  940  INLVDKFFEMPR  975
            INLVD FFEM R
Sbjct  239  INLVDMFFEMTR  250



>ref|XP_009400569.1| PREDICTED: putative clathrin assembly protein At5g57200 [Musa 
acuminata subsp. malaccensis]
Length=585

 Score =   387 bits (993),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 196/249 (79%), Positives = 218/249 (88%), Gaps = 1/249 (0%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            + TWRKAYGALKD TKVGLA VNS+FKD+D+AIVKATNH ECPPKERH+R I   TS VR
Sbjct  1    MGTWRKAYGALKDSTKVGLAKVNSEFKDLDIAIVKATNHEECPPKERHVRTIFAATSVVR  60

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRADVAYCI+AL RRL+KTHNW VALKTLIVIHRTLREGDPTFREELL + +RG VL +S
Sbjct  61   PRADVAYCIYALGRRLSKTHNWMVALKTLIVIHRTLREGDPTFREELLIYSRRGNVLHIS  120

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKDDS P+AWDCSAWVRTYAL+LEERL CFR+LKYDIEAERL K P Q   KG+S+TR 
Sbjct  121  NFKDDSGPLAWDCSAWVRTYALYLEERLSCFRILKYDIEAERLMKSP-QESAKGHSRTRT  179

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            L   +LL+QL ALQQLL+RLIGCRPEGAA GN++IQYALALVLKESFKIYCAINDGIINL
Sbjct  180  LCCPDLLEQLLALQQLLFRLIGCRPEGAACGNFLIQYALALVLKESFKIYCAINDGIINL  239

Query  949  VDKFFEMPR  975
            VD FF+M +
Sbjct  240  VDMFFDMSK  248



>gb|KFK27275.1| hypothetical protein AALP_AA8G360900 [Arabis alpina]
Length=593

 Score =   386 bits (992),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 195/252 (77%), Positives = 218/252 (87%), Gaps = 2/252 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  + RKAYGALKD T VGLA VNS+FKD+D+AIVKATNHVE PPKERH+RKI   TS
Sbjct  1    MGTFTSLRKAYGALKDSTTVGLAKVNSEFKDLDIAIVKATNHVESPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             V+PRADVAYCIHAL++RL+KT NW VA+K LIVIHRTLREGDPTFREELLN+  R  +L
Sbjct  61   VVQPRADVAYCIHALSKRLSKTRNWVVAMKVLIVIHRTLREGDPTFREELLNYSHRRHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNFKDD+SP+AWDCSAWVRTYALFLEERLEC+RVLKYDIEAERLPK    G      +
Sbjct  121  RISNFKDDTSPLAWDCSAWVRTYALFLEERLECYRVLKYDIEAERLPK--GSGAASKTHR  178

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+ E+LL+QLPALQQLLYRLIGC+PEGAA  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  179  TRMLSGEDLLEQLPALQQLLYRLIGCQPEGAAYSNYLIQYALALVLKESFKIYCAINDGI  238

Query  940  INLVDKFFEMPR  975
            INLVD FFEM R
Sbjct  239  INLVDMFFEMTR  250



>ref|XP_009120244.1| PREDICTED: putative clathrin assembly protein At5g57200 [Brassica 
rapa]
Length=592

 Score =   385 bits (989),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 194/252 (77%), Positives = 218/252 (87%), Gaps = 2/252 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  + RKAYGALKD T VGLA VNS+FKD+D+AIVKATNHVE PPKERH+RKI   TS
Sbjct  1    MGTFTSLRKAYGALKDSTTVGLAKVNSEFKDLDIAIVKATNHVESPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A++PRADVAYCIHAL++RL+KT  W VA+K LIVIHRTLREGDPTFREELLN+  R  +L
Sbjct  61   AIQPRADVAYCIHALSKRLSKTRTWVVAMKVLIVIHRTLREGDPTFREELLNYSHRRHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNFKDD+SP+AWDCSAWVRTYALFLEERLEC+RVLKYDIEAERLPK    G      +
Sbjct  121  RISNFKDDTSPLAWDCSAWVRTYALFLEERLECYRVLKYDIEAERLPK--GAGAASKTHR  178

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+ E+LL+QLPALQQLLYRLIGC+PEGAA  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  179  TRMLSGEDLLEQLPALQQLLYRLIGCQPEGAAYSNYLIQYALALVLKESFKIYCAINDGI  238

Query  940  INLVDKFFEMPR  975
            INLVD FFEM R
Sbjct  239  INLVDMFFEMTR  250



>emb|CDY38276.1| BnaA10g11240D [Brassica napus]
Length=592

 Score =   385 bits (989),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 194/252 (77%), Positives = 218/252 (87%), Gaps = 2/252 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  + RKAYGALKD T VGLA VNS+FKD+D+AIVKATNHVE PPKERH+RKI   TS
Sbjct  1    MGTFTSLRKAYGALKDSTTVGLAKVNSEFKDLDIAIVKATNHVESPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A++PRADVAYCIHAL++RL+KT  W VA+K LIVIHRTLREGDPTFREELLN+  R  +L
Sbjct  61   AIQPRADVAYCIHALSKRLSKTRTWVVAMKVLIVIHRTLREGDPTFREELLNYSHRRHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNFKDD+SP+AWDCSAWVRTYALFLEERLEC+RVLKYDIEAERLPK    G      +
Sbjct  121  RISNFKDDTSPLAWDCSAWVRTYALFLEERLECYRVLKYDIEAERLPK--GAGAASKTHR  178

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+ E+LL+QLPALQQLLYRLIGC+PEGAA  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  179  TRMLSGEDLLEQLPALQQLLYRLIGCQPEGAAYSNYLIQYALALVLKESFKIYCAINDGI  238

Query  940  INLVDKFFEMPR  975
            INLVD FFEM R
Sbjct  239  INLVDMFFEMTR  250



>emb|CDY52732.1| BnaC09g53320D [Brassica napus]
Length=585

 Score =   385 bits (988),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 194/252 (77%), Positives = 218/252 (87%), Gaps = 2/252 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  + RKAYGALKD T VGLA VNS+FKD+D+AIVKATNHVE PPKERH+RKI   TS
Sbjct  1    MGTFTSLRKAYGALKDSTTVGLAKVNSEFKDLDIAIVKATNHVESPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A++PRADVAYCIHAL++RL+KT  W VA+K LIVIHRTLREGDPTFREELLN+  R  +L
Sbjct  61   AIQPRADVAYCIHALSKRLSKTRTWVVAMKVLIVIHRTLREGDPTFREELLNYSHRRHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNFKDD+SP+AWDCSAWVRTYALFLEERLEC+RVLKYDIEAERLPK    G      +
Sbjct  121  RISNFKDDTSPLAWDCSAWVRTYALFLEERLECYRVLKYDIEAERLPK--GAGAASKTHR  178

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+ E+LL+QLPALQQLLYRLIGC+PEGAA  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  179  TRMLSGEDLLEQLPALQQLLYRLIGCQPEGAAYSNYLIQYALALVLKESFKIYCAINDGI  238

Query  940  INLVDKFFEMPR  975
            INLVD FFEM R
Sbjct  239  INLVDMFFEMTR  250



>ref|XP_011094096.1| PREDICTED: putative clathrin assembly protein At5g57200 [Sesamum 
indicum]
Length=576

 Score =   384 bits (987),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 189/249 (76%), Positives = 222/249 (89%), Gaps = 1/249 (0%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            + ++RKAYGALKD TKVGLA++NS+FKD+D+AIVKATNH ECPPK+RH+RKI+   S  R
Sbjct  1    MDSFRKAYGALKDSTKVGLANLNSEFKDLDIAIVKATNHDECPPKDRHVRKIIAAVSVNR  60

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRADVAYCIHAL+RRLAKT +W VA+K L+V+HRTLREGDPTFREELL++  RG++ Q+S
Sbjct  61   PRADVAYCIHALSRRLAKTRSWIVAIKALVVVHRTLREGDPTFREELLHYSHRGKLFQIS  120

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKDDSSP+AWDCSAW+RTYALFLEERLECFR L YDIEAER+PK P +G  K YSKTR 
Sbjct  121  NFKDDSSPLAWDCSAWIRTYALFLEERLECFRTLNYDIEAERVPK-PTRGVSKAYSKTRL  179

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            L+ ++LLDQLPALQQLLYRLI C+PEGAA  N++IQYALALVLKESFKIYC+INDGIINL
Sbjct  180  LDGDQLLDQLPALQQLLYRLICCQPEGAACHNFLIQYALALVLKESFKIYCSINDGIINL  239

Query  949  VDKFFEMPR  975
            VD FFEMP+
Sbjct  240  VDMFFEMPK  248



>ref|XP_006648363.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Oryza brachyantha]
Length=576

 Score =   382 bits (981),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 191/249 (77%), Positives = 216/249 (87%), Gaps = 1/249 (0%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            + +WRKAYGALKD TKVGLA VNSDFK++D+AIVKATNHVECPPKERH+RKI   TS  R
Sbjct  1    MGSWRKAYGALKDSTKVGLAKVNSDFKELDIAIVKATNHVECPPKERHVRKIFFATSINR  60

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRADV YCI+AL+RRLAKT NW VALKTLIV+HR LREGDPTF+EE L +  RG VLQM+
Sbjct  61   PRADVQYCIYALSRRLAKTKNWIVALKTLIVLHRLLREGDPTFKEEFLAYTHRGNVLQMA  120

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKDDSSP+AWDCSAWVRTYA FLEERLECFRVLK+DIE ERL K P Q   K +S+TR 
Sbjct  121  NFKDDSSPLAWDCSAWVRTYAFFLEERLECFRVLKFDIETERLMKSP-QCSSKAHSRTRT  179

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            L   +L++QLPALQQLL+RL+GC+PEGAA  NY+IQYALALVLKESFKIYCAINDGIINL
Sbjct  180  LPCLDLMEQLPALQQLLFRLMGCQPEGAAGTNYLIQYALALVLKESFKIYCAINDGIINL  239

Query  949  VDKFFEMPR  975
            VD FF+MP+
Sbjct  240  VDMFFDMPK  248



>ref|XP_008391574.1| PREDICTED: LOW QUALITY PROTEIN: putative clathrin assembly protein 
At5g57200 [Malus domestica]
Length=579

 Score =   380 bits (977),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 191/252 (76%), Positives = 220/252 (87%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M T Q++RKAYGALKD TKVGL  VNS+FKD+D+A VKAT+HVECPPKERH+RKI   TS
Sbjct  1    MXTFQSFRKAYGALKDSTKVGLIKVNSEFKDLDIATVKATSHVECPPKERHIRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALA+RL+KT +W VA+KTLIVIHRTLR+GDPTFREELLN+ QRG +L
Sbjct  61   VNRPRADVAYCIHALAKRLSKTRSWIVAIKTLIVIHRTLRDGDPTFREELLNYSQRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+S FKDDSSP+AWDCSAWVRTYALFLEERLECF+VLKYDIEAERL K    G  K +S+
Sbjct  121  QISYFKDDSSPLAWDCSAWVRTYALFLEERLECFKVLKYDIEAERLTK-TLPGSTKVHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+++ LL+QLPALQQLL+ L+GC+PEG A  NY+IQYALAL+LKESFKIYCAINDGI
Sbjct  180  TRTLSADALLEQLPALQQLLFCLMGCQPEGTAYNNYLIQYALALILKESFKIYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+M R
Sbjct  240  INLVDMFFDMSR  251



>gb|EYU18219.1| hypothetical protein MIMGU_mgv1a003551mg [Erythranthe guttata]
Length=578

 Score =   380 bits (975),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 189/249 (76%), Positives = 219/249 (88%), Gaps = 3/249 (1%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            ++++RKAYGALKD TKVGLA++NS+FKD+D+AIVKATNH ECPPKERH+RKI    S  R
Sbjct  1    MESFRKAYGALKDSTKVGLANLNSEFKDLDIAIVKATNHDECPPKERHVRKIFAAVSINR  60

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRADVAYCIHAL+RRLAKT NW VA+K+LIVIHRTLREGDPTFREELL +  RG++LQ+S
Sbjct  61   PRADVAYCIHALSRRLAKTRNWIVAIKSLIVIHRTLREGDPTFREELLQYSHRGKLLQIS  120

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKDDSSP+AWDCSAWVRTYALFLEERLECFR L YDIEA+R+PK         YSKTR 
Sbjct  121  NFKDDSSPLAWDCSAWVRTYALFLEERLECFRTLNYDIEADRVPK---SAPGVTYSKTRL  177

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            +N +ELLDQLPALQQLLYRL+ C+PEG+A  N+++QYALALVLKESFKIYC+INDGIINL
Sbjct  178  MNGDELLDQLPALQQLLYRLVCCQPEGSACHNFLVQYALALVLKESFKIYCSINDGIINL  237

Query  949  VDKFFEMPR  975
            VD FFEMP+
Sbjct  238  VDMFFEMPK  246



>gb|KFK29105.1| hypothetical protein AALP_AA7G089800 [Arabis alpina]
Length=598

 Score =   380 bits (976),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 194/258 (75%), Positives = 215/258 (83%), Gaps = 6/258 (2%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M T  + RKA GALKD T V +A VNSDFKD+DVAIVKATNHVE  PKERH+RKI   TS
Sbjct  1    MATFHSLRKAVGALKDSTTVSIAKVNSDFKDLDVAIVKATNHVESAPKERHIRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             VRPRADVAYCIHALA+RL+KTHNW VA+K LIVIHRTLREGDPTFREELLN+  RG +L
Sbjct  61   IVRPRADVAYCIHALAKRLSKTHNWIVAIKVLIVIHRTLREGDPTFREELLNYSHRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEK----  747
            ++SNFKDD+SP+AWDCSAW+RTYALFLEERLEC+RVLKYDIEAERLPK      +     
Sbjct  121  RISNFKDDTSPLAWDCSAWIRTYALFLEERLECYRVLKYDIEAERLPKGSGASSKNVDFD  180

Query  748  --GYSKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYC  921
                 +TR L+ EELL+QLPALQQLLYRL GC+PEGAA  NY+IQYALALVLKESFKIYC
Sbjct  181  ASQTYRTRMLSDEELLEQLPALQQLLYRLTGCQPEGAAYSNYLIQYALALVLKESFKIYC  240

Query  922  AINDGIINLVDKFFEMPR  975
            AINDGIINLVD FFEM R
Sbjct  241  AINDGIINLVDMFFEMSR  258



>ref|XP_009126852.1| PREDICTED: putative clathrin assembly protein At5g57200 [Brassica 
rapa]
Length=594

 Score =   380 bits (975),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 191/252 (76%), Positives = 217/252 (86%), Gaps = 2/252 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  + RKAYGALKD T VGLA VNS+FKD+D+AIVKATNHVE PPKERH+RKI   TS
Sbjct  1    MGTFTSLRKAYGALKDSTTVGLAKVNSEFKDLDIAIVKATNHVESPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             ++PRAD+AYCIHAL++RL++T  W VA+K LIVIHRTLREGDPTFREELLN+  R  +L
Sbjct  61   VIQPRADIAYCIHALSKRLSRTRTWVVAMKVLIVIHRTLREGDPTFREELLNYSHRRHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNFKDD+SP AWDCSAWVRTYALFLEERLEC+RVLKYDIEAERLPK  A G      +
Sbjct  121  RISNFKDDTSPRAWDCSAWVRTYALFLEERLECYRVLKYDIEAERLPK--ASGAASKTHR  178

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+ E+LL+QLPALQQLL+RLIGC+PEGAA  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  179  TRMLSGEDLLEQLPALQQLLFRLIGCQPEGAAYSNYLIQYALALVLKESFKIYCAINDGI  238

Query  940  INLVDKFFEMPR  975
            INLVD FFEM R
Sbjct  239  INLVDMFFEMTR  250



>gb|AES65322.2| clathrin assembly plant-like protein [Medicago truncatula]
Length=592

 Score =   379 bits (973),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 191/252 (76%), Positives = 223/252 (88%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  ++RKAYGALKD TKVGLA VNS++K++D+AIVKATNHVE PPKERH+RK+   TS
Sbjct  1    MGTFTSFRKAYGALKDSTKVGLAKVNSEYKELDIAIVKATNHVEYPPKERHVRKVFYATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A +PRADVAYCIH L++RLAKT +W VALKTLIVIHRTLREGDPTFREELLN+ ++G +L
Sbjct  61   AHQPRADVAYCIHKLSKRLAKTRSWIVALKTLIVIHRTLREGDPTFREELLNYSRKGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFRVLKYDIE+ERL K  A  + K +S+
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECFRVLKYDIESERLVKSSAT-EPKPHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L +++LL+QLPALQQLL+RLIGC+PEG A  NY++QYALALVLKESFKIYCA+NDGI
Sbjct  180  TRSLANDDLLEQLPALQQLLFRLIGCQPEGCAYNNYLVQYALALVLKESFKIYCALNDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FFE  R
Sbjct  240  INLVDMFFETSR  251



>ref|XP_007138775.1| hypothetical protein PHAVU_009G236300g [Phaseolus vulgaris]
 gb|ESW10769.1| hypothetical protein PHAVU_009G236300g [Phaseolus vulgaris]
Length=593

 Score =   379 bits (973),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 189/252 (75%), Positives = 221/252 (88%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  ++RKAYGALKD TKVGLA VNS++K++D+AIVKATNHVE PPKERH+RKI   TS
Sbjct  1    MGTFNSFRKAYGALKDSTKVGLAKVNSEYKELDIAIVKATNHVEYPPKERHVRKIFYATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A +PRADV+YCIH L++RL+KT +W VA+K LIVIHRTLREGDPTFREE+LN+ +RG +L
Sbjct  61   AHQPRADVSYCIHKLSKRLSKTRSWIVAIKALIVIHRTLREGDPTFREEILNYSRRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP AWDCSAWVRTYALFLEERLECFRVLKYDIE+ERL K  +    K +S+
Sbjct  121  QISNFKDDSSPQAWDCSAWVRTYALFLEERLECFRVLKYDIESERLTK-ASPAATKAHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+SE+LL QLPALQQLLYRLIGC+PEG +  NY++QYALALVLKESFKIYCA+NDGI
Sbjct  180  TRSLSSEDLLGQLPALQQLLYRLIGCQPEGCSYSNYLVQYALALVLKESFKIYCALNDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+M R
Sbjct  240  INLVDMFFDMTR  251



>ref|XP_004951735.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Setaria italica]
Length=573

 Score =   378 bits (970),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 188/249 (76%), Positives = 216/249 (87%), Gaps = 1/249 (0%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            + +WRKAYGALKD TKVGLA VNSDFK++D+AIVKATNHVECPPKERH+RKI   TSA R
Sbjct  1    MGSWRKAYGALKDSTKVGLAKVNSDFKELDIAIVKATNHVECPPKERHVRKIFFATSANR  60

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRADV YCI+AL+RRL+KT NW VALKTLIV+HR LREGDPTF+EE L +  RG +L ++
Sbjct  61   PRADVTYCIYALSRRLSKTKNWIVALKTLIVVHRLLREGDPTFKEEFLAYTYRGNILHIA  120

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKDDSS +AWDCSAWVRTYALFLEERLECFRVLKYDIE ERL + P Q   KG+SKTR 
Sbjct  121  NFKDDSSQLAWDCSAWVRTYALFLEERLECFRVLKYDIETERLMRSP-QCSSKGHSKTRT  179

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            L   +LL+QLPALQQLL+R++G +PEGAA  NY+IQYALALV+KESFKIYCAINDGIINL
Sbjct  180  LPCPDLLEQLPALQQLLFRVVGVQPEGAACSNYLIQYALALVVKESFKIYCAINDGIINL  239

Query  949  VDKFFEMPR  975
            VD FF+MP+
Sbjct  240  VDMFFDMPK  248



>ref|XP_002867587.1| hypothetical protein ARALYDRAFT_492223 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43846.1| hypothetical protein ARALYDRAFT_492223 [Arabidopsis lyrata subsp. 
lyrata]
Length=596

 Score =   378 bits (971),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 192/258 (74%), Positives = 217/258 (84%), Gaps = 6/258 (2%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M T  ++RKA GA+KD T V +A VNS+FKD+DVAIVKATNHVE  PKERH+RKI   TS
Sbjct  1    MATFNSFRKAVGAIKDSTTVSIAKVNSEFKDLDVAIVKATNHVESAPKERHIRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             V+PRADVAYCIHALA+RL+KT NW VA+K LIVIHRTLREGDPTFREELLN+  RG +L
Sbjct  61   VVQPRADVAYCIHALAKRLSKTRNWVVAIKVLIVIHRTLREGDPTFREELLNYSHRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKG---  750
            ++SNFKDD+SP+AWDCSAW+RTYALFLEERLEC+RVLKYDIEAERLPK      + G   
Sbjct  121  RISNFKDDTSPLAWDCSAWIRTYALFLEERLECYRVLKYDIEAERLPKGSGASSKNGDFN  180

Query  751  ---YSKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYC  921
                 +TR L+ EELL+QLPALQQLLYRLIGC+PEGAA  NY+IQYALALVLKESFKIYC
Sbjct  181  ASQTYRTRMLSDEELLEQLPALQQLLYRLIGCQPEGAAYSNYLIQYALALVLKESFKIYC  240

Query  922  AINDGIINLVDKFFEMPR  975
            AINDGIINLVD FFEM R
Sbjct  241  AINDGIINLVDMFFEMSR  258



>ref|XP_009398623.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009398624.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=557

 Score =   376 bits (966),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 188/249 (76%), Positives = 217/249 (87%), Gaps = 1/249 (0%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            + TWRKAYGALKD T VGLA VNS+FK++DVAIVKATNHVECPPKERH+R+I V T+A R
Sbjct  1    MGTWRKAYGALKDSTMVGLAKVNSEFKELDVAIVKATNHVECPPKERHVRRIFVATAATR  60

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRADV YCI+AL RRL+KT NWTVA+KTLIVIHRTLREGDPTF+EELL+   RG +LQ+S
Sbjct  61   PRADVTYCIYALGRRLSKTRNWTVAVKTLIVIHRTLREGDPTFQEELLSCSHRGSILQIS  120

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKDD   +AWDCSAWVRTYAL+LEERL+CFR+LKYDIE ER  K P Q   K +S+TR 
Sbjct  121  NFKDDLGSLAWDCSAWVRTYALYLEERLKCFRILKYDIETERQMKSP-QESAKWHSRTRS  179

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            L   +LL+QLPALQQL++RLIGC+PEGAA GN++IQYALALVLKESFKIYCAINDGIINL
Sbjct  180  LCCPDLLEQLPALQQLMFRLIGCQPEGAAFGNFLIQYALALVLKESFKIYCAINDGIINL  239

Query  949  VDKFFEMPR  975
            +D FFEMP+
Sbjct  240  MDMFFEMPK  248



>ref|XP_006586993.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Glycine max]
Length=596

 Score =   377 bits (967),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 189/252 (75%), Positives = 222/252 (88%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT Q++RKAYGALKD TKVGLA VNS++K++D+AIVKATNHVE PPKERH+RKI   TS
Sbjct  1    MGTFQSFRKAYGALKDSTKVGLAKVNSEYKELDIAIVKATNHVEYPPKERHVRKIFYATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A +PRADVAYCIH L++RL+KT +W VA+KTLIVIHRTLREGDPTFREE+LN+ +RG +L
Sbjct  61   AHQPRADVAYCIHKLSKRLSKTQSWIVAIKTLIVIHRTLREGDPTFREEILNYSRRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
             +SNFKDDSSP+AWDCSAWVR YALFLEERLECFRVLKYDIE+ERL K  +    K +S+
Sbjct  121  HISNFKDDSSPLAWDCSAWVRVYALFLEERLECFRVLKYDIESERLTK-ASPAVNKAHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+S +LL+QLPALQQLLYRLIGC+PEG A  N+++QYALALVLKESFKIYCA+NDGI
Sbjct  180  TRLLDSNDLLEQLPALQQLLYRLIGCQPEGCAYRNHLVQYALALVLKESFKIYCALNDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+M R
Sbjct  240  INLVDMFFDMTR  251



>gb|EMT16298.1| Putative clathrin assembly protein [Aegilops tauschii]
Length=657

 Score =   379 bits (972),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 199/297 (67%), Positives = 226/297 (76%), Gaps = 46/297 (15%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFK------------------------------  309
            M  LQ+WRKAYGALKD T V LA +NSDFK                              
Sbjct  1    MSALQSWRKAYGALKDTTTVSLASLNSDFKVPPSSPSPGAKFARFSSPPFPQPSEARGSV  60

Query  310  ---------DVDVAIVKATNHVECPPKERHLR------KIMVYTSAVRPRADVAYCIHAL  444
                     D+DVAIVKATNHVECPPK+RHLR      +I+  +S  RP+ADVAYCIHAL
Sbjct  61   AARTRFGSVDLDVAIVKATNHVECPPKDRHLRIGGGVAEIVAASSMARPQADVAYCIHAL  120

Query  445  ARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMSNFKDDSSPIAWD  624
            ARRL KT +W VALKTL+VIHR LR+GDPTFREELLNF QR ++LQ+SNFKD+SSPIAWD
Sbjct  121  ARRLTKTRSWIVALKTLVVIHRLLRDGDPTFREELLNFTQRVQILQLSNFKDNSSPIAWD  180

Query  625  CSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRELNSEElldqlpa  804
             S+WVRTY LFLEERL+CFR+LKYDIEAERLPK   QG EK +S+TREL+S+ LL+Q+PA
Sbjct  181  YSSWVRTYGLFLEERLQCFRILKYDIEAERLPK-QGQGTEKAHSQTRELDSQALLEQMPA  239

Query  805  lqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINLVDKFFEMPR  975
            LQQLLYRLIGC+PEGAA  NY++QYALALVLKESFKIYCAINDGIINLVDKFFEMPR
Sbjct  240  LQQLLYRLIGCQPEGAANTNYLVQYALALVLKESFKIYCAINDGIINLVDKFFEMPR  296



>gb|KHN15336.1| Putative clathrin assembly protein [Glycine soja]
Length=596

 Score =   376 bits (966),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 190/252 (75%), Positives = 222/252 (88%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT Q++RKAYGALKD TKVGLA VNS++K++D+AIVKATNHVE PPKERH+RKI   T 
Sbjct  1    MGTFQSFRKAYGALKDSTKVGLAKVNSEYKELDIAIVKATNHVEYPPKERHVRKIFCATL  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A +PRADVAYCIH LA+RL+KT +W VA+KTLIVIHRTLREGDPTFREE+LN+ +RG +L
Sbjct  61   AHQPRADVAYCIHKLAKRLSKTRSWIVAIKTLIVIHRTLREGDPTFREEILNYSRRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFRVLKYDIE+ERL K  +      +SK
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECFRVLKYDIESERLTK-ASPVVNNVHSK  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+S++LL+QLPALQQLLYRLIGC+PEG A  N+++QYALALVLKESFKIYC +NDGI
Sbjct  180  TRSLDSDDLLEQLPALQQLLYRLIGCQPEGCAYSNHLVQYALALVLKESFKIYCTLNDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+M R
Sbjct  240  INLVDVFFDMTR  251



>ref|XP_010545389.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X1 [Tarenaya hassleriana]
Length=573

 Score =   375 bits (964),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 188/252 (75%), Positives = 216/252 (86%), Gaps = 2/252 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MG+   +RKAYGALKD T VGLA VNS+FKD+DVA+VKATNHVECPPKERH+RKI    S
Sbjct  1    MGSFPNFRKAYGALKDSTTVGLAKVNSEFKDLDVAVVKATNHVECPPKERHVRKIFSAVS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             V+PRADVAYCIHAL++RL+K+ NW VA+K LIVIHRTLREGDPTFR+ELLN+  RG +L
Sbjct  61   EVQPRADVAYCIHALSKRLSKSRNWIVAIKVLIVIHRTLREGDPTFRKELLNYSHRGHLL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNFKDDSSP+AWDCSAWVRTYALFLEERLEC+RVL YDIEAE L K  + G      +
Sbjct  121  RISNFKDDSSPLAWDCSAWVRTYALFLEERLECYRVLNYDIEAELLQK--SSGASMQTYR  178

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+ EE+LDQLPALQQLL+RL+GC+PEGAA  NY+IQYAL LVLKESFKIYCAINDGI
Sbjct  179  TRMLSGEEVLDQLPALQQLLFRLVGCQPEGAAYSNYLIQYALTLVLKESFKIYCAINDGI  238

Query  940  INLVDKFFEMPR  975
            INLVD FFEM +
Sbjct  239  INLVDMFFEMSK  250



>ref|XP_006413249.1| hypothetical protein EUTSA_v10024721mg [Eutrema salsugineum]
 gb|ESQ54702.1| hypothetical protein EUTSA_v10024721mg [Eutrema salsugineum]
Length=599

 Score =   376 bits (966),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 190/252 (75%), Positives = 215/252 (85%), Gaps = 5/252 (2%)
 Frame = +1

Query  235  TWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVRPR  414
            ++RKA GALKD T V +A VNS+FKD+DVAIVKATNHVE  PKERH+RKI   TS  RPR
Sbjct  4    SFRKAVGALKDSTTVSIAKVNSEFKDLDVAIVKATNHVESAPKERHIRKIFSATSVTRPR  63

Query  415  ADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMSNF  594
            ADVAYCIHALA+RL+KTHNW VA+K LIVIHRTLREGDPTFREE LN+  RG +L++SNF
Sbjct  64   ADVAYCIHALAKRLSKTHNWVVAIKVLIVIHRTLREGDPTFREEFLNYSHRGHILRISNF  123

Query  595  KDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYS-----K  759
            KDD+SP+AWDCSAW+RTYALFLEERLEC+RVLKYDIEAERLPK      +  ++     +
Sbjct  124  KDDTSPLAWDCSAWIRTYALFLEERLECYRVLKYDIEAERLPKGSGASSKVDFNASQTYR  183

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+ EELL+QLPALQQLLYRLIGC+PEGAA  NY+IQYALALVLKESFKIYCAINDGI
Sbjct  184  TRMLSDEELLEQLPALQQLLYRLIGCKPEGAAYSNYLIQYALALVLKESFKIYCAINDGI  243

Query  940  INLVDKFFEMPR  975
            INLVD FFEM R
Sbjct  244  INLVDLFFEMSR  255



>ref|XP_004231715.1| PREDICTED: putative clathrin assembly protein At5g57200 [Solanum 
lycopersicum]
Length=578

 Score =   375 bits (964),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 214/249 (86%), Gaps = 1/249 (0%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            ++++RKAYGALKD TKVGLA VNS+FKD+D+AIVKATNHVE PPKERH+  I   TS  R
Sbjct  1    MESFRKAYGALKDSTKVGLAKVNSEFKDLDIAIVKATNHVESPPKERHVAMIFAATSVTR  60

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRADVAYCIHAL+RRLAKT NW VALK+LIVIHR LREGDPTF+EELL+F  RG + Q+S
Sbjct  61   PRADVAYCIHALSRRLAKTRNWIVALKSLIVIHRVLREGDPTFKEELLHFSHRGHIFQIS  120

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKD+SSP+AWDCSAWVRTY LFLEERLECFR LKYDI+ ERL K    G  K +S+TR 
Sbjct  121  NFKDESSPLAWDCSAWVRTYGLFLEERLECFRNLKYDIDGERLTK-TTPGINKVHSRTRL  179

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            LN EELL+QLPALQQLLYRLIGC+PEG A  N++IQYALALVLKESFKIYCAINDGIINL
Sbjct  180  LNGEELLNQLPALQQLLYRLIGCQPEGGACYNFLIQYALALVLKESFKIYCAINDGIINL  239

Query  949  VDKFFEMPR  975
            VD FFEM +
Sbjct  240  VDFFFEMSK  248



>ref|XP_006597797.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Glycine max]
Length=595

 Score =   376 bits (965),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 191/253 (75%), Positives = 222/253 (88%), Gaps = 3/253 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT Q++RKAYGALKD TKVGLA VNS++K++D+AIVKATNHVE PPKERH+RKI   T 
Sbjct  1    MGTFQSFRKAYGALKDSTKVGLAKVNSEYKELDIAIVKATNHVEYPPKERHVRKIFCATL  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A +PRADVAYCIH LA+RL+KT +W VA+KTLIVIHRTLREGDPTFREE+LN+ +RG +L
Sbjct  61   AHQPRADVAYCIHKLAKRLSKTRSWIVAIKTLIVIHRTLREGDPTFREEILNYSRRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPK-PPAQGQEKGYS  756
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFRVLKYDIE+ERL K  P     +  S
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECFRVLKYDIESERLTKASPVVNNVR--S  178

Query  757  KTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDG  936
            KTR L+S++LL+QLPALQQLLYRLIGC+PEG A  N+++QYALALVLKESFKIYC +NDG
Sbjct  179  KTRSLDSDDLLEQLPALQQLLYRLIGCQPEGCAYSNHLVQYALALVLKESFKIYCTLNDG  238

Query  937  IINLVDKFFEMPR  975
            IINLVD FF+M R
Sbjct  239  IINLVDVFFDMTR  251



>ref|XP_010545391.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X2 [Tarenaya hassleriana]
Length=572

 Score =   375 bits (963),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 189/252 (75%), Positives = 217/252 (86%), Gaps = 3/252 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MG+   +RKAYGALKD T VGLA VNS+FKD+DVA+VKATNHVECPPKERH+RKI    S
Sbjct  1    MGSFPNFRKAYGALKDSTTVGLAKVNSEFKDLDVAVVKATNHVECPPKERHVRKIFSAVS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             V+PRADVAYCIHAL++RL+K+ NW VA+K LIVIHRTLREGDPTFR+ELLN+  RG +L
Sbjct  61   EVQPRADVAYCIHALSKRLSKSRNWIVAIKVLIVIHRTLREGDPTFRKELLNYSHRGHLL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNFKDDSSP+AWDCSAWVRTYALFLEERLEC+RVL YDIEAE L K  + G    Y +
Sbjct  121  RISNFKDDSSPLAWDCSAWVRTYALFLEERLECYRVLNYDIEAELLQK--SSGASMTY-R  177

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+ EE+LDQLPALQQLL+RL+GC+PEGAA  NY+IQYAL LVLKESFKIYCAINDGI
Sbjct  178  TRMLSGEEVLDQLPALQQLLFRLVGCQPEGAAYSNYLIQYALTLVLKESFKIYCAINDGI  237

Query  940  INLVDKFFEMPR  975
            INLVD FFEM +
Sbjct  238  INLVDMFFEMSK  249



>ref|XP_009595317.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X2 [Nicotiana tomentosiformis]
Length=622

 Score =   377 bits (967),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 193/249 (78%), Positives = 214/249 (86%), Gaps = 1/249 (0%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            ++++RKAYGALKD TKVGLA VNSDFKD+D+AIVKATNHVE PPKERH+  I   TS  R
Sbjct  46   MESFRKAYGALKDSTKVGLAKVNSDFKDLDIAIVKATNHVESPPKERHVAMIFAATSVTR  105

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRADVAYCIHAL+RRLAKT NW VALKTLIVIHR LREGDPTF+EELL+F  RG + Q+S
Sbjct  106  PRADVAYCIHALSRRLAKTRNWIVALKTLIVIHRVLREGDPTFKEELLHFSHRGHIFQIS  165

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKDDSS +AWDCSAWVRTY LFLEERLECFR LKYDIEAERL K  + G  K +S+TR 
Sbjct  166  NFKDDSSTLAWDCSAWVRTYGLFLEERLECFRTLKYDIEAERLTK-TSPGISKVHSRTRL  224

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            LN EELL+QLPALQQLLYRLI C+PEG A  N++IQYALALVLKESFKIYCAINDGIINL
Sbjct  225  LNGEELLEQLPALQQLLYRLICCQPEGGACYNFLIQYALALVLKESFKIYCAINDGIINL  284

Query  949  VDKFFEMPR  975
            VD FFEM +
Sbjct  285  VDFFFEMSK  293



>ref|XP_006346667.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Solanum tuberosum]
Length=573

 Score =   375 bits (963),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 214/249 (86%), Gaps = 1/249 (0%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            ++++RKAYGALKD TKVGLA VNS+FKD+D+AIVKATNHVE PPKERH+  I   TS  R
Sbjct  1    MESFRKAYGALKDSTKVGLAKVNSEFKDLDIAIVKATNHVESPPKERHVAMIFAATSVTR  60

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRADVAYCIHAL+RRLAKT NW VALK+LIVIHR LREGDPTF+EELL+F  RG + Q+S
Sbjct  61   PRADVAYCIHALSRRLAKTRNWIVALKSLIVIHRVLREGDPTFKEELLHFSHRGHIFQIS  120

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKD+SSP+AWDCSAWVRTY LFLEERLECFR LKYDI+ ERL K    G  K +S+TR 
Sbjct  121  NFKDESSPLAWDCSAWVRTYGLFLEERLECFRNLKYDIDGERLTK-TTPGINKVHSRTRL  179

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            LN EELL+QLPALQQLLYRLIGC+PEG A  N++IQYALALVLKESFKIYCAINDGIINL
Sbjct  180  LNGEELLNQLPALQQLLYRLIGCQPEGGACYNFLIQYALALVLKESFKIYCAINDGIINL  239

Query  949  VDKFFEMPR  975
            VD FFEM +
Sbjct  240  VDFFFEMSK  248



>gb|AAF79231.1|AC006917_16 F10B6.32 [Arabidopsis thaliana]
Length=813

 Score =   382 bits (980),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 205/322 (64%), Positives = 234/322 (73%), Gaps = 71/322 (22%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQ+WR+AYGALKD TKVGL  VNSD+ ++DVAIVKATNHVECPPK+RHLRKI + TS
Sbjct  1    MGTLQSWRRAYGALKDTTKVGLVRVNSDYAELDVAIVKATNHVECPPKDRHLRKIFLATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHAL+RRL KT NWTVALK L+VIHR LR+GDPTFREELLNF Q+GR++
Sbjct  61   AIRPRADVAYCIHALSRRLHKTRNWTVALKALLVIHRLLRDGDPTFREELLNFSQKGRIM  120

Query  580  QMSNFKDDSSPI---------------------------------------AWDCSAWVR  642
            Q+SNFKDDSSP+                                       AWDCS WVR
Sbjct  121  QISNFKDDSSPVGESLLLHSRVYVFLEANEVHSRFLHRVIVDMVFALCLLTAWDCSGWVR  180

Query  643  TYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRELNSEElldqlpalqqllY  822
            TYALFLEERLECFRVLKYDIEAERLPK  + GQEKGYSKTR+L+ E+LL+QLPALQQLL+
Sbjct  181  TYALFLEERLECFRVLKYDIEAERLPK-VSPGQEKGYSKTRDLDGEKLLEQLPALQQLLH  239

Query  823  RLIGCR---------------PEGAAVGNYVIQYALALVLKESFKIYCAINDGIINLVDK  957
            RLIGC+               PEGAA  N++IQYAL+LVLKESFK+YCAIN+GIINLV+K
Sbjct  240  RLIGCKLFLTYELTLLFRLFQPEGAAKHNHIIQYALSLVLKESFKVYCAINEGIINLVEK  299

Query  958  ----------------FFEMPR  975
                            FFEMPR
Sbjct  300  VGQFFLFPQSYSLPSCFFEMPR  321



>gb|KHN35810.1| Putative clathrin assembly protein [Glycine soja]
Length=593

 Score =   375 bits (963),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 188/252 (75%), Positives = 220/252 (87%), Gaps = 4/252 (2%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT Q++RKAYGALKD TKVGLA VNS++K++D+AIVKATNHVE PPKERH+RKI   TS
Sbjct  1    MGTFQSFRKAYGALKDSTKVGLAKVNSEYKELDIAIVKATNHVEYPPKERHVRKIFYATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A +PRADVAYCIH L++RL+KT +W VA+KTLIVIHRTLREGDPTFREE+LN+ +RG +L
Sbjct  61   AHQPRADVAYCIHKLSKRLSKTQSWIVAIKTLIVIHRTLREGDPTFREEILNYSRRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
             +SNFKDDSSP+AWDCSAWVR YALFLEERLECFRVLKYDIE+ERL K         +S+
Sbjct  121  HISNFKDDSSPLAWDCSAWVRVYALFLEERLECFRVLKYDIESERLTK----ASPAAHSR  176

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L+S +LL+QLPALQQLLYRLIGC+PEG A  N+++QYALALVLKESFKIYCA+NDGI
Sbjct  177  TRLLDSNDLLEQLPALQQLLYRLIGCQPEGCAYRNHLVQYALALVLKESFKIYCALNDGI  236

Query  940  INLVDKFFEMPR  975
            INLVD FF+M R
Sbjct  237  INLVDMFFDMTR  248



>ref|XP_009595316.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X1 [Nicotiana tomentosiformis]
Length=622

 Score =   376 bits (966),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 193/249 (78%), Positives = 214/249 (86%), Gaps = 1/249 (0%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            ++++RKAYGALKD TKVGLA VNSDFKD+D+AIVKATNHVE PPKERH+  I   TS  R
Sbjct  46   MESFRKAYGALKDSTKVGLAKVNSDFKDLDIAIVKATNHVESPPKERHVAMIFAATSVTR  105

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRADVAYCIHAL+RRLAKT NW VALKTLIVIHR LREGDPTF+EELL+F  RG + Q+S
Sbjct  106  PRADVAYCIHALSRRLAKTRNWIVALKTLIVIHRVLREGDPTFKEELLHFSHRGHIFQIS  165

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKDDSS +AWDCSAWVRTY LFLEERLECFR LKYDIEAERL K  + G  K +S+TR 
Sbjct  166  NFKDDSSTLAWDCSAWVRTYGLFLEERLECFRTLKYDIEAERLTK-TSPGISKVHSRTRL  224

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            LN EELL+QLPALQQLLYRLI C+PEG A  N++IQYALALVLKESFKIYCAINDGIINL
Sbjct  225  LNGEELLEQLPALQQLLYRLICCQPEGGACYNFLIQYALALVLKESFKIYCAINDGIINL  284

Query  949  VDKFFEMPR  975
            VD FFEM +
Sbjct  285  VDFFFEMSK  293



>ref|XP_006593512.1| PREDICTED: putative clathrin assembly protein At4g25940-like 
[Glycine max]
Length=574

 Score =   374 bits (961),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 187/252 (74%), Positives = 221/252 (88%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT QT RKAYGALKD T VGLA VNS++K++D+AIVKAT+HVE PPKERH+RKI   TS
Sbjct  1    MGTFQTLRKAYGALKDSTTVGLAKVNSEYKELDIAIVKATSHVEYPPKERHVRKIFYATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A +PRADVAYCIH LA+RL+KT NW VA+KTLIVIHR LREGDPTF+++L+N+ +RGR L
Sbjct  61   AHQPRADVAYCIHTLAKRLSKTRNWIVAIKTLIVIHRILREGDPTFKDDLINYARRGRFL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSS +AWDCSAW+RTYALFLEE+LE FR+L+ DIEAERL K P+  + +G+S+
Sbjct  121  QISNFKDDSSALAWDCSAWIRTYALFLEEKLEYFRILRCDIEAERLTK-PSPTKTQGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L SEELL+QLPALQQLLYRLIGC PEG A  NY+IQYALAL+LKESFKIYCA+NDGI
Sbjct  180  TRMLTSEELLEQLPALQQLLYRLIGCEPEGLAFSNYLIQYALALILKESFKIYCALNDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+MP+
Sbjct  240  INLVDVFFDMPK  251



>ref|XP_006413250.1| hypothetical protein EUTSA_v10024721mg [Eutrema salsugineum]
 gb|ESQ54703.1| hypothetical protein EUTSA_v10024721mg [Eutrema salsugineum]
Length=600

 Score =   375 bits (963),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 191/253 (75%), Positives = 214/253 (85%), Gaps = 6/253 (2%)
 Frame = +1

Query  235  TWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVRPR  414
            ++RKA GALKD T V +A VNS+FKD+DVAIVKATNHVE  PKERH+RKI   TS  RPR
Sbjct  4    SFRKAVGALKDSTTVSIAKVNSEFKDLDVAIVKATNHVESAPKERHIRKIFSATSVTRPR  63

Query  415  ADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMSNF  594
            ADVAYCIHALA+RL+KTHNW VA+K LIVIHRTLREGDPTFREE LN+  RG +L++SNF
Sbjct  64   ADVAYCIHALAKRLSKTHNWVVAIKVLIVIHRTLREGDPTFREEFLNYSHRGHILRISNF  123

Query  595  KDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEK------GYS  756
            KDD+SP+AWDCSAW+RTYALFLEERLEC+RVLKYDIEAERLPK      +K         
Sbjct  124  KDDTSPLAWDCSAWIRTYALFLEERLECYRVLKYDIEAERLPKGSGASSKKVDFNASQTY  183

Query  757  KTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDG  936
            +TR L+ EELL+QLPALQQLLYRLIGC+PEGAA  NY+IQYALALVLKESFKIYCAINDG
Sbjct  184  RTRMLSDEELLEQLPALQQLLYRLIGCKPEGAAYSNYLIQYALALVLKESFKIYCAINDG  243

Query  937  IINLVDKFFEMPR  975
            IINLVD FFEM R
Sbjct  244  IINLVDLFFEMSR  256



>gb|KHN22664.1| Putative clathrin assembly protein [Glycine soja]
Length=574

 Score =   374 bits (960),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 187/252 (74%), Positives = 221/252 (88%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT QT RKAYGALKD T VGLA VNS++K++D+AIVKAT+HVE PPKERH+RKI   TS
Sbjct  1    MGTFQTLRKAYGALKDSTTVGLAKVNSEYKELDIAIVKATSHVEYPPKERHVRKIFYATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            + +PRADVAYCIH LA+RL+KT NW VA+KTLIVIHR LREGDPTF+++L+N+ +RGR L
Sbjct  61   SHQPRADVAYCIHTLAKRLSKTRNWIVAIKTLIVIHRILREGDPTFKDDLINYARRGRFL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSS +AWDCSAWVRTYALFLEE+LE FR+L+ DIEAERL K P+  + +G+S+
Sbjct  121  QISNFKDDSSALAWDCSAWVRTYALFLEEKLEYFRILRCDIEAERLTK-PSPTKTQGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L SEELL+QLPALQQLLYRLIGC PEG A  NY+IQYALAL+LKESFKIYCA+NDGI
Sbjct  180  TRMLTSEELLEQLPALQQLLYRLIGCEPEGLAFSNYLIQYALALILKESFKIYCALNDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+MP+
Sbjct  240  INLVDVFFDMPK  251



>emb|CDX94400.1| BnaC01g17840D [Brassica napus]
Length=596

 Score =   375 bits (962),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 189/258 (73%), Positives = 220/258 (85%), Gaps = 6/258 (2%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M T  ++RKA GALKD T V +A VNS+FKD+DVAIVK+TNHVE  PKERH+RKI   TS
Sbjct  1    MATFHSFRKAVGALKDSTTVSIAKVNSEFKDLDVAIVKSTNHVESAPKERHIRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            AVRPRADVAYCIHALA+RL++THNW VA+K LIVIHRTLREGDPTFR+ELLN+  RG +L
Sbjct  61   AVRPRADVAYCIHALAKRLSRTHNWVVAIKVLIVIHRTLREGDPTFRDELLNYSHRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPK-PPAQGQEKGYS  756
            ++SNFKDD+SP+AWDCSAW+RTYALFLEERLEC+RVLKYDIEAERLPK   A  +   ++
Sbjct  121  RISNFKDDTSPLAWDCSAWIRTYALFLEERLECYRVLKYDIEAERLPKGSGASSKNVDFN  180

Query  757  -----KTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYC  921
                 +TR L++EELL+QLPALQQLL+RL GC+PEGA   NY+IQYALALVLKESFK+YC
Sbjct  181  ASQTYRTRMLSNEELLEQLPALQQLLFRLTGCKPEGAGYSNYLIQYALALVLKESFKVYC  240

Query  922  AINDGIINLVDKFFEMPR  975
            AINDGIINLVD FFEM R
Sbjct  241  AINDGIINLVDLFFEMSR  258



>emb|CDX89382.1| BnaA01g15110D [Brassica napus]
Length=601

 Score =   374 bits (961),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 188/258 (73%), Positives = 217/258 (84%), Gaps = 6/258 (2%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M T  ++RKA GALKD T V +A VNS+FKD+DVAIVK+TNHVE  PKERH+RKI   TS
Sbjct  1    MATFHSFRKAVGALKDSTTVSIAKVNSEFKDLDVAIVKSTNHVESAPKERHIRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHALA+RL++THNW VA+K LIVIHRTLREGDPTFR+ELLN+  RG +L
Sbjct  61   AIRPRADVAYCIHALAKRLSRTHNWVVAIKVLIVIHRTLREGDPTFRDELLNYSHRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEK----  747
            ++SNFKDD+SP+AWDCSAW+RTYALFLEERLEC+RVLKYDIEAERLPK      +     
Sbjct  121  RISNFKDDTSPLAWDCSAWIRTYALFLEERLECYRVLKYDIEAERLPKGSGASSKNVDLN  180

Query  748  --GYSKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYC  921
                 +TR L++EELL+QLPALQQLL+RL GC+PEGA   NY+IQYALALVLKESFKIYC
Sbjct  181  ASQTYRTRMLSNEELLEQLPALQQLLFRLTGCKPEGAGYSNYLIQYALALVLKESFKIYC  240

Query  922  AINDGIINLVDKFFEMPR  975
            AINDGIINLVD FFEM R
Sbjct  241  AINDGIINLVDLFFEMSR  258



>ref|XP_004487990.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
isoform X1 [Cicer arietinum]
Length=590

 Score =   374 bits (960),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 186/252 (74%), Positives = 221/252 (88%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  ++RKAYGALKD TKVGLA VNS++K++DVAIVKATNH E PPKERH+RKI   TS
Sbjct  1    MGTFTSFRKAYGALKDSTKVGLAKVNSEYKELDVAIVKATNHNEYPPKERHVRKIFYATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A +PRADVAYCIH L++RL+KT +W VA+KTLIVIHRTLREGDPTFREELLN+ +RG +L
Sbjct  61   AHQPRADVAYCIHKLSKRLSKTRSWIVAVKTLIVIHRTLREGDPTFREELLNYSRRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFR+LKYDIE+ERL K  +    K +S+
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECFRILKYDIESERLVK-SSPASTKAHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L +++LL+QLPALQQLL+RL+GC+PEG A  NY++QYALAL+LKESFKIYCA+NDGI
Sbjct  180  TRSLANDDLLEQLPALQQLLFRLVGCQPEGCAYNNYLVQYALALILKESFKIYCALNDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+  R
Sbjct  240  INLVDMFFDTSR  251



>ref|XP_002453380.1| hypothetical protein SORBIDRAFT_04g005060 [Sorghum bicolor]
 gb|EES06356.1| hypothetical protein SORBIDRAFT_04g005060 [Sorghum bicolor]
Length=570

 Score =   373 bits (958),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 185/249 (74%), Positives = 216/249 (87%), Gaps = 1/249 (0%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            + +WRKAYGALKD T VGLA VNS+FK++D+AIVKATNHVECPPKERH+RKI++ TSA R
Sbjct  1    MGSWRKAYGALKDSTTVGLAKVNSEFKELDIAIVKATNHVECPPKERHVRKILLATSANR  60

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRADV+YC++AL+RRL+KT NW VALKTLIV+HR LREGDPTF+EE L +  RG +L ++
Sbjct  61   PRADVSYCMYALSRRLSKTKNWIVALKTLIVVHRLLREGDPTFKEEFLAYSSRGNILYIA  120

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKDDSS  AWDCSAWVRTYA FLEERLECFRVLKYDIE ERL + P Q   K +SKTR 
Sbjct  121  NFKDDSSQSAWDCSAWVRTYAFFLEERLECFRVLKYDIETERLVRYP-QTSSKAHSKTRN  179

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            L S ELL+QLPALQQLL+R++G +PEGAA  NY+IQYALALVLKESFKIYC+INDGIINL
Sbjct  180  LPSPELLEQLPALQQLLFRVVGVQPEGAACSNYLIQYALALVLKESFKIYCSINDGIINL  239

Query  949  VDKFFEMPR  975
            VD FF+MP+
Sbjct  240  VDMFFDMPK  248



>emb|CDY47927.1| BnaA02g08290D [Brassica napus]
Length=505

 Score =   371 bits (952),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 190/254 (75%), Positives = 217/254 (85%), Gaps = 4/254 (2%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  + RKAYGALKD T VGLA VNS+FKD+D+AIVKATNHVE PPKERH+RKI   TS
Sbjct  1    MGTFTSLRKAYGALKDSTTVGLAKVNSEFKDLDIAIVKATNHVESPPKERHVRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             ++PRAD+AYCIHAL++RL++T  W VA+K LIVIHRTLREGDPTFREELLN+  R  +L
Sbjct  61   VIQPRADIAYCIHALSKRLSRTRTWVVAMKVLIVIHRTLREGDPTFREELLNYSHRRHIL  120

Query  580  QMSNFKDDSSP--IAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGY  753
            ++SNFKDD+SP   +WDCSAWVRTYALFLEERLEC+RVLKYDIEAERLPK  A G     
Sbjct  121  RISNFKDDTSPRGGSWDCSAWVRTYALFLEERLECYRVLKYDIEAERLPK--ASGAASKT  178

Query  754  SKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAIND  933
             +TR L+ E+LL+QLPALQQLL+RLIGC+PEGAA  NY+IQYALALVLKESFKIYCAIND
Sbjct  179  HRTRMLSGEDLLEQLPALQQLLFRLIGCQPEGAAYSNYLIQYALALVLKESFKIYCAIND  238

Query  934  GIINLVDKFFEMPR  975
            GIINLVD FFEM R
Sbjct  239  GIINLVDMFFEMTR  252



>ref|XP_009139694.1| PREDICTED: putative clathrin assembly protein At4g25940 [Brassica 
rapa]
Length=601

 Score =   374 bits (960),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 188/258 (73%), Positives = 217/258 (84%), Gaps = 6/258 (2%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M T  ++RKA GALKD T V +A VNS+FKD+DVAIVK+TNHVE  PKERH+RKI   TS
Sbjct  1    MATFHSFRKAVGALKDSTTVSIAKVNSEFKDLDVAIVKSTNHVESAPKERHIRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHALA+RL++THNW VA+K LIVIHRTLREGDPTFR+ELLN+  RG +L
Sbjct  61   AIRPRADVAYCIHALAKRLSRTHNWVVAIKVLIVIHRTLREGDPTFRDELLNYSHRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEK----  747
            ++SNFKDD+SP+AWDCSAW+RTYALFLEERLEC+RVLKYDIEAERLPK      +     
Sbjct  121  RISNFKDDTSPLAWDCSAWIRTYALFLEERLECYRVLKYDIEAERLPKGSGASSKNVDLN  180

Query  748  --GYSKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYC  921
                 +TR L++EELL+QLPALQQLL+RL GC+PEGA   NY+IQYALALVLKESFKIYC
Sbjct  181  ASQTYRTRMLSNEELLEQLPALQQLLFRLTGCKPEGAGYSNYLIQYALALVLKESFKIYC  240

Query  922  AINDGIINLVDKFFEMPR  975
            AINDGIINLVD FFEM R
Sbjct  241  AINDGIINLVDLFFEMSR  258



>ref|XP_006600479.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Glycine max]
Length=574

 Score =   373 bits (957),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 188/252 (75%), Positives = 220/252 (87%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT QT RKAYGALKD T VGLA VNS++K++D+AIVKAT+HVE PPKERH+RKI   TS
Sbjct  1    MGTFQTLRKAYGALKDSTTVGLAKVNSEYKELDIAIVKATSHVEYPPKERHVRKIFYATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A +PRADVAYCIH LA+RL+KT NW VA+KTLIVIHR LREGDPTF+++L  + +RGR L
Sbjct  61   AHQPRADVAYCIHTLAKRLSKTRNWIVAIKTLIVIHRILREGDPTFKDDLTAYVRRGRFL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSS +AWDCSAWVRTYALFLEERLECFR+L+YDIEAERL K P+    +G+S+
Sbjct  121  QISNFKDDSSALAWDCSAWVRTYALFLEERLECFRILRYDIEAERLTK-PSPTITQGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L SE LL+QLPALQQLLYRLIGC PEG A+ N++IQYALAL+LKESFKIYCA+NDGI
Sbjct  180  TRMLTSEGLLEQLPALQQLLYRLIGCEPEGLALRNHLIQYALALILKESFKIYCALNDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+MP+
Sbjct  240  INLVDVFFDMPK  251



>emb|CAB39659.1| predicted protein destination factor [Arabidopsis thaliana]
 emb|CAB79449.1| predicted protein destination factor [Arabidopsis thaliana]
Length=574

 Score =   373 bits (957),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 190/258 (74%), Positives = 219/258 (85%), Gaps = 6/258 (2%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M T  ++RKA GA+KD T V +A VNS+FKD+DVAIVKATNHVE  PKERH+R+I   TS
Sbjct  1    MATFNSFRKAVGAIKDSTTVSIAKVNSEFKDLDVAIVKATNHVESAPKERHIRRIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             V+PRADVAYCIHALA+RL+KT NW VA+K LIVIHRTLREGDPTFREELLN+  RG +L
Sbjct  61   VVQPRADVAYCIHALAKRLSKTRNWVVAIKVLIVIHRTLREGDPTFREELLNYSHRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPK-PPAQGQEKGYS  756
            ++SNFKDD+SP+AWDCSAW+RTYALFLEERLEC+RVLKYDIEAERLPK   A  +   ++
Sbjct  121  RISNFKDDTSPLAWDCSAWIRTYALFLEERLECYRVLKYDIEAERLPKGSGASSKNVDFN  180

Query  757  -----KTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYC  921
                 +TR L+ EELL+QLPALQQLLYRLIGC+PEG+A  NY+IQYALALVLKESFKIYC
Sbjct  181  ASQTYRTRMLSDEELLEQLPALQQLLYRLIGCQPEGSAYSNYLIQYALALVLKESFKIYC  240

Query  922  AINDGIINLVDKFFEMPR  975
            AINDGIINLVD FFEM R
Sbjct  241  AINDGIINLVDMFFEMSR  258



>ref|XP_006283380.1| hypothetical protein CARUB_v10004424mg [Capsella rubella]
 gb|EOA16278.1| hypothetical protein CARUB_v10004424mg [Capsella rubella]
Length=421

 Score =   367 bits (941),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 190/258 (74%), Positives = 218/258 (84%), Gaps = 6/258 (2%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M T  ++RKA GA+KD T V +A VNS+FKD+DVAIVKATNHVE  PKERH+RKI   TS
Sbjct  1    MATFHSFRKAVGAIKDSTTVSIAKVNSEFKDLDVAIVKATNHVESAPKERHIRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             V+PRADVAYCIHALA+RL+KT NW VA+K LIVIHRTLREGDPTFREELLN+  RG +L
Sbjct  61   VVQPRADVAYCIHALAKRLSKTRNWVVAIKVLIVIHRTLREGDPTFREELLNYSHRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPP-AQGQEKGYS  756
            ++SNFKDD+SP+AWDCSAW+RTYALFLEERLEC+RVLKYDIEAERLPK   A  +   ++
Sbjct  121  RISNFKDDTSPLAWDCSAWIRTYALFLEERLECYRVLKYDIEAERLPKASGASSKNVDFN  180

Query  757  -----KTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYC  921
                 +TR L+ EELL+QLPALQQLLYRL+GC+PEG A  NY+IQYALALVLKESFKIYC
Sbjct  181  ATQTYRTRMLSEEELLEQLPALQQLLYRLVGCQPEGTAYSNYLIQYALALVLKESFKIYC  240

Query  922  AINDGIINLVDKFFEMPR  975
            AINDGIINLVD FFEM R
Sbjct  241  AINDGIINLVDMFFEMSR  258



>ref|XP_009757132.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X2 [Nicotiana sylvestris]
Length=585

 Score =   372 bits (955),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 213/249 (86%), Gaps = 1/249 (0%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            ++++RKAYGALKD TKVGLA VNS+FKD+D+AIVKATNHVE  PKERH+  I   TS  R
Sbjct  1    MESFRKAYGALKDSTKVGLAKVNSEFKDLDIAIVKATNHVESAPKERHVAMIFAATSVTR  60

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRADVAYCIHAL+RRL+KT NW VALKTLIVIHR LREGDPTF+EELL+F  RG + Q+S
Sbjct  61   PRADVAYCIHALSRRLSKTRNWIVALKTLIVIHRVLREGDPTFKEELLHFSHRGHIFQIS  120

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKDDSS +AWDCSAWVRTY LFLEERLECFR LKYDIEAERL K  + G  K +S+TR 
Sbjct  121  NFKDDSSTLAWDCSAWVRTYGLFLEERLECFRTLKYDIEAERLTK-TSPGISKVHSRTRH  179

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            LN EELL+QLPALQQLLYRLI C+PEG A  N++IQYALALVLKESFKIYCAINDGIINL
Sbjct  180  LNGEELLEQLPALQQLLYRLICCQPEGGACYNFLIQYALALVLKESFKIYCAINDGIINL  239

Query  949  VDKFFEMPR  975
            VD FFEM +
Sbjct  240  VDFFFEMSK  248



>gb|EMT23238.1| Putative clathrin assembly protein [Aegilops tauschii]
Length=536

 Score =   370 bits (951),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 179/249 (72%), Positives = 196/249 (79%), Gaps = 32/249 (13%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            +Q+WRKAYGA+KD T V LA++NSDFKD+DVAIVKATNHVECPPKERHLRKI   TS  R
Sbjct  1    MQSWRKAYGAIKDTTTVSLANINSDFKDLDVAIVKATNHVECPPKERHLRKIAAATSIAR  60

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRAD+AYCIHAL+RRL+KT NW VALKTL+V+HR LREGDPTFREELLNF QRGR+LQ+S
Sbjct  61   PRADIAYCIHALSRRLSKTRNWIVALKTLVVVHRLLREGDPTFREELLNFTQRGRILQLS  120

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKDDSSPIAWDCSAWVRTY  FLEERLECFR+LKYD+EAERL K   QG EK       
Sbjct  121  NFKDDSSPIAWDCSAWVRTYGQFLEERLECFRILKYDVEAERLSK-QGQGPEK-------  172

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
                                    PEGAA  NY++QYALALVLKESFKIYCAINDGIINL
Sbjct  173  ------------------------PEGAANNNYLVQYALALVLKESFKIYCAINDGIINL  208

Query  949  VDKFFEMPR  975
            VDKFFEM R
Sbjct  209  VDKFFEMAR  217



>ref|NP_194324.2| ENTH/ANTH/VHS superfamily protein [Arabidopsis thaliana]
 sp|Q8VYT2.1|CAP6_ARATH RecName: Full=Putative clathrin assembly protein At4g25940 [Arabidopsis 
thaliana]
 gb|AAL49802.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20067.1| putative protein destination factor [Arabidopsis thaliana]
 gb|AEE85135.1| ENTH/ANTH/VHS superfamily protein [Arabidopsis thaliana]
Length=601

 Score =   372 bits (956),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 190/258 (74%), Positives = 219/258 (85%), Gaps = 6/258 (2%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M T  ++RKA GA+KD T V +A VNS+FKD+DVAIVKATNHVE  PKERH+R+I   TS
Sbjct  1    MATFNSFRKAVGAIKDSTTVSIAKVNSEFKDLDVAIVKATNHVESAPKERHIRRIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             V+PRADVAYCIHALA+RL+KT NW VA+K LIVIHRTLREGDPTFREELLN+  RG +L
Sbjct  61   VVQPRADVAYCIHALAKRLSKTRNWVVAIKVLIVIHRTLREGDPTFREELLNYSHRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPK-PPAQGQEKGYS  756
            ++SNFKDD+SP+AWDCSAW+RTYALFLEERLEC+RVLKYDIEAERLPK   A  +   ++
Sbjct  121  RISNFKDDTSPLAWDCSAWIRTYALFLEERLECYRVLKYDIEAERLPKGSGASSKNVDFN  180

Query  757  -----KTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYC  921
                 +TR L+ EELL+QLPALQQLLYRLIGC+PEG+A  NY+IQYALALVLKESFKIYC
Sbjct  181  ASQTYRTRMLSDEELLEQLPALQQLLYRLIGCQPEGSAYSNYLIQYALALVLKESFKIYC  240

Query  922  AINDGIINLVDKFFEMPR  975
            AINDGIINLVD FFEM R
Sbjct  241  AINDGIINLVDMFFEMSR  258



>ref|XP_009757131.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X1 [Nicotiana sylvestris]
Length=585

 Score =   372 bits (954),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 213/249 (86%), Gaps = 1/249 (0%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            ++++RKAYGALKD TKVGLA VNS+FKD+D+AIVKATNHVE  PKERH+  I   TS  R
Sbjct  1    MESFRKAYGALKDSTKVGLAKVNSEFKDLDIAIVKATNHVESAPKERHVAMIFAATSVTR  60

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRADVAYCIHAL+RRL+KT NW VALKTLIVIHR LREGDPTF+EELL+F  RG + Q+S
Sbjct  61   PRADVAYCIHALSRRLSKTRNWIVALKTLIVIHRVLREGDPTFKEELLHFSHRGHIFQIS  120

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKDDSS +AWDCSAWVRTY LFLEERLECFR LKYDIEAERL K  + G  K +S+TR 
Sbjct  121  NFKDDSSTLAWDCSAWVRTYGLFLEERLECFRTLKYDIEAERLTK-TSPGISKVHSRTRH  179

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            LN EELL+QLPALQQLLYRLI C+PEG A  N++IQYALALVLKESFKIYCAINDGIINL
Sbjct  180  LNGEELLEQLPALQQLLYRLICCQPEGGACYNFLIQYALALVLKESFKIYCAINDGIINL  239

Query  949  VDKFFEMPR  975
            VD FFEM +
Sbjct  240  VDFFFEMSK  248



>gb|KHN17630.1| Putative clathrin assembly protein [Glycine soja]
Length=574

 Score =   371 bits (953),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 187/252 (74%), Positives = 219/252 (87%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT QT RKAYG LKD T VGLA VNS++K++D+AIVKAT+HVE PPKERH+RKI   TS
Sbjct  1    MGTFQTLRKAYGVLKDSTTVGLAKVNSEYKELDIAIVKATSHVEYPPKERHVRKIFYATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A +PRADVAYCIH LA+RL+KT NW VA+KTLIVIHR LREGDPTF+++L  + +RGR L
Sbjct  61   AHQPRADVAYCIHTLAKRLSKTRNWIVAIKTLIVIHRILREGDPTFKDDLTAYVRRGRFL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSS +AWDCSAWVRTYALFLEERLECFR+L+YDIEAERL K P+    +G+S+
Sbjct  121  QISNFKDDSSALAWDCSAWVRTYALFLEERLECFRILRYDIEAERLTK-PSPTITQGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L SE LL+QLPALQQLLYRLIGC PEG A+ N++IQYALAL+LKESFKIYCA+NDGI
Sbjct  180  TRMLTSEGLLEQLPALQQLLYRLIGCEPEGLALRNHLIQYALALILKESFKIYCALNDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FF+MP+
Sbjct  240  INLVDVFFDMPK  251



>ref|XP_010433571.1| PREDICTED: putative clathrin assembly protein At4g25940 [Camelina 
sativa]
Length=596

 Score =   371 bits (953),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 190/258 (74%), Positives = 216/258 (84%), Gaps = 6/258 (2%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M T  ++RKA GA+KD T V +A VNS+FKD+DVAIVKATNHVE  PKERH+RKI   TS
Sbjct  1    MATFHSFRKAVGAIKDSTTVSIAKVNSEFKDLDVAIVKATNHVESAPKERHMRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             V+PRADVAYCIHALA+RL+KT NW VA+K LIVIHRTLREGDPTFREELLN+ +RG +L
Sbjct  61   VVQPRADVAYCIHALAKRLSKTRNWVVAIKVLIVIHRTLREGDPTFREELLNYSRRGHML  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYS-  756
            ++SNFKDD+SP+AWDCSAW+RTYALFLEERLEC+R LKYDIEAERLPK      +   S 
Sbjct  121  RISNFKDDTSPLAWDCSAWIRTYALFLEERLECYRGLKYDIEAERLPKGSGASSKNVDSN  180

Query  757  -----KTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYC  921
                 +TR L+ EELL+QLPALQQLLYRLIGC+PEG A  NY+IQYALALVLKESFKIYC
Sbjct  181  ASQTYRTRMLSDEELLEQLPALQQLLYRLIGCQPEGTAYSNYLIQYALALVLKESFKIYC  240

Query  922  AINDGIINLVDKFFEMPR  975
            AINDGIINLVD FFEM R
Sbjct  241  AINDGIINLVDMFFEMSR  258



>gb|EEC72596.1| hypothetical protein OsI_06060 [Oryza sativa Indica Group]
Length=583

 Score =   370 bits (950),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 188/250 (75%), Positives = 216/250 (86%), Gaps = 2/250 (1%)
 Frame = +1

Query  229  LQTWR-KAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAV  405
            + +WR KAYGALKD TKVGLA VNSDFK++D+AIVKATNHVECPPK+RH+RKI V TS  
Sbjct  1    MGSWRRKAYGALKDSTKVGLAKVNSDFKELDIAIVKATNHVECPPKDRHVRKIFVATSIN  60

Query  406  RPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQM  585
            RPRADV YCI+AL+RRL+KT NWTVALKTLIV+HR LREGDPTF+EE L +  +G VLQ 
Sbjct  61   RPRADVQYCIYALSRRLSKTKNWTVALKTLIVVHRLLREGDPTFKEEFLAYSYKGSVLQR  120

Query  586  SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTR  765
            +NFKDDSS +AWDCSAWVR YALFLEERLECFR+LK+DIE ERL + P +   K +S+TR
Sbjct  121  ANFKDDSSQLAWDCSAWVRAYALFLEERLECFRILKFDIETERLMRSP-ECSSKAHSRTR  179

Query  766  ELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIIN  945
             L   ELL+QLPALQQLL+RLIGC+PEGAA  NY+IQYALALVLKESFKIYCAINDGIIN
Sbjct  180  TLPCIELLEQLPALQQLLFRLIGCQPEGAAGTNYLIQYALALVLKESFKIYCAINDGIIN  239

Query  946  LVDKFFEMPR  975
            LVD FF+MP+
Sbjct  240  LVDMFFDMPK  249



>ref|NP_001046057.1| Os02g0175700 [Oryza sativa Japonica Group]
 dbj|BAD27613.1| synaptosomal-associated protein 91-like [Oryza sativa Japonica 
Group]
 dbj|BAF07971.1| Os02g0175700 [Oryza sativa Japonica Group]
 dbj|BAG91480.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56421.1| hypothetical protein OsJ_05586 [Oryza sativa Japonica Group]
Length=583

 Score =   370 bits (950),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 188/250 (75%), Positives = 216/250 (86%), Gaps = 2/250 (1%)
 Frame = +1

Query  229  LQTWR-KAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAV  405
            + +WR KAYGALKD TKVGLA VNSDFK++D+AIVKATNHVECPPK+RH+RKI V TS  
Sbjct  1    MGSWRRKAYGALKDSTKVGLAKVNSDFKELDIAIVKATNHVECPPKDRHVRKIFVATSIN  60

Query  406  RPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQM  585
            RPRADV YCI+AL+RRL+KT NWTVALKTLIV+HR LREGDPTF+EE L +  +G VLQ 
Sbjct  61   RPRADVQYCIYALSRRLSKTKNWTVALKTLIVVHRLLREGDPTFKEEFLAYSYKGSVLQR  120

Query  586  SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTR  765
            +NFKDDSS +AWDCSAWVR YALFLEERLECFR+LK+DIE ERL + P +   K +S+TR
Sbjct  121  ANFKDDSSQLAWDCSAWVRAYALFLEERLECFRILKFDIETERLMRSP-ECSSKAHSRTR  179

Query  766  ELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIIN  945
             L   ELL+QLPALQQLL+RLIGC+PEGAA  NY+IQYALALVLKESFKIYCAINDGIIN
Sbjct  180  TLPCIELLEQLPALQQLLFRLIGCQPEGAAGTNYLIQYALALVLKESFKIYCAINDGIIN  239

Query  946  LVDKFFEMPR  975
            LVD FF+MP+
Sbjct  240  LVDMFFDMPK  249



>ref|XP_010448345.1| PREDICTED: putative clathrin assembly protein At4g25940 [Camelina 
sativa]
Length=600

 Score =   370 bits (951),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 189/258 (73%), Positives = 216/258 (84%), Gaps = 6/258 (2%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M T  ++RKA GA+KD T V +A VNS+FKD+DVAIVKATNHVE  PKERH+RKI   TS
Sbjct  1    MATFHSFRKAVGAIKDSTTVSIAKVNSEFKDLDVAIVKATNHVESAPKERHMRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             V+PRADVAYCIHALA+RL+KT NW VA+K L+VIHRTLREGDPTFREELLN+ +RG +L
Sbjct  61   VVQPRADVAYCIHALAKRLSKTRNWVVAIKVLLVIHRTLREGDPTFREELLNYSRRGHML  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYS-  756
            ++SNFKDD+SP+AWDCSAW+RTYALFLEERLEC+R LKYDIEAERLPK      +   S 
Sbjct  121  RISNFKDDTSPLAWDCSAWIRTYALFLEERLECYRGLKYDIEAERLPKGSGASSKNVDSN  180

Query  757  -----KTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYC  921
                 +TR L+ EELL+QLPALQQLLYRLIGC+PEG A  NY+IQYALALVLKESFKIYC
Sbjct  181  ASQTYRTRMLSDEELLEQLPALQQLLYRLIGCQPEGTAYSNYLIQYALALVLKESFKIYC  240

Query  922  AINDGIINLVDKFFEMPR  975
            AINDGIINLVD FFEM R
Sbjct  241  AINDGIINLVDMFFEMSR  258



>ref|XP_004487991.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
isoform X2 [Cicer arietinum]
Length=581

 Score =   369 bits (948),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 184/252 (73%), Positives = 218/252 (87%), Gaps = 10/252 (4%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  ++RKAYGALKD TKVGLA VNS++K++DVAIVKATNH E PPKERH+RKI   TS
Sbjct  1    MGTFTSFRKAYGALKDSTKVGLAKVNSEYKELDVAIVKATNHNEYPPKERHVRKIFYATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A +PRADVAYCIH L++RL+KT +W VA+KTLIVIHRTLREGDPTFREELLN+ +RG +L
Sbjct  61   AHQPRADVAYCIHKLSKRLSKTRSWIVAVKTLIVIHRTLREGDPTFREELLNYSRRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFR+LKYDIE+ERL           +S+
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYALFLEERLECFRILKYDIESERL----------AHSR  170

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L +++LL+QLPALQQLL+RL+GC+PEG A  NY++QYALAL+LKESFKIYCA+NDGI
Sbjct  171  TRSLANDDLLEQLPALQQLLFRLVGCQPEGCAYNNYLVQYALALILKESFKIYCALNDGI  230

Query  940  INLVDKFFEMPR  975
            INLVD FF+  R
Sbjct  231  INLVDMFFDTSR  242



>ref|XP_009595513.1| PREDICTED: putative clathrin assembly protein At5g57200 [Nicotiana 
tomentosiformis]
Length=584

 Score =   368 bits (945),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/249 (76%), Positives = 211/249 (85%), Gaps = 1/249 (0%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            ++ +RKAY  LKD TKVGLA V S+FKD+D+AIVKATNHVE PPKERH+ KI V TS   
Sbjct  1    MERFRKAYDKLKDSTKVGLAKVKSEFKDLDIAIVKATNHVESPPKERHIAKIAVATSITC  60

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRADVAYCIHAL RRL+KT NW V +KTLIVIHR LREGDP+FREELL + QRG + Q+S
Sbjct  61   PRADVAYCIHALNRRLSKTRNWIVVIKTLIVIHRVLREGDPSFREELLRYSQRGHIFQLS  120

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKDDSSP+AWDCSAWVRTYALFLEERLECFR LKYDIEAERL K  A G +K + +TR 
Sbjct  121  NFKDDSSPLAWDCSAWVRTYALFLEERLECFRTLKYDIEAERLTKTSA-GTDKVHCRTRL  179

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            LN EELL+QLPALQQLLYRL GC+PEG A  N++IQYALALVLKESFKIYCAINDGIINL
Sbjct  180  LNGEELLEQLPALQQLLYRLTGCQPEGGACYNFLIQYALALVLKESFKIYCAINDGIINL  239

Query  949  VDKFFEMPR  975
            VD FFEM +
Sbjct  240  VDFFFEMSK  248



>emb|CDY42239.1| BnaC02g11760D [Brassica napus]
Length=337

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/258 (72%), Positives = 212/258 (82%), Gaps = 8/258 (3%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  + RKAYGALKD T VGLA VNS+FKD+D+AIVKATNHVE PPKERH+RKI   TS
Sbjct  1    MGTFTSLRKAYGALKDSTTVGLAKVNSEFKDLDIAIVKATNHVESPPKERHVRKIFSATS  60

Query  400  AVRP----RADVAYCIHALARRLAKTHNWTVA--LKTLIVIHRTLREGDPTFREELLNFQ  561
             ++P    RAD+AYCIHAL++RL+KT  W V+  L    +IHRTLREGDPTFREELLN+ 
Sbjct  61   VIQPWSLPRADIAYCIHALSKRLSKTRTWVVSSFLSCFAIIHRTLREGDPTFREELLNYS  120

Query  562  QRGRVLQMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQ  741
             R   L++SNFKDD+SP+AWDCS WVRTYALFLEERLEC+RVLKYDIEAERLPK  A G 
Sbjct  121  HRRHTLRISNFKDDTSPLAWDCSGWVRTYALFLEERLECYRVLKYDIEAERLPK--ASGA  178

Query  742  EKGYSKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYC  921
                 +TR L+ E+LL+QLPALQQLL+RLIGC+PEGAA  NY+I YALALVLKESFKIYC
Sbjct  179  ASRTHRTRMLSGEDLLEQLPALQQLLFRLIGCQPEGAAYSNYLIHYALALVLKESFKIYC  238

Query  922  AINDGIINLVDKFFEMPR  975
            AINDGIINLVD FFEM R
Sbjct  239  AINDGIINLVDMFFEMTR  256



>ref|XP_009390454.1| PREDICTED: putative clathrin assembly protein At4g25940 [Musa 
acuminata subsp. malaccensis]
Length=550

 Score =   367 bits (941),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 184/252 (73%), Positives = 215/252 (85%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTL++WRKAYGALKD T V LA VNS+FKD+D+A+VKATNHVECPPKERH+RKI V TS
Sbjct  1    MGTLESWRKAYGALKDTTTVSLAKVNSEFKDLDIAVVKATNHVECPPKERHIRKIFVATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A  PR+DVAYC+HALARRL+KT NW VALK+LIVIHR LREGD  FR+ELL++  +  +L
Sbjct  61   ANCPRSDVAYCVHALARRLSKTRNWVVALKSLIVIHRALREGDAPFRDELLHYCHKANIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+S FKDDSS +AWDCSAWVRTY+LFLEERLECFR+L+YDIEAE L +  +    K  S+
Sbjct  121  QISYFKDDSSSVAWDCSAWVRTYSLFLEERLECFRILRYDIEAEDL-RRSSDDSSKNCSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L  ++LL+QLPALQQLL+RL+ C+PEGAA GNY+IQYALALVLKESFK YCAINDGI
Sbjct  180  TRTLGCQQLLEQLPALQQLLFRLVECKPEGAAFGNYLIQYALALVLKESFKTYCAINDGI  239

Query  940  INLVDKFFEMPR  975
            INLVD FFEM R
Sbjct  240  INLVDLFFEMSR  251



>ref|XP_010438819.1| PREDICTED: putative clathrin assembly protein At4g25940 [Camelina 
sativa]
Length=591

 Score =   368 bits (945),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/258 (73%), Positives = 215/258 (83%), Gaps = 6/258 (2%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M T  ++RKA GA+KD T V +A VNS+FKD+DVAIVKATNHVE  PKERH+RKI   TS
Sbjct  1    MATFHSFRKAVGAIKDSTTVSIAKVNSEFKDLDVAIVKATNHVESAPKERHMRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             V+PRADVAYCIHALA+RL+KT NW VA+K LIVIHRTLREGDPTFREELLN+ +RG +L
Sbjct  61   VVQPRADVAYCIHALAKRLSKTRNWVVAIKVLIVIHRTLREGDPTFREELLNYSRRGHML  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYS-  756
            ++SNFKDD+SP+AWDCSAW+RTYALFLEERLEC+R LKYDIEAERLPK      +   S 
Sbjct  121  RISNFKDDTSPLAWDCSAWIRTYALFLEERLECYRGLKYDIEAERLPKGSGASSKNVDSN  180

Query  757  -----KTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYC  921
                 +TR L+ EELL+QLPALQQLLYRLIGC+PE  A  NY+IQYALALVLKESFKIYC
Sbjct  181  ASQTYRTRMLSDEELLEQLPALQQLLYRLIGCQPEVTAYSNYLIQYALALVLKESFKIYC  240

Query  922  AINDGIINLVDKFFEMPR  975
            AINDGIINLVD FFEM R
Sbjct  241  AINDGIINLVDMFFEMSR  258



>ref|XP_004507895.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
isoform X1 [Cicer arietinum]
Length=600

 Score =   368 bits (945),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 185/252 (73%), Positives = 219/252 (87%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT QT+RKAYGALKD TKVGLA VNS++K++D+AIVKAT+HVE PPKERH+RKI   TS
Sbjct  1    MGTFQTFRKAYGALKDSTKVGLAKVNSEYKELDIAIVKATSHVEYPPKERHVRKIFYATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A +PRADVAYCIHAL++RL+KT NW VA+KTLIVIHR LREGDP+F+E+L+N+ +R   L
Sbjct  61   AQQPRADVAYCIHALSKRLSKTRNWIVAIKTLIVIHRILREGDPSFKEDLVNYSRRVHFL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYA FLEERLECFR+LKYDIE ERL K  +    K +S+
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYAQFLEERLECFRILKYDIEFERLTK-ASPASTKVHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L S+ LL+QLPALQQLLYRL+ C+PEG+A  NY+IQYALALVLKESFKIYCA+NDGI
Sbjct  180  TRMLTSDGLLEQLPALQQLLYRLVCCQPEGSAFNNYLIQYALALVLKESFKIYCALNDGI  239

Query  940  INLVDKFFEMPR  975
            I LVD+FF+M R
Sbjct  240  IKLVDEFFDMTR  251



>ref|XP_004507896.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
isoform X2 [Cicer arietinum]
Length=604

 Score =   368 bits (944),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 185/252 (73%), Positives = 219/252 (87%), Gaps = 1/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT QT+RKAYGALKD TKVGLA VNS++K++D+AIVKAT+HVE PPKERH+RKI   TS
Sbjct  1    MGTFQTFRKAYGALKDSTKVGLAKVNSEYKELDIAIVKATSHVEYPPKERHVRKIFYATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A +PRADVAYCIHAL++RL+KT NW VA+KTLIVIHR LREGDP+F+E+L+N+ +R   L
Sbjct  61   AQQPRADVAYCIHALSKRLSKTRNWIVAIKTLIVIHRILREGDPSFKEDLVNYSRRVHFL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSP+AWDCSAWVRTYA FLEERLECFR+LKYDIE ERL K  +    K +S+
Sbjct  121  QISNFKDDSSPLAWDCSAWVRTYAQFLEERLECFRILKYDIEFERLTK-ASPASTKVHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L S+ LL+QLPALQQLLYRL+ C+PEG+A  NY+IQYALALVLKESFKIYCA+NDGI
Sbjct  180  TRMLTSDGLLEQLPALQQLLYRLVCCQPEGSAFNNYLIQYALALVLKESFKIYCALNDGI  239

Query  940  INLVDKFFEMPR  975
            I LVD+FF+M R
Sbjct  240  IKLVDEFFDMTR  251



>ref|XP_001755297.1| predicted protein [Physcomitrella patens]
 gb|EDQ79777.1| predicted protein, partial [Physcomitrella patens]
Length=457

 Score =   363 bits (931),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 185/253 (73%), Positives = 217/253 (86%), Gaps = 10/253 (4%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M + Q+ RKA GA+KD TKVGLA VNS +K++D+A+VKATNHVECPPKE+H+R I + TS
Sbjct  1    MASQQSIRKALGAIKDSTKVGLAKVNSTYKELDIAVVKATNHVECPPKEKHVRMIFLATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNF-QQRGRV  576
            A R RADVAYCIHALARR+AKTHNWTVALK+++VIHRTLREGDPTFREEL+N+ + RG +
Sbjct  61   ASRLRADVAYCIHALARRIAKTHNWTVALKSMMVIHRTLREGDPTFREELINYGRNRGHI  120

Query  577  LQMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYS  756
            L +SNFKDDSSP AWD SAWVRTYALFLEERLECFRVLKYD+E+ER           G+S
Sbjct  121  LNLSNFKDDSSPHAWDYSAWVRTYALFLEERLECFRVLKYDVESER---------PTGHS  171

Query  757  KTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDG  936
            +TREL++ ELL+ LPALQQLL+RL+GC+PEGAA+ NYVIQ AL LVLKESFK+Y AINDG
Sbjct  172  RTRELDTVELLEHLPALQQLLFRLMGCQPEGAAISNYVIQAALGLVLKESFKLYRAINDG  231

Query  937  IINLVDKFFEMPR  975
            IINLVDKFFEM R
Sbjct  232  IINLVDKFFEMQR  244



>ref|XP_009773773.1| PREDICTED: putative clathrin assembly protein At5g57200 [Nicotiana 
sylvestris]
 ref|XP_009773775.1| PREDICTED: putative clathrin assembly protein At5g57200 [Nicotiana 
sylvestris]
Length=584

 Score =   367 bits (941),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 189/249 (76%), Positives = 211/249 (85%), Gaps = 1/249 (0%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            ++ +RKAY  LKD TKVGLA V S+FKD+D+AIVKATNHVE PPKERH+ KI V TS   
Sbjct  1    MERFRKAYDRLKDSTKVGLAKVKSEFKDLDIAIVKATNHVESPPKERHIAKIAVATSITC  60

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRADVAYCIHAL RRL+KT NW V +KTLIVIHR LREGDP+FREELL + QRG + Q+S
Sbjct  61   PRADVAYCIHALNRRLSKTRNWIVVIKTLIVIHRVLREGDPSFREELLRYSQRGHIFQLS  120

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKDDSSP+AWDCSAWVRTYALFLEERLECFR LKYDIEAERL K  A G +K + +TR 
Sbjct  121  NFKDDSSPLAWDCSAWVRTYALFLEERLECFRTLKYDIEAERLTKTSA-GADKVHCRTRL  179

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            LN EELL+QLPALQQLLYRL GC+PEG A  N++IQYALALVLKESFKIYCAINDGIINL
Sbjct  180  LNGEELLEQLPALQQLLYRLTGCQPEGGACYNFLIQYALALVLKESFKIYCAINDGIINL  239

Query  949  VDKFFEMPR  975
            VD FFEM +
Sbjct  240  VDFFFEMSK  248



>ref|XP_002982426.1| hypothetical protein SELMODRAFT_268581 [Selaginella moellendorffii]
 gb|EFJ16671.1| hypothetical protein SELMODRAFT_268581 [Selaginella moellendorffii]
Length=553

 Score =   365 bits (937),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 184/252 (73%), Positives = 215/252 (85%), Gaps = 10/252 (4%)
 Frame = +1

Query  223  GTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSA  402
            G  +T RKA GALKD TKVGLA VNS+FKD+D+A+VKATNHVECPPKE+H+R I + TSA
Sbjct  3    GGSKTIRKALGALKDSTKVGLAKVNSEFKDLDIAVVKATNHVECPPKEKHVRTIFLATSA  62

Query  403  VRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNF-QQRGRVL  579
             RPRADVAYCIHALARR++KTH WTVALK L+VIHRTLREGDPTFREEL+N+ + R  +L
Sbjct  63   ARPRADVAYCIHALARRISKTHTWTVALKALMVIHRTLREGDPTFREELINYSRNRAHIL  122

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
             +SNFKDDSSP AWD SAWVRTYALFLEERLECFR+LKYD+E+ER           G+S+
Sbjct  123  NLSNFKDDSSPNAWDYSAWVRTYALFLEERLECFRILKYDVESER---------SSGHSR  173

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL++ +LL+QLP+LQQLL+RL+GC+PEGAA  N+VIQYAL LV KESFK+Y AINDGI
Sbjct  174  TRELDTIDLLEQLPSLQQLLHRLMGCQPEGAATSNHVIQYALGLVFKESFKLYRAINDGI  233

Query  940  INLVDKFFEMPR  975
            INLVDKFFEM R
Sbjct  234  INLVDKFFEMQR  245



>ref|XP_003595071.1| hypothetical protein MTR_2g037980 [Medicago truncatula]
Length=646

 Score =   367 bits (943),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 190/262 (73%), Positives = 223/262 (85%), Gaps = 10/262 (4%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT  ++RKAYGALKD TKVGLA VNS++K++D+AIVKATNHVE PPKERH+RK+   TS
Sbjct  1    MGTFTSFRKAYGALKDSTKVGLAKVNSEYKELDIAIVKATNHVEYPPKERHVRKVFYATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTV---------ALKTLIVIHRTLREGDPTFREELL  552
            A +PRADVAYCIH L++RLAKT +W V         ALKTLIVIHRTLREGDPTFREELL
Sbjct  61   AHQPRADVAYCIHKLSKRLAKTRSWIVRTYEMIFIVALKTLIVIHRTLREGDPTFREELL  120

Query  553  NFQQRGRVLQMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPA  732
            N+ ++G +LQ+SNFKDDSSP+AWDCSAWVRTYALFLEERLECFRVLKYDIE+ERL K  A
Sbjct  121  NYSRKGHILQISNFKDDSSPLAWDCSAWVRTYALFLEERLECFRVLKYDIESERLVKSSA  180

Query  733  -QGQEKGYSKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESF  909
             + +   +S+TR L +++LL+QLPALQQLL+RLIGC+PEG A  NY++QYALALVLKESF
Sbjct  181  TEPKVCPHSRTRSLANDDLLEQLPALQQLLFRLIGCQPEGCAYNNYLVQYALALVLKESF  240

Query  910  KIYCAINDGIINLVDKFFEMPR  975
            KIYCA+NDGIINLVD FFE  R
Sbjct  241  KIYCALNDGIINLVDMFFETSR  262



>ref|NP_001169970.1| hypothetical protein [Zea mays]
 gb|ACN35397.1| unknown [Zea mays]
 gb|AFW70349.1| hypothetical protein ZEAMMB73_344011 [Zea mays]
Length=577

 Score =   365 bits (937),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/249 (73%), Positives = 213/249 (86%), Gaps = 1/249 (0%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            + +WRKAYGALKD TKVGLA VNS+FK++D+AIVKATNHVECPPKERH+RKI++ TSA R
Sbjct  1    MGSWRKAYGALKDSTKVGLAKVNSEFKELDIAIVKATNHVECPPKERHVRKILLATSANR  60

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRAD++YCI+AL+RRL+KT NW VALKTLIV+HR LREGDP F+EE L +  RG +L ++
Sbjct  61   PRADLSYCIYALSRRLSKTKNWIVALKTLIVVHRLLREGDPMFKEEFLAYSSRGNILHIA  120

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKDDSS  AWDCSAW+R Y  FLEERLEC RVL+YDIE ERL + P Q   K +SKTR 
Sbjct  121  NFKDDSSQSAWDCSAWIRAYGCFLEERLECLRVLRYDIETERLVRYP-QTSSKVHSKTRT  179

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            L S ELL+QLPALQQLL+R++G +PEGAA  NY+IQYALALVLKESFKIYC+INDGIINL
Sbjct  180  LPSPELLEQLPALQQLLFRVVGVQPEGAACSNYLIQYALALVLKESFKIYCSINDGIINL  239

Query  949  VDKFFEMPR  975
            VD FFEMP+
Sbjct  240  VDMFFEMPK  248



>ref|XP_008644118.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=578

 Score =   365 bits (937),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/249 (73%), Positives = 213/249 (86%), Gaps = 1/249 (0%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            + +WRKAYGALKD TKVGLA VNS+FK++D+AIVKATNHVECPPKERH+RKI++ TSA R
Sbjct  1    MGSWRKAYGALKDSTKVGLAKVNSEFKELDIAIVKATNHVECPPKERHVRKILLATSANR  60

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRAD++YCI+AL+RRL+KT NW VALKTLIV+HR LREGDP F+EE L +  RG +L ++
Sbjct  61   PRADLSYCIYALSRRLSKTKNWIVALKTLIVVHRLLREGDPMFKEEFLAYSSRGNILHIA  120

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKDDSS  AWDCSAW+R Y  FLEERLEC RVL+YDIE ERL + P Q   K +SKTR 
Sbjct  121  NFKDDSSQSAWDCSAWIRAYGCFLEERLECLRVLRYDIETERLVRYP-QTSSKVHSKTRT  179

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            L S ELL+QLPALQQLL+R++G +PEGAA  NY+IQYALALVLKESFKIYC+INDGIINL
Sbjct  180  LPSPELLEQLPALQQLLFRVVGVQPEGAACSNYLIQYALALVLKESFKIYCSINDGIINL  239

Query  949  VDKFFEMPR  975
            VD FFEMP+
Sbjct  240  VDMFFEMPK  248



>ref|XP_006283381.1| hypothetical protein CARUB_v10004424mg [Capsella rubella]
 gb|EOA16279.1| hypothetical protein CARUB_v10004424mg [Capsella rubella]
Length=596

 Score =   365 bits (937),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 190/258 (74%), Positives = 218/258 (84%), Gaps = 6/258 (2%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M T  ++RKA GA+KD T V +A VNS+FKD+DVAIVKATNHVE  PKERH+RKI   TS
Sbjct  1    MATFHSFRKAVGAIKDSTTVSIAKVNSEFKDLDVAIVKATNHVESAPKERHIRKIFSATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
             V+PRADVAYCIHALA+RL+KT NW VA+K LIVIHRTLREGDPTFREELLN+  RG +L
Sbjct  61   VVQPRADVAYCIHALAKRLSKTRNWVVAIKVLIVIHRTLREGDPTFREELLNYSHRGHIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPP-AQGQEKGYS  756
            ++SNFKDD+SP+AWDCSAW+RTYALFLEERLEC+RVLKYDIEAERLPK   A  +   ++
Sbjct  121  RISNFKDDTSPLAWDCSAWIRTYALFLEERLECYRVLKYDIEAERLPKASGASSKNVDFN  180

Query  757  -----KTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYC  921
                 +TR L+ EELL+QLPALQQLLYRL+GC+PEG A  NY+IQYALALVLKESFKIYC
Sbjct  181  ATQTYRTRMLSEEELLEQLPALQQLLYRLVGCQPEGTAYSNYLIQYALALVLKESFKIYC  240

Query  922  AINDGIINLVDKFFEMPR  975
            AINDGIINLVD FFEM R
Sbjct  241  AINDGIINLVDMFFEMSR  258



>gb|KJB60910.1| hypothetical protein B456_009G330700 [Gossypium raimondii]
Length=509

 Score =   362 bits (929),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 178/252 (71%), Positives = 192/252 (76%), Gaps = 54/252 (21%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGTLQTWRKAYGALKD TKVGLAHVNSD+ D+DVAIVKATNHVECPPKERHLRKI++ TS
Sbjct  1    MGTLQTWRKAYGALKDSTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKILLATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A+RPRADVAYCIHAL+RRLAKTHNWTVALKTLIVIHR LREGDPTFREE+LNF QR R+L
Sbjct  61   AIRPRADVAYCIHALSRRLAKTHNWTVALKTLIVIHRALREGDPTFREEILNFSQRARIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ P+QGQ+K    
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PSQGQDK----  175

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
                                       PEGAA+GNYVIQYALAL                
Sbjct  176  ---------------------------PEGAAIGNYVIQYALAL----------------  192

Query  940  INLVDKFFEMPR  975
                  FFEMPR
Sbjct  193  ------FFEMPR  198



>ref|XP_002966589.1| hypothetical protein SELMODRAFT_230819 [Selaginella moellendorffii]
 gb|EFJ32616.1| hypothetical protein SELMODRAFT_230819 [Selaginella moellendorffii]
Length=547

 Score =   362 bits (929),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 184/252 (73%), Positives = 217/252 (86%), Gaps = 2/252 (1%)
 Frame = +1

Query  223  GTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSA  402
            G  +T RKA GALKD TKVGLA VNS+FKD+D+A+VKATNHVECPPKE+H+R I + TSA
Sbjct  3    GGSKTIRKALGALKDSTKVGLAKVNSEFKDLDIAVVKATNHVECPPKEKHVRTIFLATSA  62

Query  403  VRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNF-QQRGRVL  579
             RPRADVAYCIHALARR++KTH WTVALK L+VIHRTLREGDPTFREEL+N+ + R  +L
Sbjct  63   ARPRADVAYCIHALARRISKTHTWTVALKALMVIHRTLREGDPTFREELINYSRNRAHIL  122

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
             +SNFKDDSSP AWD SAWVRTYALFLEERLECFR+LKYD+E+ER    P + +   Y++
Sbjct  123  NLSNFKDDSSPNAWDYSAWVRTYALFLEERLECFRILKYDVESERSSVSP-RTRFPRYNE  181

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL++ +LL+QLP+LQQLL+RL+GC+PEGAA  N+VIQYAL LV KESFK+Y AINDGI
Sbjct  182  TRELDTIDLLEQLPSLQQLLHRLMGCQPEGAATSNHVIQYALGLVFKESFKLYRAINDGI  241

Query  940  INLVDKFFEMPR  975
            INLVDKFFEM R
Sbjct  242  INLVDKFFEMQR  253



>ref|XP_011075418.1| PREDICTED: putative clathrin assembly protein At2g01600 [Sesamum 
indicum]
Length=507

 Score =   360 bits (925),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/197 (92%), Positives = 190/197 (96%), Gaps = 1/197 (1%)
 Frame = +1

Query  385  MVYTSAVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQ  564
            MV TSA+RPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDP FREELLNFQQ
Sbjct  1    MVATSAIRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPVFREELLNFQQ  60

Query  565  RGRVLQMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQE  744
            RGRVLQMSNFKDDSSPIAWDCSAWVR Y LFLEERLECFRVLKYDIEAERLP+ PAQGQ+
Sbjct  61   RGRVLQMSNFKDDSSPIAWDCSAWVRAYGLFLEERLECFRVLKYDIEAERLPR-PAQGQD  119

Query  745  KGYSKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCA  924
            KGYS+TR+L  EELLDQLPALQQLLYRL+GC+PEGAAVGNY+IQYALALVLKESFKIYCA
Sbjct  120  KGYSRTRDLMGEELLDQLPALQQLLYRLVGCQPEGAAVGNYMIQYALALVLKESFKIYCA  179

Query  925  INDGIINLVDKFFEMPR  975
            INDGIINLVDKFFEMPR
Sbjct  180  INDGIINLVDKFFEMPR  196



>dbj|BAD54001.1| destination factor-like [Oryza sativa Japonica Group]
Length=562

 Score =   362 bits (929),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 190/267 (71%), Positives = 220/267 (82%), Gaps = 9/267 (3%)
 Frame = +1

Query  190  GSGANGVEREMGTL---QTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPP  360
            GS A   E  MGT    ++WRKA GA+KD T VGLA  +S  KD+DVA+VKATNHVE PP
Sbjct  27   GSPAAAEEETMGTTSVQKSWRKACGAIKDSTTVGLARAHS--KDLDVAVVKATNHVERPP  84

Query  361  KERHLRKIMVYTSAVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFR  540
            KERHL KI+   S  RP ADV+YC+HALARRL+KTHNW VALKTL+VIHR LREGD  FR
Sbjct  85   KERHLSKIIAAASGARPLADVSYCVHALARRLSKTHNWVVALKTLVVIHRALREGDAAFR  144

Query  541  EELLNFQ--QRGRVLQMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAER  714
            EELL+++  + G  LQMS+FKDDS+P+AWDCSAWVRTYALFLEERLECFRVL+YDIEAER
Sbjct  145  EELLSYRRGRGGHCLQMSSFKDDSTPLAWDCSAWVRTYALFLEERLECFRVLRYDIEAER  204

Query  715  LPKPPAQGQEKGYSKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALV  894
            L    A+G  KG S+TR L  +ELL+QLPALQQLLYRL+GC+PEGAA GNY+IQYALALV
Sbjct  205  LRT--AEGAPKGQSRTRSLGKDELLEQLPALQQLLYRLVGCQPEGAAFGNYLIQYALALV  262

Query  895  LKESFKIYCAINDGIINLVDKFFEMPR  975
            LKESFKIYCA+NDGIINLV+ FF+M +
Sbjct  263  LKESFKIYCAVNDGIINLVEMFFDMTK  289



>gb|KJB60908.1| hypothetical protein B456_009G330700 [Gossypium raimondii]
Length=522

 Score =   359 bits (922),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 193/199 (97%), Gaps = 1/199 (1%)
 Frame = +1

Query  379  KIMVYTSAVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNF  558
            KI++ TSA+RPRADVAYCIHAL+RRLAKTHNWTVALKTLIVIHR LREGDPTFREE+LNF
Sbjct  14   KILLATSAIRPRADVAYCIHALSRRLAKTHNWTVALKTLIVIHRALREGDPTFREEILNF  73

Query  559  QQRGRVLQMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQG  738
             QR R+LQ+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ P+QG
Sbjct  74   SQRARILQLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PSQG  132

Query  739  QEKGYSKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIY  918
            Q+KGYS+TR+L SEELL+QLPALQQLL+RLIGCRPEGAA+GNYVIQYALALVLKESFKIY
Sbjct  133  QDKGYSRTRDLGSEELLEQLPALQQLLHRLIGCRPEGAAIGNYVIQYALALVLKESFKIY  192

Query  919  CAINDGIINLVDKFFEMPR  975
            CAINDGIINLVDKFFEMPR
Sbjct  193  CAINDGIINLVDKFFEMPR  211



>gb|KJB30769.1| hypothetical protein B456_005G159800 [Gossypium raimondii]
Length=526

 Score =   359 bits (922),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = +1

Query  379  KIMVYTSAVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNF  558
            KI + TSA+RPRADVAYCIHAL RRL KTHNWTVALKTLIVIHR LREGDPTFREELLNF
Sbjct  14   KIFIATSAIRPRADVAYCIHALGRRLTKTHNWTVALKTLIVIHRALREGDPTFREELLNF  73

Query  559  QQRGRVLQMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQG  738
             QR R+LQ+SNFKDDSSPIAWDCSAWVRTYALFLEERLECFR+LKYDIEAERLP+ P QG
Sbjct  74   SQRARILQLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRILKYDIEAERLPR-PDQG  132

Query  739  QEKGYSKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIY  918
            Q+KGYS+TREL+SEELL QLPALQQLL+RLIGCRPEGAA+GNYVIQYALALVLKESFKIY
Sbjct  133  QDKGYSRTRELDSEELLTQLPALQQLLHRLIGCRPEGAAIGNYVIQYALALVLKESFKIY  192

Query  919  CAINDGIINLVDKFFEMPR  975
            CAINDGIINLVDKFFEMPR
Sbjct  193  CAINDGIINLVDKFFEMPR  211



>ref|XP_011077728.1| PREDICTED: putative clathrin assembly protein At5g57200 [Sesamum 
indicum]
 ref|XP_011077729.1| PREDICTED: putative clathrin assembly protein At5g57200 [Sesamum 
indicum]
Length=597

 Score =   360 bits (924),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 213/249 (86%), Gaps = 1/249 (0%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            +++ RKAYGALKD TKVGLA VNSDFK++D+AIVKATNHVECPPKERH+RKI    +   
Sbjct  1    MESIRKAYGALKDSTKVGLAKVNSDFKELDIAIVKATNHVECPPKERHVRKIFAAVAISC  60

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRADV YCIHAL+RRLAKT +W VA+KTLIV HR LREGDP+FREEL +F +RG + Q++
Sbjct  61   PRADVGYCIHALSRRLAKTRSWIVAIKTLIVFHRVLREGDPSFREELRHFSRRGNIFQVA  120

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NF+DDS P+AW+CSAWVRTYAL+LEERLECFR + YDIEA+++PK  A G+ K  SK + 
Sbjct  121  NFRDDSGPLAWECSAWVRTYALYLEERLECFRNIHYDIEADKVPK-SAPGESKTNSKPKT  179

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            L++EELL+Q+P LQQLLYRL+ C+PEG A  N++IQYALALV+KESFK+YCAINDGIINL
Sbjct  180  LSTEELLEQIPTLQQLLYRLVCCQPEGGACHNFLIQYALALVVKESFKVYCAINDGIINL  239

Query  949  VDKFFEMPR  975
            VD FFEMP+
Sbjct  240  VDMFFEMPK  248



>gb|EEC81258.1| hypothetical protein OsI_24348 [Oryza sativa Indica Group]
Length=526

 Score =   355 bits (912),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 185/257 (72%), Positives = 216/257 (84%), Gaps = 9/257 (4%)
 Frame = +1

Query  220  MGTL---QTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMV  390
            MGT    ++WRKA GA+KD T VGLA  +S  KD+DVA+VKATNHVE PPKERHL KI+ 
Sbjct  1    MGTTSVQKSWRKACGAIKDSTTVGLARAHS--KDLDVAVVKATNHVERPPKERHLSKIIA  58

Query  391  YTSAVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQ--Q  564
              S  RP ADV+YC+HALARRL+KTHNW VALKTL+VIHR LREGD  FREELL+++  +
Sbjct  59   AASGARPLADVSYCVHALARRLSKTHNWVVALKTLVVIHRALREGDAAFREELLSYRRGR  118

Query  565  RGRVLQMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQE  744
             G  LQMS+FKDDS+P+AWDCSAWVRTYALFLEERLECFRVL+YDIEAERL    A+G  
Sbjct  119  GGHCLQMSSFKDDSTPLAWDCSAWVRTYALFLEERLECFRVLRYDIEAERLRT--AEGAP  176

Query  745  KGYSKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCA  924
            KG S+TR L  +ELL+QLPALQQLLYRL+GC+PEGAA GN++IQYALALVLKESFKIYCA
Sbjct  177  KGQSRTRSLGKDELLEQLPALQQLLYRLVGCQPEGAAFGNFLIQYALALVLKESFKIYCA  236

Query  925  INDGIINLVDKFFEMPR  975
            +NDGIINLV+ FF+M +
Sbjct  237  VNDGIINLVEMFFDMTK  253



>ref|NP_001151036.1| clathrin assembly protein [Zea mays]
 gb|ACG41378.1| clathrin assembly protein [Zea mays]
Length=575

 Score =   357 bits (915),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 181/252 (72%), Positives = 211/252 (84%), Gaps = 2/252 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MG+  TWRKAYGALKD TKVGLA+ NS++KD+D+AIVKATNHVECPPKERH R+I+  TS
Sbjct  1    MGS-GTWRKAYGALKDSTKVGLANFNSEYKDLDIAIVKATNHVECPPKERHFRRILFATS  59

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A RP+ADVAY I  LARRL+KT +W VALKTLIVIHR LREGD TF+E+ L +  RG VL
Sbjct  60   AHRPQADVAYSICTLARRLSKTKSWIVALKTLIVIHRLLREGDGTFKEDFLTYSYRGNVL  119

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+  FKDDSSP+AWDCSAWVRTYAL+L+ERLECFR+LKYD+E +RL K P     K +S+
Sbjct  120  QIPQFKDDSSPLAWDCSAWVRTYALYLDERLECFRILKYDVELDRLLKLP-HASGKAHSR  178

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L   ELL QLPALQ+LL RLI C+PEGAA  NY++QYALALVLKESFKIYC+INDGI
Sbjct  179  TRSLPLAELLVQLPALQKLLLRLIYCQPEGAACTNYLVQYALALVLKESFKIYCSINDGI  238

Query  940  INLVDKFFEMPR  975
            INLVD +FEMP+
Sbjct  239  INLVDMYFEMPK  250



>ref|XP_004967244.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Setaria italica]
Length=568

 Score =   356 bits (914),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 187/257 (73%), Positives = 216/257 (84%), Gaps = 9/257 (4%)
 Frame = +1

Query  220  MGTL---QTWRKAYGALKDHTKVGLAHVNS----DFKDVDVAIVKATNHVECPPKERHLR  378
            MGT    ++WRKA GA+KD   VGLA VN     + KD+DVA+VKAT HVE PPKERHL 
Sbjct  1    MGTASVHKSWRKACGAIKDSATVGLAKVNGGNGRERKDLDVAVVKATTHVERPPKERHLA  60

Query  379  KIMVYTSAVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNF  558
             I   TSA RP ADV+YC+HALARRLAKTHNW VALKTLIVIHRTLR+GD  FREELL++
Sbjct  61   AIFAATSASRPLADVSYCVHALARRLAKTHNWVVALKTLIVIHRTLRDGDAAFREELLSY  120

Query  559  QQRGRVLQMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQG  738
            +++G  L+MSNFKDDSSP+AWDCSAWVRTYAL+LEERLECFRVL+YDIE+ERL   PA+G
Sbjct  121  RRKGHALRMSNFKDDSSPLAWDCSAWVRTYALYLEERLECFRVLRYDIESERL--RPAEG  178

Query  739  QEKGYSKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIY  918
              KG S+TR L  ++LL+QLPALQQLL RL+GC+PEGAA GNY+IQYALALVLKESFKIY
Sbjct  179  NPKGQSRTRTLGKDDLLEQLPALQQLLLRLVGCQPEGAAFGNYLIQYALALVLKESFKIY  238

Query  919  CAINDGIINLVDKFFEM  969
            CA+NDGIINLVD FF+M
Sbjct  239  CAVNDGIINLVDAFFDM  255



>gb|AFW76126.1| clathrin assembly protein [Zea mays]
Length=575

 Score =   356 bits (914),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 181/252 (72%), Positives = 211/252 (84%), Gaps = 2/252 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MG+  TWRKAYGALKD TKVGLA+ NS++KD+D+AIVKATNHVECPPKERH R+I+  TS
Sbjct  1    MGS-GTWRKAYGALKDSTKVGLANFNSEYKDLDIAIVKATNHVECPPKERHFRRILFATS  59

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A RP+ADVAY I  LARRL+KT +W VALKTLIVIHR LREGD TF+E+ L +  RG VL
Sbjct  60   AHRPQADVAYSICTLARRLSKTKSWIVALKTLIVIHRLLREGDGTFKEDFLTYSYRGNVL  119

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+  FKDDSSP+AWDCSAWVRTYAL+L+ERLECFR+LKYD+E +RL K P     K +S+
Sbjct  120  QIPQFKDDSSPLAWDCSAWVRTYALYLDERLECFRILKYDVELDRLLKLP-HASGKAHSR  178

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L   ELL QLPALQ+LL RLI C+PEGAA  NY++QYALALVLKESFKIYC+INDGI
Sbjct  179  TRSLPLAELLVQLPALQKLLLRLIYCQPEGAACTNYLVQYALALVLKESFKIYCSINDGI  238

Query  940  INLVDKFFEMPR  975
            INLVD +FEMP+
Sbjct  239  INLVDMYFEMPK  250



>ref|XP_006657301.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Oryza brachyantha]
Length=547

 Score =   354 bits (909),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 185/255 (73%), Positives = 216/255 (85%), Gaps = 9/255 (4%)
 Frame = +1

Query  220  MGTL---QTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMV  390
            MGT+   ++WRKA GA+KD T VGLA  +S  KD+DVA+VKATNHVE PPKERHL KI+ 
Sbjct  1    MGTVSMQKSWRKACGAIKDSTTVGLARGHS--KDLDVAVVKATNHVERPPKERHLAKIIA  58

Query  391  YTSAVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQ--Q  564
              S  RP ADV+YC+HAL RRL+KTHNW VALKTL+VIHR LREGD  FREELL+++  +
Sbjct  59   AASGARPLADVSYCVHALDRRLSKTHNWVVALKTLVVIHRALREGDAAFREELLSYRRGR  118

Query  565  RGRVLQMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQE  744
             G  LQMS+FKDDS+P+AWDCSAWVRTYALFLEERLECF+VL+YDIEAERL   PA+G  
Sbjct  119  GGHCLQMSSFKDDSTPLAWDCSAWVRTYALFLEERLECFKVLRYDIEAERL--RPAEGAP  176

Query  745  KGYSKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCA  924
            KG S+TR L  +ELL+QLPALQQLLYRL+GC+PEGAA GNY+IQYALALVLKESFKIYCA
Sbjct  177  KGQSRTRSLGKDELLEQLPALQQLLYRLVGCQPEGAAFGNYLIQYALALVLKESFKIYCA  236

Query  925  INDGIINLVDKFFEM  969
            +NDGIINLV+ FF+M
Sbjct  237  VNDGIINLVEMFFDM  251



>ref|XP_004965651.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Setaria italica]
Length=575

 Score =   355 bits (910),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 180/252 (71%), Positives = 213/252 (85%), Gaps = 2/252 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MG+  TWRKAYGALKD T VGLA+ NS++KD+D+AIVKATNHVECPPKERHLR+I+  TS
Sbjct  1    MGS-GTWRKAYGALKDSTMVGLANFNSEYKDLDIAIVKATNHVECPPKERHLRRILYATS  59

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A RPRADVAY I  LARRL KT +W VALKTLIV+HR LREGD TF+E+ L +  RG +L
Sbjct  60   AHRPRADVAYSICTLARRLTKTKSWIVALKTLIVVHRLLREGDGTFKEDFLTYSYRGNIL  119

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+  FKDDSSP+AWDCSAWVRTYAL+L+ER+ECFRVLKYD+EA+RL K P Q   K +S+
Sbjct  120  QIPQFKDDSSPLAWDCSAWVRTYALYLDERVECFRVLKYDVEADRLLKLP-QASGKAHSR  178

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L   +LLDQLPALQ+LL RLI C+PEGAA  N+++QYALALVLKESF+IYC+INDGI
Sbjct  179  TRTLPLADLLDQLPALQKLLLRLIYCQPEGAACSNFLVQYALALVLKESFRIYCSINDGI  238

Query  940  INLVDKFFEMPR  975
            INLVD +FEMP+
Sbjct  239  INLVDMYFEMPK  250



>ref|XP_006656326.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Oryza brachyantha]
Length=575

 Score =   352 bits (903),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 177/250 (71%), Positives = 213/250 (85%), Gaps = 2/250 (1%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MG+  TWRKAYGALKD TKVGLA+ NS++KD+D+AIVKATNHVECPPKER+LR+I+  TS
Sbjct  1    MGS-GTWRKAYGALKDSTKVGLANFNSEYKDLDIAIVKATNHVECPPKERYLRRILFATS  59

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A RPR+DV Y I  LARRL+KT NW VALKTLIVIHR LREGD TF+E+ LN+  RG +L
Sbjct  60   ASRPRSDVGYSICTLARRLSKTKNWIVALKTLIVIHRLLREGDGTFKEDFLNYSYRGTIL  119

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+  FKDDSSP+AWDCS+W+RTYAL+L+ER+ECFRVLKYD+EA+RL K P +   K +S+
Sbjct  120  QIPQFKDDSSPLAWDCSSWIRTYALYLDERVECFRVLKYDVEADRLVKLP-RASGKAHSR  178

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TR L   +LLDQLPALQ+LL RLI C+PEG+A  NY++QYALALVLKESFKIYC+INDGI
Sbjct  179  TRTLPCSDLLDQLPALQKLLLRLIFCQPEGSACTNYLVQYALALVLKESFKIYCSINDGI  238

Query  940  INLVDKFFEM  969
            INLVD +F+M
Sbjct  239  INLVDMYFDM  248



>dbj|BAD46420.1| phosphoprotein-like [Oryza sativa Japonica Group]
Length=577

 Score =   352 bits (902),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 176/245 (72%), Positives = 207/245 (84%), Gaps = 1/245 (0%)
 Frame = +1

Query  235  TWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVRPR  414
            TWRKAYGALKD TKVGLA+ NS++KD+D+AIVKATNHVECPPKER+LRKI+  TSA RPR
Sbjct  5    TWRKAYGALKDSTKVGLANFNSEYKDLDIAIVKATNHVECPPKERYLRKILFATSANRPR  64

Query  415  ADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMSNF  594
            +DV Y I  LARRL+KT NW VALKTLIVIHR LREGD TF+E+ LN+  RG +LQ+  F
Sbjct  65   SDVGYSICTLARRLSKTKNWIVALKTLIVIHRLLREGDGTFKEDFLNYSYRGTILQIPQF  124

Query  595  KDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRELN  774
            KDDSSP+AWDCS WVRTYA +L+ER+ECFR+LKYD+EA+RL K P Q   K +S+TR L 
Sbjct  125  KDDSSPLAWDCSVWVRTYASYLDERVECFRILKYDVEADRLVKLP-QASGKAHSRTRTLP  183

Query  775  SEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINLVD  954
              +LLD LPALQ+LL RLI C+PEGAA  NY++QYALALVLKESFKIYC+INDGIINLVD
Sbjct  184  CGDLLDHLPALQRLLLRLISCQPEGAACTNYLVQYALALVLKESFKIYCSINDGIINLVD  243

Query  955  KFFEM  969
             +F+M
Sbjct  244  MYFDM  248



>ref|XP_006344967.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Solanum tuberosum]
Length=583

 Score =   351 bits (901),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 181/249 (73%), Positives = 207/249 (83%), Gaps = 1/249 (0%)
 Frame = +1

Query  229  LQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVR  408
            ++  RKAYG LKD TKVGLA V S+FKD+D+AIVKATNHVE PPKERH+ +I+V TS   
Sbjct  1    MEKIRKAYGKLKDSTKVGLAKVKSEFKDLDIAIVKATNHVESPPKERHIARIIVATSITC  60

Query  409  PRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMS  588
            PRADVAYCIHAL++RL+KT NW V +KTLIVIHR LREGDP+F+EELL   QRG + Q+S
Sbjct  61   PRADVAYCIHALSKRLSKTRNWIVVIKTLIVIHRVLREGDPSFKEELLRCSQRGYIFQLS  120

Query  589  NFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRE  768
            NFKDDSS + WDCSAWVRTYALFLEERLECFR +K DI AER  K P+ G  K + +TR 
Sbjct  121  NFKDDSSHLGWDCSAWVRTYALFLEERLECFRTMKNDIVAERSTK-PSVGINKVHCRTRL  179

Query  769  LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINL  948
            LN EELL+QLPALQQLLYRL GC+PEG A  N++IQYALALVLKESFKIYCAINDGIINL
Sbjct  180  LNGEELLEQLPALQQLLYRLTGCQPEGGACYNFLIQYALALVLKESFKIYCAINDGIINL  239

Query  949  VDKFFEMPR  975
            VD FFEM +
Sbjct  240  VDYFFEMSK  248



>ref|XP_010240260.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X1 [Brachypodium distachyon]
Length=578

 Score =   351 bits (900),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 173/247 (70%), Positives = 209/247 (85%), Gaps = 1/247 (0%)
 Frame = +1

Query  235  TWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVRPR  414
            TWRKAYGALKD TKVGLA+ NS++KD+D+A+VKATNHVECPPKERHLRK++  T   RPR
Sbjct  5    TWRKAYGALKDSTKVGLANFNSEYKDLDIAMVKATNHVECPPKERHLRKLLYATLVNRPR  64

Query  415  ADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMSNF  594
            ADVAYCI  LARRL+KT NW VALKTLIVIHR LREGD TF+++ L +  RG +LQ+ +F
Sbjct  65   ADVAYCICTLARRLSKTKNWIVALKTLIVIHRLLREGDGTFKDDFLTYSYRGNILQIPHF  124

Query  595  KDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRELN  774
            KDDSSP+AWDCSAWVR YA +L ER+EC+RVLKYD+EA+RL + P Q   K +S+TR L 
Sbjct  125  KDDSSPLAWDCSAWVRLYAFYLNERVECYRVLKYDVEADRLMRLP-QASGKAHSRTRTLP  183

Query  775  SEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINLVD  954
              +LLDQLPALQ+LL RLI C+P+G+A  NY++QYALALVLKESFKIYC+INDGIINLVD
Sbjct  184  CRDLLDQLPALQKLLLRLISCQPDGSACTNYLVQYALALVLKESFKIYCSINDGIINLVD  243

Query  955  KFFEMPR  975
             +F+MP+
Sbjct  244  MYFDMPK  250



>ref|XP_003563341.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X2 [Brachypodium distachyon]
Length=573

 Score =   350 bits (899),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 173/247 (70%), Positives = 209/247 (85%), Gaps = 1/247 (0%)
 Frame = +1

Query  235  TWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSAVRPR  414
            TWRKAYGALKD TKVGLA+ NS++KD+D+A+VKATNHVECPPKERHLRK++  T   RPR
Sbjct  5    TWRKAYGALKDSTKVGLANFNSEYKDLDIAMVKATNHVECPPKERHLRKLLYATLVNRPR  64

Query  415  ADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQMSNF  594
            ADVAYCI  LARRL+KT NW VALKTLIVIHR LREGD TF+++ L +  RG +LQ+ +F
Sbjct  65   ADVAYCICTLARRLSKTKNWIVALKTLIVIHRLLREGDGTFKDDFLTYSYRGNILQIPHF  124

Query  595  KDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTRELN  774
            KDDSSP+AWDCSAWVR YA +L ER+EC+RVLKYD+EA+RL + P Q   K +S+TR L 
Sbjct  125  KDDSSPLAWDCSAWVRLYAFYLNERVECYRVLKYDVEADRLMRLP-QASGKAHSRTRTLP  183

Query  775  SEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINLVD  954
              +LLDQLPALQ+LL RLI C+P+G+A  NY++QYALALVLKESFKIYC+INDGIINLVD
Sbjct  184  CRDLLDQLPALQKLLLRLISCQPDGSACTNYLVQYALALVLKESFKIYCSINDGIINLVD  243

Query  955  KFFEMPR  975
             +F+MP+
Sbjct  244  MYFDMPK  250



>ref|XP_002437533.1| hypothetical protein SORBIDRAFT_10g028860 [Sorghum bicolor]
 gb|EER88900.1| hypothetical protein SORBIDRAFT_10g028860 [Sorghum bicolor]
Length=595

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 181/253 (72%), Positives = 210/253 (83%), Gaps = 10/253 (4%)
 Frame = +1

Query  220  MGTLQT---WRKAYGALKDHTKVGLAHVNS-----DFKDVDVAIVKATNHVECPPKERHL  375
            MGT+     WRKA GA+KD   VG+A VNS     + KD+DVA+VKAT HVE PPKERH+
Sbjct  1    MGTVSVRKRWRKACGAIKDSATVGIAKVNSGGGGRERKDLDVAVVKATTHVERPPKERHV  60

Query  376  RKIMVYTSAVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLN  555
              I   TSA RP  DV+YC+HALARRL+KTHNW VALKTLIV+HRTLREGD  FREELL 
Sbjct  61   AAIFAATSASRPLTDVSYCVHALARRLSKTHNWVVALKTLIVVHRTLREGDAAFREELLG  120

Query  556  FQQRGRVLQMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQ  735
            +++ G  L+MSNFKDDSSP+AWDCSAWVRTYAL+LEERLECFRVL+YDIE+ERL   PA+
Sbjct  121  YRRHGHALRMSNFKDDSSPLAWDCSAWVRTYALYLEERLECFRVLRYDIESERL--RPAE  178

Query  736  GQEKGYSKTRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKI  915
            G  KG S+TR L  ++LL+QLPALQQLL+RL+GC+PEGAA GNY+IQYALALVLKESFKI
Sbjct  179  GDPKGQSRTRTLGQDDLLEQLPALQQLLFRLVGCQPEGAAFGNYLIQYALALVLKESFKI  238

Query  916  YCAINDGIINLVD  954
            YCA+NDGIINLVD
Sbjct  239  YCALNDGIINLVD  251



>gb|AFW78995.1| hypothetical protein ZEAMMB73_223268 [Zea mays]
Length=232

 Score =   336 bits (862),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 188/207 (91%), Gaps = 1/207 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M ++Q+WRKAYGA+KD T V LA++NSDFKD+DVAIVKATNHVECPPKERHLRK++  TS
Sbjct  1    MASMQSWRKAYGAIKDTTTVSLANLNSDFKDLDVAIVKATNHVECPPKERHLRKVVAATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAYCIHALARRLAKT NW VALK L+VIHR LREGDPTFREELLNF QRGR+L
Sbjct  61   IARPRADVAYCIHALARRLAKTRNWIVALKALVVIHRLLREGDPTFREELLNFTQRGRIL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDSSPIAWDCSAWVRTY LFLEERLECFRVLKYD+EAERL K   QG EKG+S+
Sbjct  121  QLSNFKDDSSPIAWDCSAWVRTYGLFLEERLECFRVLKYDVEAERLSK-QGQGPEKGHSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCR  840
            TREL+S++LL+QLPALQQLLYRL+GCR
Sbjct  180  TRELDSQDLLEQLPALQQLLYRLVGCR  206



>gb|AES92253.2| clathrin assembly plant-like protein [Medicago truncatula]
Length=579

 Score =   344 bits (883),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 171/252 (68%), Positives = 209/252 (83%), Gaps = 0/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT QTWRKAYGALKD TKVGLA VNS++K++D+AIVKAT+H+E PPKERH+RKI   TS
Sbjct  1    MGTFQTWRKAYGALKDSTKVGLAKVNSEYKELDIAIVKATSHLEYPPKERHVRKIFYATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A +PR DV+YC+  L++RL KT NW VA+KTLIV+HR LREGD +F+E+L+N+  R R L
Sbjct  61   AHQPRTDVSYCLQTLSKRLLKTRNWIVAIKTLIVVHRILREGDLSFKEDLVNYSHRVRFL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNFKDDSSP+AWDCSAWVRTYA FLEERLECFR+ KYDIE ER  K  +    K +S+
Sbjct  121  RISNFKDDSSPLAWDCSAWVRTYAQFLEERLECFRIFKYDIEFERSTKLSSPASTKTHSR  180

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            T  L S+ELL+QLPALQQLLYRL+ C+PEGAA  NY+IQYALAL+LKES+KIY ++NDGI
Sbjct  181  TTVLTSDELLEQLPALQQLLYRLVCCQPEGAAFNNYLIQYALALILKESYKIYSSLNDGI  240

Query  940  INLVDKFFEMPR  975
            I L D FF+M +
Sbjct  241  IKLGDVFFDMAK  252



>ref|XP_003610056.1| Phosphoprotein-like protein [Medicago truncatula]
Length=584

 Score =   344 bits (882),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 171/252 (68%), Positives = 209/252 (83%), Gaps = 0/252 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT QTWRKAYGALKD TKVGLA VNS++K++D+AIVKAT+H+E PPKERH+RKI   TS
Sbjct  1    MGTFQTWRKAYGALKDSTKVGLAKVNSEYKELDIAIVKATSHLEYPPKERHVRKIFYATS  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
            A +PR DV+YC+  L++RL KT NW VA+KTLIV+HR LREGD +F+E+L+N+  R R L
Sbjct  61   AHQPRTDVSYCLQTLSKRLLKTRNWIVAIKTLIVVHRILREGDLSFKEDLVNYSHRVRFL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNFKDDSSP+AWDCSAWVRTYA FLEERLECFR+ KYDIE ER  K  +    K +S+
Sbjct  121  RISNFKDDSSPLAWDCSAWVRTYAQFLEERLECFRIFKYDIEFERSTKLSSPASTKTHSR  180

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            T  L S+ELL+QLPALQQLLYRL+ C+PEGAA  NY+IQYALAL+LKES+KIY ++NDGI
Sbjct  181  TTVLTSDELLEQLPALQQLLYRLVCCQPEGAAFNNYLIQYALALILKESYKIYSSLNDGI  240

Query  940  INLVDKFFEMPR  975
            I L D FF+M +
Sbjct  241  IKLGDVFFDMAK  252



>gb|ABR16117.1| unknown [Picea sitchensis]
Length=547

 Score =   339 bits (869),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 179/252 (71%), Positives = 202/252 (80%), Gaps = 14/252 (6%)
 Frame = +1

Query  223  GTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSA  402
            GT Q+ RKA GALKD T V LA VNSD+KD+D+AIVKATNHVE P KE+H+R I   TSA
Sbjct  6    GTQQSLRKALGALKDTTTVSLAKVNSDYKDLDIAIVKATNHVERPAKEKHIRIIFAATSA  65

Query  403  VRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNF-QQRGRVL  579
             RPRADVAYCIHALARRLAKTHNW VALKTLIVIHR LRE DPTFREEL+N+ + RG +L
Sbjct  66   TRPRADVAYCIHALARRLAKTHNWAVALKTLIVIHRALREVDPTFREELINYSRSRGHIL  125

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
             +S FKDDSS  AWD SAWVR+YALFLEERLEC+RVLKYDIE ERL             +
Sbjct  126  NLSYFKDDSSSNAWDYSAWVRSYALFLEERLECYRVLKYDIETERL-------------R  172

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL++ ELL+QLPALQQ LYRL+GC+PEGAA+ N+VIQYAL  V +ES K+Y AIND  
Sbjct  173  TRELDTVELLEQLPALQQYLYRLMGCQPEGAAISNHVIQYALTAVSRESIKLYTAINDAT  232

Query  940  INLVDKFFEMPR  975
            INLVDKFFEM R
Sbjct  233  INLVDKFFEMQR  244



>ref|XP_010929366.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X5 [Elaeis guineensis]
Length=459

 Score =   335 bits (860),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/228 (75%), Positives = 197/228 (86%), Gaps = 1/228 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT Q+WR+AYGALKD TKVGLA VNS+FK++D+A+VKATNHVECPPKERH+RKI V T+
Sbjct  1    MGTFQSWRQAYGALKDTTKVGLAKVNSEFKELDIAVVKATNHVECPPKERHVRKIFVATA  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPR DVAYC+H LARRLAKT NW VALKTLIVIHR LREGDPTFREELLN+ +RG VL
Sbjct  61   VDRPRTDVAYCVHILARRLAKTRNWVVALKTLIVIHRALREGDPTFREELLNYSRRGNVL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNF+DDSS +AWDCSAWVRTYALFLEERLECFR+LKYDIEAERL K  + G  KG S+
Sbjct  121  RISNFRDDSSSLAWDCSAWVRTYALFLEERLECFRILKYDIEAERLRK-FSDGDAKGQSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKE  903
            T +L  ++LLDQLPALQ LLY L+GC+PE AA GNY+IQYALAL  +E
Sbjct  180  TGKLGCQDLLDQLPALQNLLYCLVGCQPERAAFGNYLIQYALALEYEE  227



>ref|XP_002437409.1| hypothetical protein SORBIDRAFT_10g026370 [Sorghum bicolor]
 gb|EER88776.1| hypothetical protein SORBIDRAFT_10g026370 [Sorghum bicolor]
Length=269

 Score =   327 bits (839),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 163/252 (65%), Positives = 190/252 (75%), Gaps = 33/252 (13%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MG+  TWRKAYGALKD T+VGLA+ NS++KD+D+AIVKATNHVECPPKERH R+I+  TS
Sbjct  1    MGS-GTWRKAYGALKDSTRVGLANFNSEYKDLDIAIVKATNHVECPPKERHFRRILYATS  59

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPRADVAY I ALARRL+KT NW VALKTLIVIHR LREGD TF+E+ L +  RG +L
Sbjct  60   GHRPRADVAYSICALARRLSKTKNWIVALKTLIVIHRLLREGDGTFKEDFLTYSFRGNIL  119

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+  FKDDSSP+AWDCSAWVRTYAL+L+ER+ECFRVLKYD+E +RL K P   Q  G   
Sbjct  120  QIPLFKDDSSPLAWDCSAWVRTYALYLDERVECFRVLKYDVELDRLLKLP---QASG---  173

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
                                      +PEGAA  NY++QYALALVLKESFKIYC+INDGI
Sbjct  174  --------------------------KPEGAACTNYLVQYALALVLKESFKIYCSINDGI  207

Query  940  INLVDKFFEMPR  975
            INLVD +FEMP+
Sbjct  208  INLVDMYFEMPK  219



>ref|XP_010929365.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X4 [Elaeis guineensis]
Length=486

 Score =   335 bits (858),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/224 (76%), Positives = 195/224 (87%), Gaps = 1/224 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT Q+WR+AYGALKD TKVGLA VNS+FK++D+A+VKATNHVECPPKERH+RKI V T+
Sbjct  1    MGTFQSWRQAYGALKDTTKVGLAKVNSEFKELDIAVVKATNHVECPPKERHVRKIFVATA  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPR DVAYC+H LARRLAKT NW VALKTLIVIHR LREGDPTFREELLN+ +RG VL
Sbjct  61   VDRPRTDVAYCVHILARRLAKTRNWVVALKTLIVIHRALREGDPTFREELLNYSRRGNVL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNF+DDSS +AWDCSAWVRTYALFLEERLECFR+LKYDIEAERL K  + G  KG S+
Sbjct  121  RISNFRDDSSSLAWDCSAWVRTYALFLEERLECFRILKYDIEAERLRK-FSDGDAKGQSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALAL  891
            T +L  ++LLDQLPALQ LLY L+GC+PE AA GNY+IQYALAL
Sbjct  180  TGKLGCQDLLDQLPALQNLLYCLVGCQPERAAFGNYLIQYALAL  223



>ref|XP_010929363.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X2 [Elaeis guineensis]
Length=535

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 171/229 (75%), Positives = 197/229 (86%), Gaps = 1/229 (0%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            MGT Q+WR+AYGALKD TKVGLA VNS+FK++D+A+VKATNHVECPPKERH+RKI V T+
Sbjct  1    MGTFQSWRQAYGALKDTTKVGLAKVNSEFKELDIAVVKATNHVECPPKERHVRKIFVATA  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
              RPR DVAYC+H LARRLAKT NW VALKTLIVIHR LREGDPTFREELLN+ +RG VL
Sbjct  61   VDRPRTDVAYCVHILARRLAKTRNWVVALKTLIVIHRALREGDPTFREELLNYSRRGNVL  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            ++SNF+DDSS +AWDCSAWVRTYALFLEERLECFR+LKYDIEAERL K  + G  KG S+
Sbjct  121  RISNFRDDSSSLAWDCSAWVRTYALFLEERLECFRILKYDIEAERLRK-FSDGDAKGQSR  179

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKES  906
            T +L  ++LLDQLPALQ LLY L+GC+PE AA GNY+IQYALAL  + S
Sbjct  180  TGKLGCQDLLDQLPALQNLLYCLVGCQPERAAFGNYLIQYALALFFEMS  228



>gb|EYU38747.1| hypothetical protein MIMGU_mgv1a003095mg [Erythranthe guttata]
Length=608

 Score =   338 bits (866),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 173/255 (68%), Positives = 208/255 (82%), Gaps = 8/255 (3%)
 Frame = +1

Query  220  MGTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTS  399
            M  L+ +RKAYGALKD TKVGLA VNS+FK++D+AIVKATNHVE PPKERH+RKI    +
Sbjct  1    MEILRGFRKAYGALKDSTKVGLAKVNSEFKELDIAIVKATNHVERPPKERHVRKIFAAVA  60

Query  400  AVRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVL  579
               PRADV YCIHAL++RL+KTH+W VA+K LIV HR LREGDP+FREEL +F +RG + 
Sbjct  61   ISCPRADVGYCIHALSKRLSKTHSWIVAIKCLIVFHRILREGDPSFREELAHFSRRGNLF  120

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
            Q+SNFKDDS P+AWDCSAWVRTYALFLEERL+C R L YD E+++  K        G SK
Sbjct  121  QISNFKDDSGPVAWDCSAWVRTYALFLEERLQCLRNLNYDTESDKGTK-----SASGESK  175

Query  760  TRE---LNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAIN  930
            ++    +N+EELL+QLP LQQLLYRL+ C+PEGAA  N+V+QYALALV+KESFK+YCAIN
Sbjct  176  SKPPLVMNAEELLEQLPELQQLLYRLVCCQPEGAARHNFVVQYALALVVKESFKVYCAIN  235

Query  931  DGIINLVDKFFEMPR  975
            DGIINLVD FFEMP+
Sbjct  236  DGIINLVDTFFEMPK  250



>ref|XP_004508453.1| PREDICTED: putative clathrin assembly protein At5g35200-like 
[Cicer arietinum]
Length=544

 Score =   329 bits (843),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 173/252 (69%), Positives = 203/252 (81%), Gaps = 14/252 (6%)
 Frame = +1

Query  223  GTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSA  402
            GT ++ RKA GALKD T V LA VNSD+K++D+AIV+ATNHVE P KE+H+R I    SA
Sbjct  4    GTQKSLRKALGALKDTTTVSLAKVNSDYKELDIAIVRATNHVERPAKEKHMRAIFSAISA  63

Query  403  VRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNF-QQRGRVL  579
             RPRADVAYCIHALARRL+KTHNW VALKTLIVIHR LRE DPTF EEL+N+ + R  +L
Sbjct  64   TRPRADVAYCIHALARRLSKTHNWAVALKTLIVIHRALREVDPTFHEELINYGRSRSHML  123

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
             MS+FKDDSSP AWD SAWVRTYALFLEERLECFRVLKYDIEA+R              +
Sbjct  124  NMSHFKDDSSPNAWDYSAWVRTYALFLEERLECFRVLKYDIEADR-------------PR  170

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            T++L++ ELL+QLPALQQLLYR+IGC+P+GAAV N+VIQ AL+LV  ES KIY AI+DG 
Sbjct  171  TKDLDTAELLEQLPALQQLLYRVIGCQPQGAAVNNFVIQLALSLVASESIKIYQAISDGT  230

Query  940  INLVDKFFEMPR  975
            +N+VDKFFEM R
Sbjct  231  VNMVDKFFEMQR  242



>ref|XP_006845427.1| PREDICTED: putative clathrin assembly protein At5g35200 [Amborella 
trichopoda]
 gb|ERN07102.1| hypothetical protein AMTR_s00019p00093710 [Amborella trichopoda]
Length=542

 Score =   328 bits (842),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/252 (69%), Positives = 202/252 (80%), Gaps = 14/252 (6%)
 Frame = +1

Query  223  GTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSA  402
            GT Q+ R+  GALKD T VGLA VNSD+KD+DVAIVKATNHVE   KE+H++ I   TS 
Sbjct  6    GTQQSLRRYLGALKDSTTVGLAMVNSDYKDLDVAIVKATNHVEQLAKEKHIQIIFSATSV  65

Query  403  VRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNF-QQRGRVL  579
             RPRADVAYCIHALARRL KTHNW VALKTLIVIHR LRE DPTFREEL+N+ + RG +L
Sbjct  66   ARPRADVAYCIHALARRLVKTHNWAVALKTLIVIHRALREVDPTFREELINYGRSRGHML  125

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
             +S+FKDDSSP AWD SAWVR YAL+LEERLECFRVLKYD+E ER             S+
Sbjct  126  NLSHFKDDSSPNAWDYSAWVRMYALYLEERLECFRVLKYDVETER-------------SR  172

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            TREL++ +LL+QLPALQQLL+RL+ C+PEGAAV NYVIQYAL++V  ES K+Y AINDG 
Sbjct  173  TRELDTPDLLEQLPALQQLLHRLLACQPEGAAVYNYVIQYALSMVAGESIKLYNAINDGT  232

Query  940  INLVDKFFEMPR  975
            +NLVDKFFEM R
Sbjct  233  LNLVDKFFEMQR  244



>gb|KDO73483.1| hypothetical protein CISIN_1g009078mg [Citrus sinensis]
Length=314

 Score =   319 bits (817),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 201/252 (80%), Gaps = 14/252 (6%)
 Frame = +1

Query  223  GTLQTWRKAYGALKDHTKVGLAHVNSDFKDVDVAIVKATNHVECPPKERHLRKIMVYTSA  402
            GT +++RKA GALKD T V LA VNSD+K++D+AIVKATNHVE P KE+H+R +    SA
Sbjct  5    GTQKSFRKALGALKDTTTVSLAKVNSDYKELDIAIVKATNHVERPAKEKHIRAVFASISA  64

Query  403  VRPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNF-QQRGRVL  579
             RPRADVAYCIHALA+RL+KTHNW VALKTLIVIHR LRE DPTF EE++N+ + R  +L
Sbjct  65   TRPRADVAYCIHALAKRLSKTHNWAVALKTLIVIHRALREVDPTFHEEVINYGRSRSHML  124

Query  580  QMSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSK  759
             M++FKDDSSP AWD SAWVR+YALFLEERLECFRVLKYDIE +R              +
Sbjct  125  NMAHFKDDSSPNAWDYSAWVRSYALFLEERLECFRVLKYDIETDR-------------PR  171

Query  760  TRELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGI  939
            T++L++ ELL+ LPALQ LL+R++GC+P+GAAV N+VIQ AL+LV  ES KIY AI+DG 
Sbjct  172  TKDLDTAELLEHLPALQLLLFRVLGCQPQGAAVHNFVIQLALSLVASESTKIYQAISDGT  231

Query  940  INLVDKFFEMPR  975
            +NLVDKFFEM R
Sbjct  232  VNLVDKFFEMQR  243



>gb|KJB78155.1| hypothetical protein B456_012G181700 [Gossypium raimondii]
Length=500

 Score =   325 bits (833),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = +1

Query  406  RPRADVAYCIHALARRLAKTHNWTVALKTLIVIHRTLREGDPTFREELLNFQQRGRVLQM  585
            RPRADVAYCIHAL+RRLAKT NWTVALKTLIVIHR LREGDPTFREELLNF QR  +LQ+
Sbjct  3    RPRADVAYCIHALSRRLAKTRNWTVALKTLIVIHRALREGDPTFREELLNFSQRAGILQI  62

Query  586  SNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPKPPAQGQEKGYSKTR  765
            SNFKDDSSPIAWDCSAWVRTYALFLEERLEC+ +LKYDIEAERLP+ P  GQ+K YS+T 
Sbjct  63   SNFKDDSSPIAWDCSAWVRTYALFLEERLECYSILKYDIEAERLPR-PVLGQDKDYSRTT  121

Query  766  ELNSEElldqlpalqqllYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIIN  945
            EL++EELL+QLPALQQLLYRLIGC PEGAAV NYVIQYALALVLKESFKIYCAIN GIIN
Sbjct  122  ELDNEELLEQLPALQQLLYRLIGCLPEGAAVANYVIQYALALVLKESFKIYCAINGGIIN  181

Query  946  LVDKFFEMPR  975
            LVDKFFEMPR
Sbjct  182  LVDKFFEMPR  191



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2380164130925