BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7389

Length=801
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009797863.1|  PREDICTED: zinc-finger homeodomain protein 9...    154   1e-40   Nicotiana sylvestris
ref|XP_009620291.1|  PREDICTED: zinc-finger homeodomain protein 9...    154   2e-40   Nicotiana tomentosiformis
ref|XP_008341574.1|  PREDICTED: zinc-finger homeodomain protein 1...    141   6e-36   
ref|XP_004233362.1|  PREDICTED: zinc-finger homeodomain protein 9       141   9e-36   Solanum lycopersicum
ref|XP_011085755.1|  PREDICTED: zinc-finger homeodomain protein 9       139   6e-35   Sesamum indicum [beniseed]
ref|XP_004304301.1|  PREDICTED: zinc-finger homeodomain protein 9       139   7e-35   Fragaria vesca subsp. vesca
ref|XP_008443414.1|  PREDICTED: zinc-finger homeodomain protein 9...    137   9e-35   Cucumis melo [Oriental melon]
ref|XP_006357111.1|  PREDICTED: transcription factor HB29-like          137   2e-34   Solanum tuberosum [potatoes]
ref|XP_008379353.1|  PREDICTED: zinc-finger homeodomain protein 9...    137   3e-34   Malus domestica [apple tree]
ref|XP_004147471.1|  PREDICTED: zinc-finger homeodomain protein 9...    135   1e-33   Cucumis sativus [cucumbers]
ref|XP_007215708.1|  hypothetical protein PRUPE_ppa008908mg             134   2e-33   
ref|XP_007151228.1|  hypothetical protein PHAVU_004G028600g             134   5e-33   Phaseolus vulgaris [French bean]
ref|XP_007139577.1|  hypothetical protein PHAVU_008G041300g             133   7e-33   Phaseolus vulgaris [French bean]
gb|KFK33764.1|  hypothetical protein AALP_AA5G057200                    132   8e-33   Arabis alpina [alpine rockcress]
ref|XP_008230766.1|  PREDICTED: zinc-finger homeodomain protein 9...    133   1e-32   Prunus mume [ume]
ref|XP_006431147.1|  hypothetical protein CICLE_v10011968mg             133   2e-32   Citrus clementina [clementine]
ref|XP_006482594.1|  PREDICTED: myb-like protein I-like                 132   2e-32   Citrus sinensis [apfelsine]
gb|KJB33553.1|  hypothetical protein B456_006G017200                    132   2e-32   Gossypium raimondii
gb|KDO72567.1|  hypothetical protein CISIN_1g016972mg                   132   2e-32   Citrus sinensis [apfelsine]
ref|XP_007032534.1|  Homeobox protein 34, putative                      131   3e-32   
ref|XP_009787877.1|  PREDICTED: zinc-finger homeodomain protein 9...    130   8e-32   Nicotiana sylvestris
ref|XP_012084702.1|  PREDICTED: zinc-finger homeodomain protein 9...    130   9e-32   Jatropha curcas
ref|XP_010693250.1|  PREDICTED: zinc-finger homeodomain protein 9...    131   1e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009621030.1|  PREDICTED: zinc-finger homeodomain protein 9...    130   1e-31   Nicotiana tomentosiformis
ref|XP_011010943.1|  PREDICTED: zinc-finger homeodomain protein 9...    130   1e-31   Populus euphratica
ref|XP_010257380.1|  PREDICTED: zinc-finger homeodomain protein 9       129   1e-31   Nelumbo nucifera [Indian lotus]
gb|KJB75739.1|  hypothetical protein B456_012G054300                    128   4e-31   Gossypium raimondii
emb|CDP02232.1|  unnamed protein product                                129   4e-31   Coffea canephora [robusta coffee]
ref|XP_006357697.1|  PREDICTED: transcription factor HB29-like          127   5e-31   Solanum tuberosum [potatoes]
ref|XP_010258352.1|  PREDICTED: zinc-finger homeodomain protein 9...    127   5e-31   Nelumbo nucifera [Indian lotus]
ref|XP_002534012.1|  conserved hypothetical protein                     128   6e-31   Ricinus communis
gb|EPS71422.1|  hypothetical protein M569_03334                         125   1e-30   Genlisea aurea
ref|XP_006405598.1|  hypothetical protein EUTSA_v10028098mg             126   2e-30   Eutrema salsugineum [saltwater cress]
ref|XP_002305381.2|  hypothetical protein POPTR_0004s12500g             126   2e-30   
ref|XP_010552878.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...    126   3e-30   Tarenaya hassleriana [spider flower]
ref|XP_004491795.1|  PREDICTED: transcription factor HB29-like          125   4e-30   Cicer arietinum [garbanzo]
ref|XP_002324056.2|  hypothetical protein POPTR_0017s11920g             125   6e-30   
ref|XP_006373320.1|  hypothetical protein POPTR_0017s11920g             124   6e-30   
ref|XP_002283533.1|  PREDICTED: zinc-finger homeodomain protein 9       125   7e-30   Vitis vinifera
gb|KFK26902.1|  hypothetical protein AALP_AA8G308300                    124   9e-30   Arabis alpina [alpine rockcress]
ref|XP_011010066.1|  PREDICTED: zinc-finger homeodomain protein 9...    124   1e-29   Populus euphratica
ref|XP_006363398.1|  PREDICTED: transcription factor HB29-like          124   1e-29   Solanum tuberosum [potatoes]
ref|XP_010453650.1|  PREDICTED: zinc-finger homeodomain protein 8...    123   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_009620302.1|  PREDICTED: zinc-finger homeodomain protein 9...    123   1e-29   Nicotiana tomentosiformis
ref|XP_010425683.1|  PREDICTED: zinc-finger homeodomain protein 9...    124   2e-29   Camelina sativa [gold-of-pleasure]
emb|CBI22215.3|  unnamed protein product                                122   2e-29   Vitis vinifera
ref|XP_009788342.1|  PREDICTED: zinc-finger homeodomain protein 9...    122   2e-29   Nicotiana sylvestris
ref|XP_003543789.1|  PREDICTED: transcription factor HB29-like          124   2e-29   Glycine max [soybeans]
ref|XP_010492347.1|  PREDICTED: zinc-finger homeodomain protein 8       122   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010420179.1|  PREDICTED: zinc-finger homeodomain protein 8...    121   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_009341023.1|  PREDICTED: zinc-finger homeodomain protein 9       123   6e-29   
ref|XP_004233363.1|  PREDICTED: zinc-finger homeodomain protein 9...    123   6e-29   
ref|XP_002873714.1|  ATHB30/ZFHD3                                       121   6e-29   
emb|CAN64768.1|  hypothetical protein VITISV_010311                     123   6e-29   Vitis vinifera
ref|XP_002273802.1|  PREDICTED: zinc-finger homeodomain protein 11      122   9e-29   Vitis vinifera
gb|EPS70696.1|  hypothetical protein M569_04063                         120   9e-29   Genlisea aurea
ref|XP_006606671.1|  PREDICTED: transcription factor HB29-like          119   1e-28   Glycine max [soybeans]
ref|XP_004489395.1|  PREDICTED: transcription factor HB29-like          121   1e-28   Cicer arietinum [garbanzo]
ref|XP_010937133.1|  PREDICTED: zinc-finger homeodomain protein 9...    121   1e-28   Elaeis guineensis
ref|NP_197025.1|  zinc finger homeodomain transcriptional factor ...    119   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802616.1|  PREDICTED: zinc-finger homeodomain protein 9...    119   6e-28   Phoenix dactylifera
ref|XP_003621193.1|  ZF-HD homeobox protein                             119   9e-28   Medicago truncatula
ref|XP_006602909.1|  PREDICTED: transcription factor HB29-like          119   9e-28   Glycine max [soybeans]
gb|AES74711.2|  transcription factor HB29-like protein                  119   1e-27   Medicago truncatula
ref|XP_011655994.1|  PREDICTED: zinc-finger homeodomain protein 1...    118   2e-27   Cucumis sativus [cucumbers]
ref|XP_006290001.1|  hypothetical protein CARUB_v10003631mg             117   3e-27   Capsella rubella
gb|KFK25766.1|  hypothetical protein AALP_AA8G156900                    116   3e-27   Arabis alpina [alpine rockcress]
ref|XP_008784223.1|  PREDICTED: zinc-finger homeodomain protein 9...    117   5e-27   Phoenix dactylifera
ref|XP_011070997.1|  PREDICTED: zinc-finger homeodomain protein 10      116   6e-27   Sesamum indicum [beniseed]
ref|XP_009139922.1|  PREDICTED: zinc-finger homeodomain protein 10      117   6e-27   Brassica rapa
ref|XP_009788413.1|  PREDICTED: zinc-finger homeodomain protein 9...    114   1e-26   Nicotiana sylvestris
ref|XP_006400038.1|  hypothetical protein EUTSA_v10016088mg             115   1e-26   Eutrema salsugineum [saltwater cress]
ref|XP_008467057.1|  PREDICTED: zinc-finger homeodomain protein 1...    115   2e-26   Cucumis melo [Oriental melon]
ref|XP_007158652.1|  hypothetical protein PHAVU_002G171000g             115   3e-26   Phaseolus vulgaris [French bean]
ref|XP_006302745.1|  hypothetical protein CARUB_v10020860mg             113   3e-26   Capsella rubella
gb|ABY61030.1|  zinc finger-homeodomain protein 1                       114   5e-26   Cucumis sativus [cucumbers]
gb|EAZ09094.1|  hypothetical protein OsI_31360                          111   9e-26   Oryza sativa Indica Group [Indian rice]
emb|CDY56033.1|  BnaC04g55850D                                          112   1e-25   Brassica napus [oilseed rape]
gb|EEE69700.1|  hypothetical protein OsJ_29356                          111   1e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009121598.1|  PREDICTED: zinc-finger homeodomain protein 8       112   2e-25   Brassica rapa
ref|XP_002887246.1|  ATHB29/ZFHD1                                       111   2e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_008389477.1|  PREDICTED: zinc-finger homeodomain protein 1...    113   2e-25   Malus domestica [apple tree]
ref|XP_010939501.1|  PREDICTED: zinc-finger homeodomain protein 9...    112   2e-25   Elaeis guineensis
ref|XP_008221618.1|  PREDICTED: zinc-finger homeodomain protein 1...    113   2e-25   Prunus mume [ume]
ref|NP_177118.1|  transcriptional factor ZFHD1                          111   2e-25   Arabidopsis thaliana [mouse-ear cress]
sp|Q6ER21.2|ZHD9_ORYSJ  RecName: Full=Zinc-finger homeodomain pro...    112   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006390994.1|  hypothetical protein EUTSA_v10019038mg             111   3e-25   Eutrema salsugineum [saltwater cress]
gb|EPS58358.1|  hypothetical protein M569_16456                         109   3e-25   Genlisea aurea
emb|CDX69541.1|  BnaA10g18900D                                          111   4e-25   
ref|XP_004238801.1|  PREDICTED: zinc-finger homeodomain protein 1...    111   4e-25   Solanum lycopersicum
ref|XP_010683186.1|  PREDICTED: zinc-finger homeodomain protein 8...    112   4e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010470956.1|  PREDICTED: zinc-finger homeodomain protein 11      110   5e-25   Camelina sativa [gold-of-pleasure]
ref|XP_004298431.2|  PREDICTED: zinc-finger homeodomain protein 1...    112   5e-25   Fragaria vesca subsp. vesca
ref|XP_007224765.1|  hypothetical protein PRUPE_ppa024080mg             112   5e-25   Prunus persica
gb|EEE69699.1|  hypothetical protein OsJ_29355                          111   6e-25   Oryza sativa Japonica Group [Japonica rice]
emb|CDY28566.1|  BnaC02g19350D                                          110   6e-25   Brassica napus [oilseed rape]
emb|CDY44079.1|  BnaA02g14430D                                          110   7e-25   Brassica napus [oilseed rape]
gb|ACG35864.1|  ZF-HD homeobox protein                                  111   7e-25   Zea mays [maize]
ref|NP_001063169.1|  Os09g0414600                                       106   7e-25   
ref|NP_001145929.1|  uncharacterized protein LOC100279452               111   8e-25   
ref|XP_006366102.1|  PREDICTED: transcription factor HB29-like          110   8e-25   Solanum tuberosum [potatoes]
ref|XP_003528585.2|  PREDICTED: transcription factor HB29-like          111   8e-25   Glycine max [soybeans]
ref|NP_001183843.1|  uncharacterized protein LOC100502436               111   9e-25   
ref|XP_004956814.1|  PREDICTED: transcription factor HB29-like          111   9e-25   
ref|NP_001150690.1|  ZF-HD homeobox protein                             111   1e-24   
dbj|BAD28899.1|  putative ZF-HD homeobox protein                        109   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007046103.1|  Homeobox protein 34, putative                      110   1e-24   
ref|XP_002462378.1|  hypothetical protein SORBIDRAFT_02g024650          110   1e-24   
tpg|DAA40076.1|  TPA: ZF-HD homeobox protein                            110   1e-24   
ref|XP_010415617.1|  PREDICTED: zinc-finger homeodomain protein 1...    108   2e-24   
ref|XP_009360340.1|  PREDICTED: zinc-finger homeodomain protein 8       110   2e-24   Pyrus x bretschneideri [bai li]
ref|XP_002877141.1|  hypothetical protein ARALYDRAFT_484662             109   2e-24   
ref|XP_004135457.1|  PREDICTED: zinc-finger homeodomain protein 8       107   2e-24   Cucumis sativus [cucumbers]
ref|XP_006438687.1|  hypothetical protein CICLE_v10032160mg             109   3e-24   Citrus clementina [clementine]
gb|KDO82923.1|  hypothetical protein CISIN_1g046396mg                   109   3e-24   Citrus sinensis [apfelsine]
gb|KJB80187.1|  hypothetical protein B456_013G085500                    108   3e-24   Gossypium raimondii
ref|XP_006660162.1|  PREDICTED: transcription factor HB29-like          106   3e-24   
ref|NP_189534.1|  homeobox protein 34                                   108   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512007.1|  PREDICTED: zinc-finger homeodomain protein 1...    107   4e-24   
ref|XP_010512006.1|  PREDICTED: zinc-finger homeodomain protein 1...    107   4e-24   Camelina sativa [gold-of-pleasure]
gb|KJB30399.1|  hypothetical protein B456_005G141400                    108   4e-24   Gossypium raimondii
ref|XP_008353097.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...    108   5e-24   
ref|XP_008339904.1|  PREDICTED: zinc-finger homeodomain protein 1...    108   5e-24   
gb|KEH19725.1|  homeobox domain, ZF-HD class protein                    109   5e-24   Medicago truncatula
emb|CAC34408.1|  ZF-HD homeobox protein                                 107   7e-24   Flaveria bidentis
ref|XP_010550055.1|  PREDICTED: zinc-finger homeodomain protein 8...    107   1e-23   Tarenaya hassleriana [spider flower]
ref|XP_010086552.1|  hypothetical protein L484_001444                   108   1e-23   
gb|ABO92969.1|  ZF-HD homeobox domain-containing protein                107   1e-23   Solanum tuberosum [potatoes]
ref|XP_008792837.1|  PREDICTED: zinc-finger homeodomain protein 9...    107   1e-23   Phoenix dactylifera
ref|XP_004973533.1|  PREDICTED: transcription factor HB29-like          107   1e-23   Setaria italica
ref|XP_006291497.1|  hypothetical protein CARUB_v10017644mg             107   2e-23   Capsella rubella
ref|XP_008446349.1|  PREDICTED: zinc-finger homeodomain protein 9       105   2e-23   Cucumis melo [Oriental melon]
emb|CDX86403.1|  BnaA06g31200D                                          107   2e-23   
gb|AAT39967.1|  Putative ZF-HD homeobox protein, identical              106   2e-23   Solanum demissum
ref|XP_009151829.1|  PREDICTED: zinc-finger homeodomain protein 9       107   2e-23   Brassica rapa
ref|XP_002870762.1|  hypothetical protein ARALYDRAFT_494014             106   3e-23   
ref|XP_010502894.1|  PREDICTED: zinc-finger homeodomain protein 9       106   3e-23   Camelina sativa [gold-of-pleasure]
gb|ACF84413.1|  unknown                                                 105   3e-23   Zea mays [maize]
ref|XP_009381426.1|  PREDICTED: zinc-finger homeodomain protein 9...    106   4e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004509968.1|  PREDICTED: transcription factor HB29-like          106   4e-23   Cicer arietinum [garbanzo]
ref|XP_009111615.1|  PREDICTED: zinc-finger homeodomain protein 9...    105   5e-23   Brassica rapa
ref|NP_001149634.1|  ZF-HD homeobox protein                             106   5e-23   
emb|CDX85230.1|  BnaC07g25410D                                          105   5e-23   
emb|CDY20008.1|  BnaA09g02430D                                          105   6e-23   Brassica napus [oilseed rape]
ref|XP_010514609.1|  PREDICTED: zinc-finger homeodomain protein 9...    105   6e-23   Camelina sativa [gold-of-pleasure]
ref|NP_001146009.1|  ZF-HD homeobox protein                             106   6e-23   Zea mays [maize]
ref|XP_009403170.1|  PREDICTED: zinc-finger homeodomain protein 9...    105   7e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002445555.1|  hypothetical protein SORBIDRAFT_07g021470          105   8e-23   Sorghum bicolor [broomcorn]
ref|XP_009593275.1|  PREDICTED: zinc-finger homeodomain protein 1...    103   1e-22   Nicotiana tomentosiformis
ref|XP_002522433.1|  transcription factor, putative                     105   1e-22   Ricinus communis
ref|XP_006395326.1|  hypothetical protein EUTSA_v10004599mg             104   1e-22   Eutrema salsugineum [saltwater cress]
ref|XP_008780606.1|  PREDICTED: zinc-finger homeodomain protein 9...    104   1e-22   
emb|CAC34413.1|  ZF-HD homeobox protein                                 103   2e-22   Flaveria trinervia
ref|XP_003572241.1|  PREDICTED: zinc-finger homeodomain protein 9...    104   2e-22   Brachypodium distachyon [annual false brome]
ref|XP_009410002.1|  PREDICTED: zinc-finger homeodomain protein 9       103   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004959444.1|  PREDICTED: uncharacterized protein LOC101763608    103   3e-22   Setaria italica
ref|XP_008678609.1|  PREDICTED: zinc-finger homeodomain protein 1...    103   3e-22   Zea mays [maize]
ref|NP_568570.1|  homeobox protein 23                                   103   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010926548.1|  PREDICTED: zinc-finger homeodomain protein 9...    102   4e-22   Elaeis guineensis
ref|XP_002315053.2|  hypothetical protein POPTR_0010s17650g             103   4e-22   Populus trichocarpa [western balsam poplar]
ref|XP_003517792.1|  PREDICTED: transcription factor HB29-like          103   4e-22   Glycine max [soybeans]
ref|XP_006285795.1|  hypothetical protein CARUB_v10007269mg             102   7e-22   Capsella rubella
gb|AFW62325.1|  hypothetical protein ZEAMMB73_977464                    104   9e-22   
gb|AAM64462.1|  unknown                                                 102   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010441087.1|  PREDICTED: zinc-finger homeodomain protein 10      101   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_011017078.1|  PREDICTED: zinc-finger homeodomain protein 1...    101   2e-21   Populus euphratica
ref|XP_002312243.2|  hypothetical protein POPTR_0008s08560g             101   2e-21   Populus trichocarpa [western balsam poplar]
ref|XP_012067639.1|  PREDICTED: zinc-finger homeodomain protein 1...    100   2e-21   Jatropha curcas
ref|XP_007157626.1|  hypothetical protein PHAVU_002G085400g             100   3e-21   Phaseolus vulgaris [French bean]
ref|XP_011098625.1|  PREDICTED: zinc-finger homeodomain protein 9...    100   3e-21   Sesamum indicum [beniseed]
ref|XP_003520078.1|  PREDICTED: transcription factor HB29-like          100   3e-21   Glycine max [soybeans]
ref|XP_011013536.1|  PREDICTED: zinc-finger homeodomain protein 1...    100   4e-21   Populus euphratica
dbj|BAE99230.1|  hypothetical protein                                   100   4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010551857.1|  PREDICTED: zinc-finger homeodomain protein 8...  99.4    7e-21   
emb|CDY00104.1|  BnaC09g01970D                                        99.0    1e-20   
ref|XP_010450775.1|  PREDICTED: zinc-finger homeodomain protein 1...  98.2    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_003576527.1|  PREDICTED: zinc-finger homeodomain protein 9...  96.7    8e-20   Brachypodium distachyon [annual false brome]
ref|XP_004972095.1|  PREDICTED: transcription factor HB29-like        94.4    2e-19   Setaria italica
ref|NP_200856.1|  homeobox protein 26                                 92.0    7e-19   
sp|Q9FKJ9.1|ZHD12_ARATH  RecName: Full=Zinc-finger homeodomain pr...  92.4    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010665240.1|  PREDICTED: zinc-finger homeodomain protein 2...  92.0    2e-18   Vitis vinifera
emb|CBI18514.3|  unnamed protein product                              92.0    2e-18   Vitis vinifera
emb|CAN64849.1|  hypothetical protein VITISV_004128                   91.7    2e-18   Vitis vinifera
gb|EYU40171.1|  hypothetical protein MIMGU_mgv1a008153mg              92.8    3e-18   Erythranthe guttata [common monkey flower]
gb|AHC04641.1|  zinc-finger homeodomain 1                             92.8    3e-18   Triticum aestivum [Canadian hard winter wheat]
emb|CDY01760.1|  BnaC06g28000D                                        91.3    3e-18   
ref|XP_009411228.1|  PREDICTED: zinc-finger homeodomain protein 5...  92.4    3e-18   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK05545.1|  predicted protein                                    92.8    3e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX95914.1|  BnaA07g28170D                                        90.5    5e-18   
ref|XP_009394611.1|  PREDICTED: zinc-finger homeodomain protein 2...  91.3    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAC34409.1|  ZF-HD homeobox protein                               91.3    6e-18   Flaveria bidentis
ref|XP_009131913.1|  PREDICTED: zinc-finger homeodomain protein 12    89.0    7e-18   Brassica rapa
ref|XP_010483696.1|  PREDICTED: zinc-finger homeodomain protein 1...  89.4    7e-18   Camelina sativa [gold-of-pleasure]
emb|CDX88760.1|  BnaA03g08890D                                        89.0    7e-18   
emb|CDY69628.1|  BnaAnng31040D                                        88.6    8e-18   Brassica napus [oilseed rape]
ref|XP_006827241.1|  PREDICTED: zinc-finger homeodomain protein 2     89.7    8e-18   Amborella trichopoda
ref|NP_001062055.1|  Os08g0479400                                     90.1    1e-17   
ref|XP_006282138.1|  hypothetical protein CARUB_v10028391mg           88.2    1e-17   Capsella rubella
ref|XP_002977930.1|  hypothetical protein SELMODRAFT_38997            85.5    1e-17   
ref|XP_003622365.1|  Zinc finger-homeodomain protein                  88.6    1e-17   
ref|XP_009127747.1|  PREDICTED: zinc-finger homeodomain protein 1...  89.4    1e-17   Brassica rapa
ref|XP_007047820.1|  ZF-HD homeobox protein, putative                 89.4    1e-17   
gb|ADE76551.1|  unknown                                               89.7    1e-17   Picea sitchensis
ref|XP_012075796.1|  PREDICTED: zinc-finger homeodomain protein 2...  89.4    1e-17   Jatropha curcas
gb|EEE68874.1|  hypothetical protein OsJ_27685                        89.4    1e-17   Oryza sativa Japonica Group [Japonica rice]
gb|KJB48886.1|  hypothetical protein B456_008G092000                  89.0    1e-17   Gossypium raimondii
ref|XP_009804697.1|  PREDICTED: zinc-finger homeodomain protein 6     89.7    2e-17   Nicotiana sylvestris
ref|XP_010530124.1|  PREDICTED: zinc-finger homeodomain protein 2     88.6    2e-17   
ref|XP_002534484.1|  transcription factor, putative                   88.6    3e-17   Ricinus communis
ref|XP_010254805.1|  PREDICTED: zinc-finger homeodomain protein 5...  89.4    3e-17   Nelumbo nucifera [Indian lotus]
emb|CDY11964.1|  BnaC03g13900D                                        85.9    3e-17   Brassica napus [oilseed rape]
ref|NP_001061894.2|  Os08g0438400                                     89.4    3e-17   
ref|XP_002306048.1|  zinc finger family protein                       85.9    3e-17   Populus trichocarpa [western balsam poplar]
ref|XP_010104483.1|  hypothetical protein L484_025452                 88.6    4e-17   Morus notabilis
gb|KJB44094.1|  hypothetical protein B456_007G233800                  88.2    4e-17   Gossypium raimondii
gb|KJB44095.1|  hypothetical protein B456_007G233800                  87.8    4e-17   Gossypium raimondii
gb|KJB18248.1|  hypothetical protein B456_003G042700                  87.8    4e-17   Gossypium raimondii
gb|KHG22175.1|  hypothetical protein F383_07505                       87.8    4e-17   Gossypium arboreum [tree cotton]
ref|XP_009603276.1|  PREDICTED: zinc-finger homeodomain protein 6...  88.6    4e-17   Nicotiana tomentosiformis
gb|EEC83631.1|  hypothetical protein OsI_29362                        89.0    4e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_010456467.1|  PREDICTED: zinc-finger homeodomain protein 1...  87.0    4e-17   
ref|XP_006599376.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  88.6    5e-17   
gb|KHN11103.1|  ZF-HD homeobox protein                                88.2    5e-17   Glycine soja [wild soybean]
ref|XP_002965557.1|  hypothetical protein SELMODRAFT_68508            86.7    5e-17   
ref|XP_009407034.1|  PREDICTED: zinc-finger homeodomain protein 2...  88.2    5e-17   
ref|XP_008800713.1|  PREDICTED: zinc-finger homeodomain protein 6...  88.6    5e-17   
ref|XP_006660219.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  87.8    6e-17   
gb|KJB18247.1|  hypothetical protein B456_003G042700                  87.4    7e-17   Gossypium raimondii
ref|XP_009619186.1|  PREDICTED: zinc-finger homeodomain protein 2...  87.0    8e-17   Nicotiana tomentosiformis
gb|KHN00536.1|  ZF-HD homeobox protein                                87.8    8e-17   Glycine soja [wild soybean]
ref|XP_007156052.1|  hypothetical protein PHAVU_003G254200g           87.8    8e-17   Phaseolus vulgaris [French bean]
gb|ADE77597.1|  unknown                                               87.0    8e-17   Picea sitchensis
ref|XP_003520309.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  87.8    8e-17   Glycine max [soybeans]
ref|XP_010263641.1|  PREDICTED: zinc-finger homeodomain protein 5     87.8    1e-16   Nelumbo nucifera [Indian lotus]
ref|XP_004973708.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  87.0    1e-16   Setaria italica
ref|XP_009415270.1|  PREDICTED: zinc-finger homeodomain protein 6...  87.8    1e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009769508.1|  PREDICTED: zinc-finger homeodomain protein 2...  86.7    1e-16   Nicotiana sylvestris
ref|XP_002981262.1|  hypothetical protein SELMODRAFT_38995            82.4    1e-16   
ref|XP_009769511.1|  PREDICTED: zinc-finger homeodomain protein 2...  86.7    1e-16   Nicotiana sylvestris
ref|XP_010438997.1|  PREDICTED: zinc-finger homeodomain protein 2...  86.3    1e-16   
ref|XP_009782865.1|  PREDICTED: mini zinc finger protein 2            83.2    2e-16   Nicotiana sylvestris
ref|XP_004233925.1|  PREDICTED: mini zinc finger protein 2-like       83.2    2e-16   Solanum lycopersicum
ref|XP_010438998.1|  PREDICTED: zinc-finger homeodomain protein 2...  85.9    2e-16   
ref|XP_009596464.1|  PREDICTED: mini zinc finger protein 2-like       82.8    2e-16   Nicotiana tomentosiformis
ref|XP_010681042.1|  PREDICTED: zinc-finger homeodomain protein 1...  86.3    2e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006286279.1|  hypothetical protein CARUB_v10007856mg           85.5    2e-16   Capsella rubella
ref|XP_010438996.1|  PREDICTED: zinc-finger homeodomain protein 2...  85.9    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009596948.1|  PREDICTED: zinc-finger homeodomain protein 2...  85.5    2e-16   Nicotiana tomentosiformis
ref|XP_006413402.1|  hypothetical protein EUTSA_v10026163mg           85.5    2e-16   Eutrema salsugineum [saltwater cress]
ref|NP_194197.1|  ZF-HD homeobox protein                              85.5    2e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDY03431.1|  BnaC01g16510D                                        85.5    2e-16   
ref|XP_010433740.1|  PREDICTED: zinc-finger homeodomain protein 2...  85.5    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009405659.1|  PREDICTED: zinc-finger homeodomain protein 6...  86.7    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006849460.1|  PREDICTED: zinc-finger homeodomain protein 6     84.7    3e-16   Amborella trichopoda
emb|CDP02013.1|  unnamed protein product                              86.7    3e-16   Coffea canephora [robusta coffee]
ref|XP_009596949.1|  PREDICTED: zinc-finger homeodomain protein 2...  85.1    3e-16   
ref|XP_009802157.1|  PREDICTED: zinc-finger homeodomain protein 2...  85.5    3e-16   Nicotiana sylvestris
gb|ABY61029.1|  zinc finger-homeodomain protein 1                     85.9    3e-16   Asparagus officinalis
ref|XP_010448536.1|  PREDICTED: zinc-finger homeodomain protein 2     85.1    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_012081639.1|  PREDICTED: zinc-finger homeodomain protein 2...  85.5    3e-16   
gb|ABY61019.1|  mini zinc finger 1                                    84.3    3e-16   Welwitschia mirabilis
ref|XP_009410127.1|  PREDICTED: zinc-finger homeodomain protein 2...  85.5    3e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009802158.1|  PREDICTED: zinc-finger homeodomain protein 2...  85.1    3e-16   Nicotiana sylvestris
ref|XP_004288462.1|  PREDICTED: zinc-finger homeodomain protein 1...  85.5    4e-16   Fragaria vesca subsp. vesca
ref|XP_011100018.1|  PREDICTED: zinc-finger homeodomain protein 1...  84.7    4e-16   Sesamum indicum [beniseed]
ref|XP_011099626.1|  PREDICTED: zinc-finger homeodomain protein 6     86.3    4e-16   Sesamum indicum [beniseed]
ref|XP_010939727.1|  PREDICTED: zinc-finger homeodomain protein 2     85.5    4e-16   Elaeis guineensis
ref|XP_002867654.1|  ATHB22/MEE68                                     84.7    4e-16   
emb|CBI19232.3|  unnamed protein product                              85.1    4e-16   Vitis vinifera
ref|XP_006841247.2|  PREDICTED: zinc-finger homeodomain protein 2     85.1    4e-16   Amborella trichopoda
ref|NP_001151888.1|  ZF-HD protein dimerisation region containing...  85.1    4e-16   Zea mays [maize]
ref|XP_001752347.1|  predicted protein                                85.5    4e-16   
gb|ABR16769.1|  unknown                                               83.6    5e-16   Picea sitchensis
ref|XP_009138327.1|  PREDICTED: zinc-finger homeodomain protein 2     84.7    5e-16   Brassica rapa
emb|CDY34299.1|  BnaA01g14020D                                        84.3    5e-16   Brassica napus [oilseed rape]
ref|XP_010029792.1|  PREDICTED: zinc-finger homeodomain protein 6     85.9    5e-16   Eucalyptus grandis [rose gum]
emb|CBI18716.3|  unnamed protein product                              84.0    5e-16   Vitis vinifera
ref|XP_006853040.1|  PREDICTED: zinc-finger homeodomain protein 2     84.7    5e-16   Amborella trichopoda
gb|EYU45173.1|  hypothetical protein MIMGU_mgv1a012298mg              84.7    5e-16   Erythranthe guttata [common monkey flower]
ref|XP_010272957.1|  PREDICTED: zinc-finger homeodomain protein 1...  84.3    5e-16   
ref|XP_009406459.1|  PREDICTED: zinc-finger homeodomain protein 4...  84.7    6e-16   
ref|XP_004152612.1|  PREDICTED: zinc-finger homeodomain protein 2     84.3    6e-16   
ref|XP_009396485.1|  PREDICTED: zinc-finger homeodomain protein 6...  85.9    6e-16   
ref|XP_002285709.1|  PREDICTED: zinc-finger homeodomain protein 1     84.3    6e-16   
ref|XP_009602563.1|  PREDICTED: zinc-finger homeodomain protein 2...  84.7    6e-16   
ref|XP_011003997.1|  PREDICTED: zinc-finger homeodomain protein 2...  84.7    6e-16   
emb|CAN75153.1|  hypothetical protein VITISV_035994                   84.7    6e-16   
gb|ABK25080.1|  unknown                                               84.7    6e-16   
ref|XP_008444884.1|  PREDICTED: zinc-finger homeodomain protein 2     84.3    6e-16   
ref|XP_006338094.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  84.3    7e-16   
gb|ABK25143.1|  unknown                                               84.7    7e-16   
ref|XP_008241887.1|  PREDICTED: zinc-finger homeodomain protein 5...  84.3    8e-16   
ref|XP_006376247.1|  hypothetical protein POPTR_0013s11330g           84.3    8e-16   
ref|XP_011001095.1|  PREDICTED: zinc-finger homeodomain protein 2...  84.3    8e-16   
ref|XP_002325543.2|  hypothetical protein POPTR_0019s11070g           84.0    8e-16   
gb|ERN02922.1|  hypothetical protein AMTR_s00135p00085840             84.0    8e-16   
ref|XP_004237971.1|  PREDICTED: zinc-finger homeodomain protein 2     84.0    8e-16   
ref|XP_006376248.1|  hypothetical protein POPTR_0013s11330g           84.3    8e-16   
ref|XP_007156483.1|  hypothetical protein PHAVU_003G289700g           83.6    9e-16   
ref|XP_009392577.1|  PREDICTED: zinc-finger homeodomain protein 4...  84.3    9e-16   
ref|XP_002994344.1|  hypothetical protein SELMODRAFT_236945           82.4    9e-16   
ref|XP_006340630.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  84.3    9e-16   
ref|XP_006433874.1|  hypothetical protein CICLE_v10002355mg           83.6    1e-15   
ref|XP_009395689.1|  PREDICTED: zinc-finger homeodomain protein 5...  85.1    1e-15   
ref|XP_012068197.1|  PREDICTED: mini zinc finger protein 3-like       80.5    1e-15   
ref|XP_002966118.1|  hypothetical protein SELMODRAFT_85536            82.4    1e-15   
ref|XP_004512050.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  84.0    1e-15   
gb|ABK25649.1|  unknown                                               81.6    1e-15   
ref|XP_002982727.1|  hypothetical protein SELMODRAFT_17376            82.0    1e-15   
ref|XP_009381483.1|  PREDICTED: zinc-finger homeodomain protein 2...  84.0    1e-15   
gb|ABY61028.1|  zinc finger-homeodomain protein 1                     83.6    1e-15   
ref|XP_002442725.1|  hypothetical protein SORBIDRAFT_08g001830        80.1    1e-15   
ref|XP_010326742.1|  PREDICTED: uncharacterized protein LOC101258...  86.7    1e-15   
emb|CDY08945.1|  BnaC08g11750D                                        82.8    2e-15   
gb|KJB43477.1|  hypothetical protein B456_007G202500                  84.0    2e-15   
ref|XP_004247917.1|  PREDICTED: uncharacterized protein LOC101258...  86.7    2e-15   
ref|XP_002445649.1|  hypothetical protein SORBIDRAFT_07g023360        84.0    2e-15   
ref|XP_008670258.1|  PREDICTED: zinc-finger homeodomain protein 1...  83.6    2e-15   
ref|XP_002283546.1|  PREDICTED: mini zinc finger protein 2            80.1    2e-15   
ref|XP_010326743.1|  PREDICTED: uncharacterized protein LOC101258...  86.3    2e-15   
ref|XP_009129138.1|  PREDICTED: zinc-finger homeodomain protein 3     83.6    2e-15   
ref|XP_009624224.1|  PREDICTED: zinc-finger homeodomain protein 2...  82.8    2e-15   
ref|XP_006425664.1|  hypothetical protein CICLE_v10025926mg           84.3    2e-15   
ref|XP_006354529.1|  PREDICTED: uncharacterized protein LOC102604540  86.3    2e-15   
ref|XP_008812231.1|  PREDICTED: zinc-finger homeodomain protein 2...  83.6    2e-15   
ref|XP_003517228.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  83.6    2e-15   
ref|XP_010266504.1|  PREDICTED: zinc-finger homeodomain protein 1...  82.8    2e-15   
ref|XP_010463122.1|  PREDICTED: zinc-finger homeodomain protein 1...  83.2    2e-15   
gb|AFK36118.1|  unknown                                               82.4    2e-15   
emb|CDY09363.1|  BnaA02g26470D                                        83.2    2e-15   
ref|XP_006466561.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  82.4    2e-15   
ref|XP_006426395.1|  hypothetical protein CICLE_v10027184mg           82.4    2e-15   
ref|XP_003612025.1|  Zinc finger-homeodomain protein                  83.2    2e-15   
gb|AES94983.2|  homeobox domain, ZF-HD class protein                  83.2    2e-15   
ref|XP_010678523.1|  PREDICTED: mini zinc finger protein 1            79.3    2e-15   
ref|XP_004234800.1|  PREDICTED: mini zinc finger protein 2-like       79.3    2e-15   
ref|XP_010444532.1|  PREDICTED: zinc-finger homeodomain protein 1     83.2    3e-15   
ref|XP_006291509.1|  hypothetical protein CARUB_v10017657mg           83.6    3e-15   
ref|XP_003635057.1|  PREDICTED: zinc-finger homeodomain protein 2...  82.4    3e-15   
emb|CDY41692.1|  BnaC02g34620D                                        83.2    3e-15   
ref|XP_004489767.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  82.8    3e-15   
ref|XP_001778248.1|  predicted protein                                82.8    3e-15   
ref|XP_004236700.1|  PREDICTED: zinc-finger homeodomain protein 2...  82.4    3e-15   
gb|KDO79571.1|  hypothetical protein CISIN_1g021302mg                 83.2    3e-15   
ref|XP_009371603.1|  PREDICTED: zinc-finger homeodomain protein 6...  83.2    3e-15   
ref|XP_008392268.1|  PREDICTED: zinc-finger homeodomain protein 6...  83.2    3e-15   
ref|XP_002864955.1|  hypothetical protein ARALYDRAFT_919872           82.8    3e-15   
ref|XP_006280898.1|  hypothetical protein CARUB_v10026891mg           82.8    3e-15   
gb|AES96050.2|  homeobox domain, ZF-HD class protein                  82.8    3e-15   
ref|XP_004287891.1|  PREDICTED: zinc-finger homeodomain protein 6...  83.6    3e-15   
gb|KJB40199.1|  hypothetical protein B456_007G050500                  82.8    3e-15   
ref|XP_012080548.1|  PREDICTED: mini zinc finger protein 3            79.3    3e-15   
ref|XP_003574645.1|  PREDICTED: zinc-finger homeodomain protein 1...  82.8    3e-15   
ref|XP_007205692.1|  hypothetical protein PRUPE_ppa009712mg           82.8    3e-15   
gb|ABR16776.1|  unknown                                               82.8    3e-15   
ref|XP_002875135.1|  hypothetical protein ARALYDRAFT_484166           83.2    3e-15   
gb|AFT82678.1|  ZHD9 ZF-HD type transcription factor                  79.3    3e-15   
gb|KDP31250.1|  hypothetical protein JCGZ_11626                       79.3    3e-15   
ref|XP_010484369.1|  PREDICTED: zinc-finger homeodomain protein 1...  82.8    3e-15   
ref|NP_178358.1|  homeobox protein 21                                 82.8    3e-15   
gb|AAM10791.1|  hypothetical protein At2g02540/T822.16                82.8    4e-15   
gb|KDO36261.1|  hypothetical protein CISIN_1g048824mg                 81.6    4e-15   
gb|KDO58763.1|  hypothetical protein CISIN_1g041672mg                 79.7    4e-15   
ref|NP_001152263.1|  ZF-HD homeobox protein                           82.0    4e-15   
gb|EMT26453.1|  ZF-HD homeobox protein                                83.6    4e-15   
ref|XP_009404830.1|  PREDICTED: zinc-finger homeodomain protein 4...  82.0    4e-15   
ref|XP_006434579.1|  hypothetical protein CICLE_v10004050mg           81.6    4e-15   
ref|XP_001785616.1|  predicted protein                                82.8    4e-15   
ref|XP_006473167.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  81.6    4e-15   
ref|XP_004513326.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  80.9    4e-15   
ref|XP_009416998.1|  PREDICTED: zinc-finger homeodomain protein 4...  82.4    4e-15   
ref|XP_006346746.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  82.0    4e-15   
ref|XP_007204025.1|  hypothetical protein PRUPE_ppa020272mg           82.8    4e-15   
ref|XP_008338913.1|  PREDICTED: zinc-finger homeodomain protein 2...  82.0    5e-15   
ref|XP_004299701.1|  PREDICTED: zinc-finger homeodomain protein 2...  82.0    5e-15   
ref|XP_009403385.1|  PREDICTED: zinc-finger homeodomain protein 4...  82.0    5e-15   
ref|NP_001067594.2|  Os11g0243300                                     83.6    5e-15   
ref|XP_003613092.1|  Zinc finger-homeodomain protein                  83.2    5e-15   
ref|NP_201344.1|  homeobox protein 25                                 82.0    5e-15   
ref|XP_004232414.1|  PREDICTED: zinc-finger homeodomain protein 5     82.4    5e-15   
ref|XP_008782098.1|  PREDICTED: zinc-finger homeodomain protein 4...  80.5    5e-15   
ref|XP_007018165.1|  Transcription factor, putative                   82.0    5e-15   
ref|NP_001144285.1|  uncharacterized protein LOC100277167             82.8    5e-15   
ref|XP_006593674.1|  PREDICTED: ZF-HD homeobox protein At4g24660      78.6    5e-15   
gb|ACG39295.1|  hypothetical protein                                  82.8    5e-15   
gb|KJB17762.1|  hypothetical protein B456_003G014100                  82.0    5e-15   
ref|XP_006394037.1|  hypothetical protein EUTSA_v10005568mg           82.0    5e-15   
gb|KFK28242.1|  hypothetical protein AALP_AA8G490700                  82.0    6e-15   
ref|XP_010037168.1|  PREDICTED: mini zinc finger protein 3-like       78.6    6e-15   
ref|XP_008338912.1|  PREDICTED: zinc-finger homeodomain protein 2...  82.0    6e-15   
ref|XP_010675490.1|  PREDICTED: zinc-finger homeodomain protein 1...  82.4    6e-15   
ref|XP_010026173.1|  PREDICTED: zinc-finger homeodomain protein 6...  82.4    6e-15   
ref|XP_009373696.1|  PREDICTED: zinc-finger homeodomain protein 2...  82.0    6e-15   
gb|EPS73952.1|  hypothetical protein M569_00810                       80.9    6e-15   
ref|NP_001149424.1|  LOC100283050                                     82.0    6e-15   
ref|XP_002460367.1|  hypothetical protein SORBIDRAFT_02g027040        82.0    6e-15   
tpg|DAA48505.1|  TPA: putative homeobox DNA-binding domain superf...  82.0    6e-15   
gb|EPS65251.1|  hypothetical protein M569_09527                       77.4    7e-15   
emb|CDY14559.1|  BnaC03g49000D                                        82.0    7e-15   
ref|XP_010238617.1|  PREDICTED: zinc-finger homeodomain protein 3...  82.4    7e-15   
ref|XP_010925945.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  82.4    7e-15   
gb|KDO55569.1|  hypothetical protein CISIN_1g043467mg                 78.2    7e-15   
ref|XP_009150629.1|  PREDICTED: zinc-finger homeodomain protein 1...  81.6    7e-15   
ref|XP_002310240.2|  zinc finger family protein                       82.0    7e-15   
gb|AFW79306.1|  ZF-HD homeobox protein                                81.3    7e-15   
ref|XP_007215197.1|  hypothetical protein PRUPE_ppa013998mg           78.2    8e-15   
gb|ERM94746.1|  hypothetical protein AMTR_s00011p00255340             81.3    8e-15   
ref|XP_003537589.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  82.4    8e-15   
gb|ACU20045.1|  unknown                                               82.4    8e-15   
ref|XP_008678040.1|  PREDICTED: zinc-finger homeodomain protein 4...  82.8    8e-15   
ref|XP_011623848.1|  PREDICTED: zinc-finger homeodomain protein 2     81.3    8e-15   
ref|XP_002443023.1|  hypothetical protein SORBIDRAFT_08g006490        82.0    8e-15   
sp|A2WSZ6.1|ZHD5_ORYSI  RecName: Full=Zinc-finger homeodomain pro...  80.9    8e-15   
ref|XP_009758154.1|  PREDICTED: zinc-finger homeodomain protein 2...  81.3    8e-15   
ref|XP_010927875.1|  PREDICTED: zinc-finger homeodomain protein 4...  81.3    8e-15   
emb|CDY54719.1|  BnaA09g52500D                                        80.9    8e-15   
gb|AAZ07989.1|  zinc finger homeodomain protein 1                     82.4    8e-15   
ref|XP_004978478.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  77.8    8e-15   
ref|XP_006573021.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  81.3    9e-15   
ref|XP_006383190.1|  hypothetical protein POPTR_0005s12420g           82.0    9e-15   
gb|EPS61775.1|  hypothetical protein M569_13018                       81.3    9e-15   
ref|XP_007046919.1|  Homeobox protein 24, putative                    82.8    9e-15   
emb|CAN72985.1|  hypothetical protein VITISV_009036                   81.3    9e-15   
ref|XP_012084701.1|  PREDICTED: mini zinc finger protein 2            78.2    9e-15   
ref|NP_001172477.1|  Os01g0635550                                     80.9    9e-15   
ref|NP_001234189.1|  mini zinc finger protein                         77.8    9e-15   
ref|XP_004509268.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  79.7    9e-15   
ref|XP_011025804.1|  PREDICTED: zinc-finger homeodomain protein 6     82.0    9e-15   
emb|CDP12305.1|  unnamed protein product                              77.8    9e-15   
ref|XP_008440716.1|  PREDICTED: zinc-finger homeodomain protein 2     82.0    9e-15   
ref|XP_006363993.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  80.1    9e-15   
gb|AFK39189.1|  unknown                                               77.8    9e-15   
ref|XP_011098623.1|  PREDICTED: mini zinc finger protein 2            77.8    9e-15   
gb|ABY61023.1|  zinc finger homeodomain protein 1                     80.9    9e-15   
ref|XP_008678039.1|  PREDICTED: zinc-finger homeodomain protein 4...  83.2    9e-15   
sp|Q53N87.2|ZHD4_ORYSJ  RecName: Full=Zinc-finger homeodomain pro...  82.8    1e-14   
ref|XP_008788352.1|  PREDICTED: zinc-finger homeodomain protein 4...  80.9    1e-14   
ref|XP_011003723.1|  PREDICTED: zinc-finger homeodomain protein 6     82.0    1e-14   
emb|CDX81284.1|  BnaC09g06950D                                        80.9    1e-14   
gb|ABY61018.1|  zinc finger-homeodomain protein 1                     81.6    1e-14   
ref|XP_009776474.1|  PREDICTED: uncharacterized protein LOC104226...  84.3    1e-14   
ref|XP_006859182.1|  PREDICTED: zinc-finger homeodomain protein 2     80.5    1e-14   
ref|XP_012067957.1|  PREDICTED: zinc-finger homeodomain protein 2...  81.3    1e-14   
ref|XP_009112180.1|  PREDICTED: zinc-finger homeodomain protein 1...  80.9    1e-14   
ref|XP_008353421.1|  PREDICTED: mini zinc finger protein 2-like       77.8    1e-14   
ref|XP_006341952.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  81.3    1e-14   
ref|XP_010258353.1|  PREDICTED: mini zinc finger protein 2            77.8    1e-14   
ref|XP_008808961.1|  PREDICTED: zinc-finger homeodomain protein 4...  81.3    1e-14   
ref|XP_009776475.1|  PREDICTED: uncharacterized protein LOC104226...  84.0    1e-14   
gb|AGT17348.1|  ZF-HD homeobox protein                                80.9    1e-14   
gb|ERM94479.1|  hypothetical protein AMTR_s00010p00261620             77.8    1e-14   
ref|XP_012067956.1|  PREDICTED: zinc-finger homeodomain protein 2...  81.3    1e-14   
ref|XP_009776472.1|  PREDICTED: uncharacterized protein LOC104226...  84.0    1e-14   
ref|XP_009336904.1|  PREDICTED: zinc-finger homeodomain protein 2...  82.0    1e-14   
ref|XP_011083674.1|  PREDICTED: zinc-finger homeodomain protein 5     80.9    1e-14   
ref|XP_010514025.1|  PREDICTED: zinc-finger homeodomain protein 3     81.6    1e-14   
gb|EPS61290.1|  hypothetical protein M569_13509                       80.1    1e-14   
sp|B8AX53.1|ZHD6_ORYSI  RecName: Full=Zinc-finger homeodomain pro...  80.9    1e-14   
ref|XP_009385760.1|  PREDICTED: zinc-finger homeodomain protein 2...  80.9    1e-14   
ref|XP_006380765.1|  hypothetical protein POPTR_0007s12970g           81.6    1e-14   
ref|XP_010674293.1|  PREDICTED: zinc-finger homeodomain protein 1...  80.1    1e-14   
ref|XP_009376269.1|  PREDICTED: mini zinc finger protein 2            77.4    1e-14   
gb|ABY61020.1|  zinc finger-homeodomain protein 1                     80.9    1e-14   
ref|XP_012067955.1|  PREDICTED: zinc-finger homeodomain protein 2...  81.6    1e-14   
ref|XP_009621029.1|  PREDICTED: mini zinc finger protein 2-like       77.4    1e-14   
ref|XP_004975654.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  81.3    1e-14   
ref|XP_009408377.1|  PREDICTED: mini zinc finger protein 1-like       77.4    1e-14   
ref|XP_004978993.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  82.0    1e-14   
ref|XP_004235372.1|  PREDICTED: zinc-finger homeodomain protein 7...  79.3    1e-14   
emb|CAN66937.1|  hypothetical protein VITISV_006217                   78.6    1e-14   
emb|CDX83807.1|  BnaC08g18380D                                        77.4    1e-14   
ref|XP_006395776.1|  hypothetical protein EUTSA_v10004643mg           81.3    1e-14   
ref|XP_006360403.1|  PREDICTED: uncharacterized protein LOC102604466  84.0    1e-14   
ref|XP_011097503.1|  PREDICTED: zinc-finger homeodomain protein 2...  80.5    1e-14   
ref|XP_003576116.2|  PREDICTED: zinc-finger homeodomain protein 4...  82.0    1e-14   
gb|KHN36110.1|  ZF-HD homeobox protein                                81.3    1e-14   
ref|XP_011010640.1|  PREDICTED: mini zinc finger protein 2-like       78.2    1e-14   
gb|KHG07143.1|  hypothetical protein F383_33189                       80.9    1e-14   
ref|XP_012088426.1|  PREDICTED: zinc-finger homeodomain protein 3...  80.5    1e-14   
gb|ABK23568.1|  unknown                                               79.0    1e-14   
ref|XP_002266577.2|  PREDICTED: zinc-finger homeodomain protein 6     81.6    1e-14   
gb|KHN05023.1|  ZF-HD homeobox protein                                79.7    1e-14   
ref|XP_009772007.1|  PREDICTED: zinc-finger homeodomain protein 2...  80.1    2e-14   
ref|XP_009130511.1|  PREDICTED: zinc-finger homeodomain protein 1...  80.5    2e-14   
gb|KJB14484.1|  hypothetical protein B456_002G127500                  80.9    2e-14   
ref|XP_010908151.1|  PREDICTED: zinc-finger homeodomain protein 4...  80.5    2e-14   
ref|XP_010912718.1|  PREDICTED: zinc-finger homeodomain protein 4...  80.5    2e-14   
gb|KDP24222.1|  hypothetical protein JCGZ_25879                       80.5    2e-14   
ref|XP_010653170.1|  PREDICTED: mini zinc finger protein 2-like       78.6    2e-14   
ref|XP_009763792.1|  PREDICTED: zinc-finger homeodomain protein 5...  80.9    2e-14   
ref|XP_008460585.1|  PREDICTED: zinc-finger homeodomain protein 4     80.9    2e-14   
ref|XP_009340741.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  81.3    2e-14   
gb|EEE69868.1|  hypothetical protein OsJ_29679                        80.1    2e-14   
gb|ABA96146.2|  ZF-HD protein dimerisation region containing prot...  80.9    2e-14   
ref|XP_006426297.1|  hypothetical protein CICLE_v10027024mg           80.1    2e-14   
ref|XP_003555538.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  79.7    2e-14   
ref|XP_004495441.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  79.7    2e-14   
ref|XP_002518018.1|  conserved hypothetical protein                   80.5    2e-14   
ref|XP_009347543.1|  PREDICTED: zinc-finger homeodomain protein 6...  80.9    2e-14   
ref|XP_002514762.1|  transcription factor, putative                   77.0    2e-14   



>ref|XP_009797863.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
sylvestris]
Length=358

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 98/120 (82%), Gaps = 12/120 (10%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSL-------hhhhhhhhavvvvYKECLKNHAAS  476
            E ETP  RI   KP+SFS NGVLKRHNSL        +++HHHHAVVV YKECLKNHAAS
Sbjct  21   EPETPI-RIQPAKPISFS-NGVLKRHNSLHLPHHHGFNNNHHHHAVVVTYKECLKNHAAS  78

Query  477  IGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP--SAAPALEYQ  650
            +GGHAVDGCGEFMPSPTANP DPTSLKCAACGCHRNFHRREPEEP+ LP  +  PALEYQ
Sbjct  79   LGGHAVDGCGEFMPSPTANPVDPTSLKCAACGCHRNFHRREPEEPV-LPNQNTIPALEYQ  137



>ref|XP_009620291.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 99/123 (80%), Gaps = 15/123 (12%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSL----------hhhhhhhhavvvvYKECLKNH  467
            E ETP  RI   KP+SFS NGVLKRHNSL          ++HHHHHHAVVV YKECLKNH
Sbjct  21   EPETPI-RIQPAKPISFS-NGVLKRHNSLHLPHHHGFNKNNHHHHHHAVVVTYKECLKNH  78

Query  468  AASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP--SAAPAL  641
            AAS+GGHAVDGCGEFMPSPTANP DPTSLKCAACGCHRNFHRREPEEP+ LP  +  PAL
Sbjct  79   AASLGGHAVDGCGEFMPSPTANPVDPTSLKCAACGCHRNFHRREPEEPV-LPNQNTIPAL  137

Query  642  EYQ  650
            EYQ
Sbjct  138  EYQ  140



>ref|XP_008341574.1| PREDICTED: zinc-finger homeodomain protein 10-like [Malus domestica]
Length=309

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 92/117 (79%), Gaps = 7/117 (6%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhh---havvvvYKECLKNHAASIGGH  488
            +SETP      +KPLSFS NGVLKRHN  HH HHH+     VVV YKECLKNHAA++GGH
Sbjct  22   DSETPTRIQQHIKPLSFS-NGVLKRHNPTHHLHHHNIPITPVVVTYKECLKNHAATLGGH  80

Query  489  AVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPL--GLPSAAP-ALEYQ  650
            A+DGCGEFMPSPTAN ADPTSLKCAACGCHRNFHRR+PE+P+    P+A    +EYQ
Sbjct  81   ALDGCGEFMPSPTANSADPTSLKCAACGCHRNFHRRDPEDPVQQNTPAATTHVIEYQ  137



>ref|XP_004233362.1| PREDICTED: zinc-finger homeodomain protein 9 [Solanum lycopersicum]
Length=331

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 91/118 (77%), Gaps = 11/118 (9%)
 Frame = +3

Query  297  VKGGDVQESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAAS  476
            VK  ++ E+ETP+ RI   KP SFS NGVLKR N       HHH VVVVYKECLKNHAA+
Sbjct  16   VKTPELAETETPS-RIQQPKPFSFS-NGVLKRKN-------HHHPVVVVYKECLKNHAAN  66

Query  477  IGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            +G HAVDGCGEF+P P ANPADPTSLKCAACGCHRNFHRREPEEP   P A  A+EYQ
Sbjct  67   LGTHAVDGCGEFLPIPAANPADPTSLKCAACGCHRNFHRREPEEP--PPIATAAIEYQ  122



>ref|XP_011085755.1| PREDICTED: zinc-finger homeodomain protein 9 [Sesamum indicum]
Length=345

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 85/112 (76%), Gaps = 8/112 (7%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            E+ETP  RI   K   F+ NGVLKRH  LH HH         YKECLKNHAA++GGHA+D
Sbjct  14   ETETPT-RIQPAKASPFT-NGVLKRHPPLHLHHPVVVT----YKECLKNHAATLGGHALD  67

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPL--GLPSAAPALEY  647
            GCGEFMPSPT+NPADPTSLKCAACGCHRNFHRREP+E L    P+A PALEY
Sbjct  68   GCGEFMPSPTSNPADPTSLKCAACGCHRNFHRREPDESLLPAPPNATPALEY  119



>ref|XP_004304301.1| PREDICTED: zinc-finger homeodomain protein 9 [Fragaria vesca 
subsp. vesca]
Length=360

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 95/121 (79%), Gaps = 14/121 (12%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhha-------vvvvYKECLKNHAAS  476
            +S+TP  RI   KP+SFS NGVLKRHN  HHHH HHH        VVV YKECLKNHAAS
Sbjct  20   DSDTPT-RIQPAKPISFS-NGVLKRHNPTHHHHSHHHNSNIPVTPVVVSYKECLKNHAAS  77

Query  477  IGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPA---LEY  647
            +GGHA+DGCGEFMPSPT+ P+DPTSLKCAACGCHRNFHRR+PE+   +P+ APA   +EY
Sbjct  78   LGGHALDGCGEFMPSPTSTPSDPTSLKCAACGCHRNFHRRDPED--NIPAVAPATHVIEY  135

Query  648  Q  650
            Q
Sbjct  136  Q  136



>ref|XP_008443414.1| PREDICTED: zinc-finger homeodomain protein 9-like [Cucumis melo]
Length=298

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 78/111 (70%), Gaps = 6/111 (5%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            +SETP       K L F+ NGVLKRH+ +             YKECLKNHAAS+GGHA+D
Sbjct  27   DSETPIKIQPTTKSLPFT-NGVLKRHHHIAPPPPQVV-----YKECLKNHAASLGGHALD  80

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            GCGEFMPSPTA   DPTSLKCAACGCHRNFHRREP++P+  P+    +EYQ
Sbjct  81   GCGEFMPSPTATATDPTSLKCAACGCHRNFHRREPDDPIATPTTTHVIEYQ  131



>ref|XP_006357111.1| PREDICTED: transcription factor HB29-like [Solanum tuberosum]
Length=329

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 88/118 (75%), Gaps = 12/118 (10%)
 Frame = +3

Query  297  VKGGDVQESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAAS  476
            +K  ++ E+ETP+ RI   KP  FS NGVLKR N         H VVVVYKECLKNHAA+
Sbjct  15   IKTPELAETETPS-RIQQPKPFPFS-NGVLKRKNH--------HPVVVVYKECLKNHAAN  64

Query  477  IGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            +G HAVDGCGEF+P P ANPADPTSLKCAACGCHRNFHRR+PEEP   P A  A+EYQ
Sbjct  65   LGTHAVDGCGEFLPIPAANPADPTSLKCAACGCHRNFHRRDPEEP--PPIATAAIEYQ  120



>ref|XP_008379353.1| PREDICTED: zinc-finger homeodomain protein 9-like [Malus domestica]
Length=353

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 89/117 (76%), Gaps = 7/117 (6%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHN---SLhhhhhhhhavvvvYKECLKNHAASIGGH  488
            +SETP      +KPLSFS NGVLKRHN    LHH +     VVV YKECLKNHAA++GGH
Sbjct  23   DSETPTRIQQPLKPLSFS-NGVLKRHNPTHHLHHQNIPITPVVVTYKECLKNHAAALGGH  81

Query  489  AVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPL--GLPSAAP-ALEYQ  650
            A+DGCGEFMPSP AN ADPTSLKCAACGCHRNFHRR+PE+P+    P+A    +EYQ
Sbjct  82   ALDGCGEFMPSPAANLADPTSLKCAACGCHRNFHRRDPEDPVQPNTPAATTHVIEYQ  138



>ref|XP_004147471.1| PREDICTED: zinc-finger homeodomain protein 9-like [Cucumis sativus]
 gb|KGN59574.1| hypothetical protein Csa_3G826680 [Cucumis sativus]
Length=298

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 78/111 (70%), Gaps = 6/111 (5%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP       K   F+ NGVLKRH+             VVYKECLKNHAAS+GGHA+D
Sbjct  27   ESETPIKIQPTTKSHPFT-NGVLKRHHH-----TAPPPPQVVYKECLKNHAASLGGHALD  80

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            GCGEFMPSPTA   DPTSLKCAACGCHRNFHRREP++P+  P+    +EYQ
Sbjct  81   GCGEFMPSPTATATDPTSLKCAACGCHRNFHRREPDDPIATPTTTHVIEYQ  131



>ref|XP_007215708.1| hypothetical protein PRUPE_ppa008908mg [Prunus persica]
 gb|EMJ16907.1| hypothetical protein PRUPE_ppa008908mg [Prunus persica]
Length=315

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 92/120 (77%), Gaps = 11/120 (9%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhha------vvvvYKECLKNHAASI  479
            +SETP  RI   KPLSFS NGVLKRHN   HHHH HH       V+V YKECLKNHAA++
Sbjct  23   DSETPT-RIQPAKPLSFS-NGVLKRHNPHPHHHHLHHHNIPITPVIVTYKECLKNHAATL  80

Query  480  GGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAP---ALEYQ  650
            GGHA+DGCGEFMPSPTA P DPTSLKCAACGCHRNFHRR+PE+P+   SAA     +EYQ
Sbjct  81   GGHALDGCGEFMPSPTAIPTDPTSLKCAACGCHRNFHRRDPEDPMPPSSAAATTHVIEYQ  140



>ref|XP_007151228.1| hypothetical protein PHAVU_004G028600g [Phaseolus vulgaris]
 gb|ESW23222.1| hypothetical protein PHAVU_004G028600g [Phaseolus vulgaris]
Length=343

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 79/99 (80%), Gaps = 6/99 (6%)
 Frame = +3

Query  354  KPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEFMPSPTAN  533
            KP+SFS NGVLKRH++     +H  A VVVYKECLKNH AS+GGHA+DGCGEFMPSP A 
Sbjct  45   KPVSFS-NGVLKRHHA-----NHRAAAVVVYKECLKNHVASLGGHALDGCGEFMPSPAAT  98

Query  534  PADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            P DP+S+KCAACGCHRNFHRREPEEP   P+    LEYQ
Sbjct  99   PDDPSSIKCAACGCHRNFHRREPEEPPISPATHHVLEYQ  137



>ref|XP_007139577.1| hypothetical protein PHAVU_008G041300g [Phaseolus vulgaris]
 gb|ESW11571.1| hypothetical protein PHAVU_008G041300g [Phaseolus vulgaris]
Length=326

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 90/115 (78%), Gaps = 6/115 (5%)
 Frame = +3

Query  315  QESETPAARI---SAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGG  485
             ++ETP  RI   +A K LSFS NGVLKRH+  HHHHHH  +  V YKECLKNHAA++GG
Sbjct  23   HDTETPT-RINTPTATKALSFS-NGVLKRHHHHHHHHHHPMSAAVTYKECLKNHAANLGG  80

Query  486  HAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            HA+DGCGEFMPSPTA  ADP+S+KCAACGCHRNFHRREP+EP  + S    +EYQ
Sbjct  81   HALDGCGEFMPSPTATAADPSSIKCAACGCHRNFHRREPDEP-PIASTTHVIEYQ  134



>gb|KFK33764.1| hypothetical protein AALP_AA5G057200 [Arabis alpina]
Length=304

 Score =   132 bits (333),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 86/117 (74%), Gaps = 16/117 (14%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP  RI   KP+SFS NG +KRH+       HHH + V YKECLKNHAA+IGGHA+D
Sbjct  12   ESETPT-RIQPAKPISFS-NGTIKRHH-------HHHQITVTYKECLKNHAAAIGGHALD  62

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE------PLGLPSAAPALEYQ  650
            GCGEFMPSPT+ P DPTSLKCAAC CHRNFHRR+P++      P  LP  A A+EYQ
Sbjct  63   GCGEFMPSPTSTPTDPTSLKCAACNCHRNFHRRDPDDSSTVLPPPILPPTA-AIEYQ  118



>ref|XP_008230766.1| PREDICTED: zinc-finger homeodomain protein 9-like [Prunus mume]
Length=357

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 93/121 (77%), Gaps = 13/121 (11%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhha------vvvvYKECLKNHAASI  479
            +SETP  RI   KPLSFS NGVLKRHN   HHHH HH       V+V YKECLKNHAA++
Sbjct  23   DSETPT-RIQPAKPLSFS-NGVLKRHNPHPHHHHLHHHNIPITPVIVTYKECLKNHAATL  80

Query  480  GGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPA----LEY  647
            GGHA+DGCGEFMPSPTA P DPTSLKCAACGCHRNFHRR+PE+P+  PS A A    +EY
Sbjct  81   GGHALDGCGEFMPSPTAIPTDPTSLKCAACGCHRNFHRRDPEDPMP-PSTAAATTHVIEY  139

Query  648  Q  650
            Q
Sbjct  140  Q  140



>ref|XP_006431147.1| hypothetical protein CICLE_v10011968mg [Citrus clementina]
 gb|ESR44387.1| hypothetical protein CICLE_v10011968mg [Citrus clementina]
Length=379

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 86/119 (72%), Gaps = 11/119 (9%)
 Frame = +3

Query  324  ETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhav-----vvvYKECLKNHAASIGGH  488
            +T A RI + KPL+F+ NGVLKRH     HH  HH       VV YKECLKNHAASIGGH
Sbjct  29   QTGATRIHSAKPLTFT-NGVLKRHQPQPQHHQRHHHHHHHPIVVTYKECLKNHAASIGGH  87

Query  489  AVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP-----SAAPALEYQ  650
            A+DGCGEFMPSPTA P+DPTSLKCAACGCHRNFHRREP++   LP     +    +EYQ
Sbjct  88   ALDGCGEFMPSPTATPSDPTSLKCAACGCHRNFHRREPDQDHHLPHVPTTATTATIEYQ  146



>ref|XP_006482594.1| PREDICTED: myb-like protein I-like [Citrus sinensis]
 gb|KDO72568.1| hypothetical protein CISIN_1g016972mg [Citrus sinensis]
Length=379

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 86/120 (72%), Gaps = 12/120 (10%)
 Frame = +3

Query  324  ETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhav------vvvYKECLKNHAASIGG  485
            +T A RI + KPL+F+ NGVLKRH     HH  HH        VV YKECLKNHAASIGG
Sbjct  29   QTGATRIHSAKPLTFT-NGVLKRHQPQPQHHQRHHHHHHHHPIVVTYKECLKNHAASIGG  87

Query  486  HAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP-----SAAPALEYQ  650
            HA+DGCGEFMPSPTA P+DPTSLKCAACGCHRNFHRREP++   LP     +    +EYQ
Sbjct  88   HALDGCGEFMPSPTATPSDPTSLKCAACGCHRNFHRREPDQDHHLPHVPTTATTATIEYQ  147



>gb|KJB33553.1| hypothetical protein B456_006G017200 [Gossypium raimondii]
Length=326

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 87/111 (78%), Gaps = 2/111 (2%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            E+ETP  RI   KP SF+ NGVLKRH   HH+ HH   +VV YKECLKNHAA++GGHA+D
Sbjct  22   ETETPV-RIQPAKPKSFT-NGVLKRHQPHHHYLHHAPPIVVTYKECLKNHAATLGGHALD  79

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            GCGEFMPSP+A P+DPTSLKCAACGCHRNFHRRE ++P    +A   +EYQ
Sbjct  80   GCGEFMPSPSATPSDPTSLKCAACGCHRNFHRRESDDPPPTTTATATIEYQ  130



>gb|KDO72567.1| hypothetical protein CISIN_1g016972mg [Citrus sinensis]
Length=371

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 86/120 (72%), Gaps = 12/120 (10%)
 Frame = +3

Query  324  ETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhav------vvvYKECLKNHAASIGG  485
            +T A RI + KPL+F+ NGVLKRH     HH  HH        VV YKECLKNHAASIGG
Sbjct  29   QTGATRIHSAKPLTFT-NGVLKRHQPQPQHHQRHHHHHHHHPIVVTYKECLKNHAASIGG  87

Query  486  HAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP-----SAAPALEYQ  650
            HA+DGCGEFMPSPTA P+DPTSLKCAACGCHRNFHRREP++   LP     +    +EYQ
Sbjct  88   HALDGCGEFMPSPTATPSDPTSLKCAACGCHRNFHRREPDQDHHLPHVPTTATTATIEYQ  147



>ref|XP_007032534.1| Homeobox protein 34, putative [Theobroma cacao]
 gb|EOY03460.1| Homeobox protein 34, putative [Theobroma cacao]
Length=309

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 88/117 (75%), Gaps = 9/117 (8%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhav------vvvYKECLKNHAASI  479
            ESETP  RI   KP+SF+ NGVLKRH   HH  HHHH        V+ YK+CLKNHAA++
Sbjct  21   ESETPT-RIQPTKPVSFT-NGVLKRHQPHHHPVHHHHHHPHAPPIVITYKKCLKNHAANL  78

Query  480  GGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            GGHA+DGCGEFMPSPTA P DPTSLKCAACGCHRNFH REPE+P  L +A   +EYQ
Sbjct  79   GGHALDGCGEFMPSPTATPTDPTSLKCAACGCHRNFHLREPEDP-PLATATATIEYQ  134



>ref|XP_009787877.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
sylvestris]
Length=358

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 81/114 (71%), Gaps = 9/114 (8%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            E ETP  +I   KP SFS NGVLKR N   HHH         YKECLKNHAAS+GGHAVD
Sbjct  36   EIETPT-QIQKPKPFSFS-NGVLKRKNLFQHHHPVVVI----YKECLKNHAASLGGHAVD  89

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRR---EPEEPLGLPSAAPALEYQ  650
            GCGEFMPSPTANPADPTSLKCAACGCHRNFHRR   EP      P A  ALEYQ
Sbjct  90   GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPVVIPPPPIATAALEYQ  143



>ref|XP_012084702.1| PREDICTED: zinc-finger homeodomain protein 9-like [Jatropha curcas]
Length=328

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 87/115 (76%), Gaps = 5/115 (4%)
 Frame = +3

Query  315  QESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavv---vvYKECLKNHAASIGG  485
            QE+ETP  RI   KPLS + NG+LKRH+  HHHHHHHH      V YKECLKNHAA++GG
Sbjct  29   QETETPI-RIQPAKPLSLT-NGLLKRHHPHHHHHHHHHPATPVVVTYKECLKNHAATLGG  86

Query  486  HAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            HA+DGCGEFMPSPTA   DPTSLKCAACGCHRNFHRREPE+     +    +EYQ
Sbjct  87   HALDGCGEFMPSPTATHTDPTSLKCAACGCHRNFHRREPEDSPPPTNTTTTIEYQ  141



>ref|XP_010693250.1| PREDICTED: zinc-finger homeodomain protein 9-like [Beta vulgaris 
subsp. vulgaris]
Length=400

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 73/97 (75%), Gaps = 11/97 (11%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP  RI + KP +FS NGVLKRH              VVYKEC KNHAAS+GGHA+D
Sbjct  46   ESETPPPRIQSTKPFAFS-NGVLKRH----------APAQVVYKECRKNHAASLGGHALD  94

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            GCGEFMP+PTA  +DPTSLKCAACGCHRNFHR EPE+
Sbjct  95   GCGEFMPAPTATASDPTSLKCAACGCHRNFHRHEPED  131



>ref|XP_009621030.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
tomentosiformis]
Length=356

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 81/114 (71%), Gaps = 9/114 (8%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            E ETP  +I   KP SFS NGVLKR N   HHH         YKECLKNHAAS+GGHAVD
Sbjct  33   EIETPT-QIQKPKPFSFS-NGVLKRKNLFQHHHPIVVI----YKECLKNHAASLGGHAVD  86

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRR---EPEEPLGLPSAAPALEYQ  650
            GCGEFMPSPTANPADPTSLKCAACGCHRNFHRR   EP      P A  ALEYQ
Sbjct  87   GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPIVIPPPPIATAALEYQ  140



>ref|XP_011010943.1| PREDICTED: zinc-finger homeodomain protein 9-like [Populus euphratica]
Length=324

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 81/106 (76%), Gaps = 2/106 (2%)
 Frame = +3

Query  336  ARISAVKPLSFSSNGVLKRHNSLhhhhhhhha-vvvvYKECLKNHAASIGGHAVDGCGEF  512
             RI   KP SF+ NGVLKRH+  HHH+H     V+  YKECLKNHAA+IGGHA+DGCGEF
Sbjct  34   TRIPQTKPSSFT-NGVLKRHHPHHHHNHFSQPPVIKTYKECLKNHAATIGGHALDGCGEF  92

Query  513  MPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            MPSPTA   DPTSLKCAACGCHRNFHRREPE+P    +A   +EYQ
Sbjct  93   MPSPTATHTDPTSLKCAACGCHRNFHRREPEDPPPHTTAITTIEYQ  138



>ref|XP_010257380.1| PREDICTED: zinc-finger homeodomain protein 9 [Nelumbo nucifera]
Length=300

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 72/85 (85%), Gaps = 2/85 (2%)
 Frame = +3

Query  354  KPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEFMPSPTAN  533
            KPLSFS NGVLKRH+   +H     A VV YKECLKNHAASIGGHA+DGCGEFMPSP+A 
Sbjct  38   KPLSFS-NGVLKRHHH-QNHTPTTPAAVVSYKECLKNHAASIGGHALDGCGEFMPSPSAT  95

Query  534  PADPTSLKCAACGCHRNFHRREPEE  608
            P DPTSLKCAACGCHRNFHRREP+E
Sbjct  96   PTDPTSLKCAACGCHRNFHRREPDE  120



>gb|KJB75739.1| hypothetical protein B456_012G054300 [Gossypium raimondii]
Length=337

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  339  RISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEFMP  518
            RI   KP+SF+ NGVLKRH   HHHH+    +V+ YKECLKNHAAS+GGHA+DGCGEFMP
Sbjct  28   RIQPTKPVSFT-NGVLKRHKPHHHHHYQAPPIVITYKECLKNHAASLGGHALDGCGEFMP  86

Query  519  SPTANPADPTSLKCAACGCHRNFHRRE  599
            SPTA P DPTSLKCAACGCHRNFHRRE
Sbjct  87   SPTATPTDPTSLKCAACGCHRNFHRRE  113



>emb|CDP02232.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 92/127 (72%), Gaps = 18/127 (14%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavv----------------vvYK  449
            E+ETP  RI   KP SFS NGVLKRH ++HHH HHHHA                  V YK
Sbjct  22   ETETPT-RIQPSKPSSFS-NGVLKRHPAVHHHFHHHHASFNNNSNHHHHHPHAALLVTYK  79

Query  450  ECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSA  629
            ECLKNHAAS+GGHAVDGCGEFMPSPTA P DPTSLKCAACGCHRNFHRREPEEPL  P+ 
Sbjct  80   ECLKNHAASLGGHAVDGCGEFMPSPTATPTDPTSLKCAACGCHRNFHRREPEEPLPPPNT  139

Query  630  APALEYQ  650
              ALEYQ
Sbjct  140  TAALEYQ  146



>ref|XP_006357697.1| PREDICTED: transcription factor HB29-like [Solanum tuberosum]
Length=307

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 82/111 (74%), Gaps = 6/111 (5%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            E+ET A  I   KP S + NG+LKR N    HH     VVVVYKECLKNHAA++G HAVD
Sbjct  16   EAET-ARIIQHNKPFSIT-NGILKRQN----HHPLPLPVVVVYKECLKNHAATMGAHAVD  69

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            GCGEFMPSPTA   +PTSLKCAACGCHRNFHRREPEE    P+ A AL+YQ
Sbjct  70   GCGEFMPSPTATATNPTSLKCAACGCHRNFHRREPEELFPPPNTAAALQYQ  120



>ref|XP_010258352.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nelumbo nucifera]
Length=296

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 71/85 (84%), Gaps = 6/85 (7%)
 Frame = +3

Query  354  KPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEFMPSPTAN  533
            KPLSF  NGVLKRH+      +H  + V+ YKECLKNHAAS+GGHAVDGCGEFMPSP+A 
Sbjct  39   KPLSFG-NGVLKRHHQ-----NHTPSAVITYKECLKNHAASLGGHAVDGCGEFMPSPSAT  92

Query  534  PADPTSLKCAACGCHRNFHRREPEE  608
            P DPTSLKCAACGCHRNFHRREP+E
Sbjct  93   PTDPTSLKCAACGCHRNFHRREPDE  117



>ref|XP_002534012.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28370.1| conserved hypothetical protein [Ricinus communis]
Length=335

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 84/101 (83%), Gaps = 5/101 (5%)
 Frame = +3

Query  315  QESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhha---vvvvYKECLKNHAASIGG  485
            QE+ETP  RI   KPLSF+ NGVLKRH+  HHHHHH  A   VV+ YKECLKNHAA++GG
Sbjct  31   QETETPT-RIQPPKPLSFT-NGVLKRHHHHHHHHHHLSAPPPVVITYKECLKNHAATLGG  88

Query  486  HAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            HA+DGCGEFMPSPTA   DPTSLKCAACGCHRNFHRREPE+
Sbjct  89   HALDGCGEFMPSPTATHTDPTSLKCAACGCHRNFHRREPED  129



>gb|EPS71422.1| hypothetical protein M569_03334 [Genlisea aurea]
Length=255

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 81/111 (73%), Gaps = 9/111 (8%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ES+TP   I   +  +  SNG+LKRH  LH HH    A    YKECLKNHAAS+GGHAVD
Sbjct  15   ESQTPTG-IHLPESQTPFSNGLLKRHAPLHLHHPVVVA----YKECLKNHAASLGGHAVD  69

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            GCGEFMPSP  NPADPTSLKCAACGCHRNFHRREP++ L    A P LE++
Sbjct  70   GCGEFMPSPATNPADPTSLKCAACGCHRNFHRREPDDAL----APPMLEFR  116



>ref|XP_006405598.1| hypothetical protein EUTSA_v10028098mg [Eutrema salsugineum]
 dbj|BAJ34518.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47051.1| hypothetical protein EUTSA_v10028098mg [Eutrema salsugineum]
Length=320

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 81/115 (70%), Gaps = 15/115 (13%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP  RI   KP+SFS NG++KRH+           ++  YKECLKNHAA++GGHA+D
Sbjct  19   ESETPT-RIQPAKPISFS-NGIIKRHHH---------PLLFTYKECLKNHAAALGGHALD  67

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEP----LGLPSAAPALEYQ  650
            GCGEFMPSP++   DPTSLKCAACGCHRNFHRREP+          S A A+EYQ
Sbjct  68   GCGEFMPSPSSISTDPTSLKCAACGCHRNFHRREPDNDSSSIPPPSSVAAAIEYQ  122



>ref|XP_002305381.2| hypothetical protein POPTR_0004s12500g [Populus trichocarpa]
 gb|EEE85892.2| hypothetical protein POPTR_0004s12500g [Populus trichocarpa]
Length=334

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 83/107 (78%), Gaps = 4/107 (4%)
 Frame = +3

Query  336  ARISAVKPLSFSSNGVLKRHNSLhhhhhhhha---vvvvYKECLKNHAASIGGHAVDGCG  506
             RI   KPLSF+ NGVLKRH+  HHH H+H A   VV+ YKECLKNHAA+IGGHA+DGCG
Sbjct  40   TRIPQTKPLSFT-NGVLKRHHPHHHHLHNHFAPPPVVITYKECLKNHAATIGGHALDGCG  98

Query  507  EFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEY  647
            EFMPSPTA   DPTSLKCAACGCHRNFHRREPE+     +A   +EY
Sbjct  99   EFMPSPTATHTDPTSLKCAACGCHRNFHRREPEDSPPHTTAITTIEY  145



>ref|XP_010552878.1| PREDICTED: LOW QUALITY PROTEIN: zinc-finger homeodomain protein 
10-like [Tarenaya hassleriana]
Length=344

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 87/118 (74%), Gaps = 12/118 (10%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESE    RI   KP+SFS NG++KR    HH HH+H  V V YKECLKNHAA++GGHA+D
Sbjct  22   ESEV-LTRIQPAKPISFS-NGIIKR---HHHLHHNHALVTVAYKECLKNHAAALGGHALD  76

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE-------PLGLPSAAPALEYQ  650
            GCGEFMPSP+ NP+DPTSLKCAACGCHRNFHRR+P+        P    S+A A+EYQ
Sbjct  77   GCGEFMPSPSFNPSDPTSLKCAACGCHRNFHRRDPDPSAAAAALPTAHLSSAAAIEYQ  134



>ref|XP_004491795.1| PREDICTED: transcription factor HB29-like [Cicer arietinum]
Length=328

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 86/117 (74%), Gaps = 7/117 (6%)
 Frame = +3

Query  315  QESETPAARISAV-----KPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASI  479
             E+ETP    ++      K LSFS NGVLKR +   ++HHH+H V V YKECLKNHAA++
Sbjct  27   HETETPTKITTSNTQTTPKILSFS-NGVLKR-HHHLNNHHHNHQVTVTYKECLKNHAANL  84

Query  480  GGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            GGHA+DGCGEFM SPTA  ADPTS+KCAACGCHRNFHRREPEEP    +    +EYQ
Sbjct  85   GGHALDGCGEFMTSPTATSADPTSIKCAACGCHRNFHRREPEEPPLSTTTTHVIEYQ  141



>ref|XP_002324056.2| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
 ref|XP_006373321.1| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
 gb|EEF04189.2| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
 gb|ERP51118.1| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
Length=340

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 86/114 (75%), Gaps = 6/114 (5%)
 Frame = +3

Query  321  SETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhav----vvvYKECLKNHAASIGGH  488
            +ETPA RI   KPLSF+ NGVLKRH   HHHHHHHH      V+ YKECLKNHAA+IGGH
Sbjct  30   TETPA-RIHDTKPLSFT-NGVLKRHPPHHHHHHHHHFSPSPIVIAYKECLKNHAATIGGH  87

Query  489  AVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            A+DGCGEFMPSP A   +PTSLKCAACGCHRNFHRREPE+     +    ++YQ
Sbjct  88   ALDGCGEFMPSPIATHTNPTSLKCAACGCHRNFHRREPEDSPPHTATTTTIQYQ  141



>ref|XP_006373320.1| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
 gb|ERP51117.1| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
Length=286

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 86/114 (75%), Gaps = 6/114 (5%)
 Frame = +3

Query  321  SETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhav----vvvYKECLKNHAASIGGH  488
            +ETPA RI   KPLSF+ NGVLKRH   HHHHHHHH      V+ YKECLKNHAA+IGGH
Sbjct  30   TETPA-RIHDTKPLSFT-NGVLKRHPPHHHHHHHHHFSPSPIVIAYKECLKNHAATIGGH  87

Query  489  AVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            A+DGCGEFMPSP A   +PTSLKCAACGCHRNFHRREPE+     +    ++YQ
Sbjct  88   ALDGCGEFMPSPIATHTNPTSLKCAACGCHRNFHRREPEDSPPHTATTTTIQYQ  141



>ref|XP_002283533.1| PREDICTED: zinc-finger homeodomain protein 9 [Vitis vinifera]
Length=341

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 85/114 (75%), Gaps = 8/114 (7%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhh---hhhavvvvYKECLKNHAASIGGH  488
            E+ETP  +I   K LS + NGVLKRH   HHHHH       VVV YKECLKNHAAS+GGH
Sbjct  30   ETETPT-QIQPRKGLSLT-NGVLKRHQQHHHHHHHHFAAPQVVVAYKECLKNHAASLGGH  87

Query  489  AVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            A+DGCGEFMPSPTA  ADPTSLKCAACGCHRNFHRREP++P   P     +EYQ
Sbjct  88   ALDGCGEFMPSPTATSADPTSLKCAACGCHRNFHRREPDDP---PPTTHVIEYQ  138



>gb|KFK26902.1| hypothetical protein AALP_AA8G308300 [Arabis alpina]
Length=305

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 83/113 (73%), Gaps = 11/113 (10%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP  RI   KP+SFS NG++KR       HHH+H  +  +KECLKNHAAS+GGHA+D
Sbjct  25   ESETPT-RIQPAKPISFS-NGIIKR-------HHHNHHHIFTFKECLKNHAASLGGHALD  75

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLG--LPSAAPALEYQ  650
            GCGEFMPSP++   DPTSLKCAACGCHRNFHRREP+        + + A+EYQ
Sbjct  76   GCGEFMPSPSSISTDPTSLKCAACGCHRNFHRREPDHNNNNSTSTISAAIEYQ  128



>ref|XP_011010066.1| PREDICTED: zinc-finger homeodomain protein 9-like [Populus euphratica]
Length=335

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 78/106 (74%), Gaps = 2/106 (2%)
 Frame = +3

Query  333  AARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEF  512
            AARI   KPL F+ NGVLKRH   HH H     +V+ YK+CLKNHAA+IGGHA+DGCGEF
Sbjct  31   AARIHDTKPLPFT-NGVLKRH-PPHHQHFSPSPIVITYKKCLKNHAATIGGHALDGCGEF  88

Query  513  MPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            MPSPTA   +PTSLKCAA GCHRNFHRREPE+     +    +EYQ
Sbjct  89   MPSPTATNTNPTSLKCAAWGCHRNFHRREPEDSPPHTATTTTIEYQ  134



>ref|XP_006363398.1| PREDICTED: transcription factor HB29-like [Solanum tuberosum]
Length=346

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 81/114 (71%), Gaps = 10/114 (9%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            E ETP  +I  +KP  FS NGVLKR +S HHH          Y+ECLKNHAAS+GGHAVD
Sbjct  25   EIETPT-QIQKLKPFPFS-NGVLKRKSSFHHHPVVVI-----YRECLKNHAASLGGHAVD  77

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRR---EPEEPLGLPSAAPALEYQ  650
            GCGEF+PSPTANP+DPTSLKCAACGCHRNFHRR   EP      P A   LEYQ
Sbjct  78   GCGEFLPSPTANPSDPTSLKCAACGCHRNFHRREPEEPVVIPPPPIATAVLEYQ  131



>ref|XP_010453650.1| PREDICTED: zinc-finger homeodomain protein 8-like [Camelina sativa]
Length=265

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 73/111 (66%), Gaps = 6/111 (5%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            E E P  RI   KP+SFS NG    HN L             YKECLKNHAA IGGHA+D
Sbjct  20   EIEAPV-RIQPAKPISFS-NGKRCHHNHLASEAAAVATT---YKECLKNHAARIGGHALD  74

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            GCGEFMPSP  N  DPT+L CAACGCHRNFHRRE ++PL   +  PA+E++
Sbjct  75   GCGEFMPSPAFNSNDPTTLTCAACGCHRNFHRRE-DDPLSASAVVPAIEFR  124



>ref|XP_009620302.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
tomentosiformis]
Length=263

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 78/106 (74%), Gaps = 10/106 (9%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            E++TP      +KPLSFS NG+LK H+  HH      AV   YKECLKNHAASIGGHAVD
Sbjct  17   ENDTPPL----IKPLSFS-NGILKNHHFYHHQQPPSAAVT--YKECLKNHAASIGGHAVD  69

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE---PLGLPS  626
            GCGEFMPSP + P++PTSLKCAACGCHRNFHRREP E   P   PS
Sbjct  70   GCGEFMPSPDSTPSNPTSLKCAACGCHRNFHRREPAEDSSPTHFPS  115



>ref|XP_010425683.1| PREDICTED: zinc-finger homeodomain protein 9-like [Camelina sativa]
Length=323

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 79/97 (81%), Gaps = 9/97 (9%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP  RI   KP+SFS NG++KR       HHHHH V V YKECLKNHAA+IGGHA+D
Sbjct  18   ESETPT-RIQPAKPISFS-NGIIKR-------HHHHHHVTVTYKECLKNHAAAIGGHALD  68

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            GCGEFMPS ++ P+DPTSLKCAACGCHRNFHRR+P++
Sbjct  69   GCGEFMPSLSSTPSDPTSLKCAACGCHRNFHRRDPDD  105



>emb|CBI22215.3| unnamed protein product [Vitis vinifera]
Length=238

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 82/101 (81%), Gaps = 5/101 (5%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhav---vvvYKECLKNHAASIGGH  488
            E+ETP  +I   K LS + NGVLKRH   HHHHHHH A    VV YKECLKNHAAS+GGH
Sbjct  13   ETETPT-QIQPRKGLSLT-NGVLKRHQQHHHHHHHHFAAPQVVVAYKECLKNHAASLGGH  70

Query  489  AVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEP  611
            A+DGCGEFMPSPTA  ADPTSLKCAACGCHRNFHRREP++P
Sbjct  71   ALDGCGEFMPSPTATSADPTSLKCAACGCHRNFHRREPDDP  111



>ref|XP_009788342.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
sylvestris]
Length=265

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 77/107 (72%), Gaps = 8/107 (7%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            E++TP      +KPLSFS NG LK H+    HH       V YKECLKNHAASIGGHAVD
Sbjct  17   ENDTPPL----IKPLSFS-NGTLKNHH---FHHQQPPCAAVTYKECLKNHAASIGGHAVD  68

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPA  638
            GCGEFMPSP + P++PTSLKCAACGCHRNFHRREP E    P+  P+
Sbjct  69   GCGEFMPSPDSTPSNPTSLKCAACGCHRNFHRREPAEDNSSPTHFPS  115



>ref|XP_003543789.1| PREDICTED: transcription factor HB29-like [Glycine max]
Length=331

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 73/98 (74%), Gaps = 8/98 (8%)
 Frame = +3

Query  354  KPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEFMPSPTAN  533
            KP+SFS NGVLKRH+        +H   VVYKECLKNH AS+GGHA+DGCGEFMPSP A 
Sbjct  37   KPVSFS-NGVLKRHH-------VNHRAAVVYKECLKNHVASLGGHALDGCGEFMPSPAAT  88

Query  534  PADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEY  647
              DP+S+KCAACGCHRNFHRREPEE    P+    LEY
Sbjct  89   ADDPSSIKCAACGCHRNFHRREPEESPISPATHHVLEY  126



>ref|XP_010492347.1| PREDICTED: zinc-finger homeodomain protein 8 [Camelina sativa]
Length=272

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 73/111 (66%), Gaps = 6/111 (5%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            E E P  RI   KP+SFS NG    HN L             YKECLKNHAA IGGHA+D
Sbjct  20   EIEAPI-RIQPAKPISFS-NGKRCHHNHLASEAAAVATT---YKECLKNHAARIGGHALD  74

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            GCGEFMPSP  N  DPT+L CAACGCHRNFHRRE ++PL   +  PA+E++
Sbjct  75   GCGEFMPSPAYNSNDPTTLTCAACGCHRNFHRRE-DDPLSASAVVPAIEFR  124



>ref|XP_010420179.1| PREDICTED: zinc-finger homeodomain protein 8-like [Camelina sativa]
Length=263

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 73/111 (66%), Gaps = 6/111 (5%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            E E P  RI   KP+SFS NG    HN L             YKECLKNHAA IGGHA+D
Sbjct  20   EIEAPI-RIQPAKPISFS-NGKRCHHNHLASEAAAVATP---YKECLKNHAARIGGHALD  74

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            GCGEFMPSP  N  DPT+L CAACGCHRNFHRRE ++PL   +  PA+E++
Sbjct  75   GCGEFMPSPAYNSNDPTTLTCAACGCHRNFHRRE-DDPLSASAVVPAIEFR  124



>ref|XP_009341023.1| PREDICTED: zinc-finger homeodomain protein 9 [Pyrus x bretschneideri]
Length=344

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 85/117 (73%), Gaps = 7/117 (6%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhh---havvvvYKECLKNHAASIGGH  488
            +SETP      + PLSFS NGVLKRHN  HH HHH+     VVV YKECLKNHAA++GGH
Sbjct  22   DSETPTRIQQPINPLSFS-NGVLKRHNPTHHLHHHNIPITPVVVTYKECLKNHAATLGGH  80

Query  489  AVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPL--GLPSAAP-ALEYQ  650
            A+DGCGE  PS     ADPTSLKCAACGCHRNFHRR+PE+P+    P+A    +EYQ
Sbjct  81   ALDGCGEVKPSXXXXSADPTSLKCAACGCHRNFHRRDPEDPVQPNTPAATTHVIEYQ  137



>ref|XP_004233363.1| PREDICTED: zinc-finger homeodomain protein 9-like [Solanum lycopersicum]
Length=354

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 87/114 (76%), Gaps = 6/114 (5%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            E ETP  +I  +KP  FS NGVLKR +S +H++HHH  VV+ Y+ECLKNHAAS+GGHAVD
Sbjct  26   EIETPT-QIQKLKPFPFS-NGVLKRKSSFNHNNHHHPVVVI-YRECLKNHAASLGGHAVD  82

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRR---EPEEPLGLPSAAPALEYQ  650
            GCGEF+PSP ANP+DPTSLKCAACGCHRNFHRR   EP      P A   LEYQ
Sbjct  83   GCGEFLPSPAANPSDPTSLKCAACGCHRNFHRREPEEPVVIPPPPIATAVLEYQ  136



>ref|XP_002873714.1| ATHB30/ZFHD3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49973.1| ATHB30/ZFHD3 [Arabidopsis lyrata subsp. lyrata]
Length=268

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 77/119 (65%), Gaps = 7/119 (6%)
 Frame = +3

Query  297  VKGGDVQESETPA-ARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAA  473
            V   D ++ ET A  RI   KP+SFS NG    H+ L             YKECLKNHAA
Sbjct  8    VSDLDSRQPETEAPTRIQPAKPISFS-NGKRCHHHHLASEAVAVAT----YKECLKNHAA  62

Query  474  SIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
             IGGHA+DGCGEFMPSP  N  +PTSL CAACGCHRNFHRRE E+P  L +  PA+E++
Sbjct  63   GIGGHALDGCGEFMPSPLFNTNEPTSLTCAACGCHRNFHRRE-EDPSSLSAVVPAIEFR  120



>emb|CAN64768.1| hypothetical protein VITISV_010311 [Vitis vinifera]
Length=434

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 70/87 (80%), Gaps = 3/87 (3%)
 Frame = +3

Query  351  VKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEFMPSPTA  530
             K LSF  NG LKRH+S          V+V YKECLKNHAAS+GGHA+DGCGEFMPSPT+
Sbjct  201  TKSLSFP-NGGLKRHHS--GAAPLLPVVLVSYKECLKNHAASLGGHALDGCGEFMPSPTS  257

Query  531  NPADPTSLKCAACGCHRNFHRREPEEP  611
             PADPTSLKCAACGCHRNFHRR+P+EP
Sbjct  258  TPADPTSLKCAACGCHRNFHRRDPDEP  284



>ref|XP_002273802.1| PREDICTED: zinc-finger homeodomain protein 11 [Vitis vinifera]
Length=326

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 70/87 (80%), Gaps = 3/87 (3%)
 Frame = +3

Query  351  VKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEFMPSPTA  530
             K LSF  NG LKRH+S          V+V YKECLKNHAAS+GGHA+DGCGEFMPSPT+
Sbjct  46   TKSLSFP-NGGLKRHHS--GAAPLLPVVLVSYKECLKNHAASLGGHALDGCGEFMPSPTS  102

Query  531  NPADPTSLKCAACGCHRNFHRREPEEP  611
             PADPTSLKCAACGCHRNFHRR+P+EP
Sbjct  103  TPADPTSLKCAACGCHRNFHRRDPDEP  129



>gb|EPS70696.1| hypothetical protein M569_04063, partial [Genlisea aurea]
Length=242

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 84/118 (71%), Gaps = 11/118 (9%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRH------NSLhhhhhhhhavvvvYKECLKNHAASI  479
            E ETP    S  + L+   NGVLKRH         H   HHHH VVV YKECLKNHAA++
Sbjct  4    EIETPTR--SPTRKLTPFVNGVLKRHAPPPLPGIHHLGGHHHHPVVVTYKECLKNHAAAL  61

Query  480  GGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSA-APALEYQ  650
            GGHA+DGCGEFMPSP +NPA+PTSLKCAACGCHRNFHRREP++   LP    PALEY 
Sbjct  62   GGHAIDGCGEFMPSPNSNPAEPTSLKCAACGCHRNFHRREPDD--LLPGGETPALEYH  117



>ref|XP_006606671.1| PREDICTED: transcription factor HB29-like, partial [Glycine max]
Length=215

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 71/99 (72%), Gaps = 3/99 (3%)
 Frame = +3

Query  312  VQESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHA  491
            +    TP    + +K LSF+ NG LKRH           ++VV YKECLKNHAASIGGHA
Sbjct  25   ITTKATPPIPTTTLKSLSFT-NGTLKRHP--ITTVAPPPSMVVSYKECLKNHAASIGGHA  81

Query  492  VDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            +DGCGEFMPS +  P+DP SLKCAACGCHRNFHRREP+E
Sbjct  82   LDGCGEFMPSSSTVPSDPRSLKCAACGCHRNFHRREPQE  120



>ref|XP_004489395.1| PREDICTED: transcription factor HB29-like [Cicer arietinum]
Length=322

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 82/117 (70%), Gaps = 10/117 (9%)
 Frame = +3

Query  312  VQESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavv----vvYKECLKNHAASI  479
            +Q+  T     +  KP++FS NGVLKR N   ++HH++H       V YKECLKNH A++
Sbjct  36   IQQLPTNTTTSNITKPITFS-NGVLKRLNPNTNNHHNNHHAQPPMVVTYKECLKNHVATL  94

Query  480  GGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            GGHA+DGC EFMPSPTA   DPTS+KCAACGCHRNFHRREPEEP+     +   EYQ
Sbjct  95   GGHALDGCCEFMPSPTATSDDPTSIKCAACGCHRNFHRREPEEPI-----STVFEYQ  146



>ref|XP_010937133.1| PREDICTED: zinc-finger homeodomain protein 9-like [Elaeis guineensis]
Length=307

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 72/96 (75%), Gaps = 4/96 (4%)
 Frame = +3

Query  330  PAARI--SAVKPLSFS-SNGVLKRHNS-LhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            P+ +I  +  KP SFS  NG LKRH+  L        A   +Y+ECLKNHAAS+GGHA+D
Sbjct  3    PSTKILGTDAKPKSFSFPNGSLKRHHRGLSSPAEPAAAADFLYRECLKNHAASLGGHALD  62

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            GCGEFMPSP ANPADPTSLKCAACGCHRNFHRR PE
Sbjct  63   GCGEFMPSPAANPADPTSLKCAACGCHRNFHRRLPE  98



>ref|NP_197025.1| zinc finger homeodomain transcriptional factor ZFHD3 [Arabidopsis 
thaliana]
 sp|Q9LXG0.1|ZHD8_ARATH RecName: Full=Zinc-finger homeodomain protein 8; Short=AtZHD8; 
AltName: Full=Homeobox protein 30; Short=AtHB-30; AltName: 
Full=Zinc finger homeodomain transcriptional factor ZFHD3 [Arabidopsis 
thaliana]
 emb|CAB89331.1| putative protein [Arabidopsis thaliana]
 gb|AAS76682.1| At5g15210 [Arabidopsis thaliana]
 gb|AED92130.1| zinc finger homeodomain transcriptional factor ZFHD3 [Arabidopsis 
thaliana]
Length=271

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 73/111 (66%), Gaps = 7/111 (6%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            E E P  RI   KP+SFS NG    H+ L             YKECLKNHAA IGGHA+D
Sbjct  20   EIEAPI-RIQPAKPISFS-NGKRCHHHHLASEAVAVAT----YKECLKNHAAGIGGHALD  73

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            GCGEFMPSP+ N  DP SL CAACGCHRNFHRRE E+P  L +  PA+E++
Sbjct  74   GCGEFMPSPSFNSNDPASLTCAACGCHRNFHRRE-EDPSSLSAIVPAIEFR  123



>ref|XP_008802616.1| PREDICTED: zinc-finger homeodomain protein 9-like [Phoenix dactylifera]
Length=296

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = +3

Query  327  TPAARISAVKPLSFS-SNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGC  503
            +P   +   KP  FS SNG L RH           A   +Y ECLKNHAAS+GGHA+DGC
Sbjct  4    SPKILVLDAKPRLFSFSNGALNRHYYRPLPAAAAAAADFLYTECLKNHAASLGGHALDGC  63

Query  504  GEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            GEFMPSP ANPADPTSLKCAACGCHRNFHRR PE
Sbjct  64   GEFMPSPAANPADPTSLKCAACGCHRNFHRRLPE  97



>ref|XP_003621193.1| ZF-HD homeobox protein [Medicago truncatula]
 gb|ABN05735.1| Homeobox domain, ZF-HD class; ZF-HD homeobox protein Cys/His-rich 
dimerisation region; Homeodomain-like [Medicago truncatula]
 gb|ABN08930.1| Homeobox domain, ZF-HD class; ZF-HD homeobox protein Cys/His-rich 
dimerisation region; Homeodomain-like [Medicago truncatula]
 gb|AES77411.1| homeobox domain, ZF-HD class protein [Medicago truncatula]
Length=341

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 75/96 (78%), Gaps = 6/96 (6%)
 Frame = +3

Query  372  SNGVLKRHNSLhhhhhhhhav--vvvYKECLKNHAASIGGHAVDGCGEFMPSPTANPADP  545
            SNGVLKR +  HHH +HH+     + YKECLKNHAA++GGHA+DGCGEFM SPTA P DP
Sbjct  62   SNGVLKRFHHHHHHFNHHNNHQPTITYKECLKNHAANLGGHALDGCGEFMTSPTATPTDP  121

Query  546  TSLKCAACGCHRNFHRREPEEPLGLP-SAAPALEYQ  650
            TSLKCAACGCHRNFHRREPEEP   P +    +EYQ
Sbjct  122  TSLKCAACGCHRNFHRREPEEP---PLTTTHVIEYQ  154



>ref|XP_006602909.1| PREDICTED: transcription factor HB29-like [Glycine max]
Length=338

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 75/97 (77%), Gaps = 3/97 (3%)
 Frame = +3

Query  360  LSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEFMPSPTANPA  539
            LSFS NGVLKR    HHH HH    VV YKECLKNHAA++GG A+DGCGEFMPSPTA  A
Sbjct  44   LSFS-NGVLKR--HHHHHLHHPMPAVVTYKECLKNHAANLGGLALDGCGEFMPSPTATAA  100

Query  540  DPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            DP+S+KCAACGCHRNFHRREPE+P    +    +EYQ
Sbjct  101  DPSSIKCAACGCHRNFHRREPEDPPITSNTTHVIEYQ  137



>gb|AES74711.2| transcription factor HB29-like protein [Medicago truncatula]
Length=333

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 85/122 (70%), Gaps = 18/122 (15%)
 Frame = +3

Query  318  ESETPAARI------SAVKPLSFSSNGVLKRHNSLhhhhhhhhavvv-----vYKECLKN  464
            ESE P  RI      +  KPLSFS NGVLKRH+  HH++++++   +      YKECLKN
Sbjct  40   ESENPT-RIHQPILSNITKPLSFS-NGVLKRHHPNHHNNNNNNVNNLNNVVVTYKECLKN  97

Query  465  HAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALE  644
            H A++GGHA+DGC EFMPSPTA   DP S+KCAACGCHRNFHRREPEEP+     +   E
Sbjct  98   HVATLGGHALDGCCEFMPSPTATSDDPASIKCAACGCHRNFHRREPEEPI-----STVFE  152

Query  645  YQ  650
            YQ
Sbjct  153  YQ  154



>ref|XP_011655994.1| PREDICTED: zinc-finger homeodomain protein 10-like [Cucumis sativus]
 gb|KGN52458.1| hypothetical protein Csa_5G636510 [Cucumis sativus]
Length=307

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 86/117 (74%), Gaps = 7/117 (6%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhh--hhavvvvYKECLKNHAASIGGHA  491
            +S  P +      P SF+ NGVLKRH+  HHHHH      VVV YKECLKNHAA++G HA
Sbjct  16   KSPDPDSDTPTKIPPSFT-NGVLKRHHHNHHHHHRPPSSTVVVSYKECLKNHAATLGAHA  74

Query  492  VDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGL--PSAAP--ALEYQ  650
            +DGCGEFMPSP+A P+DPTSL+CAACGCHRNFHRR+PE+P+     + AP   +EYQ
Sbjct  75   LDGCGEFMPSPSATPSDPTSLRCAACGCHRNFHRRDPEDPISTLAINTAPTHVIEYQ  131



>ref|XP_006290001.1| hypothetical protein CARUB_v10003631mg [Capsella rubella]
 gb|EOA22899.1| hypothetical protein CARUB_v10003631mg [Capsella rubella]
Length=266

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 72/111 (65%), Gaps = 7/111 (6%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            E E P  RI   KP+SFS NG    HN L             YKECLKNHAA IGGHA+D
Sbjct  20   EIEAPT-RIHPAKPISFS-NGKRCHHNHLASEAAAVVT----YKECLKNHAAGIGGHALD  73

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            GCGEFMPSP  N  DPT+L CAACGCHRNFHRRE ++P    +  PA+E++
Sbjct  74   GCGEFMPSPAFNSNDPTTLTCAACGCHRNFHRRE-DDPSLASAIVPAIEFR  123



>gb|KFK25766.1| hypothetical protein AALP_AA8G156900 [Arabis alpina]
Length=268

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 71/106 (67%), Gaps = 5/106 (5%)
 Frame = +3

Query  336  ARISAVKPLSFS-SNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEF  512
             RI   KP+S S SNG    H++    H      V  YKECLKNHAA IGGHA+DGCGEF
Sbjct  26   TRIQPPKPISVSFSNGKRCNHHN----HKPASEAVATYKECLKNHAAGIGGHALDGCGEF  81

Query  513  MPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            MPSP+ N  DPTSL CAACGCHRNFHRRE + P  + +  P +E++
Sbjct  82   MPSPSFNSNDPTSLTCAACGCHRNFHRREEDRPSSISTVVPTMEFR  127



>ref|XP_008784223.1| PREDICTED: zinc-finger homeodomain protein 9-like [Phoenix dactylifera]
Length=306

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 69/98 (70%), Gaps = 6/98 (6%)
 Frame = +3

Query  327  TPAARI----SAVKPLSFSSNGVLKRHNS-LhhhhhhhhavvvvYKECLKNHAASIGGHA  491
             PA +I    +  KP SF  NG LKRH+  L        A   +Y+ECLKNHAAS+GGHA
Sbjct  2    DPATKILDPDAKPKPFSFH-NGSLKRHHRGLSSPAEAADAADFLYRECLKNHAASLGGHA  60

Query  492  VDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            +DGCGEFMPS   NPADPTSLKCAACGCHRNFHRR PE
Sbjct  61   LDGCGEFMPSQAVNPADPTSLKCAACGCHRNFHRRLPE  98



>ref|XP_011070997.1| PREDICTED: zinc-finger homeodomain protein 10 [Sesamum indicum]
Length=295

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 66/101 (65%), Gaps = 4/101 (4%)
 Frame = +3

Query  309  DVQESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGH  488
            D +    P      +  LSF+ NG +  H+               YKEC+KNHAAS+GGH
Sbjct  15   DTEIDTPPHTNGQPINSLSFT-NGEINHHHRPPPPPPPLVVT---YKECMKNHAASLGGH  70

Query  489  AVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEP  611
            AVDGCGEFMPSP+A P DPTSLKCAACGCHRNFHRREP+ P
Sbjct  71   AVDGCGEFMPSPSATPTDPTSLKCAACGCHRNFHRREPDSP  111



>ref|XP_009139922.1| PREDICTED: zinc-finger homeodomain protein 10 [Brassica rapa]
 emb|CDX74428.1| BnaA04g09610D [Brassica napus]
Length=317

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 73/107 (68%), Gaps = 13/107 (12%)
 Frame = +3

Query  339  RISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEFMP  518
            RI   KP+SFS NG++KRH+        H  ++  YKECLKNHAA++G HA+DGCGEFMP
Sbjct  25   RIQPAKPISFS-NGIIKRHH--------HPTLLFTYKECLKNHAAALGSHALDGCGEFMP  75

Query  519  SPTANPADPTSLKCAACGCHRNFHRREPEEPLGL----PSAAPALEY  647
            SP+    DPTSLKCAACGCHRNFHRREP     +     S A  +EY
Sbjct  76   SPSLVSTDPTSLKCAACGCHRNFHRREPGNDSSIRPPPSSVAATIEY  122



>ref|XP_009788413.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
sylvestris]
Length=215

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 69/92 (75%), Gaps = 3/92 (3%)
 Frame = +3

Query  339  RISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEFMP  518
            ++  +KPLSF+ N   K+H+ +H+H      V   YKECLKNHAASIGGH VDGCGEF+P
Sbjct  18   QVPLIKPLSFT-NVTSKKHHQVHNHQPPSAVVT--YKECLKNHAASIGGHTVDGCGEFIP  74

Query  519  SPTANPADPTSLKCAACGCHRNFHRREPEEPL  614
            SP+A  ADPTSLKC  CGCHRNFHRREP++  
Sbjct  75   SPSATAADPTSLKCDVCGCHRNFHRREPDDDF  106



>ref|XP_006400038.1| hypothetical protein EUTSA_v10016088mg [Eutrema salsugineum]
 dbj|BAJ34409.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41491.1| hypothetical protein EUTSA_v10016088mg [Eutrema salsugineum]
Length=266

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 76/111 (68%), Gaps = 5/111 (5%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            E E P  RI   KP+SFS NG  KR +  HHH       V  YKECLKNHAA IGGHA+D
Sbjct  20   EIEAPT-RIQPAKPISFS-NG--KRCHHYHHHLASEAVAVATYKECLKNHAAGIGGHALD  75

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            GCGEFMPS + N  DP SL CAACGCHRNFHRRE E+P  + +  PA+E++
Sbjct  76   GCGEFMPSLSFNSNDPASLTCAACGCHRNFHRRE-EDPSSVSAIVPAIEFR  125



>ref|XP_008467057.1| PREDICTED: zinc-finger homeodomain protein 10-like [Cucumis melo]
Length=315

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 62/73 (85%), Gaps = 4/73 (5%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGL-  620
            YKECLKNHAA++G HA+DGCGEFMPSP+A P+DPTSL+CAACGCHRNFHRR+PE+P+   
Sbjct  67   YKECLKNHAATLGAHALDGCGEFMPSPSATPSDPTSLRCAACGCHRNFHRRDPEDPISTL  126

Query  621  -PSAAP--ALEYQ  650
              + AP   +EYQ
Sbjct  127  AINTAPTHVIEYQ  139



>ref|XP_007158652.1| hypothetical protein PHAVU_002G171000g [Phaseolus vulgaris]
 gb|ESW30646.1| hypothetical protein PHAVU_002G171000g [Phaseolus vulgaris]
Length=367

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = +3

Query  354  KPLSFSSNGVLKRH-NSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEFMPSPTA  530
            K LSF+ NG  KRH  ++         +VV YKECLKNHAAS+GGHA+DGCGEFMPS + 
Sbjct  33   KSLSFT-NGTPKRHPTTIGAPLPLPPPMVVTYKECLKNHAASLGGHALDGCGEFMPSSST  91

Query  531  NPADPTSLKCAACGCHRNFHRREPEE  608
            NP DP SLKCAACGCHRNFHRR+P+E
Sbjct  92   NPTDPRSLKCAACGCHRNFHRRDPQE  117



>ref|XP_006302745.1| hypothetical protein CARUB_v10020860mg [Capsella rubella]
 gb|EOA35643.1| hypothetical protein CARUB_v10020860mg [Capsella rubella]
Length=245

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            YKECLKNHAA++GGHA+DGCGEFMPSPTAN  DP+SL+CAACGCHRNFHRR+P E L   
Sbjct  32   YKECLKNHAANLGGHALDGCGEFMPSPTANSTDPSSLRCAACGCHRNFHRRDPSENLNFL  91

Query  624  SAAP  635
            +A P
Sbjct  92   TAPP  95



>gb|ABY61030.1| zinc finger-homeodomain protein 1, partial [Cucumis sativus]
Length=302

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 85/117 (73%), Gaps = 7/117 (6%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhh--hhavvvvYKECLKNHAASIGGHA  491
            +S  P +      P SF+ NGVLKRH+  HHHHH      VVV YKECLKNHAA++G HA
Sbjct  11   KSPDPDSDTPTKIPPSFT-NGVLKRHHHNHHHHHRPPSSTVVVSYKECLKNHAATLGAHA  69

Query  492  VDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGL--PSAAP--ALEYQ  650
            + GCGEFMPSP+A P+DPTSL+CAACGCHRNFHRR+PE+P+     + AP   +EYQ
Sbjct  70   LYGCGEFMPSPSATPSDPTSLRCAACGCHRNFHRRDPEDPISTLAINTAPTHVIEYQ  126



>gb|EAZ09094.1| hypothetical protein OsI_31360 [Oryza sativa Indica Group]
Length=212

 Score =   111 bits (278),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+ECLKNHAAS+GGHA+DGCGEFMPSP ANPADPTSL+CAACGCHRNFHRR PE
Sbjct  41   YRECLKNHAASLGGHALDGCGEFMPSPAANPADPTSLRCAACGCHRNFHRRLPE  94



>emb|CDY56033.1| BnaC04g55850D [Brassica napus]
Length=277

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 66/87 (76%), Gaps = 9/87 (10%)
 Frame = +3

Query  339  RISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEFMP  518
            RI   KP+SFS NG++KRH+        H  ++  YKECLKNHAA++G HA+DGCGEFMP
Sbjct  25   RIQPAKPISFS-NGIIKRHH--------HPTLLFTYKECLKNHAAALGSHALDGCGEFMP  75

Query  519  SPTANPADPTSLKCAACGCHRNFHRRE  599
            SP+    DPTSLKCAACGCHRNFHRRE
Sbjct  76   SPSLVSTDPTSLKCAACGCHRNFHRRE  102



>gb|EEE69700.1| hypothetical protein OsJ_29356 [Oryza sativa Japonica Group]
Length=244

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+ECLKNHAAS+GGHA+DGCGEFMPSP ANPADPTSL+CAACGCHRNFHRR PE
Sbjct  41   YRECLKNHAASLGGHALDGCGEFMPSPAANPADPTSLRCAACGCHRNFHRRLPE  94



>ref|XP_009121598.1| PREDICTED: zinc-finger homeodomain protein 8 [Brassica rapa]
Length=263

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 78/115 (68%), Gaps = 7/115 (6%)
 Frame = +3

Query  309  DVQESETPA-ARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGG  485
            D Q+  T A  RI   KP+SFS NG     +   H HH    VV  YKECLKNHAA IGG
Sbjct  15   DSQQPMTQAPTRIQPAKPISFS-NG----KHHHDHQHHASQVVVAAYKECLKNHAAGIGG  69

Query  486  HAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            HA+DGCGEF+PSPT N +DPTSL C ACGCHRNFHRRE ++   + +A P +E++
Sbjct  70   HALDGCGEFIPSPTFNTSDPTSLTCDACGCHRNFHRRE-DDLSAVSAAVPRIEFR  123



>ref|XP_002887246.1| ATHB29/ZFHD1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63505.1| ATHB29/ZFHD1 [Arabidopsis lyrata subsp. lyrata]
Length=240

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            YKECLKNHAA++GGHA+DGCGEFMPSPTA   DP+SL+CAACGCHRNFHRR+P E L   
Sbjct  25   YKECLKNHAANLGGHALDGCGEFMPSPTATSTDPSSLRCAACGCHRNFHRRDPSENLNFL  84

Query  624  SAAP  635
            +A P
Sbjct  85   TAPP  88



>ref|XP_008389477.1| PREDICTED: zinc-finger homeodomain protein 11-like [Malus domestica]
Length=333

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEP  611
            YKECLKNHAAS+GGHA+DGCGEFMPSP++NPADPTSLKCAACGCHRNFHRR+   P
Sbjct  54   YKECLKNHAASLGGHALDGCGEFMPSPSSNPADPTSLKCAACGCHRNFHRRDQYRP  109



>ref|XP_010939501.1| PREDICTED: zinc-finger homeodomain protein 9-like [Elaeis guineensis]
Length=289

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 69/95 (73%), Gaps = 8/95 (8%)
 Frame = +3

Query  330  PAARISA--VKPLSFS-SNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDG  500
            P+ +IS    KP +FS SNG LKRH+          A   +Y+ECLKNHAA +GGHA+DG
Sbjct  3    PSPKISGPDTKPRTFSFSNGGLKRHHH-----RSLPAADFLYRECLKNHAARLGGHALDG  57

Query  501  CGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            CGEFMPSP AN  DPTSLKCAACGCHRNFHRR P+
Sbjct  58   CGEFMPSPAANHVDPTSLKCAACGCHRNFHRRLPK  92



>ref|XP_008221618.1| PREDICTED: zinc-finger homeodomain protein 11-like [Prunus mume]
Length=347

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = +3

Query  354  KPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEFMPSPTAN  533
            + LSF  NG LK H+           + V YKECLKNHAAS+GGHA+DGCGEFMPSP++N
Sbjct  37   RSLSFP-NGSLKPHHPTIPPPQPPPTMAVAYKECLKNHAASLGGHALDGCGEFMPSPSSN  95

Query  534  PADPTSLKCAACGCHRNFHRREPEEP  611
            P DPTSLKCAACGCHRNFHRR+   P
Sbjct  96   PMDPTSLKCAACGCHRNFHRRDQHRP  121



>ref|NP_177118.1| transcriptional factor ZFHD1 [Arabidopsis thaliana]
 sp|Q9SEZ1.1|ZHD11_ARATH RecName: Full=Zinc-finger homeodomain protein 11; Short=AtZHD11; 
AltName: Full=Transcription factor HB29; Short=AtHB-29; 
AltName: Full=Zinc finger homeodomain transcription factor 1 
[Arabidopsis thaliana]
 gb|AAF24606.1|AC021046_4 hypothetical protein; 18366-17638 [Arabidopsis thaliana]
 gb|AEE34954.1| transcriptional factor ZFHD1 [Arabidopsis thaliana]
Length=242

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            YKECLKNHAA++GGHA+DGCGEFMPSPTA   DP+SL+CAACGCHRNFHRR+P E L   
Sbjct  31   YKECLKNHAANLGGHALDGCGEFMPSPTATSTDPSSLRCAACGCHRNFHRRDPSENLNFL  90

Query  624  SAAP  635
            +A P
Sbjct  91   TAPP  94



>sp|Q6ER21.2|ZHD9_ORYSJ RecName: Full=Zinc-finger homeodomain protein 9; Short=OsZHD9 
[Oryza sativa Japonica Group]
Length=341

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+ECLKNHAAS+GGHA+DGCGEFMPSP ANPADPTSL+CAACGCHRNFHRR PE
Sbjct  41   YRECLKNHAASLGGHALDGCGEFMPSPAANPADPTSLRCAACGCHRNFHRRLPE  94



>ref|XP_006390994.1| hypothetical protein EUTSA_v10019038mg [Eutrema salsugineum]
 gb|ESQ28280.1| hypothetical protein EUTSA_v10019038mg [Eutrema salsugineum]
Length=251

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 60/66 (91%), Gaps = 1/66 (2%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLG-L  620
            YKECLKNHAA++GGHA+DGCGEFMPSPTA+  DP+SL+CAACGCHRNFHRR+P + L  L
Sbjct  31   YKECLKNHAANLGGHALDGCGEFMPSPTASSTDPSSLRCAACGCHRNFHRRDPSDHLNFL  90

Query  621  PSAAPA  638
            P+++P+
Sbjct  91   PTSSPS  96



>gb|EPS58358.1| hypothetical protein M569_16456, partial [Genlisea aurea]
Length=195

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 3/64 (5%)
 Frame = +3

Query  459  KNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE-PLGLPSAAP  635
            KNHAA++GGHAVDGCGEFMPSP +NPA+PTSLKCAACGCHRNFHRREP++ P GL   AP
Sbjct  1    KNHAAALGGHAVDGCGEFMPSPNSNPAEPTSLKCAACGCHRNFHRREPDDTPPGL--EAP  58

Query  636  ALEY  647
            ALEY
Sbjct  59   ALEY  62



>emb|CDX69541.1| BnaA10g18900D [Brassica napus]
Length=263

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 78/115 (68%), Gaps = 7/115 (6%)
 Frame = +3

Query  309  DVQESETPA-ARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGG  485
            D Q+  T A  RI   KP+SFS NG     +   H HH    VV  YKECLKNHAA IGG
Sbjct  15   DSQQPMTQAPTRIQPAKPISFS-NG----KHHHDHQHHASQVVVAAYKECLKNHAAGIGG  69

Query  486  HAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            HA+DGCGEF+PSPT N +DPTSL C ACGCHRNFHRRE ++   + +A P +E++
Sbjct  70   HALDGCGEFIPSPTFNTSDPTSLTCDACGCHRNFHRRE-DDLSAVSAAVPRIEFR  123



>ref|XP_004238801.1| PREDICTED: zinc-finger homeodomain protein 10-like [Solanum lycopersicum]
Length=297

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            YKECLKNHAASIGGHAVDGCGEFMPSP + P+DP SLKCAACGCHRNFHRREP +
Sbjct  55   YKECLKNHAASIGGHAVDGCGEFMPSPESTPSDPISLKCAACGCHRNFHRREPSD  109



>ref|XP_010683186.1| PREDICTED: zinc-finger homeodomain protein 8-like [Beta vulgaris 
subsp. vulgaris]
Length=343

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            YKECLKNHAASIGGHA+DGC EFMP PTANP DPTSL CAACGCHRNFHRR+P++P  L 
Sbjct  52   YKECLKNHAASIGGHALDGCCEFMPGPTANPLDPTSLTCAACGCHRNFHRRDPDDPTPLH  111

Query  624  SAAP  635
               P
Sbjct  112  HLIP  115



>ref|XP_010470956.1| PREDICTED: zinc-finger homeodomain protein 11 [Camelina sativa]
Length=240

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            YKECLKNHAA++GGHA+DGCGEFMPSPTA   DP+SL+CAACGCHRNFHRR+P E L   
Sbjct  26   YKECLKNHAANLGGHALDGCGEFMPSPTATSTDPSSLRCAACGCHRNFHRRDPSENLNFL  85

Query  624  SAAP  635
             A P
Sbjct  86   IAPP  89



>ref|XP_004298431.2| PREDICTED: zinc-finger homeodomain protein 11-like [Fragaria 
vesca subsp. vesca]
Length=374

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 1/57 (2%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRRE-PEEP  611
            YKECLKNHAAS+GGHA+DGCGEF PSP +NP+DPTSLKCAACGCHRNFHRR+ P+EP
Sbjct  97   YKECLKNHAASLGGHALDGCGEFFPSPISNPSDPTSLKCAACGCHRNFHRRDAPDEP  153



>ref|XP_007224765.1| hypothetical protein PRUPE_ppa024080mg [Prunus persica]
 gb|EMJ25964.1| hypothetical protein PRUPE_ppa024080mg [Prunus persica]
Length=349

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEP  611
            YKECLKNHAAS+GGHA+DGCGEFMPSP++NP DPTSLKCAACGCHRNFHRR+   P
Sbjct  68   YKECLKNHAASLGGHALDGCGEFMPSPSSNPMDPTSLKCAACGCHRNFHRRDQHRP  123



>gb|EEE69699.1| hypothetical protein OsJ_29355 [Oryza sativa Japonica Group]
Length=310

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+ECLKNHAAS+GGHA+DGCGEFMPSP ANPADPTSL+CAACGCHRNFHRR PE
Sbjct  41   YRECLKNHAASLGGHALDGCGEFMPSPAANPADPTSLRCAACGCHRNFHRRLPE  94



>emb|CDY28566.1| BnaC02g19350D [Brassica napus]
Length=255

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 60/69 (87%), Gaps = 4/69 (6%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGL-  620
            YKECLKNHAA++GGHA+DGCGEFMP+PTA PADP+SL+CAACGCHRNFHRR+P + L   
Sbjct  30   YKECLKNHAANLGGHALDGCGEFMPTPTATPADPSSLRCAACGCHRNFHRRDPCDHLNFL  89

Query  621  ---PSAAPA  638
               P+++P+
Sbjct  90   PVHPTSSPS  98



>emb|CDY44079.1| BnaA02g14430D [Brassica napus]
Length=255

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 60/69 (87%), Gaps = 4/69 (6%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGL-  620
            YKECLKNHAA++GGHA+DGCGEFMP+PTA PADP+SL+CAACGCHRNFHRR+P + L   
Sbjct  30   YKECLKNHAANLGGHALDGCGEFMPTPTATPADPSSLRCAACGCHRNFHRRDPCDHLNFL  89

Query  621  ---PSAAPA  638
               P+++P+
Sbjct  90   PVHPTSSPS  98



>gb|ACG35864.1| ZF-HD homeobox protein [Zea mays]
 gb|ACN27941.1| unknown [Zea mays]
 gb|AFT82692.1| ZHD2 ZF-HD type transcription factor, partial [Zea mays subsp. 
mays]
 tpg|DAA61439.1| TPA: ZF-HD homeobox protein [Zea mays]
Length=370

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/51 (94%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRR  596
            Y+ECLKNHAAS+GGHAVDGCGEFMPSP ANPADPTSLKCAACGCHRNFHRR
Sbjct  36   YRECLKNHAASLGGHAVDGCGEFMPSPGANPADPTSLKCAACGCHRNFHRR  86



>ref|NP_001063169.1| Os09g0414600 [Oryza sativa Japonica Group]
 dbj|BAF25083.1| Os09g0414600 [Oryza sativa Japonica Group]
Length=109

 Score =   106 bits (264),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRR  596
            Y+ECLKNHAAS+GGHA+DGCGEFMPSP ANPADPTSL+CAACGCHRNFHRR
Sbjct  41   YRECLKNHAASLGGHALDGCGEFMPSPAANPADPTSLRCAACGCHRNFHRR  91



>ref|NP_001145929.1| uncharacterized protein LOC100279452 [Zea mays]
 gb|ACL52867.1| unknown [Zea mays]
Length=370

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/51 (94%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRR  596
            Y+ECLKNHAAS+GGHAVDGCGEFMPSP ANPADPTSLKCAACGCHRNFHRR
Sbjct  36   YRECLKNHAASLGGHAVDGCGEFMPSPGANPADPTSLKCAACGCHRNFHRR  86



>ref|XP_006366102.1| PREDICTED: transcription factor HB29-like [Solanum tuberosum]
Length=287

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 72/99 (73%), Gaps = 8/99 (8%)
 Frame = +3

Query  321  SETPAARISA---VKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHA  491
            ++TP + +     +KPLSFS NG        +HHH       V+YKECLKNHAAS+GGHA
Sbjct  14   TKTPDSEVDTPPLIKPLSFS-NGNN----HHNHHHELPPCTAVIYKECLKNHAASLGGHA  68

Query  492  VDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            VDGCGEFMPSP + P+DP SLKCAACGCHRNFHRREP +
Sbjct  69   VDGCGEFMPSPESTPSDPISLKCAACGCHRNFHRREPSD  107



>ref|XP_003528585.2| PREDICTED: transcription factor HB29-like [Glycine max]
Length=358

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 65/83 (78%), Gaps = 3/83 (4%)
 Frame = +3

Query  360  LSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEFMPSPTANPA  539
            LSF+ NG LKRH +         ++VV YKECLKNHAASIGGHA+DGCGEFM S +  P+
Sbjct  40   LSFA-NGTLKRHPT--TTVAQPPSMVVSYKECLKNHAASIGGHALDGCGEFMLSSSTVPS  96

Query  540  DPTSLKCAACGCHRNFHRREPEE  608
            DP SLKCAACGCHRNFHRREP+E
Sbjct  97   DPRSLKCAACGCHRNFHRREPQE  119



>ref|NP_001183843.1| uncharacterized protein LOC100502436 [Zea mays]
 gb|ACR38519.1| unknown [Zea mays]
Length=369

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/51 (94%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRR  596
            Y+ECLKNHAAS+GGHAVDGCGEFMPSP ANPADPTSLKCAACGCHRNFHRR
Sbjct  36   YRECLKNHAASLGGHAVDGCGEFMPSPGANPADPTSLKCAACGCHRNFHRR  86



>ref|XP_004956814.1| PREDICTED: transcription factor HB29-like [Setaria italica]
Length=367

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+ECLKNHAAS+GGHAVDGCGEFMPSP ANPADPTSLKCAACGCHRNFHRR  E
Sbjct  40   YRECLKNHAASLGGHAVDGCGEFMPSPGANPADPTSLKCAACGCHRNFHRRAVE  93



>ref|NP_001150690.1| ZF-HD homeobox protein [Zea mays]
 gb|ACG40010.1| ZF-HD homeobox protein [Zea mays]
Length=361

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+ECLKNHAAS+GGHAVDGCGEFMPSP ANPADPTSLKCAACGCHRNFHRR  E
Sbjct  35   YRECLKNHAASLGGHAVDGCGEFMPSPGANPADPTSLKCAACGCHRNFHRRTVE  88



>dbj|BAD28899.1| putative ZF-HD homeobox protein [Oryza sativa Japonica Group]
Length=263

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRR  596
            Y+ECLKNHAAS+GGHA+DGCGEFMPSP ANPADPTSL+CAACGCHRNFHRR
Sbjct  41   YRECLKNHAASLGGHALDGCGEFMPSPAANPADPTSLRCAACGCHRNFHRR  91



>ref|XP_007046103.1| Homeobox protein 34, putative [Theobroma cacao]
 gb|EOY01935.1| Homeobox protein 34, putative [Theobroma cacao]
Length=305

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            YKECLKNHAA++GGHA+DGCGEFMPSPTA P DP SLKCAACGCHRNFHRR+P +
Sbjct  42   YKECLKNHAATLGGHALDGCGEFMPSPTATPTDPASLKCAACGCHRNFHRRDPYD  96



>ref|XP_002462378.1| hypothetical protein SORBIDRAFT_02g024650 [Sorghum bicolor]
 gb|EER98899.1| hypothetical protein SORBIDRAFT_02g024650 [Sorghum bicolor]
Length=381

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/51 (94%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRR  596
            Y+ECLKNHAAS+GGHAVDGCGEFMPSP ANPADPTSLKCAACGCHRNFHRR
Sbjct  36   YRECLKNHAASLGGHAVDGCGEFMPSPGANPADPTSLKCAACGCHRNFHRR  86



>tpg|DAA40076.1| TPA: ZF-HD homeobox protein [Zea mays]
 gb|AIB04491.1| ZF-HD transcription factor, partial [Zea mays]
Length=361

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+ECLKNHAAS+GGHAVDGCGEFMPSP ANPADPTSLKCAACGCHRNFHRR  E
Sbjct  35   YRECLKNHAASLGGHAVDGCGEFMPSPGANPADPTSLKCAACGCHRNFHRRTVE  88



>ref|XP_010415617.1| PREDICTED: zinc-finger homeodomain protein 11-like [Camelina 
sativa]
Length=240

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            YKECLKNHAA++GGHA+DGCGEFMPSPTA   DP+S +CAACGCHRNFHRR+P E L   
Sbjct  26   YKECLKNHAANLGGHALDGCGEFMPSPTATSTDPSSFRCAACGCHRNFHRRDPSENLNFL  85

Query  624  SAAP  635
             A P
Sbjct  86   IAPP  89



>ref|XP_009360340.1| PREDICTED: zinc-finger homeodomain protein 8 [Pyrus x bretschneideri]
Length=378

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEP  611
            YKECLKNHAAS+GGHA+DGCGEFMPSP++NPADPTSLKCAACGCHRNFHR +   P
Sbjct  99   YKECLKNHAASLGGHALDGCGEFMPSPSSNPADPTSLKCAACGCHRNFHRLDQYRP  154



>ref|XP_002877141.1| hypothetical protein ARALYDRAFT_484662 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53400.1| hypothetical protein ARALYDRAFT_484662 [Arabidopsis lyrata subsp. 
lyrata]
Length=299

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 86/119 (72%), Gaps = 17/119 (14%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP  RI   KP+SFS NG++KRH+  HH+          YKECLKN+AA+IGGHA+D
Sbjct  11   ESETPT-RIQPAKPISFS-NGIIKRHHHHHHNTVT-------YKECLKNYAAAIGGHALD  61

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP--------SAAPALEYQ  650
            GCGEFMPSP++ P+DPTSLKCAACGCHRNFHRREP++   +P        +   A+EYQ
Sbjct  62   GCGEFMPSPSSTPSDPTSLKCAACGCHRNFHRREPDDSSSVPPPSLLPSSTTTAAIEYQ  120



>ref|XP_004135457.1| PREDICTED: zinc-finger homeodomain protein 8 [Cucumis sativus]
 gb|KGN51914.1| ZF-HD homeobox domain-containing protein [Cucumis sativus]
Length=215

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPL  614
            YKECLKNHAA++GGHA+DGCGEFMPS T+ P DPTSL CAACGCHRNFHRRE ++P 
Sbjct  5    YKECLKNHAAAVGGHALDGCGEFMPSITSTPTDPTSLNCAACGCHRNFHRRESDDPW  61



>ref|XP_006438687.1| hypothetical protein CICLE_v10032160mg [Citrus clementina]
 ref|XP_006483155.1| PREDICTED: transcription factor HB29-like [Citrus sinensis]
 gb|ESR51927.1| hypothetical protein CICLE_v10032160mg [Citrus clementina]
Length=314

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 55/70 (79%), Gaps = 5/70 (7%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLG--  617
            YKECLKNHAAS+GGHA+DGCGEFMPSPTA   DP SL CAACGCHRNFHRR+P EP    
Sbjct  50   YKECLKNHAASLGGHALDGCGEFMPSPTATSNDPASLNCAACGCHRNFHRRDPYEPNAAA  109

Query  618  ---LPSAAPA  638
               LP AA A
Sbjct  110  THRLPPAATA  119



>gb|KDO82923.1| hypothetical protein CISIN_1g046396mg [Citrus sinensis]
Length=314

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 55/70 (79%), Gaps = 5/70 (7%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLG--  617
            YKECLKNHAAS+GGHA+DGCGEFMPSPTA   DP SL CAACGCHRNFHRR+P EP    
Sbjct  50   YKECLKNHAASLGGHALDGCGEFMPSPTATSNDPASLNCAACGCHRNFHRRDPYEPNAAA  109

Query  618  ---LPSAAPA  638
               LP AA A
Sbjct  110  THRLPPAATA  119



>gb|KJB80187.1| hypothetical protein B456_013G085500 [Gossypium raimondii]
Length=292

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            YKECLKNH AS+GGHA+DGCGEFMPSPT+ P DP SLKCAACGCHRNFHRR+P +
Sbjct  47   YKECLKNHVASLGGHALDGCGEFMPSPTSTPTDPVSLKCAACGCHRNFHRRDPYD  101



>ref|XP_006660162.1| PREDICTED: transcription factor HB29-like [Oryza brachyantha]
Length=168

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = +3

Query  354  KPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEFMPSPTAN  533
            +P+ F + G      S           V VY+ECLKNHAAS+GGHAVDGCGEFMPSP A+
Sbjct  10   RPVVFPNGGAAAVGRSKARAGIGGGEGVGVYRECLKNHAASLGGHAVDGCGEFMPSPAAD  69

Query  534  PADPTSLKCAACGCHRNFHRREPE  605
             ADP SLKCAACGCHRNFHRR PE
Sbjct  70   AADPCSLKCAACGCHRNFHRRLPE  93



>ref|NP_189534.1| homeobox protein 34 [Arabidopsis thaliana]
 sp|Q9LHF0.1|ZHD9_ARATH RecName: Full=Zinc-finger homeodomain protein 9; Short=AtZHD9; 
AltName: Full=Homeobox protein 34; Short=AtHB-34 [Arabidopsis 
thaliana]
 dbj|BAB02255.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM13170.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91220.1| unknown protein [Arabidopsis thaliana]
 gb|AEE77508.1| homeobox protein 34 [Arabidopsis thaliana]
Length=312

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 87/119 (73%), Gaps = 15/119 (13%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP  RI   KP+SFS NG++KRH+      HHH+   V YKECLKNHAA+IGGHA+D
Sbjct  17   ESETPT-RIQPAKPISFS-NGIIKRHHH-----HHHNNNKVTYKECLKNHAAAIGGHALD  69

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP--------SAAPALEYQ  650
            GCGEFMPSP++ P+DPTSLKCAACGCHRNFHRRE ++   +P        +   A+EYQ
Sbjct  70   GCGEFMPSPSSTPSDPTSLKCAACGCHRNFHRRETDDSSAVPPPSLLPSSTTTAAIEYQ  128



>ref|XP_010512007.1| PREDICTED: zinc-finger homeodomain protein 11-like isoform X2 
[Camelina sativa]
Length=240

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGL  620
            YKECLKNHAA++GGHA+DGCGEFMPSPTA   DP+SL+CAACGCHRNFHRR+P + L  
Sbjct  26   YKECLKNHAANLGGHALDGCGEFMPSPTATSTDPSSLRCAACGCHRNFHRRDPSDNLNF  84



>ref|XP_010512006.1| PREDICTED: zinc-finger homeodomain protein 11-like isoform X1 
[Camelina sativa]
Length=240

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGL  620
            YKECLKNHAA++GGHA+DGCGEFMPSPTA   DP+SL+CAACGCHRNFHRR+P + L  
Sbjct  26   YKECLKNHAANLGGHALDGCGEFMPSPTATSTDPSSLRCAACGCHRNFHRRDPSDNLNF  84



>gb|KJB30399.1| hypothetical protein B456_005G141400 [Gossypium raimondii]
Length=262

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            YKECLKNHAAS+GGHA+DGCGEFMP+P+A P DP S KCAACGCHRNFHRR+P +
Sbjct  11   YKECLKNHAASLGGHALDGCGEFMPTPSATPTDPASFKCAACGCHRNFHRRDPYD  65



>ref|XP_008353097.1| PREDICTED: LOW QUALITY PROTEIN: zinc-finger homeodomain protein 
11-like, partial [Malus domestica]
Length=317

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEP  611
            YKECLKNHAAS+GGHA+DGCGEFMPSP++NPADPTSLKCAACGCHRNFH R+   P
Sbjct  54   YKECLKNHAASLGGHALDGCGEFMPSPSSNPADPTSLKCAACGCHRNFHCRDQYRP  109



>ref|XP_008339904.1| PREDICTED: zinc-finger homeodomain protein 11-like [Malus domestica]
 ref|XP_008368241.1| PREDICTED: zinc-finger homeodomain protein 11-like [Malus domestica]
Length=322

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEP  611
            YKECLKNHAAS+GGHA+DGCGEFMPSP++NPADPTSLKCAACGCHRNFH R+   P
Sbjct  54   YKECLKNHAASLGGHALDGCGEFMPSPSSNPADPTSLKCAACGCHRNFHCRDQYRP  109



>gb|KEH19725.1| homeobox domain, ZF-HD class protein [Medicago truncatula]
Length=391

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPL  614
            YKECLKNHAAS+GGHA+DGCGEFMP  + NP DP SLKCAACGCHRNFHRREP+E +
Sbjct  64   YKECLKNHAASLGGHALDGCGEFMPPSSLNPNDPRSLKCAACGCHRNFHRREPQEHI  120



>emb|CAC34408.1| ZF-HD homeobox protein [Flaveria bidentis]
Length=241

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREP  602
            YK+CLKNHA  IGGHAVDGCGEFMP+PT NP+ P+S KCAACGCHRNFHRREP
Sbjct  17   YKQCLKNHAVGIGGHAVDGCGEFMPAPTYNPSQPSSFKCAACGCHRNFHRREP  69



>ref|XP_010550055.1| PREDICTED: zinc-finger homeodomain protein 8-like [Tarenaya hassleriana]
Length=282

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 66/104 (63%), Gaps = 12/104 (12%)
 Frame = +3

Query  339  RISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEFMP  518
            R    KP+SFS NG    H +L             Y+ECLKNHAA IGGHA+DGCGEFMP
Sbjct  34   RFQPAKPISFS-NGKRHHHPALGPVT---------YRECLKNHAAGIGGHALDGCGEFMP  83

Query  519  SPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            S + +P DPTSL CAACGCHRNFHRR  ++P   P+AA     Q
Sbjct  84   SSSTDPNDPTSLTCAACGCHRNFHRR--DDPSSSPAAAVEFRPQ  125



>ref|XP_010086552.1| hypothetical protein L484_001444 [Morus notabilis]
 gb|EXB20251.1| hypothetical protein L484_001444 [Morus notabilis]
Length=370

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            Y+ECLKNHAA+IGGHA+DGCGEFMPSP++  +DPTSLKCAACGCHRNFHRR PE+
Sbjct  70   YRECLKNHAATIGGHALDGCGEFMPSPSSLLSDPTSLKCAACGCHRNFHRRHPED  124



>gb|ABO92969.1| ZF-HD homeobox domain-containing protein [Solanum tuberosum]
Length=285

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 72/99 (73%), Gaps = 12/99 (12%)
 Frame = +3

Query  321  SETPAARISA---VKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHA  491
            ++TP + +     +KPLSFS NG        ++HH      VV+YKECLKNHAAS+GGHA
Sbjct  14   TKTPDSEVDTPPLIKPLSFS-NG--------NNHHQPPPCTVVIYKECLKNHAASLGGHA  64

Query  492  VDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            VDGCGEFMPS  + P+DP SLKCAACGCHRNFHRREP +
Sbjct  65   VDGCGEFMPSTESTPSDPISLKCAACGCHRNFHRREPSD  103



>ref|XP_008792837.1| PREDICTED: zinc-finger homeodomain protein 9-like [Phoenix dactylifera]
Length=299

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 65/95 (68%), Gaps = 3/95 (3%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            +S T +  +   KP+SF  NG LK+   L             Y+ECL+NHAAS+GGHAVD
Sbjct  2    DSVTKSFDLDTQKPVSFP-NGTLKKQ--LPRPPAPAADGHHQYRECLRNHAASLGGHAVD  58

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREP  602
            GC EFMPSP+A+PA PTSL CAACGCHRNFHRR P
Sbjct  59   GCCEFMPSPSADPAVPTSLTCAACGCHRNFHRRLP  93



>ref|XP_004973533.1| PREDICTED: transcription factor HB29-like [Setaria italica]
Length=355

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+ECLKNHAAS+GGHA+DGCGEFMP+P A+PADP SL+CAACGCHRNFHRR PE
Sbjct  43   YRECLKNHAASLGGHALDGCGEFMPTPEADPADPASLRCAACGCHRNFHRRLPE  96



>ref|XP_006291497.1| hypothetical protein CARUB_v10017644mg [Capsella rubella]
 gb|EOA24395.1| hypothetical protein CARUB_v10017644mg [Capsella rubella]
Length=323

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 78/97 (80%), Gaps = 10/97 (10%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP  RI   KP+SFS NG +KRH+        HH V V YKECLKNHAA+IGGHA+D
Sbjct  18   ESETPI-RIQPAKPISFS-NGFIKRHH--------HHNVTVTYKECLKNHAAAIGGHALD  67

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            GCGEFMPSP++ P+DPTSLKCAACGCHRNFHRR+P++
Sbjct  68   GCGEFMPSPSSTPSDPTSLKCAACGCHRNFHRRDPDD  104



>ref|XP_008446349.1| PREDICTED: zinc-finger homeodomain protein 9 [Cucumis melo]
Length=216

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            YKECLKNHAA++GGHA+DGCGEFMPS T+ P DPTSL CAACGCHRNFHRRE ++
Sbjct  5    YKECLKNHAAAVGGHALDGCGEFMPSITSTPTDPTSLNCAACGCHRNFHRRESDD  59



>emb|CDX86403.1| BnaA06g31200D [Brassica napus]
Length=344

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 88/122 (72%), Gaps = 19/122 (16%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP  RI   KP+SFS NG++KRH+       HHH + V YKECLKNHAA+IGGHA+D
Sbjct  17   ESETPT-RIQPAKPISFS-NGIIKRHHH-----IHHHTLTVTYKECLKNHAAAIGGHALD  69

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAA-----------PALE  644
            GCGEFMPSP++ P+DPTSLKCAACGCHRNFHRR+P++   L SA             A+E
Sbjct  70   GCGEFMPSPSSTPSDPTSLKCAACGCHRNFHRRDPDDS-SLASAVPPPSLPPSSTTAAIE  128

Query  645  YQ  650
            YQ
Sbjct  129  YQ  130



>gb|AAT39967.1| Putative ZF-HD homeobox protein, identical [Solanum demissum]
Length=291

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            YKECLKNHAAS+GGHAVDGCGEFM SP + P+DP SLKCAACGCHRNFHRREP +
Sbjct  53   YKECLKNHAASLGGHAVDGCGEFMLSPESTPSDPISLKCAACGCHRNFHRREPSD  107



>ref|XP_009151829.1| PREDICTED: zinc-finger homeodomain protein 9 [Brassica rapa]
Length=344

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 88/122 (72%), Gaps = 19/122 (16%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP  RI   KP+SFS NG++KRH+       HHH + V YKECLKNHAA+IGGHA+D
Sbjct  17   ESETPT-RIQPAKPISFS-NGIIKRHHH-----IHHHTLTVTYKECLKNHAAAIGGHALD  69

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAA-----------PALE  644
            GCGEFMPSP++ P+DPTSLKCAACGCHRNFHRR+P++   L SA             A+E
Sbjct  70   GCGEFMPSPSSTPSDPTSLKCAACGCHRNFHRRDPDDS-SLASAVPPPSLPPSSTTAAIE  128

Query  645  YQ  650
            YQ
Sbjct  129  YQ  130



>ref|XP_002870762.1| hypothetical protein ARALYDRAFT_494014 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47021.1| hypothetical protein ARALYDRAFT_494014 [Arabidopsis lyrata subsp. 
lyrata]
Length=327

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 85/116 (73%), Gaps = 16/116 (14%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP  RI   KP+SFS NG++KRH+         H ++  YKECLKNHAA++GGHA+D
Sbjct  20   ESETPT-RIQPAKPISFS-NGIIKRHHH--------HPLLFTYKECLKNHAAALGGHALD  69

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE-----PLGLPSAAPALEYQ  650
            GCGEFMPSP++  +DPTSLKCAACGCHRNFHRR+P+      P+  P  + A+EYQ
Sbjct  70   GCGEFMPSPSSISSDPTSLKCAACGCHRNFHRRDPDNNNDSSPIH-PPPSTAVEYQ  124



>ref|XP_010502894.1| PREDICTED: zinc-finger homeodomain protein 9 [Camelina sativa]
Length=321

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 81/97 (84%), Gaps = 7/97 (7%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP  RI   KP+SFS NG++KRH+      HHHH V V YKECLKNHAA+IGGHA+D
Sbjct  18   ESETPT-RIQPAKPISFS-NGIIKRHHH-----HHHHNVTVTYKECLKNHAAAIGGHALD  70

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            GCGEFMPSP++ P+DPTSLKCAACGCHRNFHRR+P++
Sbjct  71   GCGEFMPSPSSTPSDPTSLKCAACGCHRNFHRRDPDD  107



>gb|ACF84413.1| unknown [Zea mays]
 tpg|DAA48949.1| TPA: hypothetical protein ZEAMMB73_913579 [Zea mays]
Length=253

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRR  596
            Y+ECLKNHAAS+GGHA+DGCGEFMPSP A+PADP+SL+CAACGCHRNFHRR
Sbjct  41   YRECLKNHAASLGGHALDGCGEFMPSPEADPADPSSLRCAACGCHRNFHRR  91



>ref|XP_009381426.1| PREDICTED: zinc-finger homeodomain protein 9-like [Musa acuminata 
subsp. malaccensis]
Length=303

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 62/84 (74%), Gaps = 4/84 (5%)
 Frame = +3

Query  354  KPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEFMPSPTAN  533
            K LSF  NG L++H+              +Y+ECLKNHAAS+GGHA+DGCGEFM SP A+
Sbjct  15   KTLSFP-NGTLRKHHQ---RQPATAVEEFLYRECLKNHAASLGGHALDGCGEFMHSPAAD  70

Query  534  PADPTSLKCAACGCHRNFHRREPE  605
            PADP+SL+C ACGCHRNFHRR P+
Sbjct  71   PADPSSLRCVACGCHRNFHRRLPD  94



>ref|XP_004509968.1| PREDICTED: transcription factor HB29-like [Cicer arietinum]
Length=349

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPL  614
            YKECLKNHAA++GGHA+DGCGEFMPS + N  DP SLKCAACGCHRNFHRR+P+E +
Sbjct  55   YKECLKNHAAALGGHALDGCGEFMPSSSVNLNDPRSLKCAACGCHRNFHRRDPQEHI  111



>ref|XP_009111615.1| PREDICTED: zinc-finger homeodomain protein 9-like [Brassica rapa]
Length=309

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 82/119 (69%), Gaps = 20/119 (17%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            E ETP  RI   KP+SFS NG+ KRH+           + V YKECLKNHAA+IGGHA+D
Sbjct  11   EPETPT-RIQPAKPISFS-NGITKRHHH---------PIAVTYKECLKNHAAAIGGHALD  59

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAA--------PALEYQ  650
            GCGEFMPSP++ P+DPTSLKCAACGCHRNFHRR+PE+   L SA           LEYQ
Sbjct  60   GCGEFMPSPSSTPSDPTSLKCAACGCHRNFHRRDPEDS-SLTSAVPPPSLPPSSTLEYQ  117



>ref|NP_001149634.1| ZF-HD homeobox protein [Zea mays]
 gb|ACG36188.1| ZF-HD homeobox protein [Zea mays]
Length=373

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRR  596
            Y+ECLKNHAAS+GGHA+DGCGEFMPSP A+PADP+SL+CAACGCHRNFHRR
Sbjct  41   YRECLKNHAASLGGHALDGCGEFMPSPEADPADPSSLRCAACGCHRNFHRR  91



>emb|CDX85230.1| BnaC07g25410D [Brassica napus]
Length=339

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 7/97 (7%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP  RI   KP+SFS NG++KRH+       HHH V V YKECLKNHAA+IGGHA+D
Sbjct  17   ESETPT-RIQPAKPISFS-NGIIKRHHH-----IHHHTVTVTYKECLKNHAAAIGGHALD  69

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            GCGEFMPSP++ P+DPTSLKCAACGCHRNFHRR+P++
Sbjct  70   GCGEFMPSPSSTPSDPTSLKCAACGCHRNFHRRDPDD  106



>emb|CDY20008.1| BnaA09g02430D [Brassica napus]
Length=281

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 75/97 (77%), Gaps = 11/97 (11%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            E ETP  RI   KP+SFS NG+ KRH+           + V YKECLKNHAA+IGGHA+D
Sbjct  11   EPETPT-RIQPAKPISFS-NGITKRHHH---------PIAVTYKECLKNHAAAIGGHALD  59

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            GCGEFMPSP++ P+DPTSLKCAACGCHRNFHRR+PE+
Sbjct  60   GCGEFMPSPSSTPSDPTSLKCAACGCHRNFHRRDPED  96



>ref|XP_010514609.1| PREDICTED: zinc-finger homeodomain protein 9-like [Camelina sativa]
Length=323

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 6/97 (6%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESET + RI   KP+SFS NG++KRH+     HHHHH V V YKECLKNHAA+IGGHA+D
Sbjct  18   ESET-STRIQPAKPISFS-NGIIKRHHH----HHHHHNVTVTYKECLKNHAAAIGGHALD  71

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            GCGEFMPSP++ P+DPTSLKCAACGCHRNFHRR+PE+
Sbjct  72   GCGEFMPSPSSTPSDPTSLKCAACGCHRNFHRRDPED  108



>ref|NP_001146009.1| ZF-HD homeobox protein [Zea mays]
 gb|ACL53031.1| unknown [Zea mays]
 gb|ACN34801.1| unknown [Zea mays]
 gb|AFU81562.1| ZF-HD-type transcription factor, partial [Zea mays subsp. mays]
 tpg|DAA48950.1| TPA: ZF-HD homeobox protein [Zea mays]
Length=373

 Score =   106 bits (264),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRR  596
            Y+ECLKNHAAS+GGHA+DGCGEFMPSP A+PADP+SL+CAACGCHRNFHRR
Sbjct  41   YRECLKNHAASLGGHALDGCGEFMPSPEADPADPSSLRCAACGCHRNFHRR  91



>ref|XP_009403170.1| PREDICTED: zinc-finger homeodomain protein 9-like [Musa acuminata 
subsp. malaccensis]
Length=321

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEP  611
            Y+ECLKNHAAS+GGHA+DGCGEFM SPTA+PADPTSL+CAACGCHRNFHRR  + P
Sbjct  41   YRECLKNHAASLGGHALDGCGEFMLSPTADPADPTSLRCAACGCHRNFHRRLADPP  96



>ref|XP_002445555.1| hypothetical protein SORBIDRAFT_07g021470 [Sorghum bicolor]
 gb|EES15050.1| hypothetical protein SORBIDRAFT_07g021470 [Sorghum bicolor]
Length=390

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRR  596
            Y+ECLKNHAAS+GGHA+DGCGEFMPSP A+PADP+SL+CAACGCHRNFHRR
Sbjct  34   YRECLKNHAASLGGHALDGCGEFMPSPEADPADPSSLRCAACGCHRNFHRR  84



>ref|XP_009593275.1| PREDICTED: zinc-finger homeodomain protein 10-like [Nicotiana 
tomentosiformis]
Length=223

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            E + P      +KPLSF+ N   K+H+ +H+H     AV   YKECLKNHAASIGG+ VD
Sbjct  21   EKDFPPYPQVPLKPLSFT-NVTSKKHHQVHNHQPPSAAVT--YKECLKNHAASIGGYTVD  77

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPL  614
            GCGEF+P+P A  ADPTSLKC  CGCHRNFHRR+ ++  
Sbjct  78   GCGEFIPTPDAIAADPTSLKCDVCGCHRNFHRRKRDDDF  116



>ref|XP_002522433.1| transcription factor, putative [Ricinus communis]
 gb|EEF39925.1| transcription factor, putative [Ricinus communis]
Length=319

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 74/104 (71%), Gaps = 4/104 (4%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ++ETP  +    K LS ++  ++++H++          +VV YKECLKNHAAS+GG A+D
Sbjct  25   DTETPL-QTHLSKALSLTNGSLIRQHHN---PPEPQQPMVVSYKECLKNHAASLGGVALD  80

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSA  629
            GCGEFMP+P+A  +DPTSLKCAACGCHRNFHRR+   P  LP+ 
Sbjct  81   GCGEFMPTPSATLSDPTSLKCAACGCHRNFHRRDHFPPPTLPAV  124



>ref|XP_006395326.1| hypothetical protein EUTSA_v10004599mg [Eutrema salsugineum]
 gb|ESQ32612.1| hypothetical protein EUTSA_v10004599mg [Eutrema salsugineum]
Length=323

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 81/97 (84%), Gaps = 7/97 (7%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP  RI   KP+SFS NG++KR     HHHHHH  + V YKECLKNHAA+IGGHA+D
Sbjct  11   ESETPT-RIQPAKPISFS-NGIIKR-----HHHHHHPIIAVTYKECLKNHAAAIGGHALD  63

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            GCGEFMPSP++ P+DPTSLKCAACGCHRNFHRR+P++
Sbjct  64   GCGEFMPSPSSTPSDPTSLKCAACGCHRNFHRRDPDD  100



>ref|XP_008780606.1| PREDICTED: zinc-finger homeodomain protein 9-like [Phoenix dactylifera]
Length=298

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 61/85 (72%), Gaps = 5/85 (6%)
 Frame = +3

Query  357  PLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEFMPSPTANP  536
            P+SF  NG LK+H      H         Y+ECL+NHAAS+GGHAVDGC EFMPSP+A+P
Sbjct  26   PISFP-NGTLKKH----LPHPPAEEEHPQYRECLRNHAASLGGHAVDGCCEFMPSPSADP  80

Query  537  ADPTSLKCAACGCHRNFHRREPEEP  611
            A PTSL C ACGCHRNFHRR P +P
Sbjct  81   AVPTSLTCDACGCHRNFHRRLPTDP  105



>emb|CAC34413.1| ZF-HD homeobox protein [Flaveria trinervia]
Length=263

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREP  602
            YK+CLKNHA  IG HAVDGCGEFMP+PT NP+ P+S KCAACGCHRNFHRREP
Sbjct  42   YKQCLKNHAVGIGCHAVDGCGEFMPAPTYNPSQPSSFKCAACGCHRNFHRREP  94



>ref|XP_003572241.1| PREDICTED: zinc-finger homeodomain protein 9-like [Brachypodium 
distachyon]
Length=372

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRR  596
            Y+ECLKNHAAS+GGHAVDGCGEFMPSP A+P++P SLKCAACGCHRNFHRR
Sbjct  46   YRECLKNHAASLGGHAVDGCGEFMPSPAADPSNPGSLKCAACGCHRNFHRR  96



>ref|XP_009410002.1| PREDICTED: zinc-finger homeodomain protein 9 [Musa acuminata 
subsp. malaccensis]
Length=300

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 61/83 (73%), Gaps = 6/83 (7%)
 Frame = +3

Query  354  KPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEFMPSPTAN  533
            K  SF  NG L++H+           V   Y+ECLKNHAAS+GGHA+DGCGEFM SP A+
Sbjct  15   KAFSFP-NGALRKHHQ-----RSPPVVEFSYRECLKNHAASLGGHALDGCGEFMLSPAAD  68

Query  534  PADPTSLKCAACGCHRNFHRREP  602
            PADP+S++CAACGCHRNFHRR P
Sbjct  69   PADPSSIRCAACGCHRNFHRRLP  91



>ref|XP_004959444.1| PREDICTED: uncharacterized protein LOC101763608 [Setaria italica]
Length=303

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+ECLKNH AS+GGHA+DGCGEFMPSP A+PADP SL+CAA GCHRNFHRR PE
Sbjct  15   YRECLKNHGASLGGHALDGCGEFMPSPEADPADPASLRCAAYGCHRNFHRRLPE  68



>ref|XP_008678609.1| PREDICTED: zinc-finger homeodomain protein 10-like [Zea mays]
Length=366

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRR  596
            Y+ECLKNHAAS+GGHA+DGCGEFMPSP A+ ADP+SL+CAACGCHRNFHRR
Sbjct  38   YRECLKNHAASLGGHALDGCGEFMPSPEADRADPSSLRCAACGCHRNFHRR  88



>ref|NP_568570.1| homeobox protein 23 [Arabidopsis thaliana]
 sp|Q9FIW9.1|ZHD10_ARATH RecName: Full=Zinc-finger homeodomain protein 10; Short=AtZHD10; 
AltName: Full=Homeobox protein 23; Short=AtHB-23 [Arabidopsis 
thaliana]
 dbj|BAB11382.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM13855.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51422.1| unknown protein [Arabidopsis thaliana]
 gb|AED94472.1| homeobox protein 23 [Arabidopsis thaliana]
Length=334

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 85/115 (74%), Gaps = 12/115 (10%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP  RI   KP+SFS NG++KR      HHHHHH ++  YKECLKNHAA++GGHA+D
Sbjct  22   ESETPT-RIQPAKPISFS-NGIIKR------HHHHHHPLLFTYKECLKNHAAALGGHALD  73

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAP----ALEYQ  650
            GCGEFMPSP++  +DPTSLKCAACGCHRNFHRR+P+         P    A+EYQ
Sbjct  74   GCGEFMPSPSSISSDPTSLKCAACGCHRNFHRRDPDNNNDSSQIPPPPSTAVEYQ  128



>ref|XP_010926548.1| PREDICTED: zinc-finger homeodomain protein 9-like [Elaeis guineensis]
Length=275

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 60/86 (70%), Gaps = 8/86 (9%)
 Frame = +3

Query  354  KPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEFMPSPTAN  533
            KP SF  NG LK+H                Y+ECL+NHAA++GGHA+DGC EFMPSP+A+
Sbjct  14   KPTSFP-NGTLKKH-------LPPEDENHQYRECLRNHAATLGGHALDGCCEFMPSPSAD  65

Query  534  PADPTSLKCAACGCHRNFHRREPEEP  611
            PA PTSL C ACGCHRNFHRR P +P
Sbjct  66   PAVPTSLTCDACGCHRNFHRRLPPDP  91



>ref|XP_002315053.2| hypothetical protein POPTR_0010s17650g [Populus trichocarpa]
 gb|EEF01224.2| hypothetical protein POPTR_0010s17650g [Populus trichocarpa]
Length=332

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            YKEC KNHAA IGG A+DGCGEFMP  TA P DPTS KCAACGCHRNFHRREP  P  + 
Sbjct  65   YKECHKNHAAGIGGLALDGCGEFMPKSTATPQDPTSFKCAACGCHRNFHRREPSGPTTIT  124

Query  624  SAAP  635
               P
Sbjct  125  HMLP  128



>ref|XP_003517792.1| PREDICTED: transcription factor HB29-like [Glycine max]
Length=296

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 60/88 (68%), Gaps = 4/88 (5%)
 Frame = +3

Query  345  SAVKPLSFSSNGVLKRHN----SLhhhhhhhhavvvvYKECLKNHAASIGGHAVDGCGEF  512
            S   P  F++NG LK H+    +         +  V YKECLKNHAASIGGHA+DGCGEF
Sbjct  14   SQTPPQPFTTNGSLKDHHHHHPTTVSPPQQPPSTAVAYKECLKNHAASIGGHALDGCGEF  73

Query  513  MPSPTANPADPTSLKCAACGCHRNFHRR  596
            MPS  +NP +P SL CAACGCHRNFHRR
Sbjct  74   MPSSFSNPNEPRSLTCAACGCHRNFHRR  101



>ref|XP_006285795.1| hypothetical protein CARUB_v10007269mg [Capsella rubella]
 gb|EOA18693.1| hypothetical protein CARUB_v10007269mg [Capsella rubella]
Length=341

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 79/96 (82%), Gaps = 8/96 (8%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP  RI   KP+SFS NG++KR      HHHHHH ++  YKECLKNHAA++GGHA+D
Sbjct  27   ESETPT-RIQPAKPISFS-NGIIKR------HHHHHHPILFTYKECLKNHAAALGGHALD  78

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            GCGEFMPSP++  +DPTSLKCAACGCHRNFHRR+P+
Sbjct  79   GCGEFMPSPSSISSDPTSLKCAACGCHRNFHRRDPD  114



>gb|AFW62325.1| hypothetical protein ZEAMMB73_977464 [Zea mays]
Length=526

 Score =   104 bits (259),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRR  596
            Y+ECLKNHAAS+GGHA+DGCGEFMPSP A+ ADP+SL+CAACGCHRNFHRR
Sbjct  198  YRECLKNHAASLGGHALDGCGEFMPSPEADRADPSSLRCAACGCHRNFHRR  248



>gb|AAM64462.1| unknown [Arabidopsis thaliana]
Length=333

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 79/96 (82%), Gaps = 8/96 (8%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP  RI   KP+SFS NG++KR      HHHHHH ++  YKECLKNHAA++GGHA+D
Sbjct  21   ESETPT-RIQPAKPISFS-NGIIKR------HHHHHHPLLFTYKECLKNHAAALGGHALD  72

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            GCGEFMPSP++  +DPTSLKCAACGCHRNFHRR+P+
Sbjct  73   GCGEFMPSPSSISSDPTSLKCAACGCHRNFHRRDPD  108



>ref|XP_010441087.1| PREDICTED: zinc-finger homeodomain protein 10 [Camelina sativa]
Length=342

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 77/95 (81%), Gaps = 8/95 (8%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP  RI   KP+SFS NG++KRH+       HHH ++  YKECLKNHAA++GGHA+D
Sbjct  22   ESETPT-RIQPAKPISFS-NGIIKRHHH------HHHPLLFTYKECLKNHAAALGGHALD  73

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREP  602
            GCGEFMPSP++  +DPTSLKCAACGCHRNFHRR+P
Sbjct  74   GCGEFMPSPSSISSDPTSLKCAACGCHRNFHRRDP  108



>ref|XP_011017078.1| PREDICTED: zinc-finger homeodomain protein 11-like [Populus euphratica]
Length=322

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEP  611
            Y+ECLKNHAA  GG A+DGCGEFMP PT  P DPTSLKCAACGCHRNFHR EP  P
Sbjct  59   YRECLKNHAAGFGGLALDGCGEFMPKPTTTPQDPTSLKCAACGCHRNFHRSEPFGP  114



>ref|XP_002312243.2| hypothetical protein POPTR_0008s08560g [Populus trichocarpa]
 gb|EEE89610.2| hypothetical protein POPTR_0008s08560g [Populus trichocarpa]
Length=324

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREP  602
            Y+ECLKNHAA  GG A+DGCGEFMP PT  P DPTSLKCAACGCHRNFHR EP
Sbjct  59   YRECLKNHAAGFGGLALDGCGEFMPKPTTTPQDPTSLKCAACGCHRNFHRSEP  111



>ref|XP_012067639.1| PREDICTED: zinc-finger homeodomain protein 11-like [Jatropha 
curcas]
 gb|KDP41197.1| hypothetical protein JCGZ_15604 [Jatropha curcas]
Length=283

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEP  611
            YKECLKNHAA++GG A+DGCGEFMPSP+A+ +DPTSLKC ACGCHRNFHRR+  +P
Sbjct  50   YKECLKNHAATLGGLALDGCGEFMPSPSASLSDPTSLKCVACGCHRNFHRRDSLQP  105



>ref|XP_007157626.1| hypothetical protein PHAVU_002G085400g [Phaseolus vulgaris]
 gb|ESW29620.1| hypothetical protein PHAVU_002G085400g [Phaseolus vulgaris]
Length=264

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            YKECLKNHAASIGGHA+DGCGEFMPS ++NP +P SL CAACGCHRNFH R+ ++
Sbjct  43   YKECLKNHAASIGGHALDGCGEFMPSSSSNPTEPRSLTCAACGCHRNFHHRDTQQ  97



>ref|XP_011098625.1| PREDICTED: zinc-finger homeodomain protein 9-like [Sesamum indicum]
Length=325

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 109/161 (68%), Gaps = 23/161 (14%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ++ETP  RI   KP  F+ NGVLKRH  LH HH         YKECLKNHAA++GGHA+D
Sbjct  14   DTETPT-RIQPAKPSPFT-NGVLKRHAPLHLHHPVVVT----YKECLKNHAAALGGHALD  67

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQphhrhhppp  677
            GCGEFMPSP +NPA+PTSLKCAA                  P  APALEYQPHHRHHPPP
Sbjct  68   GCGEFMPSPASNPAEPTSLKCAA-----------------WPPQAPALEYQPHHRHHPPP  110

Query  678  pppppphdhsspnspspppisssyypsapQMLLALXTGLSG  800
            PPP      S  NSPSPPPISSSYYPSAP MLLAL  GLSG
Sbjct  111  PPPRGNSGSSPNNSPSPPPISSSYYPSAPHMLLALSHGLSG  151



>ref|XP_003520078.1| PREDICTED: transcription factor HB29-like [Glycine max]
Length=291

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRR  596
            YKECLKNHAASIGGHA+DGCGEFMPS ++NP +P SL CAACGCHRNFHRR
Sbjct  46   YKECLKNHAASIGGHALDGCGEFMPSSSSNPNEPRSLTCAACGCHRNFHRR  96



>ref|XP_011013536.1| PREDICTED: zinc-finger homeodomain protein 11-like [Populus euphratica]
Length=328

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ++ETP  +    K LS + NG  K H + H        +VV YKEC KNHAA IGG A+D
Sbjct  24   DTETPL-QTHLTKALSLT-NGSHKTHQNRHLPPPPQQNMVVSYKECHKNHAAGIGGLALD  81

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAP  635
            GCGEFMP  TA P D  S KCAACGCHRNFHRREP  P  +    P
Sbjct  82   GCGEFMPKSTATPQDAASFKCAACGCHRNFHRREPSGPTTIAHMLP  127



>dbj|BAE99230.1| hypothetical protein [Arabidopsis thaliana]
Length=334

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 84/115 (73%), Gaps = 12/115 (10%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP  RI   KP+SFS NG++KR      HHHHHH ++  YKECLKNHAA++GGHA+D
Sbjct  22   ESETPT-RIQPAKPISFS-NGIIKR------HHHHHHPLLFTYKECLKNHAAALGGHALD  73

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAP----ALEYQ  650
            GCGEFMPSP++  +DPTSLKCAACGCHRNFHR +P+         P    A+EYQ
Sbjct  74   GCGEFMPSPSSISSDPTSLKCAACGCHRNFHRLDPDNNNDSSQIPPPPSTAVEYQ  128



>ref|XP_010551857.1| PREDICTED: zinc-finger homeodomain protein 8-like [Tarenaya hassleriana]
Length=278

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 71/111 (64%), Gaps = 15/111 (14%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            E E P  RI   KP+SFS NG  KRH+  H          V Y+EC KNHAA IGGHA+D
Sbjct  25   ELEAPT-RILPAKPISFS-NG--KRHH--HPPAASPAVGAVTYRECQKNHAAGIGGHALD  78

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAAPALEYQ  650
            GCGEFMPS +++P  P SL CAACGCHRNFHRR         S++ ALE++
Sbjct  79   GCGEFMPSSSSDPTVPISLTCAACGCHRNFHRR---------SSSSALEFR  120



>emb|CDY00104.1| BnaC09g01970D [Brassica napus]
Length=312

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 84/119 (71%), Gaps = 17/119 (14%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            E E P  RI   KP+SF  NG+ KR      HHHHHH + V YKECLKNHAA+IGGHA+D
Sbjct  11   EPENPT-RIQPAKPISFG-NGITKR------HHHHHHPIAVTYKECLKNHAAAIGGHALD  62

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLPSAA--------PALEYQ  650
            GCGEFMPSP++ P+DPTSLKCAACGCHRNFHRR+PE+   L SA           LEYQ
Sbjct  63   GCGEFMPSPSSTPSDPTSLKCAACGCHRNFHRRDPEDS-SLTSAVPPPSLPPSSTLEYQ  120



>ref|XP_010450775.1| PREDICTED: zinc-finger homeodomain protein 10-like [Camelina 
sativa]
Length=334

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 76/93 (82%), Gaps = 8/93 (9%)
 Frame = +3

Query  318  ESETPAARISAVKPLSFSSNGVLKRHNSLhhhhhhhhavvvvYKECLKNHAASIGGHAVD  497
            ESETP  RI   KP+SFS NG++KR      HHHHHH ++  YKECLKNHAA++GGHA+D
Sbjct  24   ESETPT-RIQPAKPISFS-NGIIKR------HHHHHHPLLFTYKECLKNHAAALGGHALD  75

Query  498  GCGEFMPSPTANPADPTSLKCAACGCHRNFHRR  596
            GCGEFMPSP++  +DPTSLKCAACGCHRNFHRR
Sbjct  76   GCGEFMPSPSSISSDPTSLKCAACGCHRNFHRR  108



>ref|XP_003576527.1| PREDICTED: zinc-finger homeodomain protein 9-like [Brachypodium 
distachyon]
Length=352

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRR  596
            Y++CL+NHAA++G HAVDGC EF+P+P  NPADP SLKCAACGCHRNFHRR
Sbjct  40   YQDCLRNHAANLGAHAVDGCREFLPTPENNPADPWSLKCAACGCHRNFHRR  90



>ref|XP_004972095.1| PREDICTED: transcription factor HB29-like [Setaria italica]
Length=215

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRR  596
            Y ECLKNHAAS+ GHA+DG GEFMPSP A PADP SL+CAACGCHRNFH R
Sbjct  19   YWECLKNHAASLDGHALDGYGEFMPSPEAGPADPASLQCAACGCHRNFHYR  69



>ref|NP_200856.1| homeobox protein 26 [Arabidopsis thaliana]
 gb|AED97335.1| homeobox protein 26 [Arabidopsis thaliana]
Length=191

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y ECLKNHA S+GGHA+DGCGEF P  T    DP SL+C ACGCHRNFHRR P +     
Sbjct  5    YNECLKNHAVSLGGHALDGCGEFTPKSTTILTDPPSLRCDACGCHRNFHRRSPSDGFSQH  64

Query  624  SAAPA  638
             + P+
Sbjct  65   RSPPS  69



>sp|Q9FKJ9.1|ZHD12_ARATH RecName: Full=Zinc-finger homeodomain protein 12; Short=AtZHD12; 
AltName: Full=Homeobox protein 26; Short=AtHB-26 [Arabidopsis 
thaliana]
 dbj|BAB08231.1| unnamed protein product [Arabidopsis thaliana]
Length=223

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y ECLKNHA S+GGHA+DGCGEF P  T    DP SL+C ACGCHRNFHRR P +     
Sbjct  37   YNECLKNHAVSLGGHALDGCGEFTPKSTTILTDPPSLRCDACGCHRNFHRRSPSDGFSQH  96

Query  624  SAAPA  638
             + P+
Sbjct  97   RSPPS  101



>ref|XP_010665240.1| PREDICTED: zinc-finger homeodomain protein 2-like [Vitis vinifera]
 ref|XP_010665241.1| PREDICTED: zinc-finger homeodomain protein 2-like [Vitis vinifera]
Length=272

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRRE  599
            Y+EC++NHAASIGGHA DGCGEFMPS      D  SL CAACGCHRNFHRRE
Sbjct  43   YRECMRNHAASIGGHASDGCGEFMPSGGGGGGDAASLTCAACGCHRNFHRRE  94



>emb|CBI18514.3| unnamed protein product [Vitis vinifera]
Length=266

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRRE  599
            Y+EC++NHAASIGGHA DGCGEFMPS      D  SL CAACGCHRNFHRRE
Sbjct  67   YRECMRNHAASIGGHASDGCGEFMPSGGGGGGDAASLTCAACGCHRNFHRRE  118



>emb|CAN64849.1| hypothetical protein VITISV_004128 [Vitis vinifera]
Length=243

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRRE  599
            Y+EC++NHAASIGGHA DGCGEFMPS      D  SL CAACGCHRNFHRRE
Sbjct  14   YRECMRNHAASIGGHASDGCGEFMPSGGGGGGDAASLTCAACGCHRNFHRRE  65



>gb|EYU40171.1| hypothetical protein MIMGU_mgv1a008153mg [Erythranthe guttata]
Length=383

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 2/57 (4%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPL  614
            Y+ECLKNHAAS+GGH VDGCGEFMPS   + A P SL+CAAC CHRNFHR+E E  L
Sbjct  160  YRECLKNHAASMGGHVVDGCGEFMPS--GDDASPESLRCAACNCHRNFHRKEAEGQL  214



>gb|AHC04641.1| zinc-finger homeodomain 1 [Triticum aestivum]
Length=387

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHR  593
            YKECLKNHAA+IG HAVDGCGE+MP    N ADP S KCAACGCHRNFHR
Sbjct  42   YKECLKNHAAAIGAHAVDGCGEWMPVVELNTADPASYKCAACGCHRNFHR  91



>emb|CDY01760.1| BnaC06g28000D [Brassica napus]
Length=256

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 59/69 (86%), Gaps = 4/69 (6%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGL-  620
            YKECLKNHAA++GGHA+DGCGEFMP+PTA P DP+SL+CAACGCHRNFHRR+P + L   
Sbjct  30   YKECLKNHAANLGGHALDGCGEFMPTPTATPTDPSSLRCAACGCHRNFHRRDPSDHLNFL  89

Query  621  ---PSAAPA  638
               P+++P+
Sbjct  90   PSHPTSSPS  98



>ref|XP_009411228.1| PREDICTED: zinc-finger homeodomain protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=376

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLG  617
            YKECL+NHAA++GGH VDGCGEFMPS   +P  P +LKCAACGCHR+FHRRE +   G
Sbjct  148  YKECLRNHAAALGGHVVDGCGEFMPS--GDPDTPEALKCAACGCHRSFHRRETDGSAG  203



>dbj|BAK05545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=402

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHR  593
            YKECLKNHAA+IG HAVDGCGE+MP    N ADP S KCAACGCHRNFHR
Sbjct  56   YKECLKNHAAAIGAHAVDGCGEWMPVVELNTADPASYKCAACGCHRNFHR  105



>emb|CDX95914.1| BnaA07g28170D [Brassica napus]
Length=231

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 59/69 (86%), Gaps = 4/69 (6%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGL-  620
            YKECLKNHAA++GGHA+DGCGEFMP+PTA P DP+SL+CAACGCHRNFHRR+P + L   
Sbjct  5    YKECLKNHAANLGGHALDGCGEFMPTPTATPTDPSSLRCAACGCHRNFHRRDPSDHLNFL  64

Query  621  ---PSAAPA  638
               P+++P+
Sbjct  65   PSHPTSSPS  73



>ref|XP_009394611.1| PREDICTED: zinc-finger homeodomain protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=333

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 46/54 (85%), Gaps = 2/54 (4%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            YKECL+NHAA++GGH VDGCGEFMP+   +P  P +LKCAACGCHR+FHRRE E
Sbjct  128  YKECLRNHAAALGGHVVDGCGEFMPN--GDPDTPEALKCAACGCHRSFHRRETE  179



>emb|CAC34409.1| ZF-HD homeobox protein [Flaveria bidentis]
Length=339

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 1/70 (1%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPL-GL  620
            Y+ECLKNHAA++GGHAVDGCGEFMPSP+++P DPTSLKCAACGCHRNFHRR+P+ P    
Sbjct  69   YRECLKNHAAAMGGHAVDGCGEFMPSPSSSPTDPTSLKCAACGCHRNFHRRDPDGPFPAN  128

Query  621  PSAAPALEYQ  650
            P     +EY+
Sbjct  129  PPVQHVIEYK  138



>ref|XP_009131913.1| PREDICTED: zinc-finger homeodomain protein 12 [Brassica rapa]
Length=182

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREP  602
            Y ECLKN A S GG+A+DGCGEFMP  T    DP SL C ACGCHRNFHRR+P
Sbjct  5    YNECLKNQAVSFGGYALDGCGEFMPKSTTILTDPPSLSCDACGCHRNFHRRDP  57



>ref|XP_010483696.1| PREDICTED: zinc-finger homeodomain protein 12-like [Camelina 
sativa]
Length=202

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            Y ECLKNHA S+GGHA+DGCGEF+P  T    D  SL C ACGCHRNFHRR P +
Sbjct  23   YNECLKNHAVSLGGHALDGCGEFIPKSTTILTDTPSLTCGACGCHRNFHRRSPSD  77



>emb|CDX88760.1| BnaA03g08890D [Brassica napus]
Length=181

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREP  602
            Y ECLKN A S GG+A+DGCGEFMP  T    DP SL C ACGCHRNFHRR+P
Sbjct  5    YNECLKNQAVSFGGYALDGCGEFMPKSTTILTDPPSLSCDACGCHRNFHRRDP  57



>emb|CDY69628.1| BnaAnng31040D [Brassica napus]
Length=179

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREP  602
            Y ECLKN A S GG+A+DGCGEFMP  T    DP SL C ACGCHRNFHRR+P
Sbjct  5    YNECLKNQAVSFGGYALDGCGEFMPKSTTILTDPPSLSCDACGCHRNFHRRDP  57



>ref|XP_006827241.1| PREDICTED: zinc-finger homeodomain protein 2 [Amborella trichopoda]
 gb|ERM94478.1| hypothetical protein AMTR_s00010p00261450 [Amborella trichopoda]
Length=232

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 44/57 (77%), Gaps = 3/57 (5%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMP---SPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+ECLKNHAAS+GGHA+DGCGEFMP      A    P  LKCAACGCHRNFHRRE E
Sbjct  32   YRECLKNHAASLGGHALDGCGEFMPISGEILATGISPEDLKCAACGCHRNFHRREIE  88



>ref|NP_001062055.1| Os08g0479400 [Oryza sativa Japonica Group]
 sp|Q6ZB90.1|ZHD2_ORYSJ RecName: Full=Zinc-finger homeodomain protein 2; Short=OsZHD2 
[Oryza sativa Japonica Group]
 sp|A2YWA6.1|ZHD2_ORYSI RecName: Full=Zinc-finger homeodomain protein 2 [Oryza sativa 
Indica Group]
 dbj|BAD09750.1| putative ZF-HD homeobox protein [Oryza sativa Japonica Group]
 dbj|BAF23969.1| Os08g0479400 [Oryza sativa Japonica Group]
 gb|EAZ07367.1| hypothetical protein OsI_29618 [Oryza sativa Indica Group]
 dbj|BAG98791.1| unnamed protein product [Oryza sativa Japonica Group]
Length=290

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 48/65 (74%), Gaps = 2/65 (3%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y+ECLKNHA  IGGHAVDGCGEFM S      D  +L+CAACGCHRNFHR+E E P G+ 
Sbjct  63   YRECLKNHAVGIGGHAVDGCGEFMASGEEGSID--ALRCAACGCHRNFHRKESESPTGVG  120

Query  624  SAAPA  638
             A P+
Sbjct  121  PAEPS  125



>ref|XP_006282138.1| hypothetical protein CARUB_v10028391mg [Capsella rubella]
 gb|EOA15036.1| hypothetical protein CARUB_v10028391mg [Capsella rubella]
Length=176

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            Y ECLKNHA S+GGHA+DGCGEF+P  T    +P SL+C ACGCHRNFHRR   E
Sbjct  5    YNECLKNHAVSLGGHALDGCGEFIPKSTTILTEPPSLRCDACGCHRNFHRRSSSE  59



>ref|XP_002977930.1| hypothetical protein SELMODRAFT_38997, partial [Selaginella moellendorffii]
 ref|XP_002986957.1| hypothetical protein SELMODRAFT_28982, partial [Selaginella moellendorffii]
 gb|EFJ12039.1| hypothetical protein SELMODRAFT_28982, partial [Selaginella moellendorffii]
 gb|EFJ21268.1| hypothetical protein SELMODRAFT_38997, partial [Selaginella moellendorffii]
Length=72

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 4/54 (7%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+ECLKNHAA IGGHA+DGCGEFMP    N  D +S++C AC CHRNFHRRE E
Sbjct  5    YRECLKNHAAGIGGHALDGCGEFMP----NKEDESSMRCGACDCHRNFHRREVE  54



>ref|XP_003622365.1| Zinc finger-homeodomain protein [Medicago truncatula]
 gb|AFK37422.1| unknown [Medicago truncatula]
 gb|KEH42846.1| homeobox domain, ZF-HD class protein [Medicago truncatula]
Length=191

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            YKECLKNHAA+IGG+A+DGCGEFMPS   +  +  +LKC AC CHRNFHR+E E     P
Sbjct  9    YKECLKNHAATIGGNAIDGCGEFMPSGENDTLE--ALKCCACNCHRNFHRKEIESDFNSP  66

Query  624  SAAPA  638
            S   A
Sbjct  67   SQHYA  71



>ref|XP_009127747.1| PREDICTED: zinc-finger homeodomain protein 11-like [Brassica 
rapa]
Length=255

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 59/69 (86%), Gaps = 4/69 (6%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGL-  620
            YKECLKNHAA++GGHA+DGCGEFMP+PTA P DP+SL+CAACGCHRNFHRR+P + L   
Sbjct  30   YKECLKNHAANLGGHALDGCGEFMPTPTATPTDPSSLRCAACGCHRNFHRRDPCDHLNFL  89

Query  621  ---PSAAPA  638
               P+++P+
Sbjct  90   PVHPTSSPS  98



>ref|XP_007047820.1| ZF-HD homeobox protein, putative [Theobroma cacao]
 gb|EOX91977.1| ZF-HD homeobox protein, putative [Theobroma cacao]
Length=259

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y+ECLKNHA  IGGHAVDGCGEFM +      D  +LKCAAC CHRNFHR+EPE  LG P
Sbjct  55   YRECLKNHAVGIGGHAVDGCGEFMAAGAEGTLD--ALKCAACNCHRNFHRKEPE--LGSP  110

Query  624  SAAPALE  644
            ++ P  +
Sbjct  111  NSVPTTD  117



>gb|ADE76551.1| unknown [Picea sitchensis]
Length=283

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y+ECLKNHAASIGGHA DGCGEFMPS   +     +LKCAACGCHRNFHRR+     G P
Sbjct  79   YRECLKNHAASIGGHANDGCGEFMPS--GDEGTLEALKCAACGCHRNFHRRDTNNGGGDP  136

Query  624  SAA  632
            SA+
Sbjct  137  SAS  139



>ref|XP_012075796.1| PREDICTED: zinc-finger homeodomain protein 2-like [Jatropha curcas]
Length=257

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 43/54 (80%), Gaps = 3/54 (6%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            YKEC++NHAASIGGHA DGCGEFMP      AD  SL CAACGCHRNFHRRE E
Sbjct  39   YKECMRNHAASIGGHANDGCGEFMPR---GAADDGSLTCAACGCHRNFHRRETE  89



>gb|EEE68874.1| hypothetical protein OsJ_27685 [Oryza sativa Japonica Group]
Length=267

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 48/65 (74%), Gaps = 2/65 (3%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y+ECLKNHA  IGGHAVDGCGEFM S      D  +L+CAACGCHRNFHR+E E P G+ 
Sbjct  63   YRECLKNHAVGIGGHAVDGCGEFMASGEEGSID--ALRCAACGCHRNFHRKESESPTGVG  120

Query  624  SAAPA  638
             A P+
Sbjct  121  PAEPS  125



>gb|KJB48886.1| hypothetical protein B456_008G092000 [Gossypium raimondii]
Length=231

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 46/64 (72%), Gaps = 4/64 (6%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRR--EPEEPLG  617
            Y+ECLKNHA  IGGHAVDGCGEFMP+ T    D  +LKCAAC CHRNFHR+  EP  P  
Sbjct  50   YRECLKNHAVGIGGHAVDGCGEFMPAGTEGTLD--ALKCAACNCHRNFHRKETEPNSPNT  107

Query  618  LPSA  629
             PS 
Sbjct  108  FPST  111



>ref|XP_009804697.1| PREDICTED: zinc-finger homeodomain protein 6 [Nicotiana sylvestris]
Length=311

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 44/57 (77%), Gaps = 2/57 (4%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPL  614
            YKECLKNHAAS+GGH +DGCGEFMPS       P  LKCAAC CHRNFHR+E E+ L
Sbjct  105  YKECLKNHAASMGGHVLDGCGEFMPS--GEEGTPEYLKCAACDCHRNFHRKETEDEL  159



>ref|XP_010530124.1| PREDICTED: zinc-finger homeodomain protein 2 [Tarenaya hassleriana]
Length=225

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+ECLKNHA SIGGHAVDGCGEFMPS      +  SLKCAACGCHRNFHR+E +
Sbjct  48   YRECLKNHAVSIGGHAVDGCGEFMPSGEEGTLE--SLKCAACGCHRNFHRKETD  99



>ref|XP_002534484.1| transcription factor, putative [Ricinus communis]
 gb|EEF27897.1| transcription factor, putative [Ricinus communis]
Length=245

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 42/52 (81%), Gaps = 5/52 (10%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRRE  599
            YKEC+KNHAASIGGHA DGCGEFMP      AD  +L CAACGCHRNFHRRE
Sbjct  37   YKECMKNHAASIGGHANDGCGEFMPC-----ADDNNLTCAACGCHRNFHRRE  83



>ref|XP_010254805.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
 ref|XP_010254806.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
 ref|XP_010254807.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
Length=363

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+ECLKNHAASIGGH VDGCGEFMPS       P +LKCAAC CHRNFHR+E E
Sbjct  145  YRECLKNHAASIGGHVVDGCGEFMPS--GEEGTPEALKCAACDCHRNFHRKEME  196



>emb|CDY11964.1| BnaC03g13900D [Brassica napus]
Length=133

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +3

Query  456  LKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            L+N AA+IGGHA+D C EFMPSPT   +DPTSLKCAACGCH NF+RR+P++
Sbjct  54   LQNRAAAIGGHALDVCSEFMPSPTFTSSDPTSLKCAACGCHHNFNRRDPDD  104



>ref|NP_001061894.2| Os08g0438400 [Oryza sativa Japonica Group]
 sp|Q6Z528.1|ZHD10_ORYSJ RecName: Full=Zinc-finger homeodomain protein 10; Short=OsZHD10 
[Oryza sativa Japonica Group]
 dbj|BAD09869.1| putative ZF-HD homeobox protein [Oryza sativa Japonica Group]
 dbj|BAD10155.1| putative ZF-HD homeobox protein [Oryza sativa Japonica Group]
 dbj|BAF23808.2| Os08g0438400 [Oryza sativa Japonica Group]
Length=359

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+ECLKNHAAS+GGHAVDGCGEFMPSP A+ ADP SLKCAACGCHRNFHRR PE
Sbjct  39   YRECLKNHAASLGGHAVDGCGEFMPSPAADAADPASLKCAACGCHRNFHRRLPE  92



>ref|XP_002306048.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE86559.1| zinc finger family protein [Populus trichocarpa]
Length=130

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y ECLKNHAAS+GG+AVDGC EFM S     AD  +L CAACGCHRNFHRRE E  +   
Sbjct  64   YGECLKNHAASVGGYAVDGCREFMASGEEGTAD--ALTCAACGCHRNFHRREVETEVICD  121

Query  624  SAAPA  638
             ++P+
Sbjct  122  CSSPS  126



>ref|XP_010104483.1| hypothetical protein L484_025452 [Morus notabilis]
 gb|EXC01084.1| hypothetical protein L484_025452 [Morus notabilis]
Length=302

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 46/55 (84%), Gaps = 3/55 (5%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPT-ANPAD--PTSLKCAACGCHRNFHRRE  599
            YKEC++NHAASIGGHA DGCGEFMPS   A  +D  P+SL CAACGCHRNFHRRE
Sbjct  58   YKECMRNHAASIGGHANDGCGEFMPSSAEAEKSDMSPSSLTCAACGCHRNFHRRE  112



>gb|KJB44094.1| hypothetical protein B456_007G233800 [Gossypium raimondii]
Length=254

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y+ECLKNHA  IGGHAVDGCGEFMP+      D  +LKCAAC CHRNFHR+E E  LG P
Sbjct  54   YRECLKNHAVGIGGHAVDGCGEFMPAGIEGTLD--ALKCAACNCHRNFHRKETE--LGSP  109

Query  624  SAAPALE  644
             + P  +
Sbjct  110  HSVPMTD  116



>gb|KJB44095.1| hypothetical protein B456_007G233800 [Gossypium raimondii]
Length=238

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y+ECLKNHA  IGGHAVDGCGEFMP+      D  +LKCAAC CHRNFHR+E E  LG P
Sbjct  54   YRECLKNHAVGIGGHAVDGCGEFMPAGIEGTLD--ALKCAACNCHRNFHRKETE--LGSP  109

Query  624  SAAPALE  644
             + P  +
Sbjct  110  HSVPMTD  116



>gb|KJB18248.1| hypothetical protein B456_003G042700 [Gossypium raimondii]
Length=248

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 4/62 (6%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y+ECLKNHA  IGGHA+DGCGEFMP+ T    D  +LKCAAC CHRNFHR+E E  LG P
Sbjct  51   YRECLKNHAVGIGGHALDGCGEFMPAGTEGTLD--ALKCAACNCHRNFHRKESE--LGSP  106

Query  624  SA  629
            ++
Sbjct  107  NS  108



>gb|KHG22175.1| hypothetical protein F383_07505 [Gossypium arboreum]
Length=251

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 4/63 (6%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y+ECLKNHA  IGGHA+DGCGEFMP+ T    D  +LKCAAC CHRNFHR+E E  LG P
Sbjct  54   YRECLKNHAVGIGGHALDGCGEFMPAGTEGTLD--ALKCAACNCHRNFHRKESE--LGSP  109

Query  624  SAA  632
            ++ 
Sbjct  110  NSV  112



>ref|XP_009603276.1| PREDICTED: zinc-finger homeodomain protein 6-like [Nicotiana 
tomentosiformis]
Length=311

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 43/55 (78%), Gaps = 2/55 (4%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            YKECLKNHAAS+GGH +DGCGEFMPS       P  LKCAAC CHRNFHR+E E+
Sbjct  105  YKECLKNHAASMGGHVLDGCGEFMPS--GEEGTPEYLKCAACDCHRNFHRKETED  157



>gb|EEC83631.1| hypothetical protein OsI_29362 [Oryza sativa Indica Group]
Length=362

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+ECLKNHAAS+GGHAVDGCGEFMPSP A+ ADP SLKCAACGCHRNFHRR PE
Sbjct  39   YRECLKNHAASLGGHAVDGCGEFMPSPAADAADPASLKCAACGCHRNFHRRLPE  92



>ref|XP_010456467.1| PREDICTED: zinc-finger homeodomain protein 12-like isoform X1 
[Camelina sativa]
 ref|XP_010456474.1| PREDICTED: zinc-finger homeodomain protein 12-like isoform X2 
[Camelina sativa]
Length=186

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            Y ECLKNHA S+GGHA+DGCGEF+   T    D  SL+C ACGCHRNFHRR P +
Sbjct  5    YNECLKNHAVSLGGHALDGCGEFIRKSTTILTDTPSLRCDACGCHRNFHRRSPSD  59



>ref|XP_006599376.1| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform X2 [Glycine 
max]
 ref|XP_003548885.2| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform X1 [Glycine 
max]
Length=329

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y+ECLKNHAAS+GGH  DGCGEFMP+       P S KCAAC CHRNFHR+EP + + L 
Sbjct  111  YRECLKNHAASMGGHVTDGCGEFMPN--GEEGTPESFKCAACECHRNFHRKEPHQGVVLE  168

Query  624  S  626
            S
Sbjct  169  S  169



>gb|KHN11103.1| ZF-HD homeobox protein [Glycine soja]
Length=317

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y+ECLKNHAAS+GGH  DGCGEFMP+       P S KCAAC CHRNFHR+EP + + L 
Sbjct  111  YRECLKNHAASMGGHVTDGCGEFMPN--GEEGTPESFKCAACECHRNFHRKEPHQGVVLE  168

Query  624  S  626
            S
Sbjct  169  S  169



>ref|XP_002965557.1| hypothetical protein SELMODRAFT_68508, partial [Selaginella moellendorffii]
 ref|XP_002983043.1| hypothetical protein SELMODRAFT_48444, partial [Selaginella moellendorffii]
 gb|EFJ15852.1| hypothetical protein SELMODRAFT_48444, partial [Selaginella moellendorffii]
 gb|EFJ32977.1| hypothetical protein SELMODRAFT_68508, partial [Selaginella moellendorffii]
Length=184

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+ECLKNHAA IGGHA+DGCGEFMPS      +  SLKC+AC CHRNFHRRE E
Sbjct  3    YRECLKNHAAGIGGHALDGCGEFMPSGEEGTIE--SLKCSACDCHRNFHRREVE  54



>ref|XP_009407034.1| PREDICTED: zinc-finger homeodomain protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=296

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 2/51 (4%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRR  596
            Y+ECL+NHAASIGGH +DGCGEFMP    +P+ P +LKCAACGCHR+FHR+
Sbjct  71   YRECLRNHAASIGGHVLDGCGEFMPE--GDPSSPEALKCAACGCHRSFHRK  119



>ref|XP_008800713.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
 ref|XP_008800714.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
 ref|XP_008800715.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
Length=330

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 52/69 (75%), Gaps = 5/69 (7%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y+ECL+NHAA+IGGH VDGCGEFMPS   +   P +LKCAACGCHR+FHRRE +   G P
Sbjct  111  YRECLRNHAAAIGGHVVDGCGEFMPS--GDVGTPDALKCAACGCHRSFHRREVD---GDP  165

Query  624  SAAPALEYQ  650
            +A  +  Y+
Sbjct  166  NAGSSSYYR  174



>ref|XP_006660219.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Oryza brachyantha]
Length=290

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 48/65 (74%), Gaps = 2/65 (3%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y+ECLKNHA  IGGHAVDGCGEFM +      D  +L+CAACGCHRNFHR+E + P G+ 
Sbjct  66   YRECLKNHAVGIGGHAVDGCGEFMAAGEEGSID--ALRCAACGCHRNFHRKESDSPTGVG  123

Query  624  SAAPA  638
             A P+
Sbjct  124  PAEPS  128



>gb|KJB18247.1| hypothetical protein B456_003G042700 [Gossypium raimondii]
Length=270

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 4/62 (6%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y+ECLKNHA  IGGHA+DGCGEFMP+ T    D  +LKCAAC CHRNFHR+E E  LG P
Sbjct  85   YRECLKNHAVGIGGHALDGCGEFMPAGTEGTLD--ALKCAACNCHRNFHRKESE--LGSP  140

Query  624  SA  629
            ++
Sbjct  141  NS  142



>ref|XP_009619186.1| PREDICTED: zinc-finger homeodomain protein 2-like [Nicotiana 
tomentosiformis]
Length=241

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 44/57 (77%), Gaps = 2/57 (4%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPL  614
            YKECLKNHA SIGGHAVDGCGEFMP+      D  SLKCAAC CHRNFHR+  + PL
Sbjct  58   YKECLKNHAVSIGGHAVDGCGEFMPAGEDGSLD--SLKCAACNCHRNFHRKITQPPL  112



>gb|KHN00536.1| ZF-HD homeobox protein [Glycine soja]
Length=333

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 43/55 (78%), Gaps = 2/55 (4%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            Y+ECLKNHAAS+GGH  DGCGEFMP+       P SLKCAAC CHRNFHR+EP +
Sbjct  115  YRECLKNHAASMGGHVTDGCGEFMPN--GEEGTPESLKCAACECHRNFHRKEPHQ  167



>ref|XP_007156052.1| hypothetical protein PHAVU_003G254200g [Phaseolus vulgaris]
 gb|ESW28046.1| hypothetical protein PHAVU_003G254200g [Phaseolus vulgaris]
Length=321

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+ECLKNHAA +GGH  DGCGEFMPS       P S KCAAC CHRNFHR+EPE
Sbjct  115  YRECLKNHAAIMGGHVTDGCGEFMPS--GEEGTPESFKCAACECHRNFHRKEPE  166



>gb|ADE77597.1| unknown [Picea sitchensis]
Length=249

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+EC+KNHAASIGGHA+DGCGEFMPS   +     +LKCAAC CHRNFHRRE E
Sbjct  56   YRECMKNHAASIGGHAIDGCGEFMPS--GDEGTLEALKCAACNCHRNFHRREVE  107



>ref|XP_003520309.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=334

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 43/55 (78%), Gaps = 2/55 (4%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEE  608
            Y+ECLKNHAAS+GGH  DGCGEFMP+       P SLKCAAC CHRNFHR+EP +
Sbjct  116  YRECLKNHAASMGGHVTDGCGEFMPN--GEEGTPESLKCAACECHRNFHRKEPHQ  168



>ref|XP_010263641.1| PREDICTED: zinc-finger homeodomain protein 5 [Nelumbo nucifera]
Length=356

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+ECLKNHAASIGGH VDGCGEFMPS       P +LKCAAC CHRNFHR++ E
Sbjct  137  YRECLKNHAASIGGHVVDGCGEFMPS--GEEGTPEALKCAACDCHRNFHRKDME  188



>ref|XP_004973708.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Setaria italica]
Length=298

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 48/65 (74%), Gaps = 4/65 (6%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y+ECLKNHA  IGGHAVDGCGEFM +      D  +L+CAACGCHRNFHR+E + P G  
Sbjct  78   YRECLKNHAVGIGGHAVDGCGEFMAAGEEGSID--ALRCAACGCHRNFHRKESDSPTG--  133

Query  624  SAAPA  638
             AAPA
Sbjct  134  GAAPA  138



>ref|XP_009415270.1| PREDICTED: zinc-finger homeodomain protein 6-like [Musa acuminata 
subsp. malaccensis]
Length=356

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            YKECL+NHAA IGGH +DGCGEFMP     P+ P  LKCAACGCHR+FHR+E +
Sbjct  140  YKECLRNHAAGIGGHVLDGCGEFMPE--GEPSTPGGLKCAACGCHRSFHRKETD  191



>ref|XP_009769508.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X1 
[Nicotiana sylvestris]
Length=242

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            YKECLKNHA SIGGHAVDGCGEFMP+      D  SLKCAAC CHRNFHR+  + P    
Sbjct  57   YKECLKNHAVSIGGHAVDGCGEFMPAGEDGSLD--SLKCAACNCHRNFHRKITQPPPNAV  114

Query  624  SAAPALEY  647
               P + Y
Sbjct  115  EPLPFVNY  122



>ref|XP_002981262.1| hypothetical protein SELMODRAFT_38995, partial [Selaginella moellendorffii]
 gb|EFJ17963.1| hypothetical protein SELMODRAFT_38995, partial [Selaginella moellendorffii]
Length=64

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 46/58 (79%), Gaps = 3/58 (5%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE-EPL  614
            Y+ECLKNHAASIGGH++DGCGEFMP       +  +LKCAAC CHRNFH+RE E EPL
Sbjct  6    YRECLKNHAASIGGHSLDGCGEFMPCGEEGTME--ALKCAACDCHRNFHKREVEGEPL  61



>ref|XP_009769511.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X2 
[Nicotiana sylvestris]
Length=241

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            YKECLKNHA SIGGHAVDGCGEFMP+      D  SLKCAAC CHRNFHR+  + P    
Sbjct  57   YKECLKNHAVSIGGHAVDGCGEFMPAGEDGSLD--SLKCAACNCHRNFHRKITQPPPNAV  114

Query  624  SAAPALEY  647
               P + Y
Sbjct  115  EPLPFVNY  122



>ref|XP_010438997.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X2 
[Camelina sativa]
Length=239

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y+ECLKNHA +IGGHAVDGC EFMPS      D  +LKCAACGCHRNFHR+E E   G  
Sbjct  50   YRECLKNHAVNIGGHAVDGCCEFMPSGEDGTLD--ALKCAACGCHRNFHRKETEIIGGRA  107

Query  624  SAAPAL  641
            +  P  
Sbjct  108  NRVPTY  113



>ref|XP_009782865.1| PREDICTED: mini zinc finger protein 2 [Nicotiana sylvestris]
Length=102

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y+EC KNHAAS+GG+AVDGC EFMP        P +L CAACGCHRNFHRRE E  +   
Sbjct  40   YRECQKNHAASVGGYAVDGCREFMPCD--EEGTPGALTCAACGCHRNFHRREVETEVACD  97

Query  624  SAAPA  638
             + P 
Sbjct  98   CSFPT  102



>ref|XP_004233925.1| PREDICTED: mini zinc finger protein 2-like [Solanum lycopersicum]
Length=102

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 41/58 (71%), Gaps = 2/58 (3%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLG  617
            YKEC KNHAA +GGHAVDGC EFMPS        ++  CAACGCHRNFHRRE E  + 
Sbjct  32   YKECQKNHAARVGGHAVDGCREFMPS--GEEGTSSAFICAACGCHRNFHRREVETEVA  87



>ref|XP_010438998.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X3 
[Camelina sativa]
Length=225

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y+ECLKNHA +IGGHAVDGC EFMPS      D  +LKCAACGCHRNFHR+E E   G  
Sbjct  50   YRECLKNHAVNIGGHAVDGCCEFMPSGEDGTLD--ALKCAACGCHRNFHRKETEIIGGRA  107

Query  624  SAAPAL  641
            +  P  
Sbjct  108  NRVPTY  113



>ref|XP_009596464.1| PREDICTED: mini zinc finger protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009596465.1| PREDICTED: mini zinc finger protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009596466.1| PREDICTED: mini zinc finger protein 2-like [Nicotiana tomentosiformis]
Length=92

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 43/65 (66%), Gaps = 2/65 (3%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y+EC KNHAAS+GG+AVDGC EFMP        P  L CAACGCHRNFHRRE E  +   
Sbjct  30   YRECQKNHAASVGGYAVDGCREFMPC--GEEGTPGGLTCAACGCHRNFHRREVETEVACD  87

Query  624  SAAPA  638
             + P 
Sbjct  88   CSFPT  92



>ref|XP_010681042.1| PREDICTED: zinc-finger homeodomain protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=284

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 2/52 (4%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRRE  599
            Y+ECLKNHA  IGGHAVDGCGEFMP+ T    D  +L+CAAC CHRNFHR+E
Sbjct  49   YRECLKNHAVGIGGHAVDGCGEFMPAGTEGSID--ALRCAACNCHRNFHRKE  98



>ref|XP_006286279.1| hypothetical protein CARUB_v10007856mg [Capsella rubella]
 gb|EOA19177.1| hypothetical protein CARUB_v10007856mg [Capsella rubella]
Length=224

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+ECLKNHA +IGGHAVDGC EFMPS      D  +LKCAACGCHRNFHR+E E
Sbjct  49   YRECLKNHAVNIGGHAVDGCCEFMPSGEDGTLD--ALKCAACGCHRNFHRKETE  100



>ref|XP_010438996.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X1 
[Camelina sativa]
Length=259

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 46/65 (71%), Gaps = 2/65 (3%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y+ECLKNHA +IGGHAVDGC EFMPS      D  +LKCAACGCHRNFHR+E E   G  
Sbjct  50   YRECLKNHAVNIGGHAVDGCCEFMPSGEDGTLD--ALKCAACGCHRNFHRKETEIIGGRA  107

Query  624  SAAPA  638
            +  P 
Sbjct  108  NRVPT  112



>ref|XP_009596948.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X1 
[Nicotiana tomentosiformis]
Length=229

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 49/85 (58%), Gaps = 24/85 (28%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRRE--------  599
            YKECLKNHA  IGGHAVDGCGEFMP+      D  +LKCAAC CHRNFHR+E        
Sbjct  53   YKECLKNHAVGIGGHAVDGCGEFMPAGEDGTLD--ALKCAACNCHRNFHRKETQLHHLPY  110

Query  600  --------------PEEPLGLPSAA  632
                          P+ PL LPS +
Sbjct  111  YGTPPCGYVQHVLPPQRPLALPSTS  135



>ref|XP_006413402.1| hypothetical protein EUTSA_v10026163mg [Eutrema salsugineum]
 dbj|BAJ34347.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ54855.1| hypothetical protein EUTSA_v10026163mg [Eutrema salsugineum]
Length=227

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPE  605
            Y+ECLKNHA +IGGHAVDGC EFMPS      D  +LKCAACGCHRNFHR+E E
Sbjct  52   YRECLKNHAVNIGGHAVDGCCEFMPSGEDGSLD--ALKCAACGCHRNFHRKETE  103



>ref|NP_194197.1| ZF-HD homeobox protein [Arabidopsis thaliana]
 sp|Q9SB61.1|ZHD2_ARATH RecName: Full=Zinc-finger homeodomain protein 2; Short=AtZHD2; 
AltName: Full=Homeobox protein 22; Short=AtHB-22; AltName: 
Full=Protein MATERNAL EFFECT EMBRYO ARREST 68 [Arabidopsis 
thaliana]
 gb|AAL27510.1|AF439841_1 AT4g24660/F22K18_140 [Arabidopsis thaliana]
 emb|CAA22997.1| putative protein [Arabidopsis thaliana]
 emb|CAB79376.1| putative protein [Arabidopsis thaliana]
 gb|AAM78073.1| AT4g24660/F22K18_140 [Arabidopsis thaliana]
 gb|AEE84939.1| ZF-HD homeobox protein [Arabidopsis thaliana]
Length=220

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 45/66 (68%), Gaps = 2/66 (3%)
 Frame = +3

Query  444  YKECLKNHAASIGGHAVDGCGEFMPSPTANPADPTSLKCAACGCHRNFHRREPEEPLGLP  623
            Y+ECLKNHA +IGGHAVDGC EFMPS      D  +LKCAACGCHRNFHR+E E   G  
Sbjct  49   YRECLKNHAVNIGGHAVDGCCEFMPSGEDGTLD--ALKCAACGCHRNFHRKETESIGGRA  106

Query  624  SAAPAL  641
               P  
Sbjct  107  HRVPTY  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1655620752480