BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig736

Length=676
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006360794.1|  PREDICTED: FRIGIDA-like protein 4a-like            278   4e-87   Solanum tuberosum [potatoes]
ref|XP_004247354.1|  PREDICTED: FRIGIDA-like protein 4a                 273   6e-85   Solanum lycopersicum
ref|XP_009784382.1|  PREDICTED: FRIGIDA-like protein 4a                 267   1e-82   Nicotiana sylvestris
ref|XP_009610915.1|  PREDICTED: FRIGIDA-like protein 4a                 265   4e-82   Nicotiana tomentosiformis
ref|XP_002282465.1|  PREDICTED: FRIGIDA-like protein 4a                 248   3e-75   Vitis vinifera
emb|CAN69766.1|  hypothetical protein VITISV_022061                     247   6e-75   Vitis vinifera
gb|AEK20760.1|  FRIGIDA                                                 242   6e-73   Coffea arabica [arabica coffee]
ref|XP_010256039.1|  PREDICTED: FRIGIDA-like protein 4a                 241   2e-72   Nelumbo nucifera [Indian lotus]
ref|XP_010695287.1|  PREDICTED: FRIGIDA-like protein 4a                 240   2e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_012069629.1|  PREDICTED: FRIGIDA-like protein 4a                 238   2e-71   Jatropha curcas
ref|XP_008390891.1|  PREDICTED: FRIGIDA-like protein 4a                 238   2e-71   Malus domestica [apple tree]
ref|XP_008340987.1|  PREDICTED: FRIGIDA-like protein 4a                 236   7e-71   
ref|XP_004299118.1|  PREDICTED: FRIGIDA-like protein 4a                 236   2e-70   Fragaria vesca subsp. vesca
ref|XP_009369844.1|  PREDICTED: FRIGIDA-like protein 4a                 233   2e-69   Pyrus x bretschneideri [bai li]
ref|XP_007225712.1|  hypothetical protein PRUPE_ppa004224mg             231   9e-69   Prunus persica
ref|XP_008224458.1|  PREDICTED: FRIGIDA-like protein 4a                 230   2e-68   Prunus mume [ume]
ref|XP_011071583.1|  PREDICTED: FRIGIDA-like protein 4a                 229   3e-68   Sesamum indicum [beniseed]
ref|XP_010090919.1|  hypothetical protein L484_004461                   229   6e-68   Morus notabilis
gb|ACJ85672.1|  unknown                                                 223   1e-67   Medicago truncatula
ref|XP_010277260.1|  PREDICTED: FRIGIDA-like protein 4a                 228   1e-67   Nelumbo nucifera [Indian lotus]
gb|AFP97615.1|  frigida-like protein                                    228   2e-67   Medicago sativa [alfalfa]
ref|XP_011659019.1|  PREDICTED: FRIGIDA-like protein 4a                 227   2e-67   Cucumis sativus [cucumbers]
gb|KEH43877.1|  frigida-LIKE protein                                    227   3e-67   Medicago truncatula
ref|XP_011026525.1|  PREDICTED: FRIGIDA-like protein 4a                 226   5e-67   Populus euphratica
ref|XP_010511354.1|  PREDICTED: FRIGIDA-like protein 4a                 225   1e-66   Camelina sativa [gold-of-pleasure]
ref|XP_002311627.2|  hydroxyproline-rich glycoprotein                   225   2e-66   Populus trichocarpa [western balsam poplar]
ref|XP_010466529.1|  PREDICTED: FRIGIDA-like protein 4a                 225   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_007143260.1|  hypothetical protein PHAVU_007G057500g             224   3e-66   Phaseolus vulgaris [French bean]
gb|KFK39537.1|  hypothetical protein AALP_AA3G257000                    223   8e-66   Arabis alpina [alpine rockcress]
ref|XP_010024304.1|  PREDICTED: LOW QUALITY PROTEIN: FRIGIDA-like...    223   9e-66   Eucalyptus grandis [rose gum]
ref|XP_002517136.1|  Protein FRIGIDA, putative                          222   2e-65   Ricinus communis
gb|EYU45654.1|  hypothetical protein MIMGU_mgv1a004401mg                221   8e-65   Erythranthe guttata [common monkey flower]
ref|XP_003556050.1|  PREDICTED: FRIGIDA-like protein 4a-like            219   3e-64   
gb|AGV54404.1|  frigida protein                                         219   5e-64   Phaseolus vulgaris [French bean]
ref|XP_010488272.1|  PREDICTED: FRIGIDA-like protein 4a                 219   5e-64   Camelina sativa [gold-of-pleasure]
ref|XP_006406163.1|  hypothetical protein EUTSA_v10020440mg             219   5e-64   
ref|XP_007034761.1|  FRIGIDA-like protein isoform 2                     214   7e-64   
ref|XP_006419935.1|  hypothetical protein CICLE_v100047532mg            211   1e-63   
ref|XP_002883367.1|  hydroxyproline-rich glycoprotein family protein    218   1e-63   
ref|XP_007034760.1|  FRIGIDA-like protein isoform 1                     216   3e-63   
gb|KDO74580.1|  hypothetical protein CISIN_1g010192mg                   211   3e-63   Citrus sinensis [apfelsine]
gb|KDO74579.1|  hypothetical protein CISIN_1g010192mg                   211   7e-63   Citrus sinensis [apfelsine]
ref|XP_003536533.1|  PREDICTED: FRIGIDA-like protein 4a-like            215   9e-63   Glycine max [soybeans]
gb|KDO74578.1|  hypothetical protein CISIN_1g010192mg                   212   2e-62   Citrus sinensis [apfelsine]
ref|XP_006299103.1|  hypothetical protein CARUB_v10015242mg             214   2e-62   Capsella rubella
gb|KDO74576.1|  hypothetical protein CISIN_1g010192mg                   214   3e-62   Citrus sinensis [apfelsine]
ref|XP_006489388.1|  PREDICTED: FRIGIDA-like protein 4a-like            214   3e-62   Citrus sinensis [apfelsine]
ref|NP_566709.1|  FRIGIDA-like protein                                  214   4e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283490.1|  hypothetical protein CARUB_v10004542mg             214   5e-62   Capsella rubella
ref|XP_006414627.1|  hypothetical protein EUTSA_v10024868mg             213   9e-62   Eutrema salsugineum [saltwater cress]
ref|XP_010533277.1|  PREDICTED: FRIGIDA-like protein 4a                 213   1e-61   
emb|CAB10269.1|  hydroxyproline-rich glycoprotein homolog               212   1e-61   Arabidopsis thaliana [mouse-ear cress]
emb|CDY46317.1|  BnaC01g31510D                                          212   2e-61   Brassica napus [oilseed rape]
ref|NP_567447.1|  FRIGIDA-like protein                                  212   2e-61   Arabidopsis thaliana [mouse-ear cress]
gb|KFK43732.1|  hypothetical protein AALP_AA1G165500                    211   4e-61   Arabis alpina [alpine rockcress]
gb|KJB38150.1|  hypothetical protein B456_006G239300                    206   1e-60   Gossypium raimondii
ref|XP_002868244.1|  hydroxyproline-rich glycoprotein family protein    210   1e-60   Arabidopsis lyrata subsp. lyrata
gb|KJB38151.1|  hypothetical protein B456_006G239300                    208   3e-60   Gossypium raimondii
ref|XP_010525189.1|  PREDICTED: FRIGIDA-like protein 4a                 208   5e-60   Tarenaya hassleriana [spider flower]
ref|XP_010551726.1|  PREDICTED: FRIGIDA-like protein 4a                 207   1e-59   Tarenaya hassleriana [spider flower]
gb|KHG22505.1|  Protein FRIGIDA -like protein                           206   2e-59   Gossypium arboreum [tree cotton]
gb|KHG27689.1|  Protein FRIGIDA -like protein                           206   4e-59   Gossypium arboreum [tree cotton]
ref|XP_009108852.1|  PREDICTED: FRIGIDA-like protein 4a                 203   5e-58   Brassica rapa
gb|KJB28346.1|  hypothetical protein B456_005G042900                    205   2e-57   Gossypium raimondii
ref|XP_010449973.1|  PREDICTED: FRIGIDA-like protein 4b                 201   3e-57   Camelina sativa [gold-of-pleasure]
emb|CDY34252.1|  BnaA01g24690D                                          199   1e-56   Brassica napus [oilseed rape]
ref|XP_008447152.1|  PREDICTED: FRIGIDA-like protein 4a                 197   5e-56   
ref|XP_010440374.1|  PREDICTED: FRIGIDA-like protein 4b                 196   4e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010435051.1|  PREDICTED: FRIGIDA-like protein 4b                 194   1e-54   Camelina sativa [gold-of-pleasure]
gb|AAL31182.1|  AT4g14900/dl3490c                                       191   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008778905.1|  PREDICTED: FRIGIDA-like protein 4a                 181   8e-50   Phoenix dactylifera
gb|EPS62727.1|  hypothetical protein M569_12062                         179   1e-49   Genlisea aurea
ref|XP_010909467.1|  PREDICTED: FRIGIDA-like protein 4a                 179   4e-49   Elaeis guineensis
ref|XP_010906476.1|  PREDICTED: FRIGIDA-like protein 4a                 171   3e-46   Elaeis guineensis
gb|AGV54236.1|  hydroxyproline-rich glycoprotein                        169   1e-45   Phaseolus vulgaris [French bean]
ref|XP_008796767.1|  PREDICTED: FRIGIDA-like protein 4a                 169   3e-45   Phoenix dactylifera
ref|XP_009408489.1|  PREDICTED: FRIGIDA-like protein 4a                 167   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY38318.1|  BnaC05g30110D                                          166   2e-44   Brassica napus [oilseed rape]
ref|XP_009344103.1|  PREDICTED: FRIGIDA-like protein 4a                 156   3e-44   
ref|XP_009398870.1|  PREDICTED: FRIGIDA-like protein 4b                 159   3e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW60755.1|  hypothetical protein EUGRSUZ_H03480                     158   1e-41   Eucalyptus grandis [rose gum]
gb|KCW60756.1|  hypothetical protein EUGRSUZ_H03480                     157   2e-41   Eucalyptus grandis [rose gum]
ref|XP_009389010.1|  PREDICTED: FRIGIDA-like protein 4a                 155   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006826275.1|  PREDICTED: FRIGIDA-like protein 4a                 148   5e-38   Amborella trichopoda
ref|XP_010228309.1|  PREDICTED: FRIGIDA-like protein 4a                 144   2e-36   Brachypodium distachyon [annual false brome]
ref|XP_006650719.1|  PREDICTED: FRIGIDA-like protein 4a-like            142   1e-35   
tpg|DAA59720.1|  TPA: hypothetical protein ZEAMMB73_037297              140   2e-35   
ref|XP_008652075.1|  PREDICTED: FRIGIDA-like protein 4a                 142   2e-35   Zea mays [maize]
gb|EEC76321.1|  hypothetical protein OsI_13877                          137   4e-34   Oryza sativa Indica Group [Indian rice]
ref|NP_001051543.1|  Os03g0794900                                       137   4e-34   
ref|XP_004955594.1|  PREDICTED: protein FRIGIDA-like                    134   1e-32   Setaria italica
ref|XP_002461525.1|  hypothetical protein SORBIDRAFT_02g004090          133   2e-32   
dbj|BAC83627.1|  putative hydroxyproline-rich glycoprotein              131   5e-32   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059003.1|  Os07g0173200                                       129   2e-31   
dbj|BAC83628.1|  putative hydroxyproline-rich glycoprotein              129   2e-31   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK00009.1|  predicted protein                                      129   4e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA42568.1|  TPA: hypothetical protein ZEAMMB73_160821              125   1e-29   
ref|XP_008786398.1|  PREDICTED: FRIGIDA-like protein 4a                 122   9e-29   Phoenix dactylifera
ref|XP_010254145.1|  PREDICTED: FRIGIDA-like protein 4a                 121   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_010915057.1|  PREDICTED: FRIGIDA-like protein 4b isoform X1      113   1e-25   Elaeis guineensis
ref|XP_010915058.1|  PREDICTED: FRIGIDA-like protein 4b isoform X2      113   1e-25   Elaeis guineensis
ref|XP_006842236.1|  PREDICTED: FRIGIDA-like protein 4a                 113   2e-25   Amborella trichopoda
ref|XP_002281155.2|  PREDICTED: FRIGIDA-like protein 4a isoform X2      109   6e-24   Vitis vinifera
ref|XP_010656337.1|  PREDICTED: FRIGIDA-like protein 4a isoform X1      108   7e-24   Vitis vinifera
ref|XP_007204566.1|  hypothetical protein PRUPE_ppa003799mg             108   1e-23   Prunus persica
ref|XP_008242610.1|  PREDICTED: FRIGIDA-like protein 4a                 107   2e-23   Prunus mume [ume]
emb|CAN61251.1|  hypothetical protein VITISV_004639                     108   2e-23   Vitis vinifera
ref|XP_004287092.1|  PREDICTED: FRIGIDA-like protein 4a isoform X1      107   3e-23   Fragaria vesca subsp. vesca
ref|XP_011458926.1|  PREDICTED: FRIGIDA-like protein 4a isoform X2      107   3e-23   Fragaria vesca subsp. vesca
ref|XP_012076667.1|  PREDICTED: FRIGIDA-like protein 4a                 105   2e-22   Jatropha curcas
ref|XP_008386583.1|  PREDICTED: FRIGIDA-like protein 4a                 104   3e-22   
ref|XP_010088834.1|  hypothetical protein L484_020817                   103   9e-22   Morus notabilis
ref|XP_009347163.1|  PREDICTED: FRIGIDA-like protein 4a                 102   1e-21   Pyrus x bretschneideri [bai li]
ref|XP_009336927.1|  PREDICTED: FRIGIDA-like protein 4a                 102   2e-21   Pyrus x bretschneideri [bai li]
gb|ABK25209.1|  unknown                                                 101   5e-21   Picea sitchensis
ref|XP_004503419.1|  PREDICTED: uncharacterized protein LOC101489761    100   9e-21   Cicer arietinum [garbanzo]
ref|XP_002514326.1|  conserved hypothetical protein                     100   1e-20   Ricinus communis
gb|KDO50860.1|  hypothetical protein CISIN_1g009377mg                 98.2    5e-20   Citrus sinensis [apfelsine]
ref|XP_006451127.1|  hypothetical protein CICLE_v10007961mg           98.2    5e-20   Citrus clementina [clementine]
ref|XP_003532490.1|  PREDICTED: FRIGIDA-like protein 4a-like          96.7    2e-19   Glycine max [soybeans]
ref|XP_008337438.1|  PREDICTED: FRIGIDA-like protein 4a               96.3    2e-19   
ref|XP_011043451.1|  PREDICTED: FRIGIDA-like protein 4a               95.9    3e-19   Populus euphratica
ref|XP_006371900.1|  hypothetical protein POPTR_0018s05910g           94.7    9e-19   Populus trichocarpa [western balsam poplar]
ref|XP_003525267.2|  PREDICTED: FRIGIDA-like protein 4a-like          93.2    2e-18   Glycine max [soybeans]
ref|XP_010688181.1|  PREDICTED: FRIGIDA-like protein 4a               92.0    8e-18   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK43654.1|  unknown                                               90.9    2e-17   Medicago truncatula
ref|XP_007013214.1|  FRIGIDA-like protein                             90.5    3e-17   
ref|XP_007160344.1|  hypothetical protein PHAVU_002G313900g           89.4    6e-17   Phaseolus vulgaris [French bean]
ref|XP_003629646.1|  Protein FRIGIDA                                  89.4    7e-17   Medicago truncatula
gb|EEE60086.1|  hypothetical protein OsJ_12936                        88.6    1e-16   Oryza sativa Japonica Group [Japonica rice]
gb|KHG13959.1|  Protein FRIGIDA -like protein                         88.6    1e-16   Gossypium arboreum [tree cotton]
gb|KJB06948.1|  hypothetical protein B456_001G004500                  87.8    2e-16   Gossypium raimondii
gb|ABR17868.1|  unknown                                               85.9    1e-15   Picea sitchensis
gb|AFG65514.1|  hypothetical protein UMN_3842_02                      80.5    1e-15   Pinus taeda
ref|XP_010047742.1|  PREDICTED: FRIGIDA-like protein 4a               81.3    4e-14   Eucalyptus grandis [rose gum]
gb|EEE66652.1|  hypothetical protein OsJ_23273                        81.3    4e-14   Oryza sativa Japonica Group [Japonica rice]
gb|KJB38152.1|  hypothetical protein B456_006G239300                  77.4    4e-13   Gossypium raimondii
ref|XP_004251422.1|  PREDICTED: FRIGIDA-like protein 4a               77.4    7e-13   Solanum lycopersicum
gb|EAY90122.1|  hypothetical protein OsI_11688                        73.9    8e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_009766201.1|  PREDICTED: FRIGIDA-like protein 4a               75.9    2e-12   Nicotiana sylvestris
ref|XP_006340271.1|  PREDICTED: FRIGIDA-like protein 4a-like isof...  75.1    3e-12   Solanum tuberosum [potatoes]
ref|XP_002303026.1|  hypothetical protein POPTR_0002s24090g           75.1    3e-12   Populus trichocarpa [western balsam poplar]
ref|XP_011024727.1|  PREDICTED: FRIGIDA-like protein 3                75.1    4e-12   Populus euphratica
ref|XP_004968433.1|  PREDICTED: uncharacterized abhydrolase domai...  74.3    7e-12   Setaria italica
ref|XP_011010336.1|  PREDICTED: FRIGIDA-like protein 3                73.9    8e-12   Populus euphratica
ref|XP_010270166.1|  PREDICTED: truncated FRIGIDA-like protein 1      73.6    9e-12   Nelumbo nucifera [Indian lotus]
gb|ABK94872.1|  unknown                                               72.4    3e-11   Populus trichocarpa [western balsam poplar]
emb|CDM81767.1|  unnamed protein product                              72.0    4e-11   Triticum aestivum [Canadian hard winter wheat]
gb|AAZ32849.1|  hydroxyproline-rich glycoprotein-like protein         68.9    4e-11   Medicago sativa [alfalfa]
ref|XP_002320559.2|  hypothetical protein POPTR_0014s17360g           71.6    6e-11   
gb|KJB08746.1|  hypothetical protein B456_001G101100                  71.2    6e-11   Gossypium raimondii
gb|KHG21752.1|  Protein FRIGIDA -like protein                         71.2    6e-11   Gossypium arboreum [tree cotton]
ref|XP_006375597.1|  hypothetical protein POPTR_0014s17360g           70.9    7e-11   
gb|KJB08747.1|  hypothetical protein B456_001G101100                  70.1    7e-11   Gossypium raimondii
gb|KJB08745.1|  hypothetical protein B456_001G101100                  71.2    7e-11   Gossypium raimondii
gb|KJB08748.1|  hypothetical protein B456_001G101100                  70.5    8e-11   Gossypium raimondii
ref|XP_009598293.1|  PREDICTED: FRIGIDA-like protein 4a               70.1    1e-10   Nicotiana tomentosiformis
ref|NP_001141095.1|  hypothetical protein                             69.7    2e-10   Zea mays [maize]
gb|ACG48802.1|  hypothetical protein                                  68.6    2e-10   Zea mays [maize]
ref|XP_002455057.1|  hypothetical protein SORBIDRAFT_03g003680        68.9    4e-10   
gb|KDO79035.1|  hypothetical protein CISIN_1g008359mg                 68.9    4e-10   Citrus sinensis [apfelsine]
ref|XP_006426019.1|  hypothetical protein CICLE_v10025275mg           68.6    5e-10   Citrus clementina [clementine]
ref|XP_006466524.1|  PREDICTED: FRIGIDA-like protein 3-like isofo...  68.6    5e-10   Citrus sinensis [apfelsine]
ref|XP_006858746.1|  PREDICTED: FRIGIDA-like protein 3                68.6    5e-10   Amborella trichopoda
ref|XP_003634846.1|  PREDICTED: FRIGIDA-like protein 3                68.2    6e-10   Vitis vinifera
ref|XP_002527289.1|  conserved hypothetical protein                   68.2    6e-10   Ricinus communis
emb|CDY00066.1|  BnaC09g02350D                                        68.2    7e-10   
gb|ABF98223.1|  hypothetical protein LOC_Os03g47804                   65.1    7e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010251408.1|  PREDICTED: FRIGIDA-like protein 3                67.8    8e-10   Nelumbo nucifera [Indian lotus]
gb|ABU93956.1|  hydroxyproline-rich glycoprotein-like protein         63.2    2e-09   Pinus sylvestris [Scotch pine]
ref|NP_001151902.1|  ABI3-interacting protein 2                       65.9    4e-09   Zea mays [maize]
gb|ABU93961.1|  hydroxyproline-rich glycoprotein-like protein         62.0    5e-09   Pinus sylvestris [Scotch pine]
ref|XP_012084486.1|  PREDICTED: FRIGIDA-like protein 3                65.1    6e-09   Jatropha curcas
ref|XP_004290112.1|  PREDICTED: FRIGIDA-like protein 3                65.1    8e-09   Fragaria vesca subsp. vesca
ref|XP_004956399.1|  PREDICTED: protein FRIGIDA-like                  63.5    2e-08   Setaria italica
ref|XP_003565433.1|  PREDICTED: FRIGIDA-like protein 4b               63.9    2e-08   Brachypodium distachyon [annual false brome]
ref|XP_009342384.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     63.2    3e-08   Pyrus x bretschneideri [bai li]
dbj|BAD19898.1|  putative ABI3-interacting protein 2                  62.8    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008382546.1|  PREDICTED: FRIGIDA-like protein 3                62.8    4e-08   
ref|NP_001062667.1|  Os09g0248200                                     62.8    4e-08   
ref|XP_003516350.1|  PREDICTED: auxin transporter-like protein 4-...  62.4    4e-08   
gb|EEC84154.1|  hypothetical protein OsI_30525                        62.8    4e-08   Oryza sativa Indica Group [Indian rice]
gb|AFW79629.1|  hypothetical protein ZEAMMB73_791390                  62.0    4e-08   
gb|AIG88464.1|  FRIGIDA-like protein                                  62.0    6e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002457174.1|  hypothetical protein SORBIDRAFT_03g002730        62.0    7e-08   Sorghum bicolor [broomcorn]
ref|XP_010271588.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     61.6    9e-08   Nelumbo nucifera [Indian lotus]
ref|XP_008235869.1|  PREDICTED: FRIGIDA-like protein 3                61.6    9e-08   Prunus mume [ume]
ref|XP_006829297.1|  PREDICTED: FRIGIDA-like protein 3                61.6    1e-07   Amborella trichopoda
ref|XP_010271580.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     61.6    1e-07   Nelumbo nucifera [Indian lotus]
ref|XP_010095585.1|  hypothetical protein L484_007424                 61.2    1e-07   Morus notabilis
ref|XP_008652494.1|  PREDICTED: FRIGIDA-like protein 3                61.2    1e-07   Zea mays [maize]
ref|XP_007201712.1|  hypothetical protein PRUPE_ppa003836mg           60.8    2e-07   Prunus persica
ref|XP_009151640.1|  PREDICTED: FRIGIDA-like protein 3                60.8    2e-07   Brassica rapa
gb|EEE53996.1|  hypothetical protein OsJ_00631                        60.5    2e-07   Oryza sativa Japonica Group [Japonica rice]
gb|KJB10822.1|  hypothetical protein B456_001G227000                  60.5    2e-07   Gossypium raimondii
dbj|BAD68038.1|  hypothetical protein                                 60.5    2e-07   Oryza sativa Japonica Group [Japonica rice]
gb|KJB10825.1|  hypothetical protein B456_001G227000                  60.5    2e-07   Gossypium raimondii
ref|NP_001172206.1|  Os01g0181000                                     60.5    2e-07   
gb|EEC70056.1|  hypothetical protein OsI_00656                        60.5    3e-07   Oryza sativa Indica Group [Indian rice]
gb|KHG07809.1|  Protein FRIGIDA -like protein                         60.1    3e-07   Gossypium arboreum [tree cotton]
ref|XP_010679002.1|  PREDICTED: FRIGIDA-like protein 3                60.1    3e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009342382.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     60.1    3e-07   Pyrus x bretschneideri [bai li]
ref|XP_007049532.1|  FRIGIDA-like protein isoform 1                   59.7    4e-07   
ref|XP_010547174.1|  PREDICTED: FRIGIDA-like protein 3                59.7    5e-07   Tarenaya hassleriana [spider flower]
ref|XP_009401034.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     59.3    5e-07   
ref|XP_006395188.1|  hypothetical protein EUTSA_v10003930mg           59.3    6e-07   
gb|EMS54104.1|  hypothetical protein TRIUR3_33659                     59.3    6e-07   Triticum urartu
ref|XP_010939086.1|  PREDICTED: FRIGIDA-like protein 3                58.9    7e-07   Elaeis guineensis
emb|CDY48750.1|  BnaA02g30110D                                        58.5    9e-07   Brassica napus [oilseed rape]
emb|CDX86307.1|  BnaA06g30240D                                        58.9    9e-07   
ref|XP_006447936.1|  hypothetical protein CICLE_v10014710mg           58.5    9e-07   Citrus clementina [clementine]
ref|XP_007155867.1|  hypothetical protein PHAVU_003G238500g           58.5    9e-07   Phaseolus vulgaris [French bean]
ref|XP_006584257.1|  PREDICTED: uncharacterized protein LOC100817935  57.8    9e-07   
ref|XP_009358937.1|  PREDICTED: FRIGIDA-like protein 3                58.5    9e-07   Pyrus x bretschneideri [bai li]
gb|AIN75614.1|  FRIGIDA3b-1                                           58.5    1e-06   Dimocarpus longan [longan]
gb|AAP31312.2|  ABI3-interacting protein 2                            58.5    1e-06   Callitropsis nootkatensis [Nootka cypress]
ref|XP_009129722.1|  PREDICTED: FRIGIDA-like protein 3                58.5    1e-06   Brassica rapa
tpg|DAA41489.1|  TPA: hypothetical protein ZEAMMB73_922617            58.5    1e-06   
ref|XP_010037083.1|  PREDICTED: FRIGIDA-like protein 3                58.2    1e-06   Eucalyptus grandis [rose gum]
ref|XP_006447935.1|  hypothetical protein CICLE_v10014710mg           58.2    1e-06   Citrus clementina [clementine]
ref|XP_006366815.1|  PREDICTED: FRIGIDA-like protein 3-like isofo...  57.8    2e-06   Solanum tuberosum [potatoes]
ref|XP_008780981.1|  PREDICTED: truncated FRIGIDA-like protein 1      57.8    2e-06   Phoenix dactylifera
ref|XP_010551997.1|  PREDICTED: FRIGIDA-like protein 3                57.8    2e-06   Tarenaya hassleriana [spider flower]
gb|ABK24390.1|  unknown                                               57.8    2e-06   Picea sitchensis
gb|ABR17421.1|  unknown                                               57.8    2e-06   Picea sitchensis
ref|XP_010442259.1|  PREDICTED: FRIGIDA-like protein 3                57.8    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_008458100.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     57.4    2e-06   Cucumis melo [Oriental melon]
emb|CDY05684.1|  BnaC02g38530D                                        57.4    3e-06   
gb|KCW48710.1|  hypothetical protein EUGRSUZ_K02358                   57.0    3e-06   Eucalyptus grandis [rose gum]
ref|XP_007134303.1|  hypothetical protein PHAVU_010G035900g           57.4    3e-06   Phaseolus vulgaris [French bean]
ref|XP_001752883.1|  predicted protein                                57.0    3e-06   
emb|CDX85335.1|  BnaC07g26460D                                        57.4    3e-06   
ref|XP_010482087.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     57.0    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_004242450.1|  PREDICTED: FRIGIDA-like protein 3                57.0    3e-06   Solanum lycopersicum
ref|XP_010482089.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     57.0    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_002283922.2|  PREDICTED: FRIGIDA-like protein 3                57.0    3e-06   Vitis vinifera
ref|XP_003521013.1|  PREDICTED: FRIGIDA-like protein 3-like           57.0    3e-06   Glycine max [soybeans]
gb|KHN30845.1|  Protein FRIGIDA                                       57.0    4e-06   Glycine soja [wild soybean]
ref|XP_006660447.1|  PREDICTED: FRIGIDA-like protein 3-like           56.6    4e-06   Oryza brachyantha
ref|XP_003521014.1|  PREDICTED: FRIGIDA-like protein 3-like isofo...  56.6    5e-06   Glycine max [soybeans]
ref|XP_008458098.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     56.6    5e-06   
ref|XP_006280261.1|  hypothetical protein CARUB_v10026179mg           56.2    5e-06   
ref|XP_009401032.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     56.2    5e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002961449.1|  hypothetical protein SELMODRAFT_76871            56.2    5e-06   
ref|NP_001062668.1|  Os09g0248300                                     56.2    6e-06   
ref|XP_004510190.1|  PREDICTED: protein FRIGIDA-like                  56.2    6e-06   Cicer arietinum [garbanzo]
ref|XP_009802214.1|  PREDICTED: FRIGIDA-like protein 3                55.8    7e-06   Nicotiana sylvestris
ref|XP_010493658.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     55.8    9e-06   
ref|XP_009385695.1|  PREDICTED: FRIGIDA-like protein 3                55.5    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009771266.1|  PREDICTED: FRIGIDA-like protein 3                55.5    1e-05   Nicotiana sylvestris
emb|CDP03992.1|  unnamed protein product                              55.5    1e-05   Coffea canephora [robusta coffee]
gb|KDO43512.1|  hypothetical protein CISIN_1g008061mg                 55.5    1e-05   Citrus sinensis [apfelsine]
gb|KDO43511.1|  hypothetical protein CISIN_1g008061mg                 55.5    1e-05   Citrus sinensis [apfelsine]
ref|XP_003577079.1|  PREDICTED: FRIGIDA-like protein 3                55.1    1e-05   Brachypodium distachyon [annual false brome]
ref|XP_010644522.1|  PREDICTED: truncated FRIGIDA-like protein 1      55.1    1e-05   Vitis vinifera
ref|XP_007204987.1|  hypothetical protein PRUPE_ppa003454mg           55.1    1e-05   Prunus persica
gb|AIN75612.1|  FRIGIDA3a-1                                           55.1    2e-05   Dimocarpus longan [longan]
gb|KDO43521.1|  hypothetical protein CISIN_1g008061mg                 54.7    2e-05   Citrus sinensis [apfelsine]
gb|AIN75613.1|  FRIGIDA3a-2                                           55.1    2e-05   Dimocarpus longan [longan]
ref|XP_004149315.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     54.7    2e-05   Cucumis sativus [cucumbers]
ref|XP_003562780.1|  PREDICTED: FRIGIDA-like protein 3                54.7    2e-05   Brachypodium distachyon [annual false brome]
ref|XP_008238516.1|  PREDICTED: FRIGIDA-like protein 3                54.7    2e-05   Prunus mume [ume]
ref|XP_011659218.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     54.7    2e-05   Cucumis sativus [cucumbers]
ref|XP_009392592.1|  PREDICTED: FRIGIDA-like protein 3                54.3    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006599130.1|  PREDICTED: FRIGIDA-like protein 3-like           54.3    3e-05   Glycine max [soybeans]
gb|KDO43517.1|  hypothetical protein CISIN_1g008061mg                 54.3    3e-05   Citrus sinensis [apfelsine]
ref|XP_009367793.1|  PREDICTED: FRIGIDA-like protein 3                54.3    3e-05   
ref|XP_008790629.1|  PREDICTED: FRIGIDA-like protein 3                54.3    3e-05   
gb|KEH31518.1|  frigida-like protein                                  54.3    3e-05   Medicago truncatula
gb|EYU40676.1|  hypothetical protein MIMGU_mgv1a004360mg              53.9    3e-05   Erythranthe guttata [common monkey flower]
gb|KHN41627.1|  hypothetical protein glysoja_036371                   50.4    4e-05   Glycine soja [wild soybean]
gb|KDO43514.1|  hypothetical protein CISIN_1g008061mg                 53.9    4e-05   Citrus sinensis [apfelsine]
ref|XP_010277793.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     53.9    4e-05   Nelumbo nucifera [Indian lotus]
gb|KDO43513.1|  hypothetical protein CISIN_1g008061mg                 53.5    4e-05   Citrus sinensis [apfelsine]
ref|XP_010277794.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     53.5    4e-05   Nelumbo nucifera [Indian lotus]
gb|KDO43515.1|  hypothetical protein CISIN_1g008061mg                 53.1    6e-05   Citrus sinensis [apfelsine]
ref|XP_010938943.1|  PREDICTED: truncated FRIGIDA-like protein 1      53.1    6e-05   Elaeis guineensis
ref|XP_011463627.1|  PREDICTED: FRIGIDA-like protein 3                52.8    8e-05   Fragaria vesca subsp. vesca
ref|XP_002463117.1|  hypothetical protein SORBIDRAFT_02g038160        52.8    9e-05   Sorghum bicolor [broomcorn]
ref|XP_002863893.1|  hypothetical protein ARALYDRAFT_331248           52.8    9e-05   
gb|KHN30846.1|  Protein FRIGIDA                                       52.4    1e-04   
gb|ABR17986.1|  unknown                                               52.4    1e-04   
ref|XP_010907692.1|  PREDICTED: FRIGIDA-like protein 1                52.4    1e-04   
gb|AFK33866.1|  unknown                                               51.2    1e-04   
ref|XP_009415031.1|  PREDICTED: FRIGIDA-like protein 3                52.0    2e-04   
ref|XP_008813697.1|  PREDICTED: truncated FRIGIDA-like protein 1      51.6    2e-04   
ref|XP_004510189.1|  PREDICTED: protein FRIGIDA-like                  51.2    3e-04   
ref|XP_006579918.1|  PREDICTED: FRIGIDA-like protein 3-like isofo...  51.2    3e-04   
ref|XP_004958191.1|  PREDICTED: protein FRIGIDA-like                  51.2    3e-04   
ref|XP_003524673.1|  PREDICTED: FRIGIDA-like protein 3-like isofo...  51.2    3e-04   
gb|KHN41556.1|  Protein FRIGIDA                                       51.2    3e-04   
ref|XP_007134304.1|  hypothetical protein PHAVU_010G036000g           50.8    4e-04   
ref|XP_004509091.1|  PREDICTED: protein FRIGIDA-like                  50.1    7e-04   
ref|NP_001060162.1|  Os07g0592300                                     50.1    8e-04   
gb|EEE67512.1|  hypothetical protein OsJ_24962                        50.1    8e-04   
ref|NP_850923.1|  FRIGIDA-like protein                                49.7    0.001   
gb|AAM96992.1|  putative protein                                      49.7    0.001   
gb|EEC82372.1|  hypothetical protein OsI_26706                        49.7    0.001   



>ref|XP_006360794.1| PREDICTED: FRIGIDA-like protein 4a-like [Solanum tuberosum]
Length=514

 Score =   278 bits (712),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 169/197 (86%), Gaps = 4/197 (2%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGS+ADPGE+   S  P     SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQD+L+KSE
Sbjct  1    MGSLADPGELD--SVEPPQQQPSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDILKKSE  58

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            ALKAK+QTLD++TK SLEVLE+RETS+  S+SI L+KV E+K+AA++ F    G E+PEV
Sbjct  59   ALKAKIQTLDSETKASLEVLEQRETSMNVSLSIALQKVVENKKAAILAFDE--GVEQPEV  116

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            D+S GLLLKL+SFCV+MDSRSFW+F+  +KK+L+SLR EI KALG+CVDPP+FV+E+ISE
Sbjct  117  DDSTGLLLKLKSFCVKMDSRSFWNFLTAKKKDLDSLRVEIPKALGECVDPPRFVLESISE  176

Query  624  VFPVDKRELKSERSNDL  674
            VFP DKRE ++ER+NDL
Sbjct  177  VFPEDKREERNERNNDL  193



>ref|XP_004247354.1| PREDICTED: FRIGIDA-like protein 4a [Solanum lycopersicum]
Length=514

 Score =   273 bits (697),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 168/197 (85%), Gaps = 4/197 (2%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGS+ADPGE+   S  P P   SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQD+L+KSE
Sbjct  1    MGSLADPGELD--SVEPPPQQPSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDILKKSE  58

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            ALKAK+QTLD++TK SLEVLE+RETS+  S+SI L+KV E+KRAA++      G E+PEV
Sbjct  59   ALKAKIQTLDSETKASLEVLEQRETSMNVSLSIALQKVVENKRAAILALDE--GVEQPEV  116

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            D+S GLLLKL+SFCV+MDSRSFW+F+  +KK+L+SLR EI KAL +CVDPP+FV+E+ISE
Sbjct  117  DDSTGLLLKLKSFCVKMDSRSFWNFLTAKKKDLDSLRLEIPKALEECVDPPRFVLESISE  176

Query  624  VFPVDKRELKSERSNDL  674
            VFP DKRE ++ER+NDL
Sbjct  177  VFPEDKREERNERNNDL  193



>ref|XP_009784382.1| PREDICTED: FRIGIDA-like protein 4a [Nicotiana sylvestris]
Length=516

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 160/187 (86%), Gaps = 7/187 (4%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGS+ADPGE+   +        SFD+FQRQTSLMTSCTLLWKELSDHFTSLEQD+L+KSE
Sbjct  1    MGSLADPGELDSVAPS-----PSFDDFQRQTSLMTSCTLLWKELSDHFTSLEQDILKKSE  55

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            ALKAK+QTLD++TK SL+VLEKRE S+  S+SI+L+KV E+K+AA++  G   G+E+PEV
Sbjct  56   ALKAKIQTLDSETKASLDVLEKRENSMNVSLSISLQKVLENKQAAILALGE--GAEQPEV  113

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            D+S GL LKL+SFCV+MDSRSFW F+IV+KK+L+SLR EI KALGDCVDPP+FV+E+ISE
Sbjct  114  DDSTGLYLKLKSFCVKMDSRSFWRFLIVKKKDLDSLRVEIPKALGDCVDPPRFVLESISE  173

Query  624  VFPVDKR  644
            VFP DKR
Sbjct  174  VFPEDKR  180



>ref|XP_009610915.1| PREDICTED: FRIGIDA-like protein 4a [Nicotiana tomentosiformis]
Length=516

 Score =   265 bits (678),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 160/187 (86%), Gaps = 7/187 (4%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGS+ADPGE+   + P      SFD+FQRQTSLMTSCTLLWKELSDHFTSLEQD+++KSE
Sbjct  1    MGSLADPGELDSVAPP-----PSFDDFQRQTSLMTSCTLLWKELSDHFTSLEQDIIKKSE  55

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            ALKAK+QTLD++TK SLEVLEKRE S+  S+SI+L+KV E+K+AA++      G+E+PEV
Sbjct  56   ALKAKIQTLDSETKASLEVLEKRENSMNVSLSISLQKVLENKQAAILALNE--GAEQPEV  113

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            D+S GL LKL+SFCV+MDSRSFW F+IV+KK+L+SLR EI KALGDCVDPP+FV+E+ISE
Sbjct  114  DDSTGLYLKLKSFCVKMDSRSFWRFLIVKKKDLDSLRVEIPKALGDCVDPPRFVLESISE  173

Query  624  VFPVDKR  644
            VFP DKR
Sbjct  174  VFPEDKR  180



>ref|XP_002282465.1| PREDICTED: FRIGIDA-like protein 4a [Vitis vinifera]
Length=522

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 154/197 (78%), Gaps = 7/197 (4%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPG+++           SFD+FQ+QTSLMTSCTLLWKELSDHFTSLEQ+L +KSE
Sbjct  1    MGSIPDPGDIS-----GELNQPSFDDFQKQTSLMTSCTLLWKELSDHFTSLEQNLQKKSE  55

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            ALK K QTLD  TK+SL VL+KRE +I  S+ I L KV+ES+ AAL+      G+++ EV
Sbjct  56   ALKNKFQTLDHHTKESLGVLKKREVTIDGSVEIALGKVEESREAALIAL--LKGAQDGEV  113

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            D+S GLLLKL+SFC++MDS+ FW F+  RKKEL++LR++  +AL +CVDP KFV+EAISE
Sbjct  114  DDSEGLLLKLKSFCLKMDSKEFWRFITARKKELDALRAQTPEALAECVDPAKFVLEAISE  173

Query  624  VFPVDKRELKSERSNDL  674
            VFPVDKR  KSERSNDL
Sbjct  174  VFPVDKRVEKSERSNDL  190



>emb|CAN69766.1| hypothetical protein VITISV_022061 [Vitis vinifera]
Length=524

 Score =   247 bits (631),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 154/197 (78%), Gaps = 7/197 (4%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPG+++           SFD+FQ+QTSLMTSCTLLWKELSDHFTSLEQ+L +KSE
Sbjct  1    MGSIPDPGDIS-----GELNXPSFDDFQKQTSLMTSCTLLWKELSDHFTSLEQNLQKKSE  55

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            ALK K QTLD  TK+SL VL+KRE +I  S+ I L KV+ES+ AAL+      G+++ EV
Sbjct  56   ALKNKFQTLDHHTKESLGVLKKREVTIDGSVEIALGKVEESREAALIAL--LKGAQDGEV  113

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            D+S GLLLKL+SFC++MDS+ FW F+  RKKEL++LR++  +AL +CVDP KFV+EAISE
Sbjct  114  DDSEGLLLKLKSFCLKMDSKEFWRFITARKKELDALRAQTPEALAECVDPAKFVLEAISE  173

Query  624  VFPVDKRELKSERSNDL  674
            VFPVDKR  KSERSNDL
Sbjct  174  VFPVDKRVEKSERSNDL  190



>gb|AEK20760.1| FRIGIDA [Coffea arabica]
Length=532

 Score =   242 bits (618),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 155/194 (80%), Gaps = 6/194 (3%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSIADPGE+TQ   PP  PP SFD+FQRQTSLMTSCTLLWKELSDHFTSLEQ+L +KS 
Sbjct  1    MGSIADPGELTQTQPPPPQPPPSFDDFQRQTSLMTSCTLLWKELSDHFTSLEQNLEKKSA  60

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGG------  425
            ALKAKL+TLD QT  SL+ L +RE++++  +S+ L+KV++SK  A++      G      
Sbjct  61   ALKAKLKTLDFQTNTSLDELNRRESTLSTVLSMALEKVEKSKAGAILSVAQQNGVSNGAE  120

Query  426  SEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFV  605
            S E EVD+S G+ LKL++FC++MD ++FW FV+VRKKELESLR EI KALG+CVDPPKFV
Sbjct  121  SGEGEVDDSLGVFLKLKTFCIRMDFKNFWGFVVVRKKELESLRQEIPKALGECVDPPKFV  180

Query  606  MEAISEVFPVDKRE  647
            +EAISEVFPVD R+
Sbjct  181  LEAISEVFPVDTRK  194



>ref|XP_010256039.1| PREDICTED: FRIGIDA-like protein 4a [Nelumbo nucifera]
Length=522

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 150/197 (76%), Gaps = 11/197 (6%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGS A PGE+ Q         TSF++FQ+QTSLMTSCTLLWKELSDHF+SLEQDLL+KSE
Sbjct  1    MGSAALPGEMLQ---------TSFEDFQQQTSLMTSCTLLWKELSDHFSSLEQDLLKKSE  51

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            ALK K++ LD +TK++L+VLEKRE SI  ++   L KV+E K AAL+     GG EE   
Sbjct  52   ALKEKIKNLDNKTKETLDVLEKREVSIDGTVEQALAKVEERKEAALIAM-QKGGKEE-FG  109

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            D   G+LLKLRSFC +MDS  FW FV VRKKE+++LR +I  AL DC+DPPKFV+EAISE
Sbjct  110  DGEDGVLLKLRSFCTKMDSAGFWKFVTVRKKEIDALRVKIPLALSDCIDPPKFVIEAISE  169

Query  624  VFPVDKRELKSERSNDL  674
            VFPVDKR  K+ER+NDL
Sbjct  170  VFPVDKRAEKTERTNDL  186



>ref|XP_010695287.1| PREDICTED: FRIGIDA-like protein 4a [Beta vulgaris subsp. vulgaris]
Length=524

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 150/201 (75%), Gaps = 10/201 (5%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE TQ ++       SF+EFQ+QTSLMTSCTLLWKELSDHF +LE+D+ RKSE
Sbjct  1    MGSIPDPGESTQLNS------PSFEEFQKQTSLMTSCTLLWKELSDHFNTLEEDIRRKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL----VEFGNAGGSE  431
            ALK K+QTLD QTKQSLEVL+KRE +I  S+ I + + +ESK+ AL    VE        
Sbjct  55   ALKRKIQTLDHQTKQSLEVLKKREVTIEGSVEIAIGRAEESKKVALSLGVVEERENVRVG  114

Query  432  EPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVME  611
            E EVD+  GLL+KL+SFC+ MD   FW FV VRKKEL+ LR++I  AL DCVD PKFV+E
Sbjct  115  EGEVDDGEGLLMKLKSFCIWMDYEGFWRFVTVRKKELDLLRAKIPVALADCVDSPKFVLE  174

Query  612  AISEVFPVDKRELKSERSNDL  674
            AISEVFPVDKR  KS+R NDL
Sbjct  175  AISEVFPVDKRADKSDRVNDL  195



>ref|XP_012069629.1| PREDICTED: FRIGIDA-like protein 4a [Jatropha curcas]
 gb|KDP40175.1| hypothetical protein JCGZ_02173 [Jatropha curcas]
Length=520

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 148/198 (75%), Gaps = 7/198 (4%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDHF+SLEQ+L +KSE
Sbjct  1    MGSIPDPGELTELTQ------PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEQNLQKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAG-GSEEPE  440
            ALK K QTLD QTK SL  L+KRE +I  S+ I LK+V++ + AAL    N      + E
Sbjct  55   ALKNKFQTLDHQTKTSLASLKKREVTIDGSVEIALKRVEQHREAALKSLDNPNFDHPDGE  114

Query  441  VDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAIS  620
            VDN  GLL  L+SFC++M+SR FW FVI +KKEL+ LRS+I  AL +CVDP KFV+EAIS
Sbjct  115  VDNGDGLLQLLKSFCLKMESREFWKFVITKKKELDVLRSQIPLALAECVDPSKFVLEAIS  174

Query  621  EVFPVDKRELKSERSNDL  674
            EVFPVDKR  ++E+ NDL
Sbjct  175  EVFPVDKRGERTEKGNDL  192



>ref|XP_008390891.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
Length=522

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 151/198 (76%), Gaps = 7/198 (4%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+++        SFDEFQRQTSLMTSCTLLWKELSDHF+SLEQ+LL+KSE
Sbjct  1    MGSIPDPGELTESTP------PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEQNLLKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEE-PE  440
            A+K K+QTL+ +TK SL+ LE+RE SI     + L KV++SK AAL     A   +E  E
Sbjct  55   AIKLKIQTLEHETKASLDELEQREVSIRDIFEVALGKVEKSKEAALKVLKRARSDDEYGE  114

Query  441  VDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAIS  620
            VD+  GLL+ L+S C++MDS  FW FV  RKKELE+LRS++  ALGDCVDP KFV+EAIS
Sbjct  115  VDDGEGLLMNLKSLCLKMDSGGFWRFVTARKKELEALRSQMPLALGDCVDPAKFVLEAIS  174

Query  621  EVFPVDKRELKSERSNDL  674
            EVFPVDKR  +S+R NDL
Sbjct  175  EVFPVDKRVERSDRGNDL  192



>ref|XP_008340987.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
Length=521

 Score =   236 bits (603),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 148/198 (75%), Gaps = 7/198 (4%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDHF+SLEQ+LL+KSE
Sbjct  1    MGSIPDPGELTELTP------PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEQNLLKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEE-PE  440
            A+K K+QTL+  TK SL+ LE+RE +I  S  I L KV++SK AAL         +E  E
Sbjct  55   AIKLKIQTLEQXTKASLDELEQREVTIRDSFEIALGKVEKSKEAALKVLKRGRSDDEYGE  114

Query  441  VDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAIS  620
            VD+  GLL+ L+S C++MDS  FW FV  RKKELE LRS++  ALGDCVDP KFV+EAIS
Sbjct  115  VDDGEGLLMNLKSLCLKMDSGGFWRFVTARKKELEGLRSQMPVALGDCVDPXKFVLEAIS  174

Query  621  EVFPVDKRELKSERSNDL  674
            EVFPVDKR  +S+R NDL
Sbjct  175  EVFPVDKRLERSDRGNDL  192



>ref|XP_004299118.1| PREDICTED: FRIGIDA-like protein 4a [Fragaria vesca subsp. vesca]
Length=584

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 155/198 (78%), Gaps = 4/198 (2%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +APP     SFDEFQRQTSLMTSCTLLWKELSDHF SLEQ+LL+KSE
Sbjct  1    MGSIPDPGELTELTAPPP---ASFDEFQRQTSLMTSCTLLWKELSDHFLSLEQNLLQKSE  57

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEE-PE  440
            A+K K+Q L+ +TK+SL+ LE+RE +I  S+ I L KV+E+K+AAL     A   +E  E
Sbjct  58   AIKRKIQALEHETKESLDELEQREITINLSVEIALVKVEETKKAALKVLKRARSDDEYGE  117

Query  441  VDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAIS  620
            VDNS GLL++++S C++MDS  FW FV  RKKELESLR+++  AL +C DP +FV+EAIS
Sbjct  118  VDNSEGLLMEMKSLCLKMDSGRFWRFVTGRKKELESLRAQMSLALAECADPARFVLEAIS  177

Query  621  EVFPVDKRELKSERSNDL  674
            EVFPVDKR  KS+R NDL
Sbjct  178  EVFPVDKRSEKSDRGNDL  195



>ref|XP_009369844.1| PREDICTED: FRIGIDA-like protein 4a [Pyrus x bretschneideri]
Length=521

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 148/198 (75%), Gaps = 7/198 (4%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDHF+SLEQ+LL+KSE
Sbjct  1    MGSIPDPGELTELTP------PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEQNLLKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEE-PE  440
            A+K K+QTL+ +TK SL+ LE+RE +I  S  I L KV+++K +AL         +E  E
Sbjct  55   AIKLKIQTLEQETKASLDELEQREVTIRDSFEIALGKVEKTKESALKVLKRGRSDDEYGE  114

Query  441  VDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAIS  620
            VD+  GLL+ L+S C++MDS   W FV  RKKELE LRS++  ALGDCVDP KFV+EAIS
Sbjct  115  VDDGEGLLMNLKSLCLKMDSGGLWRFVTARKKELEGLRSQMPVALGDCVDPAKFVLEAIS  174

Query  621  EVFPVDKRELKSERSNDL  674
            EVFPVDKR  +S+R NDL
Sbjct  175  EVFPVDKRLERSDRGNDL  192



>ref|XP_007225712.1| hypothetical protein PRUPE_ppa004224mg [Prunus persica]
 gb|EMJ26911.1| hypothetical protein PRUPE_ppa004224mg [Prunus persica]
Length=522

 Score =   231 bits (589),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 151/199 (76%), Gaps = 9/199 (5%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+LL+KSE
Sbjct  1    MGSIPDPGELTELTP------PSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLLKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL--VEFGNAGGSEEP  437
            A+K K+Q L+ +TK+SL+ LE+RE +I  S+ I + KV++SK AAL  ++ G +   +  
Sbjct  55   AIKRKIQNLEQETKESLDELEQREVTIMESVEIAVGKVEKSKEAALKVLKRGRSDDDDGE  114

Query  438  EVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAI  617
              DN  GLL+ L+S C++MDS  FW FV  RKKELE+LRS++  AL DCVDP KFV+EAI
Sbjct  115  VDDNE-GLLMNLKSLCLKMDSGRFWRFVTARKKELEALRSQMPLALADCVDPAKFVLEAI  173

Query  618  SEVFPVDKRELKSERSNDL  674
            SEVFPVDKR  KSER NDL
Sbjct  174  SEVFPVDKRVDKSERGNDL  192



>ref|XP_008224458.1| PREDICTED: FRIGIDA-like protein 4a [Prunus mume]
Length=497

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 151/199 (76%), Gaps = 9/199 (5%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+LL+KSE
Sbjct  1    MGSIPDPGELTELTP------PSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLLKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL--VEFGNAGGSEEP  437
            A+K K+Q L+ +TK+SL+ LE+RE +I  S+ I + KV++SK AAL  ++ G +   +  
Sbjct  55   AIKRKIQNLEQETKESLDELEQREVTIMESVEIAVGKVEKSKEAALKVLKRGRSDDDDGE  114

Query  438  EVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAI  617
              DN  GLL+ L+S C++MD+  FW FV  RKKELE+LRS++  AL DCVDP KFV+EAI
Sbjct  115  VDDNE-GLLMNLKSLCLKMDTGRFWRFVTARKKELEALRSQMPLALADCVDPAKFVLEAI  173

Query  618  SEVFPVDKRELKSERSNDL  674
            SEVFPVDKR  KSER NDL
Sbjct  174  SEVFPVDKRVDKSERGNDL  192



>ref|XP_011071583.1| PREDICTED: FRIGIDA-like protein 4a [Sesamum indicum]
Length=520

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 146/186 (78%), Gaps = 6/186 (3%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGS+ DPGE+T    PP     SFDEFQRQTSLMTSCTLLWKELSDHF+SLEQDL++KS+
Sbjct  1    MGSLPDPGELTHPPPPP----PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEQDLIKKSD  56

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRA--ALVEFGNAGGSEEP  437
            ALKAK Q L+ +T+QSL+ L+ RE+SI+ S+SI L+ ++++ +   +L   G    +EEP
Sbjct  57   ALKAKFQALNNETQQSLQALDTRESSISKSMSIVLESLEKTTKMSISLAAPGAESQTEEP  116

Query  438  EVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAI  617
            EVD+S GLL+KL+SFC +M ++ FW FV  RKKELE  RSE+ KAL DCVDPP+FV+EAI
Sbjct  117  EVDDSEGLLMKLKSFCHKMAAKEFWVFVTARKKELELFRSELPKALADCVDPPRFVLEAI  176

Query  618  SEVFPV  635
            SEVFP+
Sbjct  177  SEVFPL  182



>ref|XP_010090919.1| hypothetical protein L484_004461 [Morus notabilis]
 gb|EXB41291.1| hypothetical protein L484_004461 [Morus notabilis]
Length=519

 Score =   229 bits (583),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 149/197 (76%), Gaps = 6/197 (3%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLL+KSE
Sbjct  1    MGSIPDPGELTELTP------PSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            A+K K+QTLD +TK+SL  LEKRE +I  S+ I L KV+ SK  AL+      G E  EV
Sbjct  55   AMKRKIQTLDNETKESLHELEKRENTIEGSVKIALGKVEVSKEVALMAMERIFGDENGEV  114

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            D+  GLLLKL+SF ++MDS   W FV  +KKEL++LR+++  AL DCVDP KFV+EAISE
Sbjct  115  DDGEGLLLKLKSFLLRMDSSGLWRFVTGKKKELDALRAQMPLALADCVDPAKFVLEAISE  174

Query  624  VFPVDKRELKSERSNDL  674
            VFPVDKR  KSER NDL
Sbjct  175  VFPVDKRVEKSERGNDL  191



>gb|ACJ85672.1| unknown [Medicago truncatula]
Length=353

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 145/200 (73%), Gaps = 11/200 (6%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +        SFD+FQRQTSLMTSCTLLWKELSDHF+SLEQDLL KSE
Sbjct  1    MGSIPDPGELTELTQ------PSFDDFQRQTSLMTSCTLLWKELSDHFSSLEQDLLNKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEE---  434
            AL  K+++LD QT +SL +L  RE+++  ++ I L+ +D    AAL          E   
Sbjct  55   ALNRKIRSLDNQTNESLNLLRHRESTLDDALQIALRDIDNRTEAALAALSRVREDVEDGD  114

Query  435  PEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEA  614
             EVDN  GL+LKL+SFC++MD+  FW FV+ +KKELE LR+E+ +ALG+C+DP KFV+EA
Sbjct  115  GEVDNGEGLMLKLKSFCLKMDALGFWGFVMGKKKELEGLRAEMPEALGECIDPAKFVLEA  174

Query  615  ISEVFPVDKRELKSERSNDL  674
            ISEVFPVDKR  KS   NDL
Sbjct  175  ISEVFPVDKRGDKS--GNDL  192



>ref|XP_010277260.1| PREDICTED: FRIGIDA-like protein 4a [Nelumbo nucifera]
Length=534

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 145/197 (74%), Gaps = 11/197 (6%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI  PGE+ Q         TSF++FQRQ +LMTSCTLLWKELSDHF+SLEQDL +KSE
Sbjct  1    MGSIPLPGEMLQ---------TSFEDFQRQATLMTSCTLLWKELSDHFSSLEQDLQKKSE  51

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            AL+ K QTLD +TK++L+ LEKRE SI  S+   L KV+E K AAL+     GG EE + 
Sbjct  52   ALREKFQTLDDRTKETLDGLEKREVSIEGSVEQALVKVEERKEAALIAL-QKGGKEEFD-  109

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            D+  G+LLKLRSFC +MDS  FW FV  +KKE+  LR +I  AL  C+DPP+FVMEAISE
Sbjct  110  DSDEGVLLKLRSFCTKMDSAGFWKFVTAKKKEIGMLRVKIPLALSGCIDPPRFVMEAISE  169

Query  624  VFPVDKRELKSERSNDL  674
            VFP+DKR  K+ER+NDL
Sbjct  170  VFPIDKRFEKTERTNDL  186



>gb|AFP97615.1| frigida-like protein [Medicago sativa]
Length=519

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 148/206 (72%), Gaps = 23/206 (11%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +        SFD+FQRQTSLMTSCTLLWKELSDHF+SLEQDLL KSE
Sbjct  1    MGSIPDPGELTELTQ------PSFDDFQRQTSLMTSCTLLWKELSDHFSSLEQDLLNKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL---------VEFGN  416
            AL  K+++LD QT +SL +L  RE+++  ++ I L+ +D    AAL         VE G+
Sbjct  55   ALNRKIRSLDNQTNESLNLLRHRESTLDDALQIALRDIDNRTEAALAALSRVREDVEDGD  114

Query  417  AGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPP  596
                   EVDN  GL+LKL+SFC++MD+  FW FVI +KKELE LR+E+ +ALG+C+DP 
Sbjct  115  G------EVDNGEGLMLKLKSFCLKMDALGFWGFVIGKKKELEGLRAEMPEALGECIDPA  168

Query  597  KFVMEAISEVFPVDKRELKSERSNDL  674
            KFV+EAISEVFPVDKR  KS   NDL
Sbjct  169  KFVLEAISEVFPVDKRGDKS--GNDL  192



>ref|XP_011659019.1| PREDICTED: FRIGIDA-like protein 4a [Cucumis sativus]
 gb|KGN44244.1| hypothetical protein Csa_7G234160 [Cucumis sativus]
Length=518

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 152/197 (77%), Gaps = 7/197 (4%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MG+I DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHFT+LEQDLL+KSE
Sbjct  1    MGTIPDPGELSELTH------PSFDEFQRQTSLMTSCTLLWKELSDHFTNLEQDLLKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            AL+ K+QTLD QTK+SL+ LEKRE SI  S+ I L KV++S  AAL       G E  EV
Sbjct  55   ALRHKIQTLDHQTKESLDELEKREVSIQGSVQIALGKVEKSMEAALKAL-EKDGDENGEV  113

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            D+  GLLLKL+SFC++MDS  FW F+  +KKELE+LR++I  AL +C+DPP+FV+EAISE
Sbjct  114  DDDDGLLLKLKSFCLEMDSGGFWRFITGKKKELEALRAKIHLALAECIDPPRFVLEAISE  173

Query  624  VFPVDKRELKSERSNDL  674
            VFP+DKR  KS+  NDL
Sbjct  174  VFPLDKRVEKSDGGNDL  190



>gb|KEH43877.1| frigida-LIKE protein [Medicago truncatula]
Length=519

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 148/206 (72%), Gaps = 23/206 (11%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +        SFD+FQRQTSLMTSCTLLWKELSDHF+SLEQDLL KSE
Sbjct  1    MGSIPDPGELTELTQ------PSFDDFQRQTSLMTSCTLLWKELSDHFSSLEQDLLNKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL---------VEFGN  416
            AL  K+++LD QT +SL +L  RE+++  ++ I L+ +D    AAL         VE G+
Sbjct  55   ALNRKIRSLDNQTNESLNLLRHRESTLDDALQIALRDIDNRTEAALAALSRVREDVEDGD  114

Query  417  AGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPP  596
                   EVDN  GL+LKL+SFC++MD+  FW FVI +KKELE LR+E+ +ALG+C+DP 
Sbjct  115  G------EVDNGEGLMLKLKSFCLKMDALGFWGFVIGKKKELEGLRAEMPEALGECIDPA  168

Query  597  KFVMEAISEVFPVDKRELKSERSNDL  674
            KFV+EAISEVFPVDKR  KS   NDL
Sbjct  169  KFVLEAISEVFPVDKRGDKS--GNDL  192



>ref|XP_011026525.1| PREDICTED: FRIGIDA-like protein 4a [Populus euphratica]
Length=521

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 147/203 (72%), Gaps = 16/203 (8%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+L +KSE
Sbjct  1    MGSIPDPGELTELTR------PSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLQKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL-----VEFGNAGGS  428
            ALK K+QTLDTQTK SL  L+KRE +I  S+ I L++V+E +  AL      ++ N  G 
Sbjct  55   ALKHKIQTLDTQTKASLASLKKREVTIDGSVEIALERVEERRELALKSLSDPDYENPDG-  113

Query  429  EEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVM  608
               EVD+  G  + L+S C+ M+SR FW+FVI +KKE+E LR +I  AL +CVDP KFV+
Sbjct  114  ---EVDDGDGSFMVLKSLCLTMESREFWNFVITKKKEIEILRKQIPLALAECVDPAKFVI  170

Query  609  EAISEVFPVDKR-ELKSERSNDL  674
            EAISEVFPVDKR E   E+ NDL
Sbjct  171  EAISEVFPVDKRGERSGEKGNDL  193



>ref|XP_010511354.1| PREDICTED: FRIGIDA-like protein 4a [Camelina sativa]
Length=530

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 145/202 (72%), Gaps = 13/202 (6%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGS+ DPGE+T+ +        SF+EFQ+QTSLMTSCTLLW+ELSDHFTSLEQ+L++KSE
Sbjct  1    MGSVPDPGELTELAQ------PSFEEFQKQTSLMTSCTLLWQELSDHFTSLEQNLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEF-----GNAGGS  428
            ALK  ++TLD QT+ SLE L++RE +I  S+ I   KV E  RAAL        G+    
Sbjct  55   ALKQMIETLDNQTQTSLESLKRREVTIDHSVEIVAGKVGERARAALESLEKARDGDGAND  114

Query  429  EEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVM  608
            +  EVD+  GLL  L+S C++MD+R FW+FV  RKKELE+LRS+I  ALGDCVDP   V+
Sbjct  115  DSGEVDDEEGLLSALKSLCLKMDARGFWNFVTARKKELENLRSKIPAALGDCVDPAMLVL  174

Query  609  EAISEVFPVDKRELKSERSNDL  674
            EAISEVFPVDKRE K   SND 
Sbjct  175  EAISEVFPVDKREEK--MSNDY  194



>ref|XP_002311627.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE88994.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=521

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 146/203 (72%), Gaps = 16/203 (8%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+L +KSE
Sbjct  1    MGSIPDPGELTELTR------PSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLQKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL-----VEFGNAGGS  428
            ALK K+QTLD QTK SL  L+KRE +I  S+ I L++V+E +  AL      ++ N  G 
Sbjct  55   ALKHKIQTLDNQTKASLASLKKREVTIDGSVEIALERVEEHRELALKSLSDPDYENPDG-  113

Query  429  EEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVM  608
               EVD+  G  + L+S C+ M+SR FW+FVI +KKE+E LR +I  AL +CVDP KFV+
Sbjct  114  ---EVDDGDGSFMVLKSLCLTMESRDFWNFVITKKKEIEILRKQIPLALAECVDPAKFVI  170

Query  609  EAISEVFPVDKR-ELKSERSNDL  674
            EAISEVFPVDKR E   E+ NDL
Sbjct  171  EAISEVFPVDKRGERSGEKGNDL  193



>ref|XP_010466529.1| PREDICTED: FRIGIDA-like protein 4a [Camelina sativa]
Length=533

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 147/204 (72%), Gaps = 15/204 (7%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGS+ DPGE+T+ +        SF+EFQ+QTSLMTSCTLLW+ELSDHFTSLEQ+L++KSE
Sbjct  1    MGSVPDPGELTELAQ------PSFEEFQKQTSLMTSCTLLWQELSDHFTSLEQNLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL--VEFGNAGGSE--  431
            ALK  ++TLD QT+ SLE L++RE +I  S+ I   KV E  RAAL  +E    GG E  
Sbjct  55   ALKQMIETLDNQTQTSLESLKRREVTIDHSVEIVAGKVGERARAALESLEKARDGGGEGA  114

Query  432  ---EPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKF  602
                 EVD+  GLL  L+S C++MD+R FW+FV  RKKELE+LRS+I  ALGDCVDP   
Sbjct  115  NDDSGEVDDEEGLLSALKSLCLKMDARGFWNFVTARKKELENLRSKIPAALGDCVDPAML  174

Query  603  VMEAISEVFPVDKRELKSERSNDL  674
            V+EAISEVFPVDKRE K   SND 
Sbjct  175  VLEAISEVFPVDKREEK--MSNDY  196



>ref|XP_007143260.1| hypothetical protein PHAVU_007G057500g [Phaseolus vulgaris]
 gb|ESW15254.1| hypothetical protein PHAVU_007G057500g [Phaseolus vulgaris]
Length=525

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 145/191 (76%), Gaps = 13/191 (7%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHF+SLE+DL  KSE
Sbjct  1    MGSIPDPGELSELTQ------PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEEDLKHKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEF----GNAGGSE  431
            ALK K++TLDT T  SL +L++RETS+ A++ I L+ +D  + AAL  F     + GG  
Sbjct  55   ALKGKMRTLDTATSDSLRLLDRRETSLDATLQIALRTLDTRRTAALSSFLDDHADDGGG-  113

Query  432  EPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVME  611
              EVD++ GL+LKL+SFC++MD+  FW+F+  +KKEL+ LR+E+  AL +CVDP KFV+E
Sbjct  114  --EVDDATGLVLKLKSFCLRMDAFGFWTFLSAKKKELDGLRAEVPVALAECVDPAKFVLE  171

Query  612  AISEVFPVDKR  644
            AISEVFPVDKR
Sbjct  172  AISEVFPVDKR  182



>gb|KFK39537.1| hypothetical protein AALP_AA3G257000 [Arabis alpina]
Length=529

 Score =   223 bits (569),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 140/189 (74%), Gaps = 8/189 (4%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGS+ DPGE+T+ +        SF+EFQRQ+SLMTSCTLLW ELSDHFTSLEQ+L++KSE
Sbjct  1    MGSVPDPGELTELAQ------PSFEEFQRQSSLMTSCTLLWNELSDHFTSLEQNLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL--VEFGNAGGSEEP  437
            ALK  ++TLD QT+ SLE L++RE +I  S+ I   KV E  RAAL  +E    GG +  
Sbjct  55   ALKQMIETLDNQTQTSLESLKRREVTIDHSVEIVAGKVGERARAALESLEKARDGGDDSG  114

Query  438  EVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAI  617
            EVD+  GLL  L+S C++MD+R FW+FV  RKKELE+LRS+I  AL DCVDP   V+EAI
Sbjct  115  EVDDDEGLLTALKSLCLKMDARGFWNFVTARKKELENLRSQIPAALVDCVDPAMLVLEAI  174

Query  618  SEVFPVDKR  644
            SEVFPVDKR
Sbjct  175  SEVFPVDKR  183



>ref|XP_010024304.1| PREDICTED: LOW QUALITY PROTEIN: FRIGIDA-like protein 4a [Eucalyptus 
grandis]
Length=530

 Score =   223 bits (569),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 151/203 (74%), Gaps = 10/203 (5%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DP    + +    PP  SF++FQ+QTSLMTSCTLLWKELS HF+SLEQ+L++KSE
Sbjct  1    MGSIPDPS--GEPACQLQPPAASFEDFQKQTSLMTSCTLLWKELSXHFSSLEQNLMKKSE  58

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSE-EP-  437
            ALK KL+ LD QTK++L VL++RET+I  S+ I L+KV++SK AAL      GG + EP 
Sbjct  59   ALKQKLRALDDQTKKTLTVLDERETTIDGSVEIVLEKVEKSKEAALGALERGGGRDVEPG  118

Query  438  ----EVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFV  605
                EVD+  GLL+KLRSFC++MDS+ FW FV  +KKEL+ +R ++  AL DCVDP KFV
Sbjct  119  SPGGEVDDGEGLLMKLRSFCLRMDSKEFWRFVTGKKKELDLMREKMHLALVDCVDPAKFV  178

Query  606  MEAISEVFPVDKRELKSERSNDL  674
            +EAISEVFPVDKR    +R NDL
Sbjct  179  LEAISEVFPVDKR--GGDRGNDL  199



>ref|XP_002517136.1| Protein FRIGIDA, putative [Ricinus communis]
 gb|EEF45299.1| Protein FRIGIDA, putative [Ricinus communis]
Length=520

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 144/200 (72%), Gaps = 11/200 (6%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+L +KSE
Sbjct  1    MGSIPDPGELTELTQ------PSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLQKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSE---E  434
            ALK K+QTLDTQTK SL  L KRE +I  S+ I L+++DE K AAL    N    +   +
Sbjct  55   ALKQKIQTLDTQTKASLANLRKREVTIDGSVEIALERLDEHKEAALKSLENPDSCDDHPD  114

Query  435  PEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEA  614
             EVDN  GLL  L+S C++M+S  FW  +  +KKE+E LRS+I  AL +CVDP +FV+EA
Sbjct  115  GEVDNGEGLLQILKSLCLKMESMEFWQLITRKKKEIEVLRSQIPLALSECVDPCRFVLEA  174

Query  615  ISEVFPVDKRELKSERSNDL  674
            ISEVFPVDKR  KS   NDL
Sbjct  175  ISEVFPVDKRCEKS--GNDL  192



>gb|EYU45654.1| hypothetical protein MIMGU_mgv1a004401mg [Erythranthe guttata]
Length=529

 Score =   221 bits (562),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 144/190 (76%), Gaps = 11/190 (6%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGS+ DPGE+T    PP     SFD+FQRQTSLMTSCTLLWKELSDHF+SLEQD+++KS+
Sbjct  1    MGSLPDPGELTHPPPPP----PSFDDFQRQTSLMTSCTLLWKELSDHFSSLEQDIIKKSD  56

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGS-----  428
             LKAKLQ L+ +T+QSL+ LE RE+SI+ S++I    ++++ + + V F     +     
Sbjct  57   DLKAKLQALNNETQQSLQALETRESSISKSMAIVFDNLEKTAKMS-VSFSVPSAAADDAQ  115

Query  429  -EEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFV  605
             EEPEVD++ GLL+KLRSFC +M ++ FW FV  RKKE+E  RSE+ KAL DCVDPP+FV
Sbjct  116  IEEPEVDDTEGLLMKLRSFCHKMAAKQFWVFVTSRKKEIELFRSELPKALSDCVDPPRFV  175

Query  606  MEAISEVFPV  635
            +EAISEVFPV
Sbjct  176  LEAISEVFPV  185



>ref|XP_003556050.1| PREDICTED: FRIGIDA-like protein 4a-like [Glycine max]
Length=524

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 141/189 (75%), Gaps = 8/189 (4%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHF+SLEQDL  KSE
Sbjct  1    MGSIPDPGELSELTQ------PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEQDLNHKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEP--  437
            ALK K+ TLD  T  SL +L+ RETS+ A++ I L+ +D  + AAL    +      P  
Sbjct  55   ALKRKIHTLDNSTSDSLRLLDHRETSLDATLQIALRTLDTRRTAALSALLHDADDTSPDG  114

Query  438  EVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAI  617
            EVD++AGL+LKL+SFC++MD+  F++FV  +KKEL+ LR+E+  AL +CVDP KFV+EAI
Sbjct  115  EVDDTAGLVLKLKSFCLRMDAFGFFAFVSAKKKELDGLRAEMPVALAECVDPAKFVLEAI  174

Query  618  SEVFPVDKR  644
            SEVFPVDKR
Sbjct  175  SEVFPVDKR  183



>gb|AGV54404.1| frigida protein [Phaseolus vulgaris]
Length=525

 Score =   219 bits (557),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 145/195 (74%), Gaps = 13/195 (7%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHF+SLE+DL  KSE
Sbjct  1    MGSIPDPGELSELTQ------PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEEDLKHKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEF----GNAGGSE  431
            ALK K++TLDT T  SL +L++RETS+ A++ I L+ +D  + AAL  F     + GG  
Sbjct  55   ALKGKMRTLDTATSDSLRLLDRRETSLDATLQIALRTLDTRRTAALSSFLDDHADDGGG-  113

Query  432  EPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVME  611
              EVD++ GL+LKL+SFC++MD+  FW+F+  +KKEL+ LR+E+  AL +CVDP KFV+E
Sbjct  114  --EVDDATGLVLKLKSFCLRMDAFGFWTFLSAKKKELDGLRAEVPVALAECVDPAKFVLE  171

Query  612  AISEVFPVDKRELKS  656
            AI EVF VDKR  K+
Sbjct  172  AIFEVFSVDKRREKT  186



>ref|XP_010488272.1| PREDICTED: FRIGIDA-like protein 4a [Camelina sativa]
Length=539

 Score =   219 bits (557),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 144/203 (71%), Gaps = 15/203 (7%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGS+ DPGE+T+ +        SF+EFQ+QTSLMTSCTLLW+ELSDHFTSLEQ+L++KSE
Sbjct  1    MGSVPDPGELTELAQ------PSFEEFQKQTSLMTSCTLLWQELSDHFTSLEQNLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNA-------G  422
            ALK  ++TLD QT+ SLE L++RE +I  S+ I   KV E  RAAL     A        
Sbjct  55   ALKQMIETLDNQTQTSLESLKRREVTIDHSVEIVAGKVGERARAALESLEKARDGGGDGA  114

Query  423  GSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKF  602
              +  EVD+  GLL  L++ C++MD+R FW+FV  RKKELE+LRS+I  ALGDCVDP   
Sbjct  115  NDDSGEVDDEEGLLSALKALCLKMDARGFWNFVTARKKELENLRSKIPAALGDCVDPAML  174

Query  603  VMEAISEVFPVDKRELKSERSND  671
            V+EAISEVFPVDKRE K   SND
Sbjct  175  VLEAISEVFPVDKREEK--MSND  195



>ref|XP_006406163.1| hypothetical protein EUTSA_v10020440mg [Eutrema salsugineum]
 gb|ESQ47616.1| hypothetical protein EUTSA_v10020440mg [Eutrema salsugineum]
Length=552

 Score =   219 bits (558),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 143/203 (70%), Gaps = 12/203 (6%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGS+ DPGE+T+ +        SF+EFQRQTSLMTSCTLLWKELSDHFTSLEQ+L++KSE
Sbjct  1    MGSVPDPGELTELTQ------PSFEEFQRQTSLMTSCTLLWKELSDHFTSLEQNLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL--VEFGNAGGSE--  431
            ALK  ++TLD QT+ SLE L++RE +I  S+ I   KV E  RAAL  +E     GS   
Sbjct  55   ALKQMIETLDNQTQTSLESLKRREVTIDHSVEIVAGKVGERARAALESLEKARDCGSNVD  114

Query  432  --EPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFV  605
                EVD+  GLL  L+S C++MD+R FW FV  RKKELE+LRS+I  AL DCVDP   V
Sbjct  115  DSSGEVDDDEGLLSALKSLCLKMDARGFWDFVTARKKELENLRSQIPAALVDCVDPAMLV  174

Query  606  MEAISEVFPVDKRELKSERSNDL  674
            +EAISEVFPVDKR    + +ND 
Sbjct  175  LEAISEVFPVDKRASGEKVTNDF  197



>ref|XP_007034761.1| FRIGIDA-like protein isoform 2 [Theobroma cacao]
 gb|EOY05687.1| FRIGIDA-like protein isoform 2 [Theobroma cacao]
Length=375

 Score =   214 bits (546),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 146/198 (74%), Gaps = 9/198 (5%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDH  SLEQ+L+R+SE
Sbjct  1    MGSIPDPGELTELTH------PSFDEFQRQTSLMTSCTLLWKELSDHINSLEQNLMRQSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFG-NAGGSEEPE  440
            ALK K++TLD++TK SL+ L+KRE SI  S+ I L +V+   +AAL     +   + + E
Sbjct  55   ALKRKIETLDSETKASLDSLKKREHSIEGSVKIALDRVEFHTKAALKTLSDDVEDNPDGE  114

Query  441  VDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAIS  620
            VDN  GLL  L+S C++M+++ FW+FV  +KKE++ LR +I  AL +CVDP +FVMEAIS
Sbjct  115  VDNGDGLLQLLKSTCLKMEAKEFWNFVTGKKKEIDLLREKIPAALSECVDPARFVMEAIS  174

Query  621  EVFPVDKRELKSERSNDL  674
            EVFPVDKR   +ER NDL
Sbjct  175  EVFPVDKR--GNERGNDL  190



>ref|XP_006419935.1| hypothetical protein CICLE_v100047532mg, partial [Citrus clementina]
 gb|ESR33175.1| hypothetical protein CICLE_v100047532mg, partial [Citrus clementina]
Length=297

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 145/197 (74%), Gaps = 8/197 (4%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+L +KS 
Sbjct  1    MGSIPDPGELSELNPL------SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLQKKSA  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            AL+ K+QTLDTQTK SL+VL+KRE +I  S+ I ++K+++   A L          + EV
Sbjct  55   ALRHKIQTLDTQTKASLDVLKKREVTIDGSVEIAMEKLEDRTEATLNSISRGQELGDGEV  114

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            D+  GLL+ L S+C++M++R FW FV+ +KKE+E LR+ +  AL +CVDP KFVMEAISE
Sbjct  115  DDGDGLLMILMSYCLKMEARGFWKFVVTKKKEIEELRNALPAALSECVDPAKFVMEAISE  174

Query  624  VFPVDKRELKSERSNDL  674
            VFPVDKR  KS   NDL
Sbjct  175  VFPVDKRSDKS--GNDL  189



>ref|XP_002883367.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59626.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=531

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 143/203 (70%), Gaps = 14/203 (7%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGS+ DPGE+T+ +        SF+EFQ+QTSLMTSCTLLW+ELSDHFTSLEQ+L++KSE
Sbjct  1    MGSVPDPGELTELAQ------PSFEEFQKQTSLMTSCTLLWQELSDHFTSLEQNLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEF------GNAGG  425
            ALK  ++TLD QT+ SLE L++RE +I  S+ I   KV E  RAAL         G+   
Sbjct  55   ALKQMIETLDNQTQTSLESLKRREVTIDHSVEIVAGKVGERARAALESLEKARDGGDGSN  114

Query  426  SEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFV  605
             +  EVD+  GLL  L+S C++MD+R FW+FV  RKKELE+LRS+I  AL DCVDP   V
Sbjct  115  DDSGEVDDEEGLLSALKSLCLKMDARGFWNFVTARKKELENLRSKIPAALVDCVDPAMLV  174

Query  606  MEAISEVFPVDKRELKSERSNDL  674
            +EAISEVFPVDKR  K   SND 
Sbjct  175  LEAISEVFPVDKRGDKV--SNDY  195



>ref|XP_007034760.1| FRIGIDA-like protein isoform 1 [Theobroma cacao]
 gb|EOY05686.1| FRIGIDA-like protein isoform 1 [Theobroma cacao]
Length=520

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 146/198 (74%), Gaps = 9/198 (5%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDH  SLEQ+L+R+SE
Sbjct  1    MGSIPDPGELTELTH------PSFDEFQRQTSLMTSCTLLWKELSDHINSLEQNLMRQSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFG-NAGGSEEPE  440
            ALK K++TLD++TK SL+ L+KRE SI  S+ I L +V+   +AAL     +   + + E
Sbjct  55   ALKRKIETLDSETKASLDSLKKREHSIEGSVKIALDRVEFHTKAALKTLSDDVEDNPDGE  114

Query  441  VDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAIS  620
            VDN  GLL  L+S C++M+++ FW+FV  +KKE++ LR +I  AL +CVDP +FVMEAIS
Sbjct  115  VDNGDGLLQLLKSTCLKMEAKEFWNFVTGKKKEIDLLREKIPAALSECVDPARFVMEAIS  174

Query  621  EVFPVDKRELKSERSNDL  674
            EVFPVDKR   +ER NDL
Sbjct  175  EVFPVDKR--GNERGNDL  190



>gb|KDO74580.1| hypothetical protein CISIN_1g010192mg [Citrus sinensis]
Length=312

 Score =   211 bits (536),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 145/197 (74%), Gaps = 8/197 (4%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+L +KS 
Sbjct  1    MGSIPDPGELSELNPL------SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLQKKSA  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            AL+ K+QTLDTQTK SL+VL+KRE +I  S+ I ++K+++   A L          + EV
Sbjct  55   ALRHKIQTLDTQTKASLDVLKKREVTIDGSVEIAMEKLEDRTEATLNSISRGQELGDGEV  114

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            D+  GLL+ L S+C++M++R FW FV+ +KKE+E LR+ +  AL +CVDP KFVMEAISE
Sbjct  115  DDGDGLLMILMSYCLKMEARGFWKFVVTKKKEIEELRNALPAALSECVDPAKFVMEAISE  174

Query  624  VFPVDKRELKSERSNDL  674
            VFPVDKR  KS   NDL
Sbjct  175  VFPVDKRSDKS--GNDL  189



>gb|KDO74579.1| hypothetical protein CISIN_1g010192mg [Citrus sinensis]
Length=364

 Score =   211 bits (538),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 145/197 (74%), Gaps = 8/197 (4%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+L +KS 
Sbjct  1    MGSIPDPGELSELNP------LSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLQKKSA  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            AL+ K+QTLDTQTK SL+VL+KRE +I  S+ I ++K+++   A L          + EV
Sbjct  55   ALRHKIQTLDTQTKASLDVLKKREVTIDGSVEIAMEKLEDRTEATLNSISRGQELGDGEV  114

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            D+  GLL+ L S+C++M++R FW FV+ +KKE+E LR+ +  AL +CVDP KFVMEAISE
Sbjct  115  DDGDGLLMILMSYCLKMEARGFWKFVVTKKKEIEELRNALPAALSECVDPAKFVMEAISE  174

Query  624  VFPVDKRELKSERSNDL  674
            VFPVDKR  KS   NDL
Sbjct  175  VFPVDKRSDKS--GNDL  189



>ref|XP_003536533.1| PREDICTED: FRIGIDA-like protein 4a-like [Glycine max]
Length=530

 Score =   215 bits (548),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 142/192 (74%), Gaps = 11/192 (6%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHF+SLEQDL  KSE
Sbjct  1    MGSIPDPGELSELTQ------PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEQDLNHKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGN-----AGGS  428
            ALK K++TLD  T  SL +L++RETS+ A++ I L+ +D  + AAL             S
Sbjct  55   ALKRKIRTLDNTTSDSLRLLDRRETSLDATLQIALRTLDTRRTAALSALLTDADDIINSS  114

Query  429  EEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVM  608
             + EVD++ GL+LKL+SFC++MD+  F++FV  +KKEL+ LR+E+  AL +CVDP KFV+
Sbjct  115  PDGEVDDTTGLILKLKSFCLRMDAFGFFAFVSAKKKELDGLRAEMPVALAECVDPAKFVL  174

Query  609  EAISEVFPVDKR  644
            EAISEVFPVDKR
Sbjct  175  EAISEVFPVDKR  186



>gb|KDO74578.1| hypothetical protein CISIN_1g010192mg [Citrus sinensis]
Length=412

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 145/197 (74%), Gaps = 8/197 (4%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+L +KS 
Sbjct  1    MGSIPDPGELSELNPL------SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLQKKSA  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            AL+ K+QTLDTQTK SL+VL+KRE +I  S+ I ++K+++   A L          + EV
Sbjct  55   ALRHKIQTLDTQTKASLDVLKKREVTIDGSVEIAMEKLEDRTEATLNSISRGQELGDGEV  114

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            D+  GLL+ L S+C++M++R FW FV+ +KKE+E LR+ +  AL +CVDP KFVMEAISE
Sbjct  115  DDGDGLLMILMSYCLKMEARGFWKFVVTKKKEIEELRNALPAALSECVDPAKFVMEAISE  174

Query  624  VFPVDKRELKSERSNDL  674
            VFPVDKR  KS   NDL
Sbjct  175  VFPVDKRSDKS--GNDL  189



>ref|XP_006299103.1| hypothetical protein CARUB_v10015242mg [Capsella rubella]
 gb|EOA32001.1| hypothetical protein CARUB_v10015242mg [Capsella rubella]
Length=533

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 142/204 (70%), Gaps = 16/204 (8%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGS+ DPGE+T+ +        SF+EFQ+QTSLMTSCTLLW+ELSDHFTSLEQ+L++KSE
Sbjct  1    MGSVPDPGELTELAQ------PSFEEFQKQTSLMTSCTLLWQELSDHFTSLEQNLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNA--------  419
            ALK  +++LD QT+ SLE L +RE +I  S+ I   KV E  RAAL     A        
Sbjct  55   ALKQMIESLDNQTQTSLESLNRREVTIDHSVEIVAGKVGERARAALESLEKARDGGGGDG  114

Query  420  GGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPK  599
               +  EVD+  GLL  L++ C++MD+R FW+FV  RKKELE+LRS+I  ALGDCVDP  
Sbjct  115  SNDDSGEVDDEEGLLSALKALCLKMDARGFWNFVTARKKELENLRSKIPAALGDCVDPAM  174

Query  600  FVMEAISEVFPVDKRELKSERSND  671
             V+EAISEVFPVDKR  K   SND
Sbjct  175  LVLEAISEVFPVDKRAEK--MSND  196



>gb|KDO74576.1| hypothetical protein CISIN_1g010192mg [Citrus sinensis]
Length=511

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 145/197 (74%), Gaps = 8/197 (4%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+L +KS 
Sbjct  1    MGSIPDPGELSELNP------LSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLQKKSA  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            AL+ K+QTLDTQTK SL+VL+KRE +I  S+ I ++K+++   A L          + EV
Sbjct  55   ALRHKIQTLDTQTKASLDVLKKREVTIDGSVEIAMEKLEDRTEATLNSISRGQELGDGEV  114

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            D+  GLL+ L S+C++M++R FW FV+ +KKE+E LR+ +  AL +CVDP KFVMEAISE
Sbjct  115  DDGDGLLMILMSYCLKMEARGFWKFVVTKKKEIEELRNALPAALSECVDPAKFVMEAISE  174

Query  624  VFPVDKRELKSERSNDL  674
            VFPVDKR  KS   NDL
Sbjct  175  VFPVDKRSDKS--GNDL  189



>ref|XP_006489388.1| PREDICTED: FRIGIDA-like protein 4a-like [Citrus sinensis]
 gb|KDO74577.1| hypothetical protein CISIN_1g010192mg [Citrus sinensis]
Length=515

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 145/197 (74%), Gaps = 8/197 (4%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+L +KS 
Sbjct  1    MGSIPDPGELSELNP------LSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLQKKSA  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            AL+ K+QTLDTQTK SL+VL+KRE +I  S+ I ++K+++   A L          + EV
Sbjct  55   ALRHKIQTLDTQTKASLDVLKKREVTIDGSVEIAMEKLEDRTEATLNSISRGQELGDGEV  114

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            D+  GLL+ L S+C++M++R FW FV+ +KKE+E LR+ +  AL +CVDP KFVMEAISE
Sbjct  115  DDGDGLLMILMSYCLKMEARGFWKFVVTKKKEIEELRNALPAALSECVDPAKFVMEAISE  174

Query  624  VFPVDKRELKSERSNDL  674
            VFPVDKR  KS   NDL
Sbjct  175  VFPVDKRSDKS--GNDL  189



>ref|NP_566709.1| FRIGIDA-like protein [Arabidopsis thaliana]
 sp|Q9LUV4.1|FRL4A_ARATH RecName: Full=FRIGIDA-like protein 4a [Arabidopsis thaliana]
 dbj|BAB01784.1| hydroxyproline-rich glycoprotein [Arabidopsis thaliana]
 gb|AAK92705.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20275.1| putative hydroxyproline-rich glycoprotein [Arabidopsis thaliana]
 gb|AAM61695.1| hydroxyproline-rich glycoprotein-like protein [Arabidopsis thaliana]
 gb|AEE76640.1| FRIGIDA-like protein [Arabidopsis thaliana]
Length=532

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 142/204 (70%), Gaps = 15/204 (7%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGS+ DPGE+T+ +        SF+EFQ+QTSLMTSCTLLW+ELSDHFTSLEQ+L++KSE
Sbjct  1    MGSVPDPGELTELAQ------PSFEEFQKQTSLMTSCTLLWQELSDHFTSLEQNLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEF-------GNAG  422
            ALK  ++TLD QT+ SLE L++RE +I  S+ I   KV E  RAAL          G+  
Sbjct  55   ALKQMIETLDNQTQTSLESLKRREVTIDHSVEIVAGKVGERARAALESLEKARDGCGDGS  114

Query  423  GSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKF  602
              +  +VD+  GLL  L+S C++MD+R FW+FV  RKKELE+LRS+I  AL DCVDP   
Sbjct  115  NDDSGDVDDEEGLLSALKSLCLKMDARGFWNFVTARKKELENLRSKIPAALVDCVDPAML  174

Query  603  VMEAISEVFPVDKRELKSERSNDL  674
            V+EAISEVFPVD R  K   SND 
Sbjct  175  VLEAISEVFPVDTRGDKV--SNDY  196



>ref|XP_006283490.1| hypothetical protein CARUB_v10004542mg [Capsella rubella]
 gb|EOA16388.1| hypothetical protein CARUB_v10004542mg [Capsella rubella]
Length=540

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 141/206 (68%), Gaps = 15/206 (7%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            M S  DPGE+ ++         SF EFQ+Q SLM+SC LLWKELS+HFTS+EQ L++KSE
Sbjct  1    MESSPDPGELVESPQ------PSFFEFQKQASLMSSCNLLWKELSEHFTSMEQSLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEF------GNAGG  425
            ALK  ++TLD QT+ S+E+L+ RE +I  S+ I   KVDE  RAAL         G+  G
Sbjct  55   ALKQMIETLDNQTQTSIELLKHREVTIDRSVEIAAGKVDERARAALESLEKARDGGSTAG  114

Query  426  SEE---PEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPP  596
             E+    EVD+  GLL  L+S C++MDSR FW FVI RKKELE+LRS+I  AL DCVDPP
Sbjct  115  DEDDGAGEVDDGDGLLSALKSLCLKMDSRGFWGFVIARKKELENLRSQIPAALVDCVDPP  174

Query  597  KFVMEAISEVFPVDKRELKSERSNDL  674
            K V+EA+SEVFPVDKR    + SND 
Sbjct  175  KLVLEAVSEVFPVDKRGGGEKVSNDF  200



>ref|XP_006414627.1| hypothetical protein EUTSA_v10024868mg [Eutrema salsugineum]
 gb|ESQ56080.1| hypothetical protein EUTSA_v10024868mg [Eutrema salsugineum]
Length=539

 Score =   213 bits (542),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 140/192 (73%), Gaps = 11/192 (6%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGS  DPGE+ +++        SFDEFQRQTSLMTSC LLWKELS+HFTSLEQ+LL+KSE
Sbjct  1    MGSPHDPGELIESAQ------PSFDEFQRQTSLMTSCNLLWKELSEHFTSLEQNLLKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL--VEFGNAGGSEEP  437
            ALK  ++TLD QTK S+E+L  RE +I  S+ I   KV+E  RAAL  +E    GGS + 
Sbjct  55   ALKQMIETLDNQTKTSIELLNHREVTIDKSVEIAAGKVEERVRAALESLEKARDGGSSDG  114

Query  438  EVDNSAG---LLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVM  608
            + +   G   LL  L+S C++MD+R FW FVI RKKELE+LRS+I  AL DCVDPPK V+
Sbjct  115  DGEVDDGDGLLLSALKSLCLKMDARGFWEFVIARKKELENLRSQIPVALVDCVDPPKLVL  174

Query  609  EAISEVFPVDKR  644
            EA+SEVFPVD+R
Sbjct  175  EAVSEVFPVDRR  186



>ref|XP_010533277.1| PREDICTED: FRIGIDA-like protein 4a [Tarenaya hassleriana]
Length=539

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 143/196 (73%), Gaps = 11/196 (6%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +         FDEFQRQTSLMTSCTL WKELSDHFTSLEQ+L++KSE
Sbjct  1    MGSIPDPGELTELAE------PGFDEFQRQTSLMTSCTLRWKELSDHFTSLEQNLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEF-----GNAGGS  428
            ALK  ++TLD QT+ SLE L+ RE +I  S+ I L KV+ES +AALV       G +G  
Sbjct  55   ALKQMIETLDNQTQASLESLKHREVTIDDSVEIALGKVEESAKAALVSLEKAGGGGSGAE  114

Query  429  EEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVM  608
            +  EV++  GLL  L+SFC++M+SR  W  V  RKKELE+LR++I  AL +CVDP KFV+
Sbjct  115  DGGEVEDGDGLLSLLKSFCLKMESRELWKVVTARKKELENLRAQIPAALVECVDPAKFVL  174

Query  609  EAISEVFPVDKRELKS  656
            EAISEVFPVDKR  KS
Sbjct  175  EAISEVFPVDKRAGKS  190



>emb|CAB10269.1| hydroxyproline-rich glycoprotein homolog [Arabidopsis thaliana]
 emb|CAB78532.1| hydroxyproline-rich glycoprotein homolog [Arabidopsis thaliana]
Length=507

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 141/200 (71%), Gaps = 9/200 (5%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            M S  DPGE+ ++S        SF EFQ+Q SLMTSC LLWKELS+HFTS+EQ+L++KSE
Sbjct  1    MESSPDPGELIKSSQ------PSFFEFQKQASLMTSCNLLWKELSEHFTSMEQNLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNA---GGSEE  434
            AL+  ++TLD QT+ S+E+L+ RE +I  S+ I   KV+E  RAAL     A   G  + 
Sbjct  55   ALRQMIETLDNQTQSSIELLKHREVTIDHSVEIAEGKVEERVRAALDSLEKARDCGDEDT  114

Query  435  PEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEA  614
             EVD+  GLL  L+S C++MD+R FW FVI RKKELE+LRS+I  AL DCVDPPK V+EA
Sbjct  115  GEVDDGDGLLSALKSLCLKMDARGFWGFVIARKKELENLRSQIPVALVDCVDPPKLVLEA  174

Query  615  ISEVFPVDKRELKSERSNDL  674
            +SEVFPVDKR    + SND 
Sbjct  175  VSEVFPVDKRGGGEKVSNDF  194



>emb|CDY46317.1| BnaC01g31510D [Brassica napus]
Length=525

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 139/197 (71%), Gaps = 10/197 (5%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGS++DPGE+T+ +        SF+EFQ+QTSLMTSCTLLWKELSDHFT+LE++L++KSE
Sbjct  1    MGSVSDPGELTELAQ------PSFEEFQKQTSLMTSCTLLWKELSDHFTTLEENLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            ALK  +  LD+QT+ SLE L++RE +I  S+ I  +   ES   A     N GG    EV
Sbjct  55   ALKEMIGALDSQTQSSLESLKRREATIERSVEIRARAALESLEKARDGGDNGGG----EV  110

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            D+  GLL  L+S C++MD+R FWSFV  RKKELE LRS+I  AL DCVDP   V+EAISE
Sbjct  111  DDEEGLLSALKSLCLKMDARGFWSFVTARKKELEGLRSQIPAALVDCVDPAMLVLEAISE  170

Query  624  VFPVDKRELKSERSNDL  674
            VFPVDKR    + +ND 
Sbjct  171  VFPVDKRGSGEKMTNDF  187



>ref|NP_567447.1| FRIGIDA-like protein [Arabidopsis thaliana]
 sp|Q940H8.1|FRL4B_ARATH RecName: Full=FRIGIDA-like protein 4b [Arabidopsis thaliana]
 gb|AAK96809.1| hydroxyproline-rich glycoprotein homolog [Arabidopsis thaliana]
 gb|AAM10105.1| hydroxyproline-rich glycoprotein homolog [Arabidopsis thaliana]
 gb|AAM63474.1| hydroxyproline-rich glycoprotein-like protein [Arabidopsis thaliana]
 gb|AEE83517.1| FRIGIDA-like protein [Arabidopsis thaliana]
Length=532

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 141/200 (71%), Gaps = 9/200 (5%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            M S  DPGE+ ++S        SF EFQ+Q SLMTSC LLWKELS+HFTS+EQ+L++KSE
Sbjct  1    MESSPDPGELIKSSQ------PSFFEFQKQASLMTSCNLLWKELSEHFTSMEQNLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNA---GGSEE  434
            AL+  ++TLD QT+ S+E+L+ RE +I  S+ I   KV+E  RAAL     A   G  + 
Sbjct  55   ALRQMIETLDNQTQSSIELLKHREVTIDHSVEIAEGKVEERVRAALDSLEKARDCGDEDT  114

Query  435  PEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEA  614
             EVD+  GLL  L+S C++MD+R FW FVI RKKELE+LRS+I  AL DCVDPPK V+EA
Sbjct  115  GEVDDGDGLLSALKSLCLKMDARGFWGFVIARKKELENLRSQIPVALVDCVDPPKLVLEA  174

Query  615  ISEVFPVDKRELKSERSNDL  674
            +SEVFPVDKR    + SND 
Sbjct  175  VSEVFPVDKRGGGEKVSNDF  194



>gb|KFK43732.1| hypothetical protein AALP_AA1G165500 [Arabis alpina]
Length=531

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 143/198 (72%), Gaps = 7/198 (4%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            M S  DPGE+T+ +        S+DEFQ+QTSLMTSC+LLW+ELSDHF S+E++L++KSE
Sbjct  1    MESSLDPGELTELTQ------PSYDEFQKQTSLMTSCSLLWQELSDHFISMEKNLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            ALK  ++TLDTQT+ S+E+L++RE +I  S+ I   KV+E  RAAL     A   E  EV
Sbjct  55   ALKQMIETLDTQTQTSIELLKRREVTIDHSVEIAAAKVEERARAALESLEKARDDETGEV  114

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            D+   LL  L+  C++MD+R FW FVI RKKELE+LR +I  AL DCVDPPK V+EA+SE
Sbjct  115  DDGDELLNSLKLLCMKMDARGFWDFVITRKKELENLRLKIPVALVDCVDPPKLVLEAVSE  174

Query  624  VFPVDKRELKSER-SNDL  674
            VFPVDKR +  E+ +ND 
Sbjct  175  VFPVDKRIVVGEKVTNDF  192



>gb|KJB38150.1| hypothetical protein B456_006G239300 [Gossypium raimondii]
Length=391

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 146/198 (74%), Gaps = 9/198 (5%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDH  SLEQ+L+++SE
Sbjct  1    MGSIPDPGELTELTQ------PSFDEFQRQTSLMTSCTLLWKELSDHINSLEQNLMKQSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFG-NAGGSEEPE  440
             LK K++ LD++TK SL+ L+KRE SI  S+ I L +V+ + +AA+   G +   + + E
Sbjct  55   TLKRKIEALDSETKASLDSLKKRELSIEDSVKIALSRVEFNTKAAMRTLGDDVEDNPDGE  114

Query  441  VDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAIS  620
            VD+  GLL  L+S C++M+++ FWSFVI +KKE++ LR +I  AL +C+DP +FVMEAIS
Sbjct  115  VDDGDGLLQHLKSTCLKMEAKEFWSFVIGKKKEIDLLREKIPAALSECIDPARFVMEAIS  174

Query  621  EVFPVDKRELKSERSNDL  674
            EVFPVDKR   +E  +DL
Sbjct  175  EVFPVDKR--GNEGGSDL  190



>ref|XP_002868244.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH44503.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=532

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 141/200 (71%), Gaps = 9/200 (5%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            M S  DPGE+ +++        SF EFQ+QTSLMTSC LLWKELS+HFTS+EQ+L++KSE
Sbjct  1    MESSPDPGELIESAQ------PSFVEFQKQTSLMTSCNLLWKELSEHFTSMEQNLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEE---  434
            ALK  ++TLD QT+ S+E+L+ RE +I  S+ I   KV+E  RA L     A  ++E   
Sbjct  55   ALKQMIETLDNQTQNSIELLKHREVTIDHSVEIAAGKVEERARAVLDSLEKARAADEDDT  114

Query  435  PEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEA  614
             EVD+  G+L  L+  C++MD+R FW FVI RKKE+E+LRS+I  AL DCVDPPK V+EA
Sbjct  115  GEVDDGDGILSALKLLCLKMDARGFWEFVIARKKEVENLRSQIPVALVDCVDPPKLVLEA  174

Query  615  ISEVFPVDKRELKSERSNDL  674
            +SEVFPVDKR    + SND 
Sbjct  175  VSEVFPVDKRGGGEKVSNDF  194



>gb|KJB38151.1| hypothetical protein B456_006G239300 [Gossypium raimondii]
Length=520

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 146/198 (74%), Gaps = 9/198 (5%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDH  SLEQ+L+++SE
Sbjct  1    MGSIPDPGELTELTQ------PSFDEFQRQTSLMTSCTLLWKELSDHINSLEQNLMKQSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFG-NAGGSEEPE  440
             LK K++ LD++TK SL+ L+KRE SI  S+ I L +V+ + +AA+   G +   + + E
Sbjct  55   TLKRKIEALDSETKASLDSLKKRELSIEDSVKIALSRVEFNTKAAMRTLGDDVEDNPDGE  114

Query  441  VDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAIS  620
            VD+  GLL  L+S C++M+++ FWSFVI +KKE++ LR +I  AL +C+DP +FVMEAIS
Sbjct  115  VDDGDGLLQHLKSTCLKMEAKEFWSFVIGKKKEIDLLREKIPAALSECIDPARFVMEAIS  174

Query  621  EVFPVDKRELKSERSNDL  674
            EVFPVDKR   +E  +DL
Sbjct  175  EVFPVDKR--GNEGGSDL  190



>ref|XP_010525189.1| PREDICTED: FRIGIDA-like protein 4a [Tarenaya hassleriana]
Length=548

 Score =   208 bits (530),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 147/196 (75%), Gaps = 11/196 (6%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDHFT LEQ+L++KSE
Sbjct  1    MGSIPDPGELTELTQ------PSFDEFQRQTSLMTSCTLLWKELSDHFTLLEQNLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALV-----EFGNAGGS  428
            ALK  ++TLD QT+ SLE L+ RE +I  S+ I + K +ES ++AL+       G +G  
Sbjct  55   ALKQMIETLDNQTQASLESLKHREVTIEDSVKIAMGKAEESAKSALMLLEKAGDGGSGAD  114

Query  429  EEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVM  608
            +  EVD+  GLL  L+SFC++MD+R FW+FV +RKKELE+LR++I  AL +CVDP KFV+
Sbjct  115  DGGEVDDGDGLLSLLKSFCLKMDARKFWNFVTMRKKELENLRAQIPAALVECVDPSKFVL  174

Query  609  EAISEVFPVDKRELKS  656
            EAISEVFPVDKR  KS
Sbjct  175  EAISEVFPVDKRAGKS  190



>ref|XP_010551726.1| PREDICTED: FRIGIDA-like protein 4a [Tarenaya hassleriana]
Length=525

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 145/196 (74%), Gaps = 11/196 (6%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTL+WKELSDHFTSLEQ+L+++S+
Sbjct  1    MGSIIDPGELTELTP------PSFDEFQRQTSLMTSCTLMWKELSDHFTSLEQNLMKRSD  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEF-----GNAGGS  428
            ALK  ++TLD QT+ SLE L++RE +I  S+ I + KV E+ +AALV       G +G  
Sbjct  55   ALKQMIETLDNQTQASLESLKRREVTIDDSVEIAMGKVKENAKAALVSLQKAGDGGSGAD  114

Query  429  EEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVM  608
            +  EVD+  GLL  L+SFC++MD R FW+FV  RKKELE+LR+ I  AL +CVDP KFV+
Sbjct  115  DGGEVDDGDGLLALLKSFCLKMDVRGFWNFVTARKKELENLRALIPMALVECVDPSKFVL  174

Query  609  EAISEVFPVDKRELKS  656
            E ISEVFPVDKR  KS
Sbjct  175  ETISEVFPVDKRAGKS  190



>gb|KHG22505.1| Protein FRIGIDA -like protein [Gossypium arboreum]
Length=520

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 146/198 (74%), Gaps = 9/198 (5%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +        SF+EFQRQTSLMTSCTLLWKELSDH  SLEQ+L+++SE
Sbjct  1    MGSIPDPGELTELTQ------PSFEEFQRQTSLMTSCTLLWKELSDHINSLEQNLMKQSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFG-NAGGSEEPE  440
             LK K++ LD++TK SL+ L+KRE SI  S+ I L +V+ + +AA+   G +   + + E
Sbjct  55   TLKRKIEALDSETKASLDSLKKRELSIEDSVKIALSRVEFNTKAAMRTLGDDVEDNPDGE  114

Query  441  VDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAIS  620
            VD+  GLL  L+S C++M+++ FWSFVI +KKE++ LR +I  AL +C+DP +FVMEAIS
Sbjct  115  VDDGDGLLQHLKSTCLKMEAKEFWSFVIGKKKEIDLLREKIPAALSECIDPARFVMEAIS  174

Query  621  EVFPVDKRELKSERSNDL  674
            EVFPVDKR   +E  +DL
Sbjct  175  EVFPVDKR--GNEGGSDL  190



>gb|KHG27689.1| Protein FRIGIDA -like protein [Gossypium arboreum]
Length=516

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 144/197 (73%), Gaps = 10/197 (5%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+T+ +        SFDEFQ QTSLMT CTL+WKELSDH +SLE +L+R+SE
Sbjct  1    MGSIPDPGELTELTH------PSFDEFQHQTSLMTGCTLMWKELSDHISSLEANLIRQSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            ALK K++ LD++TK SL+ L+KRE SI  S+ I + +V+  K+ AL    +   + + EV
Sbjct  55   ALKRKIEALDSETKTSLDSLKKRELSIDDSVKIAVNRVELLKKDALKTLND--DNPDGEV  112

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            DN  GLL  L+S C++M+++ FW+FV  RKK++E LR +I +AL +C+DP KFVMEAISE
Sbjct  113  DNGDGLLQILKSTCLRMEAKEFWNFVSGRKKDIELLREKIPEALSECIDPAKFVMEAISE  172

Query  624  VFPVDKRELKSERSNDL  674
            VFPVD+R   +ER NDL
Sbjct  173  VFPVDER--GNERGNDL  187



>ref|XP_009108852.1| PREDICTED: FRIGIDA-like protein 4a [Brassica rapa]
Length=534

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 141/202 (70%), Gaps = 11/202 (5%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGS++DPGE+T+ +        SF+EFQ+QTSLMTSCTLLWKELSDHFT+LE++L++KSE
Sbjct  1    MGSVSDPGELTELAQ------PSFEEFQKQTSLMTSCTLLWKELSDHFTTLEENLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNA-----GGS  428
            ALK  +  LD+QT+ SLE L++RE +I  S+ I   KV E  RAAL     A      G 
Sbjct  55   ALKEMIGALDSQTQSSLESLKRREATIERSVEIVAGKVGERARAALESLEKARGGGDDGG  114

Query  429  EEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVM  608
               EVD+  GLL  L+S C++MD+R FWSFV  RKKELE LRS+I  AL DCVDP   V+
Sbjct  115  GGGEVDDEEGLLSTLKSLCLKMDARGFWSFVTARKKELEGLRSQIPAALVDCVDPAMLVL  174

Query  609  EAISEVFPVDKRELKSERSNDL  674
            EAISEVFPVDKR    + +ND 
Sbjct  175  EAISEVFPVDKRGSGEKMTNDF  196



>gb|KJB28346.1| hypothetical protein B456_005G042900 [Gossypium raimondii]
Length=830

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 144/197 (73%), Gaps = 10/197 (5%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGS+ +PGE+T+ +        SFDEFQ QTSLMT CTL+WKELSDH +SLE +L+R+SE
Sbjct  1    MGSVPNPGELTELTQ------PSFDEFQHQTSLMTGCTLMWKELSDHISSLEANLMRQSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            ALK K++ LD++TK SL+ L+KRE SI  S+ I + +V+  K+ AL    +   + + EV
Sbjct  55   ALKRKIEALDSETKTSLDSLKKRELSIDDSVKIAVNRVELLKKDALKTLND--DNPDGEV  112

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            DN  GLL  L+S C++M+++ FW+FV  RKK++E LR +I +AL +C+DP KFVMEAISE
Sbjct  113  DNGDGLLQILKSTCLRMEAKEFWNFVSGRKKDIELLREKIPEALSECIDPAKFVMEAISE  172

Query  624  VFPVDKRELKSERSNDL  674
            VFPVDKR   +ER NDL
Sbjct  173  VFPVDKR--GNERGNDL  187



>ref|XP_010449973.1| PREDICTED: FRIGIDA-like protein 4b [Camelina sativa]
Length=544

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 140/211 (66%), Gaps = 20/211 (9%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            M S  DPGE+ +++        SF EFQ+Q SLMTSC LLWKELS+HFTS+EQ L++KSE
Sbjct  1    MESSPDPGELVESAQ------PSFFEFQKQASLMTSCNLLWKELSEHFTSMEQSLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL--VEFGNAGG----  425
            ALK  ++TLD QT+ S+E+L+ RE +I  S+ I   KV+E  RAAL  +E    GG    
Sbjct  55   ALKQMIETLDNQTQTSIELLKHREVTIDHSVEIASGKVEERARAALESLEKARDGGDTAT  114

Query  426  -----SEEPEVDNSAG---LLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGD  581
                  +  EVD+  G   L   L+S C++MD+R FW FVI RKKELE+LRS+I  AL D
Sbjct  115  ANDNNDDTGEVDDGDGEGILSAALKSICLKMDARGFWGFVIARKKELENLRSQIPAALVD  174

Query  582  CVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
            CVDPPK V+EA+SEVFP DKR    + SND 
Sbjct  175  CVDPPKLVLEAVSEVFPADKRGGGEKVSNDF  205



>emb|CDY34252.1| BnaA01g24690D [Brassica napus]
Length=522

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 132/197 (67%), Gaps = 13/197 (7%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGS++DPGE+T+ +        SF+EFQ+QTSLMTSCTLLWKELSDHFT+LE++L++KSE
Sbjct  1    MGSVSDPGELTELAQ------PSFEEFQKQTSLMTSCTLLWKELSDHFTTLEENLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            ALK  +  LD+QT+ SLE L++RE +I  S+ I   KV E  RAAL     A        
Sbjct  55   ALKEMIGALDSQTQSSLESLKRREATIERSVEIVAGKVGERARAALESLEKAR-------  107

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            D          S C++MD+R FWSFV  RKKELE LRS+I  AL DCVDP   V+EAISE
Sbjct  108  DGGDDGGGGGESLCLKMDARGFWSFVTARKKELEGLRSQIPAALVDCVDPAMLVLEAISE  167

Query  624  VFPVDKRELKSERSNDL  674
            VFPVDKR    + +ND 
Sbjct  168  VFPVDKRGSGEKMTNDF  184



>ref|XP_008447152.1| PREDICTED: FRIGIDA-like protein 4a [Cucumis melo]
Length=517

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 142/198 (72%), Gaps = 10/198 (5%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MG+I+DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHFT+LEQDLL+KSE
Sbjct  1    MGTISDPGELSELTH------PSFDEFQRQTSLMTSCTLLWKELSDHFTNLEQDLLKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            AL+ K+QTLD QTK+SL+ LEKRE SI  S+ I L KV++S  AAL       G E  EV
Sbjct  55   ALRHKIQTLDHQTKESLDELEKREVSIQGSVQIALGKVEKSMEAALKAL-EKDGDENGEV  113

Query  444  DNSAGLLLKLRSFCVQMDSRSFWSFVIVR-KKELESLRSEIRKALGDCVDPPKFVMEAIS  620
            D+  GLLLKL+SFC++MDS   W   + R  +E          AL +C+DPP+FV+EAIS
Sbjct  114  DDDDGLLLKLKSFCLEMDSG--WFLEVYRLVREXXXXXXXXXXALAECIDPPRFVLEAIS  171

Query  621  EVFPVDKRELKSERSNDL  674
            EVFP+DKR  KS+  NDL
Sbjct  172  EVFPLDKRGEKSDGGNDL  189



>ref|XP_010440374.1| PREDICTED: FRIGIDA-like protein 4b [Camelina sativa]
Length=549

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 138/215 (64%), Gaps = 24/215 (11%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            M +  DPGE+ +++        SF EFQ+Q SLMTSC LLWKELS+HFTS+EQ L++KSE
Sbjct  1    MEASPDPGELVESAQ------PSFFEFQKQASLMTSCNLLWKELSEHFTSMEQSLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL--VEFGNAGGSEEP  437
            ALK  ++TLDTQT+ S+E+L+ RE +I  S+ I   KV+E  RAAL  +E    GG    
Sbjct  55   ALKQMIETLDTQTQTSIELLKHREVTIDHSVEIAAGKVEERARAALESLEKARDGGDTAT  114

Query  438  EVDNSAG----------------LLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRK  569
              D+                   L   L+S C++MD+R FW FVI RKKELE+LRS+I  
Sbjct  115  ANDDDDDTGEVDDGDGDGDGEGILSAALKSICLKMDARGFWGFVIARKKELENLRSQIPA  174

Query  570  ALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
            AL DCVDPPK V+EA+SEVFPVDKR    + SND 
Sbjct  175  ALVDCVDPPKLVLEAVSEVFPVDKRGGGEKVSNDF  209



>ref|XP_010435051.1| PREDICTED: FRIGIDA-like protein 4b [Camelina sativa]
Length=548

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 133/214 (62%), Gaps = 23/214 (11%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            M S  DPGE+ ++         SF EFQ+Q SLMTSC LLWKELS+HFTS+EQ L++KSE
Sbjct  1    MESSPDPGELVESDQ------PSFFEFQKQASLMTSCNLLWKELSEHFTSMEQSLMKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  443
            ALK  ++TLD QT+ S+E+L+ RE +I  S+ I   KV+E  RAAL     A    +   
Sbjct  55   ALKQMIETLDNQTQTSIELLKHREVTIDHSVEIAAGKVEERARAALESLEKARDGGDTAT  114

Query  444  DNSAG-----------------LLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKA  572
             N                    L   L+S C++MD+R FW FVI RKKELE+LRS+I  A
Sbjct  115  ANDDDDDDTGEVDDGDGDGEGILSAALKSICLKMDARGFWGFVIARKKELENLRSQIPAA  174

Query  573  LGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
            L DCVDPPK V+EA+SEVFPVDKR    + SND 
Sbjct  175  LVDCVDPPKLVLEAVSEVFPVDKRGGGEKVSNDF  208



>gb|AAL31182.1| AT4g14900/dl3490c [Arabidopsis thaliana]
Length=505

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 122/167 (73%), Gaps = 3/167 (2%)
 Frame = +3

Query  183  MTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISI  362
            MTSC LLWKELS+HFTS+EQ+L++KSEAL+  ++TLD QT+ S+E+L+ RE +I  S+ I
Sbjct  1    MTSCNLLWKELSEHFTSMEQNLMKKSEALRQMIETLDNQTQSSIELLKHREVTIDHSVEI  60

Query  363  TLKKVDESKRAALVEFGNA---GGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRK  533
               KV+E  RAAL     A   G  +  EVD+  GLL  L+S C++MD+R FW FVI RK
Sbjct  61   AEGKVEERVRAALDSLEKARDCGDEDTGEVDDGDGLLSALKSLCLKMDARGFWGFVIARK  120

Query  534  KELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
            KELE+LRS+I  AL DCVDPPK V+EA+SEVFPVDKR    + SND 
Sbjct  121  KELENLRSQIPVALVDCVDPPKLVLEAVSEVFPVDKRGGGEKVSNDF  167



>ref|XP_008778905.1| PREDICTED: FRIGIDA-like protein 4a [Phoenix dactylifera]
Length=535

 Score =   181 bits (459),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 123/175 (70%), Gaps = 2/175 (1%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            SF+E +RQ  L+TSCTLLWKELSDHF+SLE+DL  KSE+L++K Q+LD  T++SL  L  
Sbjct  16   SFEELERQRELITSCTLLWKELSDHFSSLERDLQLKSESLRSKRQSLDLSTQRSLASLHH  75

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSF  509
            RE SI  ++++ L KVDE + A L+           + +N   L  KLRSFC +MDS  F
Sbjct  76   RELSIDGAVALALAKVDERRDATLLALSFP--VSPLDSNNDHDLPGKLRSFCSRMDSDGF  133

Query  510  WSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
            W  V+ ++KE+E LRSE+  AL DC+DPPKFVM+AIS+VFPVD+R   ++  NDL
Sbjct  134  WDLVVSKRKEVELLRSELPLALADCIDPPKFVMDAISKVFPVDRRGAATKSPNDL  188



>gb|EPS62727.1| hypothetical protein M569_12062, partial [Genlisea aurea]
Length=454

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 124/162 (77%), Gaps = 6/162 (4%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            SF++FQRQTSLMTSCTLLWKELSDHF SLEQDL+RKS+ALK +LQ L+  T +SL+ L+ 
Sbjct  1    SFEDFQRQTSLMTSCTLLWKELSDHFYSLEQDLIRKSDALKVRLQDLNDHTSRSLKALDS  60

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSF  509
            RE+SI+ SIS  L+K++E+ + +L         E P+VD+S G+L+ L+ FC +M  +  
Sbjct  61   RESSISRSISAALQKLEENAKMSL------DVCENPQVDDSEGVLMILKGFCRRMAVKDL  114

Query  510  WSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPV  635
            W FV  RKK+LE  RSE+ KAL DC+DPP+FV+EAISEVFPV
Sbjct  115  WIFVTSRKKDLELFRSELPKALADCIDPPRFVLEAISEVFPV  156



>ref|XP_010909467.1| PREDICTED: FRIGIDA-like protein 4a [Elaeis guineensis]
Length=534

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 122/175 (70%), Gaps = 2/175 (1%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            SF+E +RQ  L+TSCTLLWKELSDHF+SLE+DL  KSE+L++K Q+LD  T++SL  L  
Sbjct  16   SFEELERQRELITSCTLLWKELSDHFSSLERDLQLKSESLRSKRQSLDLSTQRSLASLHH  75

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSF  509
            RE SI  ++ + L KV+E + AAL+   +       + +N   L  KLRSFC  MDS +F
Sbjct  76   RELSIDGAVDLALAKVNERRDAALLALSSPASPL--DSNNGNDLPGKLRSFCTTMDSDAF  133

Query  510  WSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
            W  V+ ++KE+E LRSE+  AL +C+DPPKFVM+AI +VFPVD R   ++  NDL
Sbjct  134  WELVVSKRKEVELLRSELPLALANCIDPPKFVMDAIFKVFPVDHRGTAAKSPNDL  188



>ref|XP_010906476.1| PREDICTED: FRIGIDA-like protein 4a [Elaeis guineensis]
Length=541

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 118/166 (71%), Gaps = 7/166 (4%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            SFDE +RQ  L+TSCTLLWKELSDHF+S+E+DL   SE+L++K Q+LD  T++SL  L +
Sbjct  16   SFDELERQRELITSCTLLWKELSDHFSSVERDLQLWSESLRSKRQSLDLSTQRSLASLHR  75

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDN---SAGLLLKLRSFCVQMDS  500
            RE SI +++ + L KV E + AAL+       S    VDN   +  L  KLRSFC +MDS
Sbjct  76   RELSIDSAVDLALAKVGERRDAALLAL----SSPASPVDNNNDTNDLPGKLRSFCTRMDS  131

Query  501  RSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVD  638
             +FW  V+ ++KE+E LRSE+  AL DC+DP KFVM+AIS+VFPVD
Sbjct  132  DAFWDLVVSKRKEVELLRSELPPALADCIDPAKFVMDAISKVFPVD  177



>gb|AGV54236.1| hydroxyproline-rich glycoprotein [Phaseolus vulgaris]
Length=523

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 114/155 (74%), Gaps = 13/155 (8%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHF+SLE+DL  KSE
Sbjct  1    MGSIPDPGELSELTQ------PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEEDLKHKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEF----GNAGGSE  431
            ALK K++TLDT T  SL +L++RETS+ A++ I L+ +D  + AAL  F     + GG  
Sbjct  55   ALKGKMRTLDTATSDSLRLLDRRETSLDATLQIALRTLDTRRTAALSSFLDDHADDGGG-  113

Query  432  EPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKK  536
              EVD++ GL+LKL+SFC++MD+  FW+F+  R++
Sbjct  114  --EVDDATGLVLKLKSFCLRMDAFGFWTFLTPRRR  146



>ref|XP_008796767.1| PREDICTED: FRIGIDA-like protein 4a [Phoenix dactylifera]
Length=538

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 122/180 (68%), Gaps = 9/180 (5%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            SF+E +RQ  L+TSCTLLWKELSDHF+S+E+DL  +SE+L++K Q+LD  T+ SL  L +
Sbjct  16   SFEELERQRELITSCTLLWKELSDHFSSMERDLQLRSESLRSKRQSLDLSTQSSLASLHR  75

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDN---SAGLLLKLRSFCVQMDS  500
            RE SI  ++ + L KV+E   AAL+       S    VDN   +  L  KLRSFC +MDS
Sbjct  76   RELSIDGAVDLALAKVEERCDAALLAL----SSPASPVDNNNDTNDLPGKLRSFCTRMDS  131

Query  501  RSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRE--LKSERSNDL  674
             + W  V+ ++KE+E LRSE+  AL DC+DP KFVM AIS+VFPVD+R     ++  NDL
Sbjct  132  DAVWDLVVSKRKEVELLRSELPLALADCIDPAKFVMNAISKVFPVDRRPPAAAAKSPNDL  191



>ref|XP_009408489.1| PREDICTED: FRIGIDA-like protein 4a [Musa acuminata subsp. malaccensis]
Length=529

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 125/175 (71%), Gaps = 7/175 (4%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            SF E ++Q  L+T CTLLWKELSDHF++LE+ +  KSEAL++K ++LD  T+++L+ L +
Sbjct  17   SFAELEKQRELITCCTLLWKELSDHFSTLERGIEIKSEALRSKRESLDGSTRRTLDSLRR  76

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSF  509
            RE SI  ++ + L K+DE +R A V+   A  +E  E+D    L  KLRSFC +MD  +F
Sbjct  77   RELSIDGAVDLALAKLDE-RRTAAVQALAASSAEANELD----LAGKLRSFCTKMDFGAF  131

Query  510  WSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
            +  V+ ++KE+E LRS++  AL DC+DP KFV++AISEVFPVDKR +KS   NDL
Sbjct  132  FDLVVAKRKEVELLRSQLPAALEDCIDPAKFVIDAISEVFPVDKRPVKS--PNDL  184



>emb|CDY38318.1| BnaC05g30110D [Brassica napus]
Length=531

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 118/169 (70%), Gaps = 5/169 (3%)
 Frame = +3

Query  183  MTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISI  362
            MTSC+L+WK+L+DHFT+LEQ+L++KSEALK  ++TLD QT+ SLE L++RE +I  S+ I
Sbjct  1    MTSCSLMWKDLTDHFTTLEQNLMKKSEALKKMIETLDNQTQTSLESLKRREVTIDRSVEI  60

Query  363  TLKKVDESKRAALVEFGNA-----GGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIV  527
              +KV +  RAAL     A         E + D+  GLL  L+S C +MD+R FWSFV  
Sbjct  61   VAEKVGKRVRAALESLEKARDGGDDDDSEVDEDDEEGLLSALKSLCWKMDARGFWSFVTA  120

Query  528  RKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
            RKKELE+ RS+I  ALGDCVDP   V+EAISEVFPV+KRE   +  ND 
Sbjct  121  RKKELENPRSKIPAALGDCVDPAMLVLEAISEVFPVEKRESGEKMMNDF  169



>ref|XP_009344103.1| PREDICTED: FRIGIDA-like protein 4a, partial [Pyrus x bretschneideri]
Length=138

 Score =   156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 104/144 (72%), Gaps = 7/144 (5%)
 Frame = +3

Query  84   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  263
            MGSI DPGEVT+ +        SFDEFQRQTSLMTSCTLLWKELSDHF+SLEQ+LL+KSE
Sbjct  1    MGSIPDPGEVTELTP------PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEQNLLKKSE  54

Query  264  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEE-PE  440
            A+K K+Q L+ +TK SL+ LE+RE SI     + L KV++SK AAL     A   +E  E
Sbjct  55   AIKLKIQNLEHETKASLDELEQREVSIRDIFEVALGKVEKSKEAALKVLKRARSDDEYGE  114

Query  441  VDNSAGLLLKLRSFCVQMDSRSFW  512
            VD+  GLL+ L+S C++MDS  FW
Sbjct  115  VDDGEGLLMNLKSLCLKMDSGGFW  138



>ref|XP_009398870.1| PREDICTED: FRIGIDA-like protein 4b [Musa acuminata subsp. malaccensis]
Length=307

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 121/175 (69%), Gaps = 7/175 (4%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            SF E ++Q  L+TSCTLLWKELSDHF+ L+Q L  KSEAL++K Q+LD  T  +L+ L +
Sbjct  17   SFAELEKQRELITSCTLLWKELSDHFSILQQGLEIKSEALRSKRQSLDASTGHALDSLRR  76

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSF  509
            RE SI +++ + + K+DE +RAA VE  +A  +   ++D    L  KLRS C +MD   F
Sbjct  77   RELSIDSAVELAIAKLDE-RRAAAVEALSATAAGGDDLD----LAEKLRSLCTKMDFNGF  131

Query  510  WSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
            +  V+ ++KE+E LR E+  AL +C+DP KFVM+A+S VFPVDKR +KS   NDL
Sbjct  132  FDLVVAKRKEVELLRLELPVALANCIDPAKFVMDAVSGVFPVDKRPVKS--PNDL  184



>gb|KCW60755.1| hypothetical protein EUGRSUZ_H03480 [Eucalyptus grandis]
Length=477

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 109/148 (74%), Gaps = 8/148 (5%)
 Frame = +3

Query  249  LRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGS  428
            ++KSEALK KL+ LD QTK++L VL++RET+I  S+ I L+KV++SK AAL      GG 
Sbjct  1    MKKSEALKQKLRALDDQTKKTLTVLDERETTIDGSVEIVLEKVEKSKEAALGALERGGGR  60

Query  429  E-EP-----EVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVD  590
            + EP     EVD+  GLL+KLRSFC++MDS+ FW FV  +KKEL+ +R ++  AL DCVD
Sbjct  61   DVEPGSPGGEVDDGEGLLMKLRSFCLRMDSKEFWRFVTGKKKELDLMREKMHLALVDCVD  120

Query  591  PPKFVMEAISEVFPVDKRELKSERSNDL  674
            P KFV+EAISEVFPVDKR    +R NDL
Sbjct  121  PAKFVLEAISEVFPVDKR--GGDRGNDL  146



>gb|KCW60756.1| hypothetical protein EUGRSUZ_H03480 [Eucalyptus grandis]
Length=511

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 109/148 (74%), Gaps = 8/148 (5%)
 Frame = +3

Query  249  LRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGS  428
            ++KSEALK KL+ LD QTK++L VL++RET+I  S+ I L+KV++SK AAL      GG 
Sbjct  1    MKKSEALKQKLRALDDQTKKTLTVLDERETTIDGSVEIVLEKVEKSKEAALGALERGGGR  60

Query  429  E-EP-----EVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVD  590
            + EP     EVD+  GLL+KLRSFC++MDS+ FW FV  +KKEL+ +R ++  AL DCVD
Sbjct  61   DVEPGSPGGEVDDGEGLLMKLRSFCLRMDSKEFWRFVTGKKKELDLMREKMHLALVDCVD  120

Query  591  PPKFVMEAISEVFPVDKRELKSERSNDL  674
            P KFV+EAISEVFPVDKR    +R NDL
Sbjct  121  PAKFVLEAISEVFPVDKR--GGDRGNDL  146



>ref|XP_009389010.1| PREDICTED: FRIGIDA-like protein 4a [Musa acuminata subsp. malaccensis]
Length=528

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 121/175 (69%), Gaps = 7/175 (4%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            SF E ++Q  L+T CTLLWKELSDHF++LE+ L  KSEAL++K Q+LD  T+++L  L +
Sbjct  17   SFAELEKQRELITCCTLLWKELSDHFSTLERGLEIKSEALRSKRQSLDASTRRTLGSLRR  76

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSF  509
            RE SI A++ + L K+DE +R A V+   A  ++  E+    GL  KLRS C +MD   F
Sbjct  77   RELSIDAAVDLALSKLDE-RRVAAVQALAAAAADGDEL----GLPEKLRSLCTKMDFDGF  131

Query  510  WSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
            +  V+ ++K++E LRSE+  AL DC+DP KFVM AIS VFPVDKR +KS   NDL
Sbjct  132  FDLVVAKRKDVELLRSELPVALADCIDPSKFVMNAISGVFPVDKRLVKS--PNDL  184



>ref|XP_006826275.1| PREDICTED: FRIGIDA-like protein 4a [Amborella trichopoda]
 gb|ERM93512.1| hypothetical protein AMTR_s00004p00045050 [Amborella trichopoda]
Length=513

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 114/180 (63%), Gaps = 11/180 (6%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F +  +Q +L+T+CTLLWK+LS HF+SLEQ L  KS+ L  K QTLD QT+++LE+LE+
Sbjct  9    AFQDLDKQRTLITNCTLLWKDLSHHFSSLEQHLQEKSQTLDTKSQTLDQQTQKTLEILEQ  68

Query  330  RETSIAASISITLKKVDESKRAALV------EFGNAGGSEEPEVDNSAGLLLKLRSFCVQ  491
            RE SI       + K+ + K AAL+      E GN   + +    N   +  KLR FC +
Sbjct  69   REQSINYLEESAVTKLQQQKEAALLAAEKVAEEGNPNSNSD---SNDRAIESKLRGFCQK  125

Query  492  MDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKSERSND  671
            MDS+  W F++ +KK++E +R+ +  AL DC+DP   V+ AI  VFPVD+R   S+R +D
Sbjct  126  MDSKGLWDFIVGKKKDIELVRTHLSNALLDCIDPSTLVLRAIEGVFPVDRR--PSDREHD  183



>ref|XP_010228309.1| PREDICTED: FRIGIDA-like protein 4a [Brachypodium distachyon]
Length=569

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 110/170 (65%), Gaps = 4/170 (2%)
 Frame = +3

Query  147  TSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLE  326
              F E +RQ  L+ SCT L+++LSDHF SLE+ L  +S+A++ K + ++ +T ++L+ L 
Sbjct  20   AGFAELERQQQLLASCTRLYQQLSDHFASLERGLAARSDAIRHKRRAVEARTGRALDSLR  79

Query  327  KRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRS  506
            +RE SI  S+S  L+++D    A            E    ++AGL   LR+ C +MDS +
Sbjct  80   RRELSIDGSVSRALEQLDSLAAAGGSGGQEGSSVSE----DAAGLADGLRALCARMDSAA  135

Query  507  FWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKS  656
            F+ FV  R+KE +SLRSE+  AL  CVDP KFVM+A+++VFPVD+RE K+
Sbjct  136  FFGFVAARRKEADSLRSEMPPALKCCVDPAKFVMDAVADVFPVDRREAKN  185



>ref|XP_006650719.1| PREDICTED: FRIGIDA-like protein 4a-like, partial [Oryza brachyantha]
Length=536

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 115/169 (68%), Gaps = 7/169 (4%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
             F E +RQ  L+ +CT L+++L++HF SLE+ L  +SE L+AK + LD +T + LE L +
Sbjct  8    GFAELERQQQLLATCTRLYQQLTEHFGSLERRLAARSETLRAKRRFLDVRTSRRLEALRR  67

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSF  509
            RE SI  S+S+ L ++D   ++A    G AG       D +AG+  +LRS C  MDS  F
Sbjct  68   REGSIDGSVSLALSQLDSLGKSAA---GTAGSGS----DAAAGIAEELRSLCASMDSAGF  120

Query  510  WSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKS  656
            ++FV+ R+KE+++LR+E+  AL  CVDP +FVM+A+S+VFPVDKR ++S
Sbjct  121  FTFVVARRKEVDALRAELPDALKRCVDPARFVMDAVSDVFPVDKRAVRS  169



>tpg|DAA59720.1| TPA: hypothetical protein ZEAMMB73_037297 [Zea mays]
Length=382

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 109/170 (64%), Gaps = 0/170 (0%)
 Frame = +3

Query  147  TSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLE  326
              F E +RQ  L+ +CT L+++LSDHF SLE+ L  +S+AL+ + +  D +T ++L+ L 
Sbjct  35   AGFAELERQQQLLATCTRLYQQLSDHFGSLERGLAARSDALRVRRRAFDARTHRALDSLH  94

Query  327  KRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRS  506
            +RE SI AS+S  L  +     +A      +  +      +S GL   LR+ C +MDS +
Sbjct  95   RREASIDASVSRALDHLHSISASASAAAAASSKAPATSDSDSEGLAESLRALCARMDSAA  154

Query  507  FWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKS  656
            F  FV+ R+KE ++LR+E+  AL  CVDP KFVM+A+++VFPVD+RE+++
Sbjct  155  FLGFVVARRKEADALRAEMPPALKLCVDPAKFVMDAVADVFPVDRREVRN  204



>ref|XP_008652075.1| PREDICTED: FRIGIDA-like protein 4a [Zea mays]
 tpg|DAA59721.1| TPA: hypothetical protein ZEAMMB73_037297 [Zea mays]
Length=607

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 109/170 (64%), Gaps = 0/170 (0%)
 Frame = +3

Query  147  TSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLE  326
              F E +RQ  L+ +CT L+++LSDHF SLE+ L  +S+AL+ + +  D +T ++L+ L 
Sbjct  35   AGFAELERQQQLLATCTRLYQQLSDHFGSLERGLAARSDALRVRRRAFDARTHRALDSLH  94

Query  327  KRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRS  506
            +RE SI AS+S  L  +     +A      +  +      +S GL   LR+ C +MDS +
Sbjct  95   RREASIDASVSRALDHLHSISASASAAAAASSKAPATSDSDSEGLAESLRALCARMDSAA  154

Query  507  FWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKS  656
            F  FV+ R+KE ++LR+E+  AL  CVDP KFVM+A+++VFPVD+RE+++
Sbjct  155  FLGFVVARRKEADALRAEMPPALKLCVDPAKFVMDAVADVFPVDRREVRN  204



>gb|EEC76321.1| hypothetical protein OsI_13877 [Oryza sativa Indica Group]
Length=550

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 112/169 (66%), Gaps = 7/169 (4%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
             F E +RQ  L+ +CT L+++L++HF SLE+ L  +SE L+ K + LD +T + LE L +
Sbjct  26   GFAELERQQQLLATCTRLYQQLTEHFGSLERRLAARSETLRTKRRFLDVRTSRRLEALRR  85

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSF  509
            RE SI  S+S+ L ++D   +      G+AG +     D +AG+   LRS C  MDS  F
Sbjct  86   REASIDGSVSLALSRLDSLAK------GDAGTTGSASAD-AAGIAEGLRSLCASMDSAGF  138

Query  510  WSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKS  656
            ++FV+ R+KE+++LR+E+  AL  CVDP +F M+A+SEVFP+DKR ++S
Sbjct  139  FTFVVARRKEVDALRAELPDALKRCVDPARFAMDAVSEVFPIDKRAVRS  187



>ref|NP_001051543.1| Os03g0794900 [Oryza sativa Japonica Group]
 gb|AAT76425.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99329.1| hydroxyproline-rich glycoprotein family protein, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13457.1| Os03g0794900 [Oryza sativa Japonica Group]
 dbj|BAG95534.1| unnamed protein product [Oryza sativa Japonica Group]
Length=550

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 112/169 (66%), Gaps = 7/169 (4%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
             F E +RQ  L+ +CT L+++L++HF SLE+ L  +SE L+ K + LD +T + LE L +
Sbjct  26   GFAELERQQQLLATCTRLYQQLTEHFGSLERRLAARSETLRTKRRFLDVRTSRRLEALRR  85

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSF  509
            RE SI  S+S+ L ++D   +      G+AG +     D +AG+   LRS C  MDS  F
Sbjct  86   REASIDGSVSLALSRLDSLAK------GDAGTTGSASAD-AAGIAEGLRSLCASMDSAGF  138

Query  510  WSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKS  656
            ++FV+ R+KE+++LR+E+  AL  CVDP +F M+A+SEVFP+DKR ++S
Sbjct  139  FTFVVARRKEVDALRAELPDALKRCVDPARFAMDAVSEVFPIDKRAVRS  187



>ref|XP_004955594.1| PREDICTED: protein FRIGIDA-like [Setaria italica]
Length=570

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 108/170 (64%), Gaps = 5/170 (3%)
 Frame = +3

Query  147  TSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLE  326
              F E +RQ  L+ +CT L+++LSDHF SLE+ L  +S+AL+ + +  D +T ++L+ L 
Sbjct  25   AGFAELERQQQLLATCTRLYQQLSDHFGSLERGLAARSDALRVRCRAFDARTHRALDALH  84

Query  327  KRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRS  506
            +RE SI  S+S  L  +     A+L     A  +      ++ GL   LR+ C +MDS +
Sbjct  85   RREASIDGSVSRALDHL-----ASLSADKGAAPAAAAAGADADGLAEGLRTLCARMDSAA  139

Query  507  FWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKS  656
            F  FV+ R+KE ++LR+E+  AL  CVDP KFVM+A++ VFPVD+RE++S
Sbjct  140  FLGFVVARRKEADALRAEMPPALKLCVDPAKFVMDAVAGVFPVDRREVRS  189



>ref|XP_002461525.1| hypothetical protein SORBIDRAFT_02g004090 [Sorghum bicolor]
 gb|EER98046.1| hypothetical protein SORBIDRAFT_02g004090 [Sorghum bicolor]
Length=524

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 107/172 (62%), Gaps = 11/172 (6%)
 Frame = +3

Query  147  TSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLE  326
              F E +RQ  L+ +CT L+++L+DHF SLE+ L  +SE L+ + +  D +T ++L+ L 
Sbjct  29   AGFAELERQQQLLATCTRLYQQLADHFGSLERGLAARSEQLRVRRRAFDARTHRALDSLH  88

Query  327  KRETSIAASISITLKKVD----ESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQM  494
            +RE S+  S+S  L  +     E+  A      ++  SEE       GL   LR+ C++M
Sbjct  89   RREASVDTSVSRALDHLHSISKEAAAAPAPTPSDSAASEE-------GLAESLRALCLRM  141

Query  495  DSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKREL  650
            DS +F  +V+  +KE ++LRSE+  AL  CVDP KFVM+A+++VFPVD+RE+
Sbjct  142  DSSAFLGYVVTHRKEADALRSEMPAALKLCVDPAKFVMDAVADVFPVDRREV  193



>dbj|BAC83627.1| putative hydroxyproline-rich glycoprotein [Oryza sativa Japonica 
Group]
 dbj|BAG89444.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81597.1| hypothetical protein OsI_25073 [Oryza sativa Indica Group]
Length=534

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 107/170 (63%), Gaps = 8/170 (5%)
 Frame = +3

Query  147  TSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLE  326
              F E +RQ  L+ SCT L+K+L +HF SLE+ L  +S++L+ K +  + +   +++ L 
Sbjct  13   AGFAELERQQQLLASCTRLYKQLEEHFASLERGLAARSDSLRHKRRAAEARASAAMDSLR  72

Query  327  KRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRS  506
            +RE SI  S+S  L  +D+   A+ V    A  +E        G+   LR+ C +MDS  
Sbjct  73   RREASIDGSVSRALDHLDDLASASSVPSDAAAAAE--------GVAESLRAMCARMDSAG  124

Query  507  FWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKS  656
            F+ FV+ R+KE+++LR+E+  AL  CVDP KFVM+A+++VFPVD+RE K+
Sbjct  125  FFGFVVARRKEVDALRAEMPPALKCCVDPAKFVMDAVADVFPVDRREAKN  174



>ref|NP_001059003.1| Os07g0173200 [Oryza sativa Japonica Group]
 dbj|BAF20917.1| Os07g0173200 [Oryza sativa Japonica Group]
Length=453

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 107/170 (63%), Gaps = 8/170 (5%)
 Frame = +3

Query  147  TSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLE  326
              F E +RQ  L+ SCT L+K+L +HF SLE+ L  +S++L+ K +  + +   +++ L 
Sbjct  13   AGFAELERQQQLLASCTRLYKQLEEHFASLERGLAARSDSLRHKRRAAEARASAAMDSLR  72

Query  327  KRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRS  506
            +RE SI  S+S  L  +D+   A+ V    A  +E        G+   LR+ C +MDS  
Sbjct  73   RREASIDGSVSRALDHLDDLASASSVPSDAAAAAE--------GVAESLRAMCARMDSAG  124

Query  507  FWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKS  656
            F+ FV+ R+KE+++LR+E+  AL  CVDP KFVM+A+++VFPVD+RE K+
Sbjct  125  FFGFVVARRKEVDALRAEMPPALKCCVDPAKFVMDAVADVFPVDRREAKN  174



>dbj|BAC83628.1| putative hydroxyproline-rich glycoprotein [Oryza sativa Japonica 
Group]
Length=419

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 107/170 (63%), Gaps = 8/170 (5%)
 Frame = +3

Query  147  TSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLE  326
              F E +RQ  L+ SCT L+K+L +HF SLE+ L  +S++L+ K +  + +   +++ L 
Sbjct  13   AGFAELERQQQLLASCTRLYKQLEEHFASLERGLAARSDSLRHKRRAAEARASAAMDSLR  72

Query  327  KRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRS  506
            +RE SI  S+S  L  +D+   A+ V    A  +E        G+   LR+ C +MDS  
Sbjct  73   RREASIDGSVSRALDHLDDLASASSVPSDAAAAAE--------GVAESLRAMCARMDSAG  124

Query  507  FWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKS  656
            F+ FV+ R+KE+++LR+E+  AL  CVDP KFVM+A+++VFPVD+RE K+
Sbjct  125  FFGFVVARRKEVDALRAEMPPALKCCVDPAKFVMDAVADVFPVDRREAKN  174



>dbj|BAK00009.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 109/169 (64%), Gaps = 1/169 (1%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
             F E +RQ  L+ SCT L+++L++HF SLE+ +  +S++L+A+ + ++ +  + L+ L +
Sbjct  29   GFAELERQQELLASCTRLYQQLTEHFGSLERGIKSRSDSLRARRRVVELRASRRLDALRR  88

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSF  509
            RE SI AS+S+ L ++D   ++   +     G + P   +S  +   L + C  MD   F
Sbjct  89   RERSIEASVSLALSRLDALAKSPAPKRDREDG-DAPPPPSSDDIADGLAALCAAMDPAGF  147

Query  510  WSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKS  656
             +FV+ R+KE+++LR+++  AL  CVDP +F M+A+SEVFPVD+R ++S
Sbjct  148  LAFVVERRKEVDALRAQLPAALQRCVDPARFAMDAVSEVFPVDRRAVRS  196



>tpg|DAA42568.1| TPA: hypothetical protein ZEAMMB73_160821 [Zea mays]
Length=578

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 105/170 (62%), Gaps = 6/170 (4%)
 Frame = +3

Query  147  TSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLE  326
              F E +RQ  L+ +CT L++ LSDH  SLE+ L  +S+AL+ + +  D +T ++L+ L 
Sbjct  30   AGFAELERQQRLLATCTRLYQHLSDHIGSLERGLAARSDALRVRRRAFDARTHRALDSLH  89

Query  327  KRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRS  506
            +RE SI AS+S  L  +        +    +  + +P     AG    LR+ C +MDS +
Sbjct  90   RREASIDASVSRALDHLHS------ISAKGSPPAPDPAHAAGAGAAEGLRALCARMDSAA  143

Query  507  FWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKS  656
            F  FV+ R+KE ++LR+E+  AL  CVDP KFVM+A+++VFPVD+RE +S
Sbjct  144  FLGFVVARRKEADALRAEMPAALKLCVDPAKFVMDAVADVFPVDRREARS  193



>ref|XP_008786398.1| PREDICTED: FRIGIDA-like protein 4a [Phoenix dactylifera]
Length=486

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 97/160 (61%), Gaps = 6/160 (4%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +FDE + Q +L+++CTL+WK LSDHF+SL Q L  +S+AL ++LQ L+ Q+KQ+LE L+ 
Sbjct  15   AFDELEAQKNLISNCTLIWKSLSDHFSSLRQTLADRSQALDSQLQALEAQSKQTLESLDL  74

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSF  509
            RE SI    S     + E K A L E       E P+      L   LR +C +MDS   
Sbjct  75   REASIPDRESAATALIGERKDAVLSEI------ETPDAKPPDDLQGILRWYCRRMDSAGL  128

Query  510  WSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVF  629
            W FV+ R+++L  LR EI +A+   VDP + V++A+++  
Sbjct  129  WRFVVSRRRDLAVLRKEIAEAVAGSVDPTRLVVDAVADFL  168



>ref|XP_010254145.1| PREDICTED: FRIGIDA-like protein 4a [Nelumbo nucifera]
Length=539

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 102/156 (65%), Gaps = 8/156 (5%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            F+  + + +L+T+CT +WK+LS HF+SLE+ LL+KS+AL +K++ LD++TK++LE LE+R
Sbjct  25   FEALETRKTLLTNCTEIWKKLSSHFSSLEESLLQKSKALDSKIEALDSETKKTLEALEQR  84

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            E SI    S  + +V E K AAL EF   G S       + GL   LRS+C +MDS    
Sbjct  85   EKSIPERESAAIARVQEQKEAALAEFEKTGTS-------NLGLAEALRSYCRKMDSPGLL  137

Query  513  SFVIVRKKELES-LRSEIRKALGDCVDPPKFVMEAI  617
             F++ ++KE    LR+EI  ++ + VDP + +++A+
Sbjct  138  RFLVAKRKESPVLLRAEISLSIAESVDPARLILDAM  173



>ref|XP_010915057.1| PREDICTED: FRIGIDA-like protein 4b isoform X1 [Elaeis guineensis]
Length=509

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 93/158 (59%), Gaps = 6/158 (4%)
 Frame = +3

Query  156  DEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRE  335
            D  + Q +L+++CTLLWK LSDHF+SL Q L  +S+A+ +++Q LD  T+Q+LE L+ RE
Sbjct  16   DYLEAQKTLISNCTLLWKNLSDHFSSLRQTLADRSQAIDSQIQALDADTEQTLESLDLRE  75

Query  336  TSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWS  515
             SI    S     + E + A L E       E P+      L   LR +C +MDS   W 
Sbjct  76   ASIPDRESTAAALIQERQDAVLAEI------EIPDAKPPDDLPGLLRWYCRRMDSAGLWR  129

Query  516  FVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVF  629
            FV+ R+++L  LR  I +A+ + VDP + V++A+++  
Sbjct  130  FVVSRRRDLAILRKVIDQAVAESVDPARLVVDAVADFL  167



>ref|XP_010915058.1| PREDICTED: FRIGIDA-like protein 4b isoform X2 [Elaeis guineensis]
Length=507

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 93/158 (59%), Gaps = 6/158 (4%)
 Frame = +3

Query  156  DEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRE  335
            D  + Q +L+++CTLLWK LSDHF+SL Q L  +S+A+ +++Q LD  T+Q+LE L+ RE
Sbjct  16   DYLEAQKTLISNCTLLWKNLSDHFSSLRQTLADRSQAIDSQIQALDADTEQTLESLDLRE  75

Query  336  TSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWS  515
             SI    S     + E + A L E       E P+      L   LR +C +MDS   W 
Sbjct  76   ASIPDRESTAAALIQERQDAVLAEI------EIPDAKPPDDLPGLLRWYCRRMDSAGLWR  129

Query  516  FVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVF  629
            FV+ R+++L  LR  I +A+ + VDP + V++A+++  
Sbjct  130  FVVSRRRDLAILRKVIDQAVAESVDPARLVVDAVADFL  167



>ref|XP_006842236.1| PREDICTED: FRIGIDA-like protein 4a [Amborella trichopoda]
 gb|ERN03911.1| hypothetical protein AMTR_s00078p00186900 [Amborella trichopoda]
Length=568

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 105/159 (66%), Gaps = 10/159 (6%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            F+  + + +L+TSCT LW+++++HF+SLE+DL  KS+ L +KLQTL+T TK++L  L++R
Sbjct  16   FETLETEKNLLTSCTDLWRKVANHFSSLERDLNLKSQTLDSKLQTLETTTKETLGSLDRR  75

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            E+SI A  S +L ++++ K AA  +F N    E PE         KLRSFC +MD     
Sbjct  76   ESSIPAIESASLDRIEKLKEAAFSDFANVNKGELPE---------KLRSFCRRMDLDGLL  126

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVF  629
             F+I ++K+L +L++EI  AL +CVDP  FV+  I E F
Sbjct  127  RFLISQRKDLAALKAEISHALSECVDPIGFVLR-IMEGF  164



>ref|XP_002281155.2| PREDICTED: FRIGIDA-like protein 4a isoform X2 [Vitis vinifera]
Length=533

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 98/157 (62%), Gaps = 7/157 (4%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            FD  + Q +++++CT L+K LS+HF+SL+  L +KS +L +K Q L++ +K++LE L++R
Sbjct  12   FDSLEAQKTILSTCTQLYKTLSNHFSSLQHSLSQKSSSLDSKFQALESDSKKTLESLDQR  71

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            E SI    S    +++E + AAL EF       E  V  +A L   L+S+C +MDS    
Sbjct  72   ENSIPERESSAAARIEEQREAALSEF-------EKAVPENAELSECLKSYCRKMDSSGLL  124

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
             F++ ++KE  SLRSEI  A+ + VD  + V++A+ E
Sbjct  125  RFMVSKRKESMSLRSEIVSAMEESVDSARLVLDAVEE  161



>ref|XP_010656337.1| PREDICTED: FRIGIDA-like protein 4a isoform X1 [Vitis vinifera]
Length=539

 Score =   108 bits (271),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 98/157 (62%), Gaps = 7/157 (4%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            FD  + Q +++++CT L+K LS+HF+SL+  L +KS +L +K Q L++ +K++LE L++R
Sbjct  12   FDSLEAQKTILSTCTQLYKTLSNHFSSLQHSLSQKSSSLDSKFQALESDSKKTLESLDQR  71

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            E SI    S    +++E + AAL EF       E  V  +A L   L+S+C +MDS    
Sbjct  72   ENSIPERESSAAARIEEQREAALSEF-------EKAVPENAELSECLKSYCRKMDSSGLL  124

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
             F++ ++KE  SLRSEI  A+ + VD  + V++A+ E
Sbjct  125  RFMVSKRKESMSLRSEIVSAMEESVDSARLVLDAVEE  161



>ref|XP_007204566.1| hypothetical protein PRUPE_ppa003799mg [Prunus persica]
 gb|EMJ05765.1| hypothetical protein PRUPE_ppa003799mg [Prunus persica]
Length=548

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 101/155 (65%), Gaps = 7/155 (5%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            FD+ + Q +++++ T L+  LS HF SL+  L +KS++L++K+Q+L+++++++LE L+ R
Sbjct  16   FDDLEAQKAILSTSTKLFTTLSKHFNSLQDSLSQKSQSLESKIQSLESRSRETLESLDLR  75

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            ETSI    S  + +++E K AAL EF       E  +  +  L   L+SF  +MD +   
Sbjct  76   ETSIPERESAAVARIEEQKAAALAEF-------EKSISGNLDLPETLKSFSRKMDPQGLL  128

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAI  617
             F++ ++KE  SLR+E+ +A+ + VDPPK V++A+
Sbjct  129  KFIVSKRKESISLRTELVQAIAEAVDPPKLVLDAL  163



>ref|XP_008242610.1| PREDICTED: FRIGIDA-like protein 4a [Prunus mume]
Length=551

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 100/155 (65%), Gaps = 7/155 (5%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            FD+ + Q +++++ T L+  LS HF SL+  L +KS++L++K+Q+L+++++++LE L+ R
Sbjct  18   FDDLEAQKAILSTSTKLFTTLSKHFNSLQDSLSQKSQSLESKIQSLESRSRETLESLDLR  77

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            ETSI    S    +++E K AAL EF       E  +  +  L   L+SF  +MD +   
Sbjct  78   ETSIPERESAAAARIEEQKAAALAEF-------EKSISGNLDLPETLKSFSRKMDPQGLL  130

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAI  617
             F+I ++KE  SLR+E+ +A+ + VDPPK V++A+
Sbjct  131  KFIISKRKESISLRTELVQAIAEAVDPPKLVLDAL  165



>emb|CAN61251.1| hypothetical protein VITISV_004639 [Vitis vinifera]
Length=630

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 98/157 (62%), Gaps = 7/157 (4%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            FD  + Q +++++CT L+K LS+HF+SL+  L +KS +L +K Q L++ +K++LE L++R
Sbjct  12   FDSLEAQKTILSTCTQLYKTLSNHFSSLQHSLSQKSSSLDSKFQALESDSKKTLESLDQR  71

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            E SI    S    +++E + AAL EF       E  V  +A L   L+S+C +MDS    
Sbjct  72   ENSIPERESSAAARIEEQREAALSEF-------EKAVPENAELSECLKSYCRKMDSSGLL  124

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
             F++ ++KE  SLRSEI  A+ + VD  + V++A+ E
Sbjct  125  RFMVSKRKESMSLRSEIVSAMEESVDSARLVLDAVEE  161



>ref|XP_004287092.1| PREDICTED: FRIGIDA-like protein 4a isoform X1 [Fragaria vesca 
subsp. vesca]
Length=570

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 101/159 (64%), Gaps = 8/159 (5%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            FD+ + Q +++++ T L+  +SDHFT+L++ L  K ++L +K+++L+++++Q+LE L+ R
Sbjct  16   FDDLEAQKAILSTSTKLYATISDHFTALQKSLAEKFKSLDSKIESLESRSRQTLESLDVR  75

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            ETS+A   +    +V E K AAL EFG            +  + + L+S C +MDS    
Sbjct  76   ETSLAEREASAAARVSEQKYAALAEFGRI-------FPANLDIAVTLKSLCRKMDSEGLL  128

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVF  629
             F++ ++KE  SLR+EI  A+ + VD P+ V++A+ EVF
Sbjct  129  RFIVTKRKESVSLRAEIVPAMAEAVDAPRLVLDAL-EVF  166



>ref|XP_011458926.1| PREDICTED: FRIGIDA-like protein 4a isoform X2 [Fragaria vesca 
subsp. vesca]
Length=547

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 101/159 (64%), Gaps = 8/159 (5%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            FD+ + Q +++++ T L+  +SDHFT+L++ L  K ++L +K+++L+++++Q+LE L+ R
Sbjct  16   FDDLEAQKAILSTSTKLYATISDHFTALQKSLAEKFKSLDSKIESLESRSRQTLESLDVR  75

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            ETS+A   +    +V E K AAL EFG            +  + + L+S C +MDS    
Sbjct  76   ETSLAEREASAAARVSEQKYAALAEFGRI-------FPANLDIAVTLKSLCRKMDSEGLL  128

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVF  629
             F++ ++KE  SLR+EI  A+ + VD P+ V++A+ EVF
Sbjct  129  RFIVTKRKESVSLRAEIVPAMAEAVDAPRLVLDAL-EVF  166



>ref|XP_012076667.1| PREDICTED: FRIGIDA-like protein 4a [Jatropha curcas]
 gb|KDP33654.1| hypothetical protein JCGZ_07225 [Jatropha curcas]
Length=539

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 97/157 (62%), Gaps = 10/157 (6%)
 Frame = +3

Query  156  DEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRE  335
            D+ + + +++TSCT L   L+ HFTSL+  L +KS++L +K Q+L++ ++ +LE L +RE
Sbjct  17   DDLEARKTVLTSCTQLLTTLTSHFTSLQDSLSQKSQSLDSKFQSLESNSQDTLESLSQRE  76

Query  336  TSIAASISITLKKVDESKRAALVEFGNAGGSEEP-EVDNSAGLLLKLRSFCVQMDSRSFW  512
            TSI    S    K+ E K  AL +F      E+P + DN + L   L+S C +MDS    
Sbjct  77   TSIPERESAAAAKIQEQKEKALADF------EKPSKFDNLSDL---LKSLCRKMDSSGLL  127

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
             FVI ++KE  S+R+EI  A+ + VDP + +++A+ E
Sbjct  128  KFVISKRKESVSMRAEIAPAITEAVDPARLILDAVDE  164



>ref|XP_008386583.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
 ref|XP_008386605.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
Length=546

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 98/155 (63%), Gaps = 7/155 (5%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            F++ + Q +++++ T L+  LSDHF SL++ +   S +L++K+Q+L+++++++L+ L+ R
Sbjct  16   FEDLEAQRAILSTSTKLFTTLSDHFDSLQKSISENSHSLESKIQSLESRSRETLQSLDHR  75

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            E SI    S    +++E K AAL E        E  V     L   L+SFC +MDS+   
Sbjct  76   EASIPERESSAAARIEEQKAAALAEV-------EKNVSGDLDLPETLKSFCRKMDSQGLV  128

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAI  617
             F++ ++KE  SLR+EI +A+ + VDPP+ V++A+
Sbjct  129  KFIVSKRKESISLRAEIVQAIAEAVDPPRLVLDAL  163



>ref|XP_010088834.1| hypothetical protein L484_020817 [Morus notabilis]
 gb|EXB37031.1| hypothetical protein L484_020817 [Morus notabilis]
Length=541

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 98/157 (62%), Gaps = 7/157 (4%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
             D+ + Q +++++CT L+K L+ HF+SL++ L  K ++L +K++ L++ ++++LE L++R
Sbjct  16   LDDLEAQKTILSTCTQLFKTLTSHFSSLQKSLSEKHQSLDSKIKALESHSRRTLESLDRR  75

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            E SI    S    ++ E K +AL EF       E ++  ++ L   L+SF  +MDS    
Sbjct  76   ECSIPDHESNAAARIAEQKDSALAEF-------EKQIPANSELSEALKSFSRRMDSSGLL  128

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            SFV+ ++KE  SLRSEI  +L + VDPP  V+ ++ E
Sbjct  129  SFVVSKRKESISLRSEIGDSLSEAVDPPSLVLGSLEE  165



>ref|XP_009347163.1| PREDICTED: FRIGIDA-like protein 4a [Pyrus x bretschneideri]
Length=539

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 96/157 (61%), Gaps = 7/157 (4%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            F +   Q +++++ T L+  LSDHF SL++ +  KS +L++K+Q+L+++T+++   L+ R
Sbjct  16   FGDLDEQKAILSTSTKLFTTLSDHFDSLQKSISDKSHSLESKIQSLESRTRENSHSLDHR  75

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            E SI    S    +++E K AAL E        E +      L   L+SFC +MDS+   
Sbjct  76   EASIPERGSSAAARIEEQKAAALAEV-------EKKASGELDLPETLKSFCRKMDSQGLV  128

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
             F++ ++KE  SLR+EI +A+ + VDPP+ V++A+ E
Sbjct  129  KFIVSKRKESISLRAEIVQAIAEAVDPPRLVLDALEE  165



>ref|XP_009336927.1| PREDICTED: FRIGIDA-like protein 4a [Pyrus x bretschneideri]
Length=554

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 99/155 (64%), Gaps = 7/155 (5%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            F++ + Q +++++ T L+  LSDHF SL++ +  KS +L++K+Q+L+++++++L+ L+ R
Sbjct  24   FEDLEAQKAILSTSTKLFTTLSDHFDSLQKSISEKSHSLESKIQSLESRSRETLQSLDHR  83

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            E SI    S T  +++E K AAL E        E  V     L   L+SFC +MDS+   
Sbjct  84   EASIPERESSTAARIEEQKAAALAEV-------EKNVFGDLDLAETLKSFCRKMDSQGLV  136

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAI  617
             F++ ++KE  SLR+EI +A+ + VDP + V++A+
Sbjct  137  KFIVSKRKESISLRAEIVQAISEAVDPLRLVLDAL  171



>gb|ABK25209.1| unknown [Picea sitchensis]
 gb|ACN40848.1| unknown [Picea sitchensis]
Length=534

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 99/171 (58%), Gaps = 14/171 (8%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F     Q +++  CTL WKEL+DH+ SLEQ L +K E L  K ++L+ +TK++ E+L+K
Sbjct  14   AFTVLDTQRAVLEKCTLQWKELTDHYASLEQSLQKKFEELAEKEKSLELKTKETEELLDK  73

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSF  509
            RE SI ++    + +++E K +AL     +G SE             L+  C +MD+   
Sbjct  74   REQSIESNEETYIARLEEQKTSALAAI-ESGKSES-----------GLKFLCEKMDAEGL  121

Query  510  WSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKSER  662
            W F++  +K++ +LR+E+  AL   +DP + V++A+   +  DK   K+E+
Sbjct  122  WKFIVEHRKDVTALRAELPSALESAIDPARLVLQALEGFY--DKGSGKTEK  170



>ref|XP_004503419.1| PREDICTED: uncharacterized protein LOC101489761 [Cicer arietinum]
Length=537

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 97/168 (58%), Gaps = 7/168 (4%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            FDE +   + +T CT L+  LS+HF+SL+  +  K + L +K Q+L++ +K++LE L  R
Sbjct  21   FDELENHKNTLTKCTHLFTSLSNHFSSLQDSISLKFQTLDSKFQSLESSSKETLESLNNR  80

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            E SI    S    ++DE K AA+ E  N+  S   ++ ++      L+S   +MD+ +  
Sbjct  81   ENSIPERESSAAARIDEQKEAAIAELRNSLPSSTLDISDA------LKSLSRKMDASAML  134

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKS  656
             F++ ++KE   LR EI  A+ + VDPP+ V++A+ E F   K E KS
Sbjct  135  RFIVSKRKESLMLRPEIAVAIKEAVDPPRLVLDAVEE-FLKSKTESKS  181



>ref|XP_002514326.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48280.1| conserved hypothetical protein [Ricinus communis]
Length=547

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 92/156 (59%), Gaps = 8/156 (5%)
 Frame = +3

Query  156  DEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRE  335
            ++ + Q ++++SCT L+  L+ HFTSL+Q L  KS++L +K Q+L + + Q+LE L  RE
Sbjct  17   EDLEAQKTILSSCTQLFTTLTSHFTSLQQSLTVKSQSLDSKFQSLQSNSNQTLESLSHRE  76

Query  336  TSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWS  515
            TSI    S    K++E K  AL EF      +  + DN   L   L+S   +MD+     
Sbjct  77   TSIPERESAAAAKIEEQKVKALAEF-----EKSQKYDN---LSDYLKSISRKMDASGLLK  128

Query  516  FVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            FVI ++KE  SLR+EI  A+ + VDP   +++A+ E
Sbjct  129  FVISKRKESVSLRAEISPAIMEAVDPAMLILDAVDE  164



>gb|KDO50860.1| hypothetical protein CISIN_1g009377mg [Citrus sinensis]
Length=536

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 98/165 (59%), Gaps = 9/165 (5%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            F++ + Q ++++SC  L+K L+ HFTSLE  L +K ++L +K  +LD+ + Q+L+ L  R
Sbjct  16   FEDLKAQKTILSSCMQLFKSLTSHFTSLEDSLSQKFKSLDSKFLSLDSTSAQTLDSLSHR  75

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            E SI    +   + + + + +AL +F      + P+    A L   L+S C +MDS    
Sbjct  76   ENSIPDRHNAAFRLIHDHRDSALADF-----LKPPKF---ADLSDTLKSLCRRMDSSGLL  127

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRE  647
             F+I ++KE  SLR+EI +A+ + VDP + V++A+ E F   KRE
Sbjct  128  KFIISKRKESVSLRTEISRAIWEAVDPSRLVLDAVEE-FLAQKRE  171



>ref|XP_006451127.1| hypothetical protein CICLE_v10007961mg [Citrus clementina]
 ref|XP_006475599.1| PREDICTED: FRIGIDA-like protein 4a-like [Citrus sinensis]
 gb|ESR64367.1| hypothetical protein CICLE_v10007961mg [Citrus clementina]
Length=536

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 98/165 (59%), Gaps = 9/165 (5%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            F++ + Q ++++SC  L+K L+ HFTSLE  L +K ++L +K  +LD+ + Q+L+ L  R
Sbjct  16   FEDLKAQKTILSSCMQLFKSLTSHFTSLEDSLSQKFKSLDSKFLSLDSTSAQTLDSLSHR  75

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            E SI    +   + + + + +AL +F      + P+    A L   L+S C +MDS    
Sbjct  76   ENSIPDRHNAAFRLIHDHRDSALADF-----LKPPKF---ADLSDTLKSLCRRMDSSGLL  127

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRE  647
             F+I ++KE  SLR+EI +A+ + VDP + V++A+ E F   KRE
Sbjct  128  KFIISKRKESVSLRTEISRAIWEAVDPSRLVLDAVEE-FLAQKRE  171



>ref|XP_003532490.1| PREDICTED: FRIGIDA-like protein 4a-like [Glycine max]
Length=520

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 95/157 (61%), Gaps = 6/157 (4%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            FDE + + +++  CT L+  LS HF+SL+  +  KS++L +KLQ+LD+ +K++LE L +R
Sbjct  9    FDELEAKKTILAKCTDLFTTLSTHFSSLQHSVAEKSQSLDSKLQSLDSLSKETLESLHRR  68

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            ETSI    S    ++ E + AAL E   A    +P+      L   L+S   +MD+ +  
Sbjct  69   ETSIPERESSAAARIKEQREAALAELLRATPPPDPD------LSATLKSLWRKMDAAALL  122

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
             FV+ ++KE  SLR+EI  A+ + VDP + V+EA+ E
Sbjct  123  RFVVSKRKESASLRAEIAAAMEEAVDPARLVVEAVEE  159



>ref|XP_008337438.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
Length=539

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 94/157 (60%), Gaps = 7/157 (4%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            F +   Q +++++ T L+  LSDHF SL++ +  KS +L++K Q+L+++T+++   L+ R
Sbjct  16   FGDLDEQRAILSTSTKLFITLSDHFDSLQKSISEKSYSLESKTQSLESRTRENSHSLDHR  75

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            E SI    S    +++E K AAL E        E +      L   L+SFC +MDS+   
Sbjct  76   EASIPERGSSAAARIEEQKAAALAEV-------EKKASGDLDLPETLKSFCRKMDSQGLV  128

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
             F++ ++KE  SLR+EI +A+ + VDP + V++A+ E
Sbjct  129  KFIVSKRKESISLRAEIVQAIAEAVDPSRLVLDALEE  165



>ref|XP_011043451.1| PREDICTED: FRIGIDA-like protein 4a [Populus euphratica]
Length=561

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 93/158 (59%), Gaps = 8/158 (5%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            F++   + + ++SCT L+  L+ HF SL+  L +KS++L++K Q+L++ ++ +LE L  R
Sbjct  16   FNDLDARKTFLSSCTQLFTTLTTHFKSLQTSLSQKSQSLESKFQSLESNSQLTLESLSCR  75

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            E SI    S    KV+E +  AL EF N+        DN   L   L+S C +MDS    
Sbjct  76   EKSIPERESAAAAKVEEQRETALSEFRNSH-----SFDN---LSDSLKSLCRRMDSSGLL  127

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEV  626
             FV+ ++KE   LR+EI +A+ + VDP +  ++A+ E+
Sbjct  128  RFVVSKRKESVFLRAEISRAIMEAVDPARLTLDAVDEL  165



>ref|XP_006371900.1| hypothetical protein POPTR_0018s05910g [Populus trichocarpa]
 gb|ERP49697.1| hypothetical protein POPTR_0018s05910g [Populus trichocarpa]
Length=564

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 93/158 (59%), Gaps = 8/158 (5%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            F++   + ++++SCT L+  L+ HF SL+  L +KS +L++K Q+L++ ++ +LE L  R
Sbjct  16   FNDLDARKTILSSCTQLFTTLTTHFKSLQNSLSQKSLSLESKFQSLESNSQLTLESLSCR  75

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            E SI    S    KV+E +  AL EF N+        DN   L   L+S C +MDS    
Sbjct  76   EKSIPERESAAAAKVEEQRETALSEFRNSH-----SFDN---LSDSLKSLCRRMDSSGLL  127

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEV  626
             FV+ ++KE   LR+EI +A+ + VDP +  ++A+ E+
Sbjct  128  RFVVSKRKESVFLRAEISRAIMEAVDPARLTLDAVDEL  165



>ref|XP_003525267.2| PREDICTED: FRIGIDA-like protein 4a-like [Glycine max]
Length=520

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 96/157 (61%), Gaps = 7/157 (4%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            FDE + + +++  CT L+  LS HF+SL+  +  KS++L + LQ+LD+ +K++LE L +R
Sbjct  9    FDELEAKKTILAKCTDLFTTLSTHFSSLQHSISEKSQSLDSNLQSLDSLSKETLESLHRR  68

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            ETSI    S    +++E + AAL +      +  P+ D SA     L+S   +MD+ +  
Sbjct  69   ETSIPERESAAAARIEEQREAALADL---RATHPPDPDLSA----TLKSLWRKMDAPALL  121

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
             FV+ ++KE  SLR+EI  A+ + VDP + V+EA+ E
Sbjct  122  RFVVSKRKESASLRAEIAAAMAEAVDPARLVVEAVEE  158



>ref|XP_010688181.1| PREDICTED: FRIGIDA-like protein 4a [Beta vulgaris subsp. vulgaris]
Length=566

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 98/173 (57%), Gaps = 10/173 (6%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            F+  + Q +L+  CT L+K L+ HF++L+Q +  K+  L +KL++LD+   +SL+ L +R
Sbjct  17   FNNLESQKNLLCKCTDLYKTLTSHFSTLQQSIDSKTLTLDSKLESLDSIHHKSLDELHER  76

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            E S+   +     ++   + +A+ E       ++P ++ S  L   LRS C +MD  +  
Sbjct  77   EISLPHRLLSLSSEIKTKRESAIAEL------QKP-LNESLPLSEVLRSLCRRMDYSNLM  129

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVF---PVDKRELKSER  662
             F+I ++KE  +LR E+ +AL +CVDP + V+E + E      V KR +  +R
Sbjct  130  RFLICKRKETTTLRGEMGEALKECVDPARMVLETVKEFLEAKKVGKRGMTDKR  182



>gb|AFK43654.1| unknown [Medicago truncatula]
Length=539

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 88/159 (55%), Gaps = 8/159 (5%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            F+E + Q + +  CT L+ +L++HF+ L+  + +K + L ++ Q+L+++ K++LE L  +
Sbjct  21   FNELESQKNTLIKCTDLFTKLNNHFSFLQDSISQKFQTLDSQFQSLESRHKETLESLANQ  80

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            E SI    S    ++DE K AAL    N         +  + +   L+S   +MD+ S  
Sbjct  81   ENSIPERESSAAARIDEQKEAALAALRNP--------NPPSNIAAALKSLSRKMDAESLL  132

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVF  629
             FVI R+KE   LR EI  AL + VD P+ V++A+ E  
Sbjct  133  MFVISRRKESIMLRPEIAAALKEAVDAPRLVLDAVEEYL  171



>ref|XP_007013214.1| FRIGIDA-like protein [Theobroma cacao]
 gb|EOY30833.1| FRIGIDA-like protein [Theobroma cacao]
Length=534

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 91/154 (59%), Gaps = 8/154 (5%)
 Frame = +3

Query  156  DEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRE  335
            D+ +   +++++CT L+  L+ HF+SL+  L +KS++L +K  +L + + Q+LE L  RE
Sbjct  17   DDLEAHKTILSTCTQLFTALTKHFSSLQDSLSQKSQSLDSKFLSLSSTSSQTLESLSLRE  76

Query  336  TSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWS  515
            +SI    S    +++  K +AL EF N         + SA L   L+S   +MDS     
Sbjct  77   SSIPDRESAVTARIETQKESALAEFQNP--------NTSAQLSESLKSLSRRMDSTGLVK  128

Query  516  FVIVRKKELESLRSEIRKALGDCVDPPKFVMEAI  617
            F++ ++KE  SLR+EI  AL + VDPP+ V+EA+
Sbjct  129  FIVSKRKESVSLRAEISNALYEAVDPPRLVLEAV  162



>ref|XP_007160344.1| hypothetical protein PHAVU_002G313900g [Phaseolus vulgaris]
 gb|ESW32338.1| hypothetical protein PHAVU_002G313900g [Phaseolus vulgaris]
Length=529

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 94/157 (60%), Gaps = 7/157 (4%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            F+E + + S++  CT L+  LS HF+SL+  +  KS+ + +KLQ+L++ + ++L+ L  R
Sbjct  17   FEELEAKKSILAKCTNLFTTLSTHFSSLQHSVTDKSQFIDSKLQSLESLSSETLQSLHHR  76

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            +TSI    S    ++ + K AAL E         P+ D SA     L+S   +MD+ +  
Sbjct  77   QTSIPERESAAAARISDQKEAALAE---VRAPPLPDPDLSAA----LKSLSRKMDAAALL  129

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
             FV+ ++KE  SLR+EI +A+ + VDPP+ V+EA+ E
Sbjct  130  RFVVSKRKESASLRAEIAEAMAEAVDPPRLVLEAVDE  166



>ref|XP_003629646.1| Protein FRIGIDA [Medicago truncatula]
 ref|XP_003630808.1| Protein FRIGIDA [Medicago truncatula]
 gb|AET04122.1| frigida-LIKE protein [Medicago truncatula]
Length=539

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 88/159 (55%), Gaps = 8/159 (5%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            F+E + Q + +  CT L+ +L++HF+ L+  + +K + L ++ Q+L+++ K++LE L  +
Sbjct  21   FNELESQKNTLIKCTDLFTKLNNHFSFLQDSISQKFQTLDSQFQSLESRHKETLESLANQ  80

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            E SI    S    ++DE K AAL    N         +  + +   L+S   +MD+ S  
Sbjct  81   ENSIPERESSAAARIDEQKEAALAALRNP--------NPPSNIAAALKSLSRKMDAESLL  132

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVF  629
             FVI ++KE   LR EI  AL + VD P+ V++A+ E  
Sbjct  133  MFVISKRKESIMLRPEIAAALKEAVDAPRLVLDAVEEYL  171



>gb|EEE60086.1| hypothetical protein OsJ_12936 [Oryza sativa Japonica Group]
Length=516

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 90/169 (53%), Gaps = 41/169 (24%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
             F E +RQ  L+ +CT L+++L++HF SLE+ L  +SE L+ K + LD +T + LE L +
Sbjct  26   GFAELERQQQLLATCTRLYQQLTEHFGSLERRLAARSETLRTKRRFLDVRTSRRLEALRR  85

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSF  509
            RE SI  S+S+ L ++D   +      G  G                        D R  
Sbjct  86   REASIDGSVSLALSRLDSLAK------GQRG------------------------DDR--  113

Query  510  WSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKS  656
                     E+++LR+E+  AL  CVDP +F M+A+SEVFP+DKR ++S
Sbjct  114  ---------EVDALRAELPDALKRCVDPARFAMDAVSEVFPIDKRAVRS  153



>gb|KHG13959.1| Protein FRIGIDA -like protein [Gossypium arboreum]
Length=534

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 85/154 (55%), Gaps = 8/154 (5%)
 Frame = +3

Query  156  DEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRE  335
            ++ + Q  +++ CT L+  L++HFTSL+  L +KS +L AK  +L ++  Q+LE L +RE
Sbjct  17   EDLEVQKKIVSKCTELFTTLTNHFTSLQNSLSQKSHSLDAKFLSLSSKFSQTLESLSQRE  76

Query  336  TSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWS  515
             S+    S     ++  K AA  EF +  G        SA L   L+S   +MDS     
Sbjct  77   YSLPDRESAAAAHIETLKEAAFAEFKDPKG--------SAQLSDTLKSLARRMDSAGLVK  128

Query  516  FVIVRKKELESLRSEIRKALGDCVDPPKFVMEAI  617
            F++ ++KE   LR+EI  AL + VDP + V+EA 
Sbjct  129  FIVSKRKESVPLRAEISVALSEAVDPHRLVLEAF  162



>gb|KJB06948.1| hypothetical protein B456_001G004500 [Gossypium raimondii]
Length=534

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 86/154 (56%), Gaps = 8/154 (5%)
 Frame = +3

Query  156  DEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRE  335
            ++ + Q  +++ CT L+  L++HFTSL+  L +KS++L AK  +L ++  QSL+ L +RE
Sbjct  17   EDLEAQKKIVSKCTELFTTLTNHFTSLQNSLSQKSQSLDAKFLSLSSKFSQSLDSLSQRE  76

Query  336  TSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWS  515
            + +    S     ++  K AA  EF +  G        SA L   L+S   +MDS     
Sbjct  77   SCLPDRESAAAAHIETLKEAAFAEFKDPKG--------SAQLSDTLKSLARRMDSAGLVK  128

Query  516  FVIVRKKELESLRSEIRKALGDCVDPPKFVMEAI  617
            F++ ++KE   LR+EI  AL + VDP + V+EA 
Sbjct  129  FIVSKRKESVPLRAEISVALSEAVDPHRLVLEAF  162



>gb|ABR17868.1| unknown [Picea sitchensis]
Length=601

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 103/217 (47%), Gaps = 52/217 (24%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F +       +T CT+ WKEL +HF SLE+ + ++ E L+AK +T + + +++ ++L+K
Sbjct  14   AFVDLDEHREALTKCTVQWKELEEHFVSLERSIQKRLEDLEAKERTFEAKMRETQDILDK  73

Query  330  RETSIAASISITLKKVDESKRAALV-----------EFG---------------------  413
            RE SIA+    +L +V E K AAL            EF                      
Sbjct  74   REVSIASKEQASLARVQEQKDAALALIFEERRKLKEEFDNGCEKVTDDDTKKDSIKEKEN  133

Query  414  ---NAGG---SEEPEVDN--------------SAGLLLKLRSFCVQMDSRSFWSFVIVRK  533
               NA G   S+ PE ++               A +  +L++ C  MDS+    ++I  +
Sbjct  134  GSVNANGSSLSDGPEANSKKEISPSTKSEAKVQAQVRSQLKTLCETMDSKGLRKYIIEHR  193

Query  534  KELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKR  644
            K+   LR+E+  AL   +DP + V+E++   + ++++
Sbjct  194  KDAAGLRNEVPSALNSAIDPSRLVLESLEGFYSLEQK  230



>gb|AFG65514.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65515.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65516.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65517.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65518.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65519.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65520.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65521.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65522.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65523.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65524.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65525.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65526.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
Length=118

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 73/123 (59%), Gaps = 12/123 (10%)
 Frame = +3

Query  171  QTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAA  350
            Q  ++  CTL WKEL+DH+ SLE+ L +K E L  K + L+ +TK++ E+L+KRE SI +
Sbjct  8    QRGVLEKCTLQWKELTDHYASLEESLQKKFEELAEKEKNLELKTKETEELLDKREQSIES  67

Query  351  SISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVR  530
            +    L +++E K AAL     +G SE     NS      L+  C +MD+   W F++ R
Sbjct  68   NEETYLARLEEQKNAALAAI-ESGKSE-----NS------LKFLCEKMDAEGLWRFIVER  115

Query  531  KKE  539
            +K+
Sbjct  116  RKD  118



>ref|XP_010047742.1| PREDICTED: FRIGIDA-like protein 4a [Eucalyptus grandis]
 gb|KCW79702.1| hypothetical protein EUGRSUZ_C01055 [Eucalyptus grandis]
Length=568

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 84/154 (55%), Gaps = 3/154 (2%)
 Frame = +3

Query  162  FQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETS  341
             + Q S +++C  L+  LSD   SL++ L  K+ A+++ LQ L + +  + E L +R+ S
Sbjct  19   LESQMSALSACARLFAALSDRLGSLQRSLDDKTRAVESGLQALASSSLAATESLSRRDAS  78

Query  342  IAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFV  521
            +    S     V+E K AAL + G            S GL   LRSF  +MDS     F+
Sbjct  79   LPGRESAAAALVEERKAAALADLGG---PGPGPSGGSGGLADSLRSFARRMDSSGLVKFL  135

Query  522  IVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            + ++KE  SLR+E+  A+ + VDPP+ V++A+ E
Sbjct  136  VSKRKESASLRAEMPAAVAEAVDPPRLVLDAVEE  169



>gb|EEE66652.1| hypothetical protein OsJ_23273 [Oryza sativa Japonica Group]
Length=684

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 67/109 (61%), Gaps = 8/109 (7%)
 Frame = +3

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSF  509
            R+ SI  S+S  L  +D+          +A       V  + G+   LR+ C +MDS  F
Sbjct  224  RKASIDGSVSRALDHLDD--------LASASSVPSEAVAAAEGVAESLRAMCARMDSAGF  275

Query  510  WSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKS  656
            + FV+ R+KE+++LR+E+  AL  CVDP KFVM+A+++VFPVD+RE K+
Sbjct  276  FGFVVARRKEVDALRAEMPPALKCCVDPAKFVMDAVADVFPVDRREAKN  324


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 41/108 (38%), Positives = 64/108 (59%), Gaps = 8/108 (7%)
 Frame = +3

Query  312  LEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQ  491
            ++ L +RE SI  S+S  L  +D+          +A          + G+   LR+ C +
Sbjct  1    MDSLRRREASIDGSVSRALDHLDD--------LASASSVPSEAAAAAEGVAESLRAMCAR  52

Query  492  MDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPV  635
            MDS  F+ FV+ R+KE+++LR+E+  AL  CVDP KFVM+A+++VFPV
Sbjct  53   MDSAGFFGFVVARRKEVDALRAEMPPALKCCVDPAKFVMDAVADVFPV  100



>gb|KJB38152.1| hypothetical protein B456_006G239300 [Gossypium raimondii]
Length=389

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 48/61 (79%), Gaps = 2/61 (3%)
 Frame = +3

Query  492  MDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKSERSND  671
            M+++ FWSFVI +KKE++ LR +I  AL +C+DP +FVMEAISEVFPVDKR   +E  +D
Sbjct  1    MEAKEFWSFVIGKKKEIDLLREKIPAALSECIDPARFVMEAISEVFPVDKR--GNEGGSD  58

Query  672  L  674
            L
Sbjct  59   L  59



>ref|XP_004251422.1| PREDICTED: FRIGIDA-like protein 4a [Solanum lycopersicum]
Length=532

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 92/174 (53%), Gaps = 8/174 (5%)
 Frame = +3

Query  147  TSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLE  326
            T F+  + + +L+T+ T L K L+ HFTS+   L +KSE L  +++T   +T+ +L  ++
Sbjct  14   TFFNNLEARQTLLTTITDLNKTLTTHFTSINNTLCQKSETLDTRIRTFKEKTEDALLKIQ  73

Query  327  KRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRS  506
             RE ++    S    ++ E K +A+ E  + G   E        L   LRS+C +MD+  
Sbjct  74   NRENALPDRESSMGARIVEMKDSAISEIESLGDLSE------KSLAEVLRSYCKRMDASG  127

Query  507  FWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVF--PVDKRELKSER  662
               F+  ++KE   LR EI  AL   VDP + +++A  E     V+K+ + ++R
Sbjct  128  LVGFIQSKRKEPAGLRMEIAAALESSVDPMRLILDAAEEFVGRKVEKKAILADR  181



>gb|EAY90122.1| hypothetical protein OsI_11688 [Oryza sativa Indica Group]
 gb|EEC75943.1| hypothetical protein OsI_13039 [Oryza sativa Indica Group]
Length=188

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 10/129 (8%)
 Frame = +3

Query  222  HFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL  401
            H  SLE+ L  +SE L+ K   LD +T + L+ L  RE SI  S+ + L + D   ++  
Sbjct  58   HVGSLERRLTARSEILRTKCHFLDVRTSRRLKALRCREVSIDGSM-LGLSQFDSLTKS--  114

Query  402  VEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGD  581
             + G  G ++   +         L+S C  MD   F++F++ R+KE+++LR+E+   L  
Sbjct  115  -KAGTTGSADTARIAEG------LKSLCASMDLTVFFTFMVARRKEVDALRAELPDTLKH  167

Query  582  CVDPPKFVM  608
            CVDP +F M
Sbjct  168  CVDPARFTM  176



>ref|XP_009766201.1| PREDICTED: FRIGIDA-like protein 4a [Nicotiana sylvestris]
Length=563

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 86/158 (54%), Gaps = 4/158 (3%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            F   + + +L+ + T L K L+ HFT++++ L +KSE L  ++++    T+ +L  L+ R
Sbjct  16   FSNLESRKTLLATVTDLHKTLTTHFTNIDKTLSQKSETLDTEMKSFKQNTENALLKLQNR  75

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLK-LRSFCVQMDSRSF  509
            E ++    S     + E K AA+ E  NA    E   D S   L + LR +C +MD+   
Sbjct  76   ENALPDIESGMAAFIAEKKDAAVSEIENAA---EGLGDLSEKSLAEVLRIYCRRMDASGL  132

Query  510  WSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
             +F+  ++KE   LR+EI  AL  CVDP + +++A  E
Sbjct  133  VTFLQTKRKESTGLRTEIVAALDTCVDPMRLILDAAEE  170



>ref|XP_006340271.1| PREDICTED: FRIGIDA-like protein 4a-like isoform X1 [Solanum tuberosum]
Length=532

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 90/174 (52%), Gaps = 8/174 (5%)
 Frame = +3

Query  147  TSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLE  326
            T F+  + + +L+T+ T L K L+ HFT++   L +KSE L   ++    +T+ +L  ++
Sbjct  14   TFFNNLEARQTLLTTITDLNKALTTHFTNINNTLCQKSETLDTHVKIFKDKTEDALLKIQ  73

Query  327  KRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRS  506
             RE ++    S    ++ E K AA+ E  + G   E        L   LRS+C +MD+  
Sbjct  74   NRENALPDRESSMGARIVEMKDAAISEIESLGDLSEKS------LAEVLRSYCKRMDASG  127

Query  507  FWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFP--VDKRELKSER  662
               F+  ++KE   LR EI  AL   VDP + +++A  E     V+K+ + ++R
Sbjct  128  LVGFIQTKRKEPTGLRMEIAAALESSVDPMRLILDAAEEFVGRKVEKKAILADR  181



>ref|XP_002303026.1| hypothetical protein POPTR_0002s24090g [Populus trichocarpa]
 gb|EEE82299.1| hypothetical protein POPTR_0002s24090g [Populus trichocarpa]
Length=544

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 87/188 (46%), Gaps = 39/188 (21%)
 Frame = +3

Query  186  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  365
             +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEKRE ++ A    +
Sbjct  34   VTLNLKWKELEEHFHGLERSLKRRFHELEDQEKQYETKTRRAREILEKREAAVMAKEQAS  93

Query  366  LKKVDESKRAALVEFGNA------------------GGSEEPEVDNSA----------GL  461
            L+K+ E + AA+    NA                  G  E P +D+            G 
Sbjct  94   LEKLQEKQDAAVFAIANALQKHRKVSSAEPAAVPYDGQCESPTIDDQPPDAMTAESNLGE  153

Query  462  LL-----------KLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVM  608
            ++           +L   C QMDS     F+   +K L  L+ EI  AL   V+P + V+
Sbjct  154  IIDPSENGNLEYPQLVKLCEQMDSEGLHKFISDNRKNLAVLKEEIPLALKAAVNPAQLVL  213

Query  609  EAISEVFP  632
            +++ + +P
Sbjct  214  DSLEDFYP  221



>ref|XP_011024727.1| PREDICTED: FRIGIDA-like protein 3 [Populus euphratica]
Length=544

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 86/188 (46%), Gaps = 39/188 (21%)
 Frame = +3

Query  186  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  365
             +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEKRE ++ A    +
Sbjct  34   VTLNLKWKELEEHFHGLERSLKRRFHELEDQEKQYETKTRRAREILEKREAAVVAKEQAS  93

Query  366  LKKVDESKRAALVEFGNA------------------GGSEEPEVDNSA----------GL  461
            L+K+ E + AA+    NA                  G  E P +D+            G 
Sbjct  94   LEKLQEKQDAAVFAIANALQKHRKVSSAEPAAVLYDGQCESPTIDDQPPDAMTAESNLGE  153

Query  462  LL-----------KLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVM  608
            ++           +L   C QMDS     F+   +K L  L+ EI  AL   V+P + V+
Sbjct  154  IIDPSENGNLEYPQLVKLCEQMDSEGLHKFISDNRKNLAVLKEEIPLALKAAVNPAQLVL  213

Query  609  EAISEVFP  632
             ++ + +P
Sbjct  214  NSLEDFYP  221



>ref|XP_004968433.1| PREDICTED: uncharacterized abhydrolase domain-containing protein 
DDB_G0269086-like [Setaria italica]
Length=596

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 74/151 (49%), Gaps = 9/151 (6%)
 Frame = +3

Query  171  QTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAA  350
            Q  L+  C   W     HF SL++DL  +S AL+  L   D  T +SL  LE RE +I A
Sbjct  23   QQQLLADCQGAWSRALAHFASLDEDLASRSAALEEALAAADASTSESLAGLETREAAIPA  82

Query  351  SISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVR  530
             ++     +  S   A  E      S  P  D    +   LR  C +MD+ + W F+  R
Sbjct  83   RLAEASAALSASVAEAEAE-----SSAPPPAD----IRGALRWICRRMDAAALWRFMAAR  133

Query  531  KKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            ++EL +LR E   A+   VDPP+ V++ +S+
Sbjct  134  RRELTALRREAGPAVASAVDPPRLVLDVVSD  164



>ref|XP_011010336.1| PREDICTED: FRIGIDA-like protein 3 [Populus euphratica]
 ref|XP_011010338.1| PREDICTED: FRIGIDA-like protein 3 [Populus euphratica]
 ref|XP_011010339.1| PREDICTED: FRIGIDA-like protein 3 [Populus euphratica]
 ref|XP_011010340.1| PREDICTED: FRIGIDA-like protein 3 [Populus euphratica]
Length=545

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 88/188 (47%), Gaps = 39/188 (21%)
 Frame = +3

Query  186  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  365
             +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEKRE ++ A   ++
Sbjct  34   VTLNLKWKELEEHFHGLERSLKRRFHELEDQEKQYETKTRRAREILEKREAAVVAKEQVS  93

Query  366  LKKVDESKRAALVEFGNA------GGSEEPEV----------------------DNSAGL  461
            L+K+ E + AA+    NA        S EP V                      +++ G 
Sbjct  94   LEKLQEKRDAAIFSISNALQKHRKVSSVEPAVVSYDDQFGSPAIDDQPPEAMTAESNLGE  153

Query  462  LL-----------KLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVM  608
            ++           +L   C QMDS     F+   +K L  L+ EI  AL    +P +FV+
Sbjct  154  IIDPSENGNLEYPQLVELCEQMDSEGLHKFISDNRKNLAVLKEEIPLALKAAANPAQFVL  213

Query  609  EAISEVFP  632
             ++ + +P
Sbjct  214  NSLEDFYP  221



>ref|XP_010270166.1| PREDICTED: truncated FRIGIDA-like protein 1 [Nelumbo nucifera]
Length=519

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 83/168 (49%), Gaps = 26/168 (15%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDL---LRKSEALKAKLQTLDTQTKQSLEV  320
            +F++ Q  +S + S TL WK+L DHF S+++ L    ++ EA +A++    +  KQS   
Sbjct  24   AFEDLQSHSSSLASFTLQWKDLEDHFDSIQKSLEHRFKELEAKEAQVSAKGSAPKQSPP-  82

Query  321  LEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDS  500
             EK +++   S  +  KK DE +R           S  PE          L+S CV MD 
Sbjct  83   -EKDKSADKPSPHLPAKKPDEPER-----------SPRPE----------LKSLCVSMDG  120

Query  501  RSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKR  644
                S++I  +KEL  ++ E+  AL    DP   V++A+   FP + +
Sbjct  121  MGLRSYIIEHRKELPFVKDELAGALRTASDPATLVLDAMQGFFPPNSK  168



>gb|ABK94872.1| unknown [Populus trichocarpa]
 gb|ABK95875.1| unknown [Populus trichocarpa]
Length=544

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 86/188 (46%), Gaps = 39/188 (21%)
 Frame = +3

Query  186  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  365
             +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEKRE ++ A    +
Sbjct  34   VTLNLKWKELEEHFHGLERSLKRRFHELEDQEKQYETKTRRAREILEKREAAVMAKEQAS  93

Query  366  LKKVDESKRAALVEFGNA------------------GGSEEPEVDNSA----------GL  461
            L+K+ E + AA+    NA                  G  E P +D+            G 
Sbjct  94   LEKLQEKQDAAVFAIANALQKHRKVSSAEPAAVPYDGQCESPTIDDQPPDAMTAESNLGE  153

Query  462  LL-----------KLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVM  608
            ++           +L   C QMDS     F+   +K L  L+  I  AL   V+P + V+
Sbjct  154  IIDPSENGNLEYPQLVKLCEQMDSEGLHKFISDNRKNLAVLKEGIPLALKAAVNPAQLVL  213

Query  609  EAISEVFP  632
            +++ + +P
Sbjct  214  DSLEDFYP  221



>emb|CDM81767.1| unnamed protein product [Triticum aestivum]
Length=623

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 72/151 (48%), Gaps = 9/151 (6%)
 Frame = +3

Query  171  QTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAA  350
            Q  L+ +C   W     HF SL+QD+  +S ++   L   D  T +SL  LE RE S+  
Sbjct  23   QQQLLATCHEAWSRTLAHFASLDQDVASRSASVDEALAAADASTSESLAALEAREASVPV  82

Query  351  SISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVR  530
             ++     +  +   A  E      ++         +   LR  C +MD+ + W F+  R
Sbjct  83   RLAEASDALSAALAEAEAESAAPPPAD---------IRGALRWICRRMDAAALWRFMAAR  133

Query  531  KKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            ++EL ++R EI   +   VDPP+ V++ +S+
Sbjct  134  RRELAAVRKEIAPTVAASVDPPRLVLDVLSD  164



>gb|AAZ32849.1| hydroxyproline-rich glycoprotein-like protein [Medicago sativa]
Length=183

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 2/49 (4%)
 Frame = +3

Query  528  RKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
            +KKELE LR+E+ +ALG+C+DP KFV+EAISEVFPVDKR  KS   NDL
Sbjct  4    KKKELEGLRAEMPEALGECIDPAKFVLEAISEVFPVDKRGDKS--GNDL  50



>ref|XP_002320559.2| hypothetical protein POPTR_0014s17360g [Populus trichocarpa]
 ref|XP_006375598.1| hypothetical protein POPTR_0014s17360g [Populus trichocarpa]
 gb|EEE98874.2| hypothetical protein POPTR_0014s17360g [Populus trichocarpa]
 gb|ERP53395.1| hypothetical protein POPTR_0014s17360g [Populus trichocarpa]
Length=545

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 87/188 (46%), Gaps = 39/188 (21%)
 Frame = +3

Query  186  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  365
             +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEKRE ++ A    +
Sbjct  34   VTLNLKWKELEEHFHGLERSLKRRFHELEDQEKQYETKTRRAREILEKREAAVVAKEQDS  93

Query  366  LKKVDESKRAALVEFGNA------GGSEEPEV----------------------DNSAGL  461
            L+K+ E + AA+    NA        S EP V                      +++ G 
Sbjct  94   LEKLQEKRDAAIFSISNALQKHRKVSSVEPAVVSYDDQFGSPAIDDQPPEAMTAESNLGE  153

Query  462  LL-----------KLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVM  608
            ++           +L   C QMDS     F+   +K L  L+ EI  AL    +P +FV+
Sbjct  154  IIDPSENGNLEYPQLVELCEQMDSEGLHKFISDNRKNLAVLKEEIPLALKAAANPAQFVL  213

Query  609  EAISEVFP  632
             ++ + +P
Sbjct  214  NSLEDFYP  221



>gb|KJB08746.1| hypothetical protein B456_001G101100 [Gossypium raimondii]
Length=527

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 93/191 (49%), Gaps = 32/191 (17%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q +L  +  L WKEL +HF+ LE+ L R+   L+ + +  +T+T+++ E+L+K
Sbjct  24   AFAELESQRAL--TLNLRWKELEEHFSGLEKSLKRRFHELEDQEKEFETKTRKAREMLQK  81

Query  330  RETSIAASISITLKKVDESKRAALVEFGNA------GGSEEPEVDNSAGLL---------  464
            RE ++ A    +L ++ E + AA+    NA        S +P  +   G L         
Sbjct  82   REAAVVAKEQSSLVRLQEKRDAAVFAITNALEKHRELSSGQPADNGDNGELSVEEKQPED  141

Query  465  ---------LKLRSF------CVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPK  599
                     L+++S+      C +MDS     F+   +K L +L+ EI  AL     P +
Sbjct  142  IKSSFENGNLEVKSYPQLVKLCEEMDSEGLQKFISDNRKNLAALKEEIPWALKAAASPAR  201

Query  600  FVMEAISEVFP  632
             V+E++   +P
Sbjct  202  LVLESLEGFYP  212



>gb|KHG21752.1| Protein FRIGIDA -like protein [Gossypium arboreum]
Length=531

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 93/191 (49%), Gaps = 32/191 (17%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q +L  +  L WKEL +HF+ LE+ L R+   L+ + +  +T+T+++ E+L+K
Sbjct  24   AFAELESQRAL--TLNLRWKELEEHFSGLEKSLKRRFHELEDQEKEFETKTRKAREMLQK  81

Query  330  RETSIAASISITLKKVDESKRAALVEFGNA------GGSEEPEVDNSAGLL---------  464
            RE ++ A    +L ++ E + AA+    NA        S +P  +   G L         
Sbjct  82   REAAVVAKEQSSLVRLQEKRDAAVFAITNALEKHRKLSSGQPADNGDNGELSVEEKQPED  141

Query  465  ---------LKLRSF------CVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPK  599
                     L+++S+      C +MDS     F+   +K L +L+ EI  AL     P +
Sbjct  142  IKSSFENGNLEVKSYPQLVKLCEEMDSEGLQKFISDNRKNLAALKEEIPWALKAAASPAR  201

Query  600  FVMEAISEVFP  632
             V+E++   +P
Sbjct  202  LVLESLEGFYP  212



>ref|XP_006375597.1| hypothetical protein POPTR_0014s17360g [Populus trichocarpa]
 gb|ERP53394.1| hypothetical protein POPTR_0014s17360g [Populus trichocarpa]
Length=414

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 87/188 (46%), Gaps = 39/188 (21%)
 Frame = +3

Query  186  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  365
             +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEKRE ++ A    +
Sbjct  34   VTLNLKWKELEEHFHGLERSLKRRFHELEDQEKQYETKTRRAREILEKREAAVVAKEQDS  93

Query  366  LKKVDESKRAALVEFGNA------GGSEEPEV----------------------DNSAGL  461
            L+K+ E + AA+    NA        S EP V                      +++ G 
Sbjct  94   LEKLQEKRDAAIFSISNALQKHRKVSSVEPAVVSYDDQFGSPAIDDQPPEAMTAESNLGE  153

Query  462  LL-----------KLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVM  608
            ++           +L   C QMDS     F+   +K L  L+ EI  AL    +P +FV+
Sbjct  154  IIDPSENGNLEYPQLVELCEQMDSEGLHKFISDNRKNLAVLKEEIPLALKAAANPAQFVL  213

Query  609  EAISEVFP  632
             ++ + +P
Sbjct  214  NSLEDFYP  221



>gb|KJB08747.1| hypothetical protein B456_001G101100 [Gossypium raimondii]
Length=339

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 93/191 (49%), Gaps = 32/191 (17%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q +L  +  L WKEL +HF+ LE+ L R+   L+ + +  +T+T+++ E+L+K
Sbjct  24   AFAELESQRAL--TLNLRWKELEEHFSGLEKSLKRRFHELEDQEKEFETKTRKAREMLQK  81

Query  330  RETSIAASISITLKKVDESKRAALVEFGNA------GGSEEPEVDNSAGLL---------  464
            RE ++ A    +L ++ E + AA+    NA        S +P  +   G L         
Sbjct  82   REAAVVAKEQSSLVRLQEKRDAAVFAITNALEKHRELSSGQPADNGDNGELSVEEKQPED  141

Query  465  ---------LKLRSF------CVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPK  599
                     L+++S+      C +MDS     F+   +K L +L+ EI  AL     P +
Sbjct  142  IKSSFENGNLEVKSYPQLVKLCEEMDSEGLQKFISDNRKNLAALKEEIPWALKAAASPAR  201

Query  600  FVMEAISEVFP  632
             V+E++   +P
Sbjct  202  LVLESLEGFYP  212



>gb|KJB08745.1| hypothetical protein B456_001G101100 [Gossypium raimondii]
Length=531

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 93/191 (49%), Gaps = 32/191 (17%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q +L  +  L WKEL +HF+ LE+ L R+   L+ + +  +T+T+++ E+L+K
Sbjct  24   AFAELESQRAL--TLNLRWKELEEHFSGLEKSLKRRFHELEDQEKEFETKTRKAREMLQK  81

Query  330  RETSIAASISITLKKVDESKRAALVEFGNA------GGSEEPEVDNSAGLL---------  464
            RE ++ A    +L ++ E + AA+    NA        S +P  +   G L         
Sbjct  82   REAAVVAKEQSSLVRLQEKRDAAVFAITNALEKHRELSSGQPADNGDNGELSVEEKQPED  141

Query  465  ---------LKLRSF------CVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPK  599
                     L+++S+      C +MDS     F+   +K L +L+ EI  AL     P +
Sbjct  142  IKSSFENGNLEVKSYPQLVKLCEEMDSEGLQKFISDNRKNLAALKEEIPWALKAAASPAR  201

Query  600  FVMEAISEVFP  632
             V+E++   +P
Sbjct  202  LVLESLEGFYP  212



>gb|KJB08748.1| hypothetical protein B456_001G101100 [Gossypium raimondii]
Length=401

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 93/191 (49%), Gaps = 32/191 (17%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q +L  +  L WKEL +HF+ LE+ L R+   L+ + +  +T+T+++ E+L+K
Sbjct  24   AFAELESQRAL--TLNLRWKELEEHFSGLEKSLKRRFHELEDQEKEFETKTRKAREMLQK  81

Query  330  RETSIAASISITLKKVDESKRAALVEFGNA------GGSEEPEVDNSAGLL---------  464
            RE ++ A    +L ++ E + AA+    NA        S +P  +   G L         
Sbjct  82   REAAVVAKEQSSLVRLQEKRDAAVFAITNALEKHRELSSGQPADNGDNGELSVEEKQPED  141

Query  465  ---------LKLRSF------CVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPK  599
                     L+++S+      C +MDS     F+   +K L +L+ EI  AL     P +
Sbjct  142  IKSSFENGNLEVKSYPQLVKLCEEMDSEGLQKFISDNRKNLAALKEEIPWALKAAASPAR  201

Query  600  FVMEAISEVFP  632
             V+E++   +P
Sbjct  202  LVLESLEGFYP  212



>ref|XP_009598293.1| PREDICTED: FRIGIDA-like protein 4a [Nicotiana tomentosiformis]
Length=562

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 84/158 (53%), Gaps = 4/158 (3%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            F   + + +L+ + T L K L+ HFT++++ L +KSE L  ++++    T+ +L  L+ R
Sbjct  16   FSNLESRKTLLATVTDLHKTLTTHFTNIDKTLSQKSETLDNQIKSFKENTENALLKLQNR  75

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLK-LRSFCVQMDSRSF  509
            E ++    S     + + K AAL E  NA    E   D S   L + LR +C +MD+   
Sbjct  76   ENALPDIESGMAAFIADKKDAALSEIENAA---EGLGDLSEKSLAEVLRIYCRRMDASGL  132

Query  510  WSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
              F+  ++KE   LR+EI  AL   VDP + +++A  E
Sbjct  133  VRFLQTKRKESTGLRTEIVAALDTSVDPMRLILDAAEE  170



>ref|NP_001141095.1| hypothetical protein [Zea mays]
 gb|ACF85388.1| unknown [Zea mays]
 gb|ACR35943.1| unknown [Zea mays]
 tpg|DAA53152.1| TPA: hypothetical protein ZEAMMB73_480801 [Zea mays]
Length=639

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 75/157 (48%), Gaps = 9/157 (6%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            F   + Q  +++ C   W     HF S E+DL  +S AL   L   D  T ++L  LE R
Sbjct  17   FALLESQQQVLSDCHGAWSRALAHFASREEDLASRSAALDEALAAADVSTSETLAALEAR  76

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            E+SI A ++     +  +   A  E      +  P  D    +   LR  C +MD+ + W
Sbjct  77   ESSIPARLAEASAALSAAVAEAETE-----STGPPPTD----IKGALRWICRRMDAAALW  127

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISE  623
             F+  R++EL  +R E   A+   VDPP+ V++ +S+
Sbjct  128  RFMAARRRELAVVRREAGPAVAMAVDPPRLVLDVVSD  164



>gb|ACG48802.1| hypothetical protein [Zea mays]
 tpg|DAA53151.1| TPA: hypothetical protein ZEAMMB73_480801 [Zea mays]
Length=309

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 72/153 (47%), Gaps = 9/153 (6%)
 Frame = +3

Query  153  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  332
            F   + Q  +++ C   W     HF S E+DL  +S AL   L   D  T ++L  LE R
Sbjct  17   FALLESQQQVLSDCHGAWSRALAHFASREEDLASRSAALDEALAAADVSTSETLAALEAR  76

Query  333  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFW  512
            E+SI A ++     +  +   A  E      +  P  D    +   LR  C +MD+ + W
Sbjct  77   ESSIPARLAEASAALSAAVAEAETE-----STGPPPTD----IKGALRWICRRMDAAALW  127

Query  513  SFVIVRKKELESLRSEIRKALGDCVDPPKFVME  611
             F+  R++EL  +R E   A+   VDPP+ V++
Sbjct  128  RFMAARRRELAVVRREAGPAVAMAVDPPRLVLD  160



>ref|XP_002455057.1| hypothetical protein SORBIDRAFT_03g003680 [Sorghum bicolor]
 gb|EES00177.1| hypothetical protein SORBIDRAFT_03g003680 [Sorghum bicolor]
Length=611

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 73/151 (48%), Gaps = 9/151 (6%)
 Frame = +3

Query  171  QTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAA  350
            Q  ++  C   W     HF SLE+DL  +S AL+  L   D  T +SL  LE RE+++ A
Sbjct  23   QQQILADCHGAWSRALAHFASLEEDLASRSAALEEALAAADASTSESLAALEARESAVPA  82

Query  351  SISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVR  530
             +S     +  +   A  E      S  P   +  G    LR  C +MD+ + W F+   
Sbjct  83   RLSEASAALSAAVAEAETE------STGPPPSDIKG---ALRWICRRMDAAALWRFMAAH  133

Query  531  KKELESLRSEIRKALGDCVDPPKFVMEAISE  623
            ++EL  +R E   A+   VDPP+ V++ +S+
Sbjct  134  RRELAVVRKEAGPAVAMAVDPPRLVLDVVSD  164



>gb|KDO79035.1| hypothetical protein CISIN_1g008359mg [Citrus sinensis]
 gb|KDO79036.1| hypothetical protein CISIN_1g008359mg [Citrus sinensis]
 gb|KDO79037.1| hypothetical protein CISIN_1g008359mg [Citrus sinensis]
Length=568

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 90/191 (47%), Gaps = 44/191 (23%)
 Frame = +3

Query  204  WKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDE  383
            WKE+ +HF +LE  L RKSE L+A+ +  + +  ++  +L +RE ++AA     + +V E
Sbjct  40   WKEIEEHFYNLETTLKRKSEELEAREKEYEEKESKTHALLAEREAAVAAKEQDFIDRVQE  99

Query  384  SKRAALVEFGNA--------------------------GGSEEPEVD-------NSAGLL  464
             K AA+   G+A                          G ++ PE D       N  G+ 
Sbjct  100  LKDAAVAAIGDARANYQPTSLDPADEGDNQDSKVSSSLGDNKSPEEDFPHEMSENDKGVN  159

Query  465  LKLR----SFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVF-  629
            +K R     FC QMD++   +F+I  +K L ++R E+  AL    +P + V++ +   + 
Sbjct  160  VKPRPELTQFCKQMDAKGLLNFIIENRKNLYAIREELPVALESATEPARLVLDLLEGFYL  219

Query  630  ------PVDKR  644
                  P+D+R
Sbjct  220  PDETNQPLDER  230



>ref|XP_006426019.1| hypothetical protein CICLE_v10025275mg [Citrus clementina]
 ref|XP_006426020.1| hypothetical protein CICLE_v10025275mg [Citrus clementina]
 gb|ESR39259.1| hypothetical protein CICLE_v10025275mg [Citrus clementina]
 gb|ESR39260.1| hypothetical protein CICLE_v10025275mg [Citrus clementina]
Length=568

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 89/191 (47%), Gaps = 44/191 (23%)
 Frame = +3

Query  204  WKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDE  383
            WKE+ +HF +LE  L RKSE L+A+ +  + +  ++  +L +RE ++AA     + +V E
Sbjct  40   WKEIEEHFYNLETTLKRKSEELEAREKEYEEKESKTHALLAEREAAVAAKEQDFIDRVQE  99

Query  384  SKRAALVEFGNAGGSEEP----EVD-----------------------------NSAGLL  464
             K AA+   G+A G+ +P     VD                             N  G+ 
Sbjct  100  LKDAAVAAIGDARGNYQPTSFDPVDEGDNQDSKVSSSLGDNKSPEEDFPHEMSENDKGVN  159

Query  465  LKLRS----FCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVF-  629
            +K R     FC QMD++   +F+I  +K L ++R E+  AL    +P   V++ +   + 
Sbjct  160  VKPRPELTQFCKQMDAKGLLNFIIENRKNLYAIREELPVALESATEPAHLVLDLLEGFYL  219

Query  630  ------PVDKR  644
                  P+D+R
Sbjct  220  PDETNQPLDER  230



>ref|XP_006466524.1| PREDICTED: FRIGIDA-like protein 3-like isoform X1 [Citrus sinensis]
 ref|XP_006466525.1| PREDICTED: FRIGIDA-like protein 3-like isoform X2 [Citrus sinensis]
Length=568

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 90/191 (47%), Gaps = 44/191 (23%)
 Frame = +3

Query  204  WKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDE  383
            WKE+ +HF +LE  L RKSE L+A+ +  + +  ++  +L +RE ++AA     + +V E
Sbjct  40   WKEIEEHFYNLETTLKRKSEELEAREKEYEEKESKTHALLAEREAAVAAKEQDFIDRVQE  99

Query  384  SKRAALVEFGNA--------------------------GGSEEPEVD-------NSAGLL  464
             K AA+   G+A                          G ++ PE D       N  G+ 
Sbjct  100  LKDAAVAAIGDARANYQPTSLDPADEGDNQDSKVSSSLGDNKSPEEDFPHEMSENDKGVN  159

Query  465  LKLR----SFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVF-  629
            +K R     FC QMD++   +F+I  +K L ++R E+  AL    +P + V++ +   + 
Sbjct  160  VKPRPELTQFCKQMDAKGLLNFIIENRKNLYAIREELPVALESATEPARLVLDLLEGFYL  219

Query  630  ------PVDKR  644
                  P+D+R
Sbjct  220  PDETNQPLDER  230



>ref|XP_006858746.1| PREDICTED: FRIGIDA-like protein 3 [Amborella trichopoda]
 gb|ERN20213.1| hypothetical protein AMTR_s00066p00134410 [Amborella trichopoda]
Length=544

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/205 (25%), Positives = 99/205 (48%), Gaps = 32/205 (16%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q ++  S  L WK L +HF  LE+ L ++ E L+ K +  + +  ++ E+LEK
Sbjct  24   AFAELEGQRAV--SLNLKWKALEEHFHDLERSLKKRFEELEEKEKAFEARASEAKEMLEK  81

Query  330  RETSIAASISITLKKVDESKRAALVEFGNA---GGSEEPE---VDNSAGLL---------  464
            RE ++ A    +L +V + + AAL     A      E PE   V+++ G++         
Sbjct  82   REAAVNAKEEASLDRVQDQRDAALSAIEEAFQKCRKESPEPIIVESNNGMIDASPESKPT  141

Query  465  ---------------LKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPK  599
                            +L+ FC +MD++    F+   +K L ++R E+  AL    DP +
Sbjct  142  DSKASEVGSPGIEPRPQLKKFCEEMDAKGLHKFISENRKALAAMREEVPAALKCATDPAQ  201

Query  600  FVMEAISEVFPVDKRELKSERSNDL  674
             V++++   +  ++   + +R ++L
Sbjct  202  LVLDSLEGFYGSEQSGQEGKRDSNL  226



>ref|XP_003634846.1| PREDICTED: FRIGIDA-like protein 3 [Vitis vinifera]
 emb|CAN80762.1| hypothetical protein VITISV_014605 [Vitis vinifera]
Length=545

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/217 (24%), Positives = 101/217 (47%), Gaps = 44/217 (20%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E +   +L  +  L WK+L +HF  LE+ L R+   L+ + +  + +T ++ ++LEK
Sbjct  24   AFAELESHRAL--TLNLKWKQLEEHFHGLEKSLKRRFNELEDQEKEFEMKTMEAQQLLEK  81

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEP---------EVDNSAGLLL-----  467
            RE ++ A    +L+++ E + AA+    NA G  +            +N AG+ +     
Sbjct  82   REAAVVAKEQDSLRRLQEKRDAAVFAIVNALGKHDKLSSSGHAVVASENRAGVPIMEEKP  141

Query  468  ----------------------KLRSF------CVQMDSRSFWSFVIVRKKELESLRSEI  563
                                  +L+S+      C  MDS     F+   +K L ++R EI
Sbjct  142  LDAMAAESNLEDVKGSSEIENVELKSYPQLIKLCEDMDSEGLHKFISDNRKNLAAMREEI  201

Query  564  RKALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
             +AL   +DP +FV++++ + + ++   L  ++  +L
Sbjct  202  PQALKAAMDPARFVLDSLEDFYRIEIPNLDGKKDANL  238



>ref|XP_002527289.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35133.1| conserved hypothetical protein [Ricinus communis]
Length=542

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 88/188 (47%), Gaps = 37/188 (20%)
 Frame = +3

Query  186  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  365
             +  L WKEL +HF  LE+ L R+   L+ + +   T+T+++ E+LEKRE ++ A    +
Sbjct  34   VTLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYATKTRRAQEMLEKREAAVLAKEHAS  93

Query  366  LKKVDESKRAALVEFGNA------GGSEEPEV------------------------DNSA  455
            L+++ E + AA+    +A      G S EP V                        +NS+
Sbjct  94   LERLQEKRDAAVFAIAHALQKNGQGSSAEPVVVTSDVQFELPSIEYQPHDTMAAVANNSS  153

Query  456  --GLL-----LKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEA  614
              G++      +L   C  MDS     F+   +K L  LR EI  AL    +P + V+ +
Sbjct  154  ENGIMEVMSYPELTKLCGAMDSEGLHKFISDNRKNLAVLREEIPLALKAAENPGQLVLNS  213

Query  615  ISEVFPVD  638
            + + +P++
Sbjct  214  LEDFYPME  221



>emb|CDY00066.1| BnaC09g02350D [Brassica napus]
Length=534

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 51/191 (27%), Positives = 93/191 (49%), Gaps = 18/191 (9%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q   +T   L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  24   AFAELESQRCAVT-LNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQELLEK  82

Query  330  RETSIAASISITLKKVDESK-------RAALVEFGNAG---GS-------EEPEVDNSAG  458
            ++ ++ A    +L+++ + +        +AL ++ NA    GS       E+ E+     
Sbjct  83   KKAAVEAKEKASLERLQKKRDSAVFAINSALDKYNNAPIADGSITDGTVQEDAEISPQVK  142

Query  459  LLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVD  638
               +L   C  MDS     FV   +K L SL+ EI  A     +P   V++++   +P++
Sbjct  143  AYPELLKLCKDMDSTGLHKFVSDNRKNLASLKEEIPLAFKVAANPATLVLDSLEGFYPIE  202

Query  639  KRELKSERSND  671
                 S+   D
Sbjct  203  SSPPPSDGKKD  213



>gb|ABF98223.1| hypothetical protein LOC_Os03g47804 [Oryza sativa Japonica Group]
Length=176

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 65/130 (50%), Gaps = 24/130 (18%)
 Frame = +3

Query  222  HFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRE-TSIAASISITLKKVDESKRAA  398
            H  SLE+ L  +SE L+ K   LD +T + L+ L  RE  S+A S               
Sbjct  58   HVGSLERRLAARSEILRTKCHFLDVRTSRRLKALRCREFDSLAKS---------------  102

Query  399  LVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALG  578
              + G  G ++   +         L+S C  MD   F++F++ R+KE+++LR+E+  AL 
Sbjct  103  --KAGTTGSADTARIAEG------LKSLCASMDLAVFFTFMVARRKEVDALRAELPDALK  154

Query  579  DCVDPPKFVM  608
             CV+P +F M
Sbjct  155  HCVNPARFTM  164



>ref|XP_010251408.1| PREDICTED: FRIGIDA-like protein 3 [Nelumbo nucifera]
 ref|XP_010251409.1| PREDICTED: FRIGIDA-like protein 3 [Nelumbo nucifera]
Length=545

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 100/218 (46%), Gaps = 45/218 (21%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E +   ++  +  L WKEL +HF  LE+ L ++   L+ + +  +++  ++ E+LEK
Sbjct  24   AFAELESHRAI--TLNLKWKELEEHFHGLERSLKQRFNELEDQEKKYESKVSEAQEMLEK  81

Query  330  RETSIAASISITLKKVDESKRAALVEFG-------NA-------------GGS-----EE  434
            R+ ++ A    +L+K+ E + AAL   G       NA             GG+     E+
Sbjct  82   RKAAVVAKEQASLEKLQEKRDAALFAIGIVVDKYKNALTSEPAIVNIEESGGADAVVEEK  141

Query  435  PEVDNSAGLLL------------------KLRSFCVQMDSRSFWSFVIVRKKELESLRSE  560
            P   NS  + +                  +L   C +MDS+    F+   +K L ++R E
Sbjct  142  PPDANSTSVDIEDVQNPSNNGDMEENPPSELTKLCKEMDSKGLHKFISDNRKNLAAIREE  201

Query  561  IRKALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
            I  AL    +P   V++++ + +P+D   L  ++  +L
Sbjct  202  IPIALKAATNPAHLVLDSLEDFYPMDVTTLDGKKDANL  239



>gb|ABU93956.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93957.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93958.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93959.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93960.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93962.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93963.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93964.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93965.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93966.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93967.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93968.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93969.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93970.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93971.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93972.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93973.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93974.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93975.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93976.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93977.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93978.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93979.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93980.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93981.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93982.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93983.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93984.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93985.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93986.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93987.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93988.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93989.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93990.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93991.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93992.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93993.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93994.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93995.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
 gb|ABU93996.1| hydroxyproline-rich glycoprotein-like protein [Pinus pinaster]
Length=129

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 70/122 (57%), Gaps = 14/122 (11%)
 Frame = +3

Query  303  KQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSF  482
            K++ E+L+KRE SI ++    L +++E K AAL     +G SE     NS      L+  
Sbjct  1    KETEELLDKREQSIESNEETYLARLEEQKNAALAAI-ESGKSE-----NS------LKFL  48

Query  483  CVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKSER  662
            C +MD+   W F++ R+K++ +LR+E+  AL   +DP + V++A+   +  DK   K+E+
Sbjct  49   CEKMDAEGLWRFIVERRKDVTALRAELPSALESAIDPARLVLQALEGFY--DKGTGKTEK  106

Query  663  SN  668
             +
Sbjct  107  KD  108



>ref|NP_001151902.1| ABI3-interacting protein 2 [Zea mays]
 gb|ACF85534.1| unknown [Zea mays]
 gb|ACG44869.1| ABI3-interacting protein 2 [Zea mays]
 gb|ACN29239.1| unknown [Zea mays]
 tpg|DAA39370.1| TPA: ABI3-interacting protein 2 isoform 1 [Zea mays]
 tpg|DAA39371.1| TPA: ABI3-interacting protein 2 isoform 2 [Zea mays]
 tpg|DAA39372.1| TPA: ABI3-interacting protein 2 isoform 3 [Zea mays]
Length=534

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/205 (27%), Positives = 94/205 (46%), Gaps = 32/205 (16%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q+++  S  L WK+L DHF  LEQ L +K + LK + +       +S ++LE+
Sbjct  24   AFAELESQSTV--SMNLKWKQLEDHFRGLEQSLKKKFDELKEQEKEFQETVAKSEQILEQ  81

Query  330  RETSIAASISITLKKVDESKRAALV--------------------EFGNAG------GSE  431
            RE ++ A    +L+K+ E + AAL                        N G       SE
Sbjct  82   REAAVVAKELTSLEKLQEKREAALAMIFSKSRLSLPVPTINPMNKALNNLGVKWPKPASE  141

Query  432  EP---EVDNSAGLLL-KLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPK  599
            E    +VDN+      +L + C +M+ +    F+   +K L ++R EI  AL     P  
Sbjct  142  ESVHLQVDNAVVTPRSELVALCEEMNVKGLHKFISDNRKNLAAIREEIPSALKKTSHPYG  201

Query  600  FVMEAISEVFPVDKRELKSERSNDL  674
             V++++ + +  D   L  ++  DL
Sbjct  202  LVLDSLEDFYSGDNLVLDGKKDGDL  226



>gb|ABU93961.1| hydroxyproline-rich glycoprotein-like protein, partial [Pinus 
sylvestris]
Length=129

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 70/122 (57%), Gaps = 14/122 (11%)
 Frame = +3

Query  303  KQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSF  482
            K++ E+L+KRE S+ ++    L +++E K AAL     +G SE     NS      L+  
Sbjct  1    KETEELLDKREQSMESNEETYLARLEEQKNAALAAI-ESGKSE-----NS------LKFL  48

Query  483  CVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKSER  662
            C +MD+   W F++ R+K++ +LR+E+  AL   +DP + V++A+   +  DK   K+E+
Sbjct  49   CEKMDAEGLWRFIVERRKDVTALRAELPSALESAIDPARLVLQALEGFY--DKGTGKTEK  106

Query  663  SN  668
             +
Sbjct  107  KD  108



>ref|XP_012084486.1| PREDICTED: FRIGIDA-like protein 3 [Jatropha curcas]
 ref|XP_012084494.1| PREDICTED: FRIGIDA-like protein 3 [Jatropha curcas]
 gb|KDP45205.1| hypothetical protein JCGZ_15070 [Jatropha curcas]
Length=538

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 49/190 (26%), Positives = 83/190 (44%), Gaps = 39/190 (21%)
 Frame = +3

Query  186  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  365
             +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ EVLEKRE ++ A    +
Sbjct  34   VTLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQEVLEKREAAVLAKEQAS  93

Query  366  LKKVDESKRAALVEFGNAGGSE------EP-----------------------------E  440
            L ++ E + AA+    NA          EP                             E
Sbjct  94   LGRLQEKRDAAVFAITNALQKHRKVSIVEPAVVTSDLQGELSTIEDQPPETLAAESNLGE  153

Query  441  VDNSAGL----LLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVM  608
             +N+  +      +L   C  MDS     F+   +K L  LR EI  AL    +P + V+
Sbjct  154  TNNNGNVEAMSYPELFKLCEAMDSEGLHKFISDNRKNLAVLREEIPLALKAAENPAQLVL  213

Query  609  EAISEVFPVD  638
             ++ + +P++
Sbjct  214  NSLEDFYPIE  223



>ref|XP_004290112.1| PREDICTED: FRIGIDA-like protein 3 [Fragaria vesca subsp. vesca]
 ref|XP_011458126.1| PREDICTED: FRIGIDA-like protein 3 [Fragaria vesca subsp. vesca]
Length=546

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 49/189 (26%), Positives = 86/189 (46%), Gaps = 41/189 (22%)
 Frame = +3

Query  186  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  365
             +  L WKEL +HF  LE+ L R+   L+ + +  +T+T ++  +L+KR+ ++ A     
Sbjct  34   VTLNLKWKELEEHFHGLEKSLKRRFHELEGQEKEFETRTVEAQRMLQKRQAAVVAKEEAR  93

Query  366  LKKVDESKRAALVEFGNA--------------------GGS-----EEPEV---------  443
            L+ + E + AA+    NA                    GGS     + P+V         
Sbjct  94   LETLQEKRDAAVYAITNAREKQRKVSTEESSCITDDGQGGSPTVEEKPPDVMVSDSNLEE  153

Query  444  ----DNSAGLLL---KLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKF  602
                +N +  ++   +L SFC QMDS     F+   +K L ++R EI  A     +P  F
Sbjct  154  VTSPENGSIEVMSYPQLVSFCEQMDSEGLHKFISDNRKNLAAIREEIPLAFRAAANPALF  213

Query  603  VMEAISEVF  629
            V+E++ + +
Sbjct  214  VLESLEDFY  222



>ref|XP_004956399.1| PREDICTED: protein FRIGIDA-like [Setaria italica]
Length=534

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 95/208 (46%), Gaps = 38/208 (18%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E +RQ+++  S  L WK+L DHF  LEQ L +K + LK + +       +S ++LE+
Sbjct  24   AFAELERQSAV--SMNLKWKQLEDHFRGLEQSLKKKFDELKEQEKEFQETVAKSEQMLEQ  81

Query  330  RETSIAASISITLKKVDESKRAALV--------------------EFGNAG------GSE  431
            RE ++ A    +L+++ E + AAL                        N G       SE
Sbjct  82   REAAVVAKELTSLERLQEKRDAALAMIFSKSKLSLPVPAINPMDKALDNLGVKWPKLASE  141

Query  432  EP---EVDNSAGLLLKLR----SFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVD  590
            E    +VD +A   +K R    S C +M+ +    F+   +K L  +R EI  AL     
Sbjct  142  ESVRLQVDCAA---VKPRSELVSLCEEMNVKGLHKFISDNRKNLAIIREEIPSALQKASH  198

Query  591  PPKFVMEAISEVFPVDKRELKSERSNDL  674
            P   V++++ + +  D   L  ++  DL
Sbjct  199  PYGLVLDSLEDFYAGDNLVLDGKKDGDL  226



>ref|XP_003565433.1| PREDICTED: FRIGIDA-like protein 4b [Brachypodium distachyon]
Length=608

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 86/172 (50%), Gaps = 17/172 (10%)
 Frame = +3

Query  147  TSFDEFQR-------QTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTK  305
            T+  E QR       Q  L+ +C   W     HF SL+QD+   S +L   L   D  T 
Sbjct  8    TAAGEVQRLLSHLDSQQQLLATCHDAWSRALAHFASLDQDVAALSASLDEALAAADASTS  67

Query  306  QSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  485
            +SL  L+ RE    A++ + L +  E+  AA+ E  +A     P++  +      LR  C
Sbjct  68   ESLAALDARE----AAVPVRLAEASEALSAAIAEAESAPAPPPPDIRGA------LRWIC  117

Query  486  VQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDK  641
             +MD+ + W F+  R++EL ++R E+  AL   VDPP+ V++ +S+    ++
Sbjct  118  RRMDAAALWRFMASRRRELSAVRKEVVPALAAAVDPPRLVLDVLSDFLSANE  169



>ref|XP_009342384.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Pyrus x bretschneideri]
 ref|XP_009342394.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Pyrus x bretschneideri]
Length=536

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/191 (26%), Positives = 89/191 (47%), Gaps = 33/191 (17%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E +   ++  +  L WKEL  HF  LE+ L R+ + L+++ +  +T+T ++ ++LEK
Sbjct  24   AFSELESHRAV--TLNLKWKELEAHFHGLEKSLKRRFDELESQEKEFETRTIEAQKLLEK  81

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAG------GSEEPEV--DNSAG---------  458
            R+ ++ A    +L+ + + + AA     +A        +EEP V  D+  G         
Sbjct  82   RQAAVVAKEQASLEILQKKRDAAAYAITHAREKQRKVSTEEPSVVTDDGQGEPPSVEEKP  141

Query  459  --------------LLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPP  596
                             +L   C QMD+    +F+   +K L S+R EI  AL     P 
Sbjct  142  PDMKSPEMVSIEVMSYPQLAKLCEQMDTEGLHTFISDNRKNLASIREEIPLALRAAAKPA  201

Query  597  KFVMEAISEVF  629
             FV+E++ + +
Sbjct  202  LFVLESLEDFY  212



>dbj|BAD19898.1| putative ABI3-interacting protein 2 [Oryza sativa Japonica Group]
 dbj|BAD26002.1| putative ABI3-interacting protein 2 [Oryza sativa Japonica Group]
 gb|ACJ54912.1| ABI3 interacting protein [Oryza sativa Japonica Group]
 dbj|BAG96275.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE69256.1| hypothetical protein OsJ_28510 [Oryza sativa Japonica Group]
Length=545

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 96/216 (44%), Gaps = 43/216 (20%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q+++  S  L WK+L DHF  LEQ L +K + LK + +  +    +S ++LE+
Sbjct  24   AFAELESQSAV--SLNLKWKQLEDHFHGLEQSLKKKFDDLKRQEEEFEETVAKSEQMLEQ  81

Query  330  RETSIAASISITLKKVDESKRAAL---------------------------VEFGNAGGS  428
            +E  + A    +L+K+ + + AAL                           V  GN GGS
Sbjct  82   QEAVVVAKELTSLEKLQQKRDAALAVIFGKSKLNLSTPLINPISKSVNNNAVFNGNIGGS  141

Query  429  -----EEPEVDNSAGL-----LLKLRS----FCVQMDSRSFWSFVIVRKKELESLRSEIR  566
                  +P   + A L      +K RS     C +M+      F+   +K+L S+R EI 
Sbjct  142  LSVKWPKPATAHGAYLQDENTAVKPRSQLVVLCEEMNVNGLHKFISDNRKDLTSIREEIP  201

Query  567  KALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
             AL    DP   V+ ++ + +  D   L  ++  +L
Sbjct  202  VALRGATDPYGLVLASLEDFYFGDNLILDGKKDGNL  237



>ref|XP_008382546.1| PREDICTED: FRIGIDA-like protein 3 [Malus domestica]
Length=546

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 92/201 (46%), Gaps = 43/201 (21%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E +   ++  +  L WKEL  HF  LE+ L R+ + L+++ +  +T+T ++ ++LEK
Sbjct  24   AFSELESHRAV--TLNLKWKELEAHFHGLEKSLKRRFDELESQEKEFETRTVEAQKLLEK  81

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAG------GSEEPEV--DNSAGLL-------  464
            R+ ++ A    +L+ + + + AA     NA        +EEP V  D+  G         
Sbjct  82   RQAAVVAKEQASLEILQKKRDAAAYAITNAREKQRKVSTEEPSVVTDDGQGEPPXVEEKP  141

Query  465  --------------------LKLRSF------CVQMDSRSFWSFVIVRKKELESLRSEIR  566
                                +K+ S+      C QMD+     F+   +K L S+R EI 
Sbjct  142  PDMIVSDSNCEEMKSPEMGSIKVMSYPQLAKLCEQMDTEGLHKFISDNRKNLASIREEIP  201

Query  567  KALGDCVDPPKFVMEAISEVF  629
             AL    +P  FV+E++ + +
Sbjct  202  LALRAAANPALFVLESLEDFY  222



>ref|NP_001062667.1| Os09g0248200 [Oryza sativa Japonica Group]
 dbj|BAD19897.1| putative ABI3-interacting protein 2 [Oryza sativa Japonica Group]
 dbj|BAD26001.1| putative ABI3-interacting protein 2 [Oryza sativa Japonica Group]
 dbj|BAF24581.1| Os09g0248200 [Oryza sativa Japonica Group]
Length=540

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 96/216 (44%), Gaps = 43/216 (20%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q+++  S  L WK+L DHF  LEQ L +K + LK + +  +    +S ++LE+
Sbjct  24   AFAELESQSAV--SLNLKWKQLEDHFHGLEQSLKKKFDDLKRQEEEFEETVAKSEQMLEQ  81

Query  330  RETSIAASISITLKKVDESKRAAL---------------------------VEFGNAGGS  428
            +E  + A    +L+K+ + + AAL                           V  GN GGS
Sbjct  82   QEAVVVAKELTSLEKLQQKRDAALAVIFGKSKLNLSTPLINPISKSVNNNAVFNGNIGGS  141

Query  429  -----EEPEVDNSAGL-----LLKLRS----FCVQMDSRSFWSFVIVRKKELESLRSEIR  566
                  +P   + A L      +K RS     C +M+      F+   +K+L S+R EI 
Sbjct  142  LSVKWPKPATAHGAYLQDENTAVKPRSQLVVLCEEMNVNGLHKFISDNRKDLTSIREEIP  201

Query  567  KALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
             AL    DP   V+ ++ + +  D   L  ++  +L
Sbjct  202  VALRGATDPYGLVLASLEDFYFGDNLILDGKKDGNL  237



>ref|XP_003516350.1| PREDICTED: auxin transporter-like protein 4-like [Glycine max]
Length=409

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  528  RKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKR  644
            +KKEL+ LR+E+  AL +CVDP KF++EAISEVFPVDKR
Sbjct  351  KKKELDGLRAEMLVALVECVDPAKFMLEAISEVFPVDKR  389



>gb|EEC84154.1| hypothetical protein OsI_30525 [Oryza sativa Indica Group]
Length=540

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 96/216 (44%), Gaps = 43/216 (20%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q+++  S  L WK+L DHF  LEQ L +K + LK + +  +    +S ++LE+
Sbjct  24   AFAELESQSAV--SLNLKWKQLEDHFHGLEQSLKKKFDDLKRQEEEFEETVAKSEQMLEQ  81

Query  330  RETSIAASISITLKKVDESKRAAL---------------------------VEFGNAGGS  428
            +E  + A    +L+K+ + + AAL                           V  GN GGS
Sbjct  82   QEAVVVAKELTSLEKLQQKRDAALAVIFGKSKLNLSTPLINPISKSVNNNAVLNGNIGGS  141

Query  429  -----EEPEVDNSAGL-----LLKLRS----FCVQMDSRSFWSFVIVRKKELESLRSEIR  566
                  +P   + A L      +K RS     C +M+      F+   +K+L S+R EI 
Sbjct  142  LSVKWPKPATAHGAYLQDENTAVKPRSQLVVLCEEMNVNGLHKFISDNRKDLTSIREEIP  201

Query  567  KALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
             AL    DP   V+ ++ + +  D   L  ++  +L
Sbjct  202  VALRGATDPYGLVLASLEDFYFGDNLILDGKKDGNL  237



>gb|AFW79629.1| hypothetical protein ZEAMMB73_791390 [Zea mays]
Length=314

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +3

Query  489  QMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKS  656
            +MDS +F  FV+ R+KE ++LR+E+  AL   VDP KF+M+ I++ FPVD RE+++
Sbjct  53   RMDSTAFLGFVVARRKEWDALRAEVSAALKLRVDPNKFLMDVITDFFPVDHREVRN  108



>gb|AIG88464.1| FRIGIDA-like protein, partial [Beta vulgaris subsp. vulgaris]
Length=333

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 95/225 (42%), Gaps = 52/225 (23%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E +   ++  S  L WKEL  HF  LE+ L R+   L+ + +  +++T ++ E++EK
Sbjct  3    AFAELESHRAV--SLNLKWKELEAHFHGLEKSLKRRFHELEDQEKEYESKTVEAQEMIEK  60

Query  330  RETSIAASISITLKKVDESKRAALVEFGNA------------------------------  419
            R+T++ A    +L+K+ E + AA+     A                              
Sbjct  61   RKTAVVAKEQASLEKLQEKRDAAVFAIAIAREKHRRVSCEEYSVDNSESQSGTMEETPTN  120

Query  420  -----------------GGSEEPEVDNSAGLLL---KLRSFCVQMDSRSFWSFVIVRKKE  539
                             G SE    DN  G +    +L   C +MD+    +F+   +K 
Sbjct  121  SMISEITSDYTSGTVEDGSSEVQSADNGNGEVASYPELVKLCEEMDAEGLHNFISDNRKN  180

Query  540  LESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
            L S++ EI +AL    DP   V++++   +  D   L +++ + L
Sbjct  181  LASMKEEIPQALNAAADPACLVLDSLKNFYRGDMTNLDAKKDSSL  225



>ref|XP_002457174.1| hypothetical protein SORBIDRAFT_03g002730 [Sorghum bicolor]
 gb|EES02294.1| hypothetical protein SORBIDRAFT_03g002730 [Sorghum bicolor]
Length=536

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 55/205 (27%), Positives = 93/205 (45%), Gaps = 32/205 (16%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q+++  S  L WK+L DHF  LEQ L +K + LK + +       +S  +LE+
Sbjct  24   AFAELESQSAV--SMNLKWKQLEDHFRGLEQSLKKKFDELKEQEEEFQEIVAKSDLMLEQ  81

Query  330  RETSIAASISITLKKVDESKRAALV--------------------EFGNAG------GSE  431
            RE ++ A    +L+++ E + AAL                        N G       SE
Sbjct  82   REAAVVAKELTSLERLQEKRDAALAMIFSKSRLSLPVPAINPMNKALDNLGVKWPKPASE  141

Query  432  EPEV--DNSAGLLLK--LRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPK  599
            E     D +A +  +  L S C +M+ +    F+   +K L ++R EI  AL    DP  
Sbjct  142  ESVHLQDGNAAVRPRSELASLCEEMNVKGLHKFISDNRKNLAAIREEIPSALKKTSDPYG  201

Query  600  FVMEAISEVFPVDKRELKSERSNDL  674
             V++++ + +  D   L  ++  DL
Sbjct  202  LVLDSLEDFYSGDNLVLDGKKDGDL  226



>ref|XP_010271588.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Nelumbo nucifera]
 ref|XP_010271594.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Nelumbo nucifera]
Length=573

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 87/194 (45%), Gaps = 45/194 (23%)
 Frame = +3

Query  195  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  374
            T  WKE+ +HF +LE+ L  + +  + K +T + +  ++  +L ++E  +AA     L +
Sbjct  38   TANWKEIEEHFCNLEKVLKSRFDEFEEKERTFEDKKSETSTLLAEKEAVVAAQEQAFLNR  97

Query  375  VDESKRAALV--------------EFGNAGGSEEPEV------DNSA-------------  455
            V E K AA+               E  + GG+ E +V      DN+A             
Sbjct  98   VQEVKDAAVAAILEAWEKYKSTSPEPADDGGNTESKVSSSFNGDNNASVPAPEEESPLRS  157

Query  456  -----GLLLK-------LRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPK  599
                 G+ ++       L  FC QMD++   +FV+   K L  LR EI  AL    +P +
Sbjct  158  GEHAEGVAVEEVKPRPELTQFCEQMDAKGLLNFVMENWKNLAVLRQEIHVALQSATEPAR  217

Query  600  FVMEAISEVFPVDK  641
             V++++   +P D+
Sbjct  218  LVLDSLDGFYPPDQ  231



>ref|XP_008235869.1| PREDICTED: FRIGIDA-like protein 3 [Prunus mume]
 ref|XP_008235870.1| PREDICTED: FRIGIDA-like protein 3 [Prunus mume]
Length=545

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 95/204 (47%), Gaps = 41/204 (20%)
 Frame = +3

Query  186  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  365
             +  L WKEL +HF  LE+ L R+   L+++ +  +++T ++ ++LEKR+ ++ A    +
Sbjct  34   VTLNLKWKELEEHFHGLEKSLKRRFHELESQEKEFESRTVEAQKLLEKRQAAVVAKEQAS  93

Query  366  LKKVDESKRAALVEFGNA--------------------GGS----EEP-----------E  440
            L+ + E + AA+     A                    GG     E+P           E
Sbjct  94   LETLQEKRDAAIYVITTAREKQRKVSTEESSVVTDDGQGGPPSVEEKPPDVMVSESNFEE  153

Query  441  VDNSAGLLLKLRSF------CVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKF  602
            + +S    +++ S+      C QMDS     F+   +K L S+R EI  AL    +P  F
Sbjct  154  MKSSENGSIEVMSYPQLVKLCEQMDSEGLHKFISDNRKNLASIREEIPLALRAAANPALF  213

Query  603  VMEAISEVFPVDKRELKSERSNDL  674
            V+E++ + + ++   +  ++ ++L
Sbjct  214  VLESLEDFYRLEGPNMDGKKDSNL  237



>ref|XP_006829297.1| PREDICTED: FRIGIDA-like protein 3 [Amborella trichopoda]
 gb|ERM96713.1| hypothetical protein AMTR_s00001p00273060 [Amborella trichopoda]
Length=578

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 92/204 (45%), Gaps = 45/204 (22%)
 Frame = +3

Query  159  EFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRET  338
            EF R T+  T+ ++ WK+L  HF+SLE  L +K E L+ K +  + +  ++ E+L KRE 
Sbjct  21   EFHRNTT--TNSSVDWKDLEQHFSSLESALKKKYEELEEKEKLYEARASENCEILAKREA  78

Query  339  SIAASISITLKKVDESKRAALVEFGNAG--------GSEEP------------EVDNSAG  458
             + A   +  ++V E + AA+     A         G EE              V ++A 
Sbjct  79   EVTAKEEVFWERVQEKRNAAVAAIEEAREKVKALFEGPEEAMDEQESKVKNSKNVQSNAP  138

Query  459  LLL-----------------------KLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRK  569
            + +                       +L+ FC QMD++    F+   +K L  +R E+  
Sbjct  139  ICINENTSGKSGAPANTVASEIKPRPELKQFCEQMDAKGLLKFIAENRKVLAQIREELPV  198

Query  570  ALGDCVDPPKFVMEAISEVFPVDK  641
            A+ D  DP + V++++   +P D+
Sbjct  199  AIKDAFDPAQLVLDSLEGFYPQDQ  222



>ref|XP_010271580.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Nelumbo nucifera]
 ref|XP_010271586.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Nelumbo nucifera]
Length=617

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 87/194 (45%), Gaps = 45/194 (23%)
 Frame = +3

Query  195  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  374
            T  WKE+ +HF +LE+ L  + +  + K +T + +  ++  +L ++E  +AA     L +
Sbjct  82   TANWKEIEEHFCNLEKVLKSRFDEFEEKERTFEDKKSETSTLLAEKEAVVAAQEQAFLNR  141

Query  375  VDESKRAALV--------------EFGNAGGSEEPEV------DNSA-------------  455
            V E K AA+               E  + GG+ E +V      DN+A             
Sbjct  142  VQEVKDAAVAAILEAWEKYKSTSPEPADDGGNTESKVSSSFNGDNNASVPAPEEESPLRS  201

Query  456  -----GLLLK-------LRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPK  599
                 G+ ++       L  FC QMD++   +FV+   K L  LR EI  AL    +P +
Sbjct  202  GEHAEGVAVEEVKPRPELTQFCEQMDAKGLLNFVMENWKNLAVLRQEIHVALQSATEPAR  261

Query  600  FVMEAISEVFPVDK  641
             V++++   +P D+
Sbjct  262  LVLDSLDGFYPPDQ  275



>ref|XP_010095585.1| hypothetical protein L484_007424 [Morus notabilis]
 gb|EXB61158.1| hypothetical protein L484_007424 [Morus notabilis]
Length=549

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 97/219 (44%), Gaps = 46/219 (21%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E +   ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T ++  +LEK
Sbjct  24   AFAELESHRAI--TLNLKWKELEEHFHGLEKSLKRRFHELEDQEKEFETRTTEAQRLLEK  81

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAG------GSEEP------------------  437
            RE +I A    +L+++ + + AA+     A        SEEP                  
Sbjct  82   REAAIVAKEQTSLERLQQKRDAAVFAITAAREKHRKVSSEEPAVRTVVSVESQVEEPSVE  141

Query  438  ----EVDNSAGLLLKLRS----------------FCVQMDSRSFWSFVIVRKKELESLRS  557
                EV  S G L  ++S                 C +M+S     F+   +K L ++R 
Sbjct  142  DAPQEVIASDGNLEGMKSPEERIVDVKSYPELVKLCKEMNSEGLHKFISDNRKNLAAIRE  201

Query  558  EIRKALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
            EI  AL    +P  FV++++ + + V+   +  ++  +L
Sbjct  202  EIPFALKAATNPACFVLDSLEDFYRVEAPNVDGKKDANL  240



>ref|XP_008652494.1| PREDICTED: FRIGIDA-like protein 3 [Zea mays]
 tpg|DAA60797.1| TPA: hypothetical protein ZEAMMB73_698906 [Zea mays]
Length=534

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/208 (26%), Positives = 93/208 (45%), Gaps = 38/208 (18%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q++   +    WK+L DHF  LEQ L +K + LK + +       +S ++LE+
Sbjct  24   AFAELESQSAFCMN--FKWKQLEDHFRGLEQSLKKKFDELKEQEKEFQETVAKSEQMLEQ  81

Query  330  RETSIAASISITLKKVDESKRAALV--------------------EFGNAG------GSE  431
            RE ++ A    +L+++ E + AAL                        N G       SE
Sbjct  82   REAAVVAKELTSLERLQEKREAALAMIFSKSRLSLPVPSINPMNKALDNLGVKWPKPASE  141

Query  432  EP---EVDNSAGLLLKLRS----FCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVD  590
            E    +VDN+A   ++ RS     C +M+      F+   +K L ++R EI  AL     
Sbjct  142  ESVHLQVDNAA---VRPRSELVALCEEMNVNGLHKFISDNRKNLAAIREEIPSALKKTSH  198

Query  591  PPKFVMEAISEVFPVDKRELKSERSNDL  674
            P   V++++ + +  D   L  ++  DL
Sbjct  199  PYGLVLDSLEDFYSGDNLVLDGKKDGDL  226



>ref|XP_007201712.1| hypothetical protein PRUPE_ppa003836mg [Prunus persica]
 gb|EMJ02911.1| hypothetical protein PRUPE_ppa003836mg [Prunus persica]
Length=545

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/204 (24%), Positives = 92/204 (45%), Gaps = 41/204 (20%)
 Frame = +3

Query  186  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  365
             +  L WKEL +HF  LE+ L R+   L+++ +  +++T ++ ++LEKR+ ++ A    +
Sbjct  34   VTLNLKWKELEEHFHGLEKSLKRRFHELESQEKEFESRTVEAQKLLEKRQAAVVAKEQAS  93

Query  366  LKKVDESKRAALVEFGNA--------------------GGS-----EEPEVDNSAGLLLK  470
            L+ + E + AA+     A                    GG      + P+V  S     +
Sbjct  94   LETLQEKRDAAIYVITTAREKQRKVSTEESSVVTDDGQGGPPSVEEKPPDVMVSESNFEE  153

Query  471  LRS----------------FCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKF  602
            ++S                 C QMDS     F+   +K L S+R EI  AL    +P  F
Sbjct  154  MKSAENGSIEVMSYPQLVKLCEQMDSEGLHKFISDNRKNLASIREEIPLALRAAANPALF  213

Query  603  VMEAISEVFPVDKRELKSERSNDL  674
            V+E++ + + ++   +  ++ ++L
Sbjct  214  VLESLEDFYRLEGPNMDGKKDSNL  237



>ref|XP_009151640.1| PREDICTED: FRIGIDA-like protein 3 [Brassica rapa]
Length=545

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 91/196 (46%), Gaps = 35/196 (18%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  24   AFAELESQRAV--TLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQELLEK  81

Query  330  RETSIAASISITLKKVDESKRA-------ALVEFGNA-----------------------  419
            ++ ++ A   ++L+++ + + A       ALV++ N                        
Sbjct  82   KKAAVEAKEKVSLERLQKKRDAAVFAINSALVKYNNPPPISITSVEDSPNKAFAADGTDE  141

Query  420  ---GGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVD  590
               G  +E E+        +L   C  MDS     FV   +K L SL+ EI  A     +
Sbjct  142  NPDGTVQEAEISPEVKAYPQLLKLCGDMDSAGLHKFVSDNRKNLASLKEEIPAAFKAAAN  201

Query  591  PPKFVMEAISEVFPVD  638
            P   V++++   +PV+
Sbjct  202  PASLVLDSLEGFYPVE  217



>gb|EEE53996.1| hypothetical protein OsJ_00631 [Oryza sativa Japonica Group]
Length=652

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 75/148 (51%), Gaps = 11/148 (7%)
 Frame = +3

Query  180  LMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASIS  359
            L+ SC   W     HF SL++DL  +S +L   L      T +SL  LE RE ++ A ++
Sbjct  27   LLASCHDAWSRALAHFASLDEDLAARSASLDDALAAAGASTSESLAALEAREAAVPARLA  86

Query  360  ITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKE  539
                 +  +   A        GS EP   +  G    LR  C +MD+ + W F+  R++E
Sbjct  87   EAEAALSAAVAEA--------GSAEPPPADVRG---ALRWMCGRMDAPALWRFMAARRRE  135

Query  540  LESLRSEIRKALGDCVDPPKFVMEAISE  623
            L ++R E+  A+   VDPP+ V++A+++
Sbjct  136  LAAVRKEVGPAVAASVDPPRLVLDALAD  163



>gb|KJB10822.1| hypothetical protein B456_001G227000 [Gossypium raimondii]
 gb|KJB10823.1| hypothetical protein B456_001G227000 [Gossypium raimondii]
 gb|KJB10824.1| hypothetical protein B456_001G227000 [Gossypium raimondii]
Length=542

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/204 (25%), Positives = 90/204 (44%), Gaps = 41/204 (20%)
 Frame = +3

Query  186  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  365
             +  L WKEL +HF  LE+ L R+   L+ + +  +T+T++S E+L+KRE ++ A    +
Sbjct  34   VTLNLKWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKSREMLKKREAAVVAKEQAS  93

Query  366  LKKVDESKRAALVEFGNA------GGSEEP--EVDNSAGLL-------------------  464
            L ++ E + AA+    NA         EEP    D  +G L                   
Sbjct  94   LVRLQEKRDAAVFAISNALEKHRKVSPEEPADSCDGDSGELSVEEKPPDSVASESNSEDI  153

Query  465  --------LKLRSF------CVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKF  602
                      ++S+      C +MDS     F+   +K L +L+ EI  AL     P   
Sbjct  154  KCSSENGNFGVKSYPQLVKICEEMDSEGLHKFISDNRKNLAALKEEIPWALKAAASPAYL  213

Query  603  VMEAISEVFPVDKRELKSERSNDL  674
            V+E++   + ++   +  ++ ++L
Sbjct  214  VLESLKGFYLLEAPNVDRKKDSNL  237



>dbj|BAD68038.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD68086.1| hypothetical protein [Oryza sativa Japonica Group]
Length=595

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 75/148 (51%), Gaps = 11/148 (7%)
 Frame = +3

Query  180  LMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASIS  359
            L+ SC   W     HF SL++DL  +S +L   L      T +SL  LE RE ++ A ++
Sbjct  27   LLASCHDAWSRALAHFASLDEDLAARSASLDDALAAAGASTSESLAALEAREAAVPARLA  86

Query  360  ITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKE  539
                 +  +   A        GS EP   +  G    LR  C +MD+ + W F+  R++E
Sbjct  87   EAEAALSAAVAEA--------GSAEPPPADVRG---ALRWMCGRMDAPALWRFMAARRRE  135

Query  540  LESLRSEIRKALGDCVDPPKFVMEAISE  623
            L ++R E+  A+   VDPP+ V++A+++
Sbjct  136  LAAVRKEVGPAVAASVDPPRLVLDALAD  163



>gb|KJB10825.1| hypothetical protein B456_001G227000 [Gossypium raimondii]
Length=551

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/204 (25%), Positives = 90/204 (44%), Gaps = 41/204 (20%)
 Frame = +3

Query  186  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  365
             +  L WKEL +HF  LE+ L R+   L+ + +  +T+T++S E+L+KRE ++ A    +
Sbjct  43   VTLNLKWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKSREMLKKREAAVVAKEQAS  102

Query  366  LKKVDESKRAALVEFGNA------GGSEEP--EVDNSAGLL-------------------  464
            L ++ E + AA+    NA         EEP    D  +G L                   
Sbjct  103  LVRLQEKRDAAVFAISNALEKHRKVSPEEPADSCDGDSGELSVEEKPPDSVASESNSEDI  162

Query  465  --------LKLRSF------CVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKF  602
                      ++S+      C +MDS     F+   +K L +L+ EI  AL     P   
Sbjct  163  KCSSENGNFGVKSYPQLVKICEEMDSEGLHKFISDNRKNLAALKEEIPWALKAAASPAYL  222

Query  603  VMEAISEVFPVDKRELKSERSNDL  674
            V+E++   + ++   +  ++ ++L
Sbjct  223  VLESLKGFYLLEAPNVDRKKDSNL  246



>ref|NP_001172206.1| Os01g0181000 [Oryza sativa Japonica Group]
 dbj|BAH90936.1| Os01g0181000 [Oryza sativa Japonica Group]
Length=606

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 75/148 (51%), Gaps = 11/148 (7%)
 Frame = +3

Query  180  LMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASIS  359
            L+ SC   W     HF SL++DL  +S +L   L      T +SL  LE RE ++ A ++
Sbjct  27   LLASCHDAWSRALAHFASLDEDLAARSASLDDALAAAGASTSESLAALEAREAAVPARLA  86

Query  360  ITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKE  539
                 +  +   A        GS EP   +  G    LR  C +MD+ + W F+  R++E
Sbjct  87   EAEAALSAAVAEA--------GSAEPPPADVRG---ALRWMCGRMDAPALWRFMAARRRE  135

Query  540  LESLRSEIRKALGDCVDPPKFVMEAISE  623
            L ++R E+  A+   VDPP+ V++A+++
Sbjct  136  LAAVRKEVGPAVAASVDPPRLVLDALAD  163



>gb|EEC70056.1| hypothetical protein OsI_00656 [Oryza sativa Indica Group]
Length=595

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 75/148 (51%), Gaps = 11/148 (7%)
 Frame = +3

Query  180  LMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASIS  359
            L+ SC   W     HF SL++DL  +S +L   L      T +SL  LE RE ++ A ++
Sbjct  27   LLASCHDAWSRALAHFASLDEDLAARSASLDDALAAAGASTSESLAALEAREAAVPARLA  86

Query  360  ITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKE  539
                 +  +   A       G +E P  D    +   LR  C +MD+ + W F+  R++E
Sbjct  87   EAEAALSAAVAEA-------GSTEPPPAD----VRGALRWMCGRMDAPALWRFMAARRRE  135

Query  540  LESLRSEIRKALGDCVDPPKFVMEAISE  623
            L ++R E+  A+   VDPP+ V++A+++
Sbjct  136  LAAVRKEVGPAVAASVDPPRLVLDALAD  163



>gb|KHG07809.1| Protein FRIGIDA -like protein [Gossypium arboreum]
Length=543

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 50/204 (25%), Positives = 90/204 (44%), Gaps = 41/204 (20%)
 Frame = +3

Query  186  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  365
             +  L WKEL +HF  LE+ L R+   L+ + +  +T+T++S E+L+KRE ++ A    +
Sbjct  34   VTLNLKWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKSREMLKKREAAVVAKEQAS  93

Query  366  LKKVDESKRAALVEFGNA------GGSEEP--EVDNSAGLL-------------------  464
            L ++ E + AA+    NA         EEP    D  +G L                   
Sbjct  94   LVRLQEMRDAAVFAISNALEKHRKVSPEEPADSCDGDSGELSVEEKPPDSVASESNSEDI  153

Query  465  --------LKLRSF------CVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKF  602
                      ++S+      C +MDS     F+   +K L +L+ EI  AL     P   
Sbjct  154  KCSSENGNFSVKSYPQLVKICEEMDSEGLHKFISDNRKNLAALKEEIPWALKAAASPAYL  213

Query  603  VMEAISEVFPVDKRELKSERSNDL  674
            V+E++   + ++   +  ++ ++L
Sbjct  214  VLESLKGFYLLEAPNVDRKKDSNL  237



>ref|XP_010679002.1| PREDICTED: FRIGIDA-like protein 3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679003.1| PREDICTED: FRIGIDA-like protein 3 [Beta vulgaris subsp. vulgaris]
Length=563

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 51/225 (23%), Positives = 94/225 (42%), Gaps = 52/225 (23%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E +   ++  S  L WKEL  HF  LE+ L R+   L+ + +  +++T ++ E++EK
Sbjct  24   AFAELESHRAV--SLNLKWKELEAHFHGLEKSLKRRFHELEDQEKEYESKTVEAQEMIEK  81

Query  330  RETSIAASISITLKKVDESKRAALVEFGNA------------------------------  419
            R+ ++ A    +L+K+ E + AA+     A                              
Sbjct  82   RKAAVVAKEQASLEKLQEKRDAAVFAIAIAREKHRRVSCEEYSVDNSESQSGTMEETPTN  141

Query  420  -----------------GGSEEPEVDNSAGLLL---KLRSFCVQMDSRSFWSFVIVRKKE  539
                             G SE    DN  G +    +L   C +MD+    +F+   +K 
Sbjct  142  SMISEITSDYTSGTVEDGSSEVQSADNGNGEVASYPELVKLCEEMDAEGLHNFISDNRKN  201

Query  540  LESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
            L S++ EI +AL    DP   V++++   +  D   L +++ + L
Sbjct  202  LASMKEEIPQALNAAADPACLVLDSLKNFYRGDMTNLDAKKDSSL  246



>ref|XP_009342382.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009342393.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Pyrus x bretschneideri]
Length=546

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 88/201 (44%), Gaps = 43/201 (21%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E +   ++  +  L WKEL  HF  LE+ L R+ + L+++ +  +T+T ++ ++LEK
Sbjct  24   AFSELESHRAV--TLNLKWKELEAHFHGLEKSLKRRFDELESQEKEFETRTIEAQKLLEK  81

Query  330  RETSIAASISITLKKVDESKRAALVEFGNA------------------GGSEEPEVDNSA  455
            R+ ++ A    +L+ + + + AA     +A                  G  E P V+   
Sbjct  82   RQAAVVAKEQASLEILQKKRDAAAYAITHAREKQRKVSTEEPSVVTDDGQGEPPSVEEKP  141

Query  456  GLLL-----------------------KLRSFCVQMDSRSFWSFVIVRKKELESLRSEIR  566
              ++                       +L   C QMD+    +F+   +K L S+R EI 
Sbjct  142  PDMIVSDSNCQEMKSPEMVSIEVMSYPQLAKLCEQMDTEGLHTFISDNRKNLASIREEIP  201

Query  567  KALGDCVDPPKFVMEAISEVF  629
             AL     P  FV+E++ + +
Sbjct  202  LALRAAAKPALFVLESLEDFY  222



>ref|XP_007049532.1| FRIGIDA-like protein isoform 1 [Theobroma cacao]
 ref|XP_007049533.1| FRIGIDA-like protein isoform 1 [Theobroma cacao]
 gb|EOX93689.1| FRIGIDA-like protein isoform 1 [Theobroma cacao]
 gb|EOX93690.1| FRIGIDA-like protein isoform 1 [Theobroma cacao]
Length=546

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 95/212 (45%), Gaps = 49/212 (23%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E +   ++  +  + WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+L+K
Sbjct  24   AFAELESHRAI--TLNMKWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKAREILQK  81

Query  330  RETSIAASISITLKKVDESKRAALVEFGNA------GGSEEP---EVDNSAGLL------  464
            RE ++ A    +L ++ E + AA+    N+        SEEP     D  +G L      
Sbjct  82   REAAVVAKEQASLLRLQEKRDAAVFAITNSLEKHRKLSSEEPADVSCDGDSGELSVEEKP  141

Query  465  ---------------------LKLRSF------CVQMDSRSFWSFVIVRKKELESLRSEI  563
                                  +++S+      C +MDS     F+   +K L +L+ EI
Sbjct  142  PDSVASESNLEDIKSSFENGNFEVKSYPQLVKLCEEMDSEGLHKFISDNRKNLAALKEEI  201

Query  564  RKALGDCVDPPKFVMEA-----ISEVFPVDKR  644
              AL     P   V+E+     +SEV  VD +
Sbjct  202  PWALKAAASPACLVLESLEGFYLSEVPNVDGK  233



>ref|XP_010547174.1| PREDICTED: FRIGIDA-like protein 3 [Tarenaya hassleriana]
Length=538

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 101/220 (46%), Gaps = 50/220 (23%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  25   AFAELESQRAI--TLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETRTRKAGELLEK  82

Query  330  RETSIAASISITLKKVDESKRAALV-------EFGN------------------------  416
            ++  + A    +L+++ + + AA++       ++ N                        
Sbjct  83   KKADVDAKEKASLERLQKKRDAAMLAITSALEKYNNTPSVEPTGLTSLGESRVGKAAEDS  142

Query  417  -----AGGSEE-----PEVDN----SAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLR  554
                 A G+ E     PE+ N    +   LLKL   C  MDS     FV   +K L  L+
Sbjct  143  PDGYIADGTVEDVQNSPEMGNFEVKAYPQLLKL---CEDMDSVGLHKFVSDNRKNLAVLK  199

Query  555  SEIRKALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
             EI  A     +P   V+++++  +PV+ +    ++ ++L
Sbjct  200  EEIPFAFKAAANPASLVLDSLTGFYPVETKNSDGKKGSNL  239



>ref|XP_009401034.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=562

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 90/175 (51%), Gaps = 6/175 (3%)
 Frame = +3

Query  159  EFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRET  338
            E  +++SL +   + W E+ +HF SLE+ L  K E +K K +  + +  ++  ++ ++E 
Sbjct  34   ESHKESSLQSK--IKWDEIKEHFQSLERLLKDKLEEVKVKKKAFEEKQSEAQALIAEKEA  91

Query  339  SIAASISITLKKVDE---SKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSF  509
            +++A    +L ++ E   S  +A+ E  +      PE  +  G   K +  C QMD++  
Sbjct  92   AVSAKEHASLARLQELRDSAVSAIAEARHKYKVASPEPIDVRGSKEK-KQLCQQMDAKGL  150

Query  510  WSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
              F++ +K+ L SLR E+  AL    +P + V+E++   +P+D+        N L
Sbjct  151  LKFILEKKRNLGSLREELSLALKYATEPARLVLESLEGFYPLDQSNSPGNEDNTL  205



>ref|XP_006395188.1| hypothetical protein EUTSA_v10003930mg [Eutrema salsugineum]
 ref|XP_006395189.1| hypothetical protein EUTSA_v10003930mg [Eutrema salsugineum]
 gb|ESQ32474.1| hypothetical protein EUTSA_v10003930mg [Eutrema salsugineum]
 gb|ESQ32475.1| hypothetical protein EUTSA_v10003930mg [Eutrema salsugineum]
Length=559

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 90/209 (43%), Gaps = 48/209 (23%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+TK++ E+LEK
Sbjct  25   AFAELESQRAV--TLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETKTKKAQELLEK  82

Query  330  RETSIAASISITLKKVDESKRAALVEFG-----------------------------NAG  422
            ++ ++ A    +L+++ + + AA+                                 NA 
Sbjct  83   KKAAVEAKEKASLERLQKKRDAAMFAINSALDKYNNVPISITSDGERWAQNARGDSPNAF  142

Query  423  GSEEPEVDNSAGLL-----------------LKLRSFCVQMDSRSFWSFVIVRKKELESL  551
             ++    DN  G +                  +L   C  MDS     FV   +K L SL
Sbjct  143  AADGITDDNPDGTVQDVQISPVMGNFEVKAYPQLLKLCGDMDSTGLHKFVSDNRKNLASL  202

Query  552  RSEIRKALGDCVDPPKFVMEAISEVFPVD  638
            + EI  AL    +P   V++++   +P++
Sbjct  203  KEEIPMALKAAANPASLVLDSLEGFYPME  231



>gb|EMS54104.1| hypothetical protein TRIUR3_33659 [Triticum urartu]
Length=627

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 94/210 (45%), Gaps = 37/210 (18%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q+++  +    WK+L DHF  LEQ L +K + LK + +       +S ++LE+
Sbjct  24   AFAELESQSAV--TMNFKWKQLEDHFRGLEQSLKKKFDELKKQEKEFQETVAKSEKMLEQ  81

Query  330  RETSIAASISITLKKVDESKRAALVE-FGNAGGS---------EEPEVDNSAGLL-----  464
            +E  + A    +L+K+ E + AAL   FG +  S          +P+ + + G L     
Sbjct  82   QEAVVVAKELTSLEKLQEKRDAALAMIFGKSKLSLNTNYITPINKPQSNYTVGTLDVKWP  141

Query  465  ----------------LKLRS----FCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDC  584
                            +K RS     C +M+ +    F+   +K L S+R EI  AL   
Sbjct  142  KHSPQGNAQMQDGNAAVKPRSELAILCEEMNVKGLHKFISDNRKNLTSIREEIPSALKGA  201

Query  585  VDPPKFVMEAISEVFPVDKRELKSERSNDL  674
              P   V++++ + +  D   L  ++  DL
Sbjct  202  SQPYVLVLDSLEDFYSGDNLVLDGKKDGDL  231



>ref|XP_010939086.1| PREDICTED: FRIGIDA-like protein 3 [Elaeis guineensis]
 ref|XP_010939087.1| PREDICTED: FRIGIDA-like protein 3 [Elaeis guineensis]
Length=586

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/215 (21%), Positives = 92/215 (43%), Gaps = 40/215 (19%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F+E + Q        + W  + +HF +LE+ L  K   L+ K +  + +  ++  ++ +
Sbjct  24   AFEELESQRESFLQNKIQWDGIKEHFHNLERSLKNKCVELEEKQRVFEEEQSKTRALIAE  83

Query  330  RETSIAA---------------SISITLKKVDESKRAA-----------------LVEFG  413
            RE ++AA               ++S+  +   + K A+                 L +  
Sbjct  84   REAAVAAKEQASSNSLQELRDIAVSVIAEARQKYKVASPEPVDIRGSKAKKVSTSLDDPN  143

Query  414  NAGGSEEPEVDNSAGLLL--------KLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRK  569
                 EE   DN +G L         +L+  C QMD++    F+   +K L +LR E+  
Sbjct  144  APPAPEEKNPDNGSGELAETGIKPRPQLKQLCEQMDAKGLLKFISENRKNLATLRGELSA  203

Query  570  ALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
            AL +  +P + V++++   +P+D+  L+    + L
Sbjct  204  ALKNATEPARLVLDSLEGFYPLDQSSLQGNEDSAL  238



>emb|CDY48750.1| BnaA02g30110D [Brassica napus]
Length=527

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 86/185 (46%), Gaps = 26/185 (14%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q ++  +  L W EL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  24   AFAELESQCAV--TFNLKWNELEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQELLEK  81

Query  330  RETSIAASISITLKKVDESKRAALVEFGNA----GGSEEPEV---------DNSAGLL--  464
            ++ ++ A    +L+++ + + AA+     A      +  P +         +N  G +  
Sbjct  82   KKAAVEAKEKASLERLQKKRDAAVFAINTALDKYNNNNAPNISAKAFAAEDENLDGTVQD  141

Query  465  ---------LKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAI  617
                      +L   C  MDS     FV   +K L  L+ EI  AL    +P   V++++
Sbjct  142  AEISPVKAYPELVKLCEDMDSAGLHKFVSDNRKNLALLKEEIPVALKAAANPASLVLDSL  201

Query  618  SEVFP  632
               +P
Sbjct  202  EGFYP  206



>emb|CDX86307.1| BnaA06g30240D [Brassica napus]
Length=1493

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 91/196 (46%), Gaps = 35/196 (18%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  24   AFAELESQRAV--TLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQELLEK  81

Query  330  RETSIAASISITLKKVDESKRA-------ALVEFGNA-----------------------  419
            ++ ++ A   ++L+++ + + A       ALV++ N                        
Sbjct  82   KKAAVEAKEKVSLERLQKKRDAAVFAINSALVKYNNPPPISITSVEDSPNKAFAADGTDE  141

Query  420  ---GGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVD  590
               G  +E E+        +L   C  MDS     FV   +K L SL+ EI  A     +
Sbjct  142  NPDGTVQEAEISPEVKAYPQLLKLCGDMDSAGLHKFVSDNRKNLASLKEEIPAAFKAAAN  201

Query  591  PPKFVMEAISEVFPVD  638
            P   V++++   +PV+
Sbjct  202  PASLVLDSLEGFYPVE  217



>ref|XP_006447936.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
 ref|XP_006447937.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
 ref|XP_006469349.1| PREDICTED: FRIGIDA-like protein 3-like isoform X2 [Citrus sinensis]
 ref|XP_006469350.1| PREDICTED: FRIGIDA-like protein 3-like isoform X3 [Citrus sinensis]
 ref|XP_006469351.1| PREDICTED: FRIGIDA-like protein 3-like isoform X4 [Citrus sinensis]
 ref|XP_006469352.1| PREDICTED: FRIGIDA-like protein 3-like isoform X5 [Citrus sinensis]
 ref|XP_006469353.1| PREDICTED: FRIGIDA-like protein 3-like isoform X6 [Citrus sinensis]
 gb|ESR61176.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
 gb|ESR61177.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
Length=549

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 90/202 (45%), Gaps = 44/202 (22%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E +   ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+L+K
Sbjct  24   AFAELESHRAI--TLNLRWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKAREILQK  81

Query  330  RETSIAASISITLKKVDESKRAALVEFGNA------GGSEEP----EVDNSAG-------  458
            RE ++ A    TL+K+ + + AA+     A        S EP     VD S         
Sbjct  82   REAAVLAKEQTTLEKLQKKRDAAVFAISTALEKQRKVSSAEPAIVSNVDESRAPPVEDKL  141

Query  459  -------------------LLLKLRSF------CVQMDSRSFWSFVIVRKKELESLRSEI  563
                                 ++L+++      C +M+S     F+   +K L  L+ EI
Sbjct  142  PDSMSLENNLESSKKSSESENMELKAYPQLFKLCEEMNSEGLHKFISDNRKNLAVLKEEI  201

Query  564  RKALGDCVDPPKFVMEAISEVF  629
              AL    DP + V++++   +
Sbjct  202  PLALKAAADPARLVLDSLEGFY  223



>ref|XP_007155867.1| hypothetical protein PHAVU_003G238500g [Phaseolus vulgaris]
 gb|ESW27861.1| hypothetical protein PHAVU_003G238500g [Phaseolus vulgaris]
Length=551

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 48/185 (26%), Positives = 86/185 (46%), Gaps = 39/185 (21%)
 Frame = +3

Query  204  WKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDE  383
            W E+  HF  LE +L +K E L+AK +  + +  +   +LE+R+ ++A+     L ++ E
Sbjct  39   WVEIKQHFHDLETELNKKREELEAKEKQYEAKQLEVDTLLEERKAAVASEEQDLLDRLQE  98

Query  384  SKRAA---LVE--------------------------FGNAGGSEE--PE--VDNSAGLL  464
             K AA   +VE                           G+   SE+  P    + S G+ 
Sbjct  99   LKDAAVASIVEAHANHRNATLESVYDGENKDNKVSSSLGDTNSSEDDFPHESAEKSEGVA  158

Query  465  LKLRS------FCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEV  626
            +++R       FC QMD++   ++V+  KK+L  +R EI  AL    DP + V++++   
Sbjct  159  VEVRPHPELTEFCEQMDAKGLLNYVVENKKKLSVIREEISVALVSATDPARLVLDSLEGF  218

Query  627  FPVDK  641
             P ++
Sbjct  219  CPTNE  223



>ref|XP_006584257.1| PREDICTED: uncharacterized protein LOC100817935 [Glycine max]
Length=250

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  528  RKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKR  644
            +KKEL+ LR+E+  AL +CV+P KFV+EAI EVFPVDKR
Sbjct  101  KKKELDGLRAEMSVALAECVNPMKFVLEAILEVFPVDKR  139



>ref|XP_009358937.1| PREDICTED: FRIGIDA-like protein 3 [Pyrus x bretschneideri]
 ref|XP_009358938.1| PREDICTED: FRIGIDA-like protein 3 [Pyrus x bretschneideri]
Length=538

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 45/190 (24%), Positives = 81/190 (43%), Gaps = 42/190 (22%)
 Frame = +3

Query  186  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  365
             +  L WKEL  HF  LE+ L R+ + L+++ +  +T+T ++ ++L KR+ ++ A    +
Sbjct  34   VTLNLKWKELEAHFHGLEKSLKRRFDELESQEKEFETRTVEAQKMLAKRQAAVVAKEQAS  93

Query  366  LKKVDESKRAALVEFGNA------------------GGSEEPEVDNSAGLLL--------  467
            L+ +   + AA     NA                  G  E+P V+     ++        
Sbjct  94   LETLQAKRDAATYAITNAREKQRKVSTEEPSAVTDDGQGEQPSVEEKPPDVMVSEINFEE  153

Query  468  ----------------KLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPK  599
                            +L   C QMDS     F+   +K L S+R EI  AL    +P  
Sbjct  154  VKSPEMGSSIEVISYPQLVKLCEQMDSEGLHKFISDNRKNLASIREEIPLALRAASNPAL  213

Query  600  FVMEAISEVF  629
            FV++++ + +
Sbjct  214  FVLKSLEDFY  223



>gb|AIN75614.1| FRIGIDA3b-1 [Dimocarpus longan]
 gb|AIN75615.1| FRIGIDA3b-2 [Dimocarpus longan]
Length=550

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/217 (23%), Positives = 100/217 (46%), Gaps = 44/217 (20%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E +   ++  +  + WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+L+K
Sbjct  24   AFAELESHRAI--TLNMKWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKAREMLQK  81

Query  330  RETSIAASISITLKKVDESKRAAL---------------VE---FGN----AGGSEEPEV  443
            RE ++ A    +L K+ + + AA+               VE    GN     G + E ++
Sbjct  82   REAAVVAKEQASLDKLQKKRDAAVFAITAALEKQRKVSPVEPAVLGNESESGGATVEDKL  141

Query  444  DNSAGLLLKLRS--------------------FCVQMDSRSFWSFVIVRKKELESLRSEI  563
             +S  +   L S                     C +M++     F+   +K L +L+ EI
Sbjct  142  PDSMSVESNLESIKTSSENGSVELKVYPQLFKLCEEMNAEGLHKFISDNRKNLAALKEEI  201

Query  564  RKALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
              AL   VDP + V++++   + ++   +  ++ ++L
Sbjct  202  PFALKAAVDPSRLVLDSLEGFYHMEMPNVDGKKDSNL  238



>gb|AAP31312.2| ABI3-interacting protein 2 [Callitropsis nootkatensis]
Length=672

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            SF+E      +M +CT+ WKEL +HF+ +++ L ++ E L  K +  + +T ++ +VLEK
Sbjct  46   SFEELDAHKGVMENCTIQWKELDEHFSYIDEALKKRFEELLEKEKQFEAKTSETWKVLEK  105

Query  330  RETSIAASISITLKKVDESKRAALV  404
             +  +AA    +L +V E K AA+ 
Sbjct  106  HDEVVAAKEQASLSRVQEEKDAAVA  130



>ref|XP_009129722.1| PREDICTED: FRIGIDA-like protein 3 [Brassica rapa]
Length=522

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 86/185 (46%), Gaps = 26/185 (14%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q ++  +  L W EL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  25   AFAELESQRAV--TFNLKWNELEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQELLEK  82

Query  330  RETSIAASISITLKKVDESKRAALVEFGNA----GGSEEPEV---------DNSAGLLL-  467
            ++ ++ A    +L+++ + + AA+     A      +  P +         +N  G +  
Sbjct  83   KKAAVEAKEKASLERLQKKRDAAVFAINTALDKYNNNNAPNISAKAFAAEDENLDGTVQD  142

Query  468  ----------KLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAI  617
                      +L   C  MDS     FV   +K L  L+ EI  AL    +P   V++++
Sbjct  143  AEISPVKAYPELVKLCEDMDSAGLHKFVSDNRKNLALLKEEIPVALKAAANPASLVLDSL  202

Query  618  SEVFP  632
               +P
Sbjct  203  EGFYP  207



>tpg|DAA41489.1| TPA: hypothetical protein ZEAMMB73_922617 [Zea mays]
Length=684

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  498  SRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKREL  650
            S +F  FV+  +KE  +L +E+  AL  CVDP KF+M+ +++VFPVD+ EL
Sbjct  553  STAFLGFVVAHRKEWNTLWAEVPTALKLCVDPNKFIMDVVTDVFPVDRHEL  603



>ref|XP_010037083.1| PREDICTED: FRIGIDA-like protein 3 [Eucalyptus grandis]
 ref|XP_010037084.1| PREDICTED: FRIGIDA-like protein 3 [Eucalyptus grandis]
 ref|XP_010037085.1| PREDICTED: FRIGIDA-like protein 3 [Eucalyptus grandis]
 ref|XP_010037086.1| PREDICTED: FRIGIDA-like protein 3 [Eucalyptus grandis]
 gb|KCW48707.1| hypothetical protein EUGRSUZ_K02358 [Eucalyptus grandis]
 gb|KCW48708.1| hypothetical protein EUGRSUZ_K02358 [Eucalyptus grandis]
 gb|KCW48709.1| hypothetical protein EUGRSUZ_K02358 [Eucalyptus grandis]
Length=546

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 97/221 (44%), Gaps = 52/221 (24%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E +   ++  +  L WKEL +HF  LE+ L R+   L+ + + L+T+  ++ E+LEK
Sbjct  24   AFAELESHRAV--TLNLKWKELEEHFHGLERSLKRRFHELEGQEKELETKASKARELLEK  81

Query  330  RETSI------------------AASISITLKKVDESKRAALVEFG------NAGG----  425
            RE  +                  A +IS  LKK    +RA+ VE        +AGG    
Sbjct  82   READVLAKEQASLEKLQVNRDAAAIAISNALKK---HRRASSVELAVGTGEDDAGGAISE  138

Query  426  ------------SEEPEVDNSAGLLLKLRSF------CVQMDSRSFWSFVIVRKKELESL  551
                        SE+ E DNS     ++ S+      C  MDS     F+   +K L  +
Sbjct  139  ENSSSVVTTESYSEDTE-DNSEVCSAEVTSYPLLDRLCKDMDSEGLHRFISDNRKNLAMI  197

Query  552  RSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
            R EI  AL     P   V+ ++ + + +D   +  ++ ++L
Sbjct  198  REEIPFALKAAPSPAGLVLRSLEDFYSMDLPNVDGKKDSNL  238



>ref|XP_006447935.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
 ref|XP_006447938.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
 ref|XP_006469348.1| PREDICTED: FRIGIDA-like protein 3-like isoform X1 [Citrus sinensis]
 gb|ESR61175.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
 gb|ESR61178.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
Length=586

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 90/202 (45%), Gaps = 44/202 (22%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E +   ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+L+K
Sbjct  61   AFAELESHRAI--TLNLRWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKAREILQK  118

Query  330  RETSIAASISITLKKVDESKRAALVEFGNA------GGSEEP----EVDNSAG-------  458
            RE ++ A    TL+K+ + + AA+     A        S EP     VD S         
Sbjct  119  REAAVLAKEQTTLEKLQKKRDAAVFAISTALEKQRKVSSAEPAIVSNVDESRAPPVEDKL  178

Query  459  -------------------LLLKLRSF------CVQMDSRSFWSFVIVRKKELESLRSEI  563
                                 ++L+++      C +M+S     F+   +K L  L+ EI
Sbjct  179  PDSMSLENNLESSKKSSESENMELKAYPQLFKLCEEMNSEGLHKFISDNRKNLAVLKEEI  238

Query  564  RKALGDCVDPPKFVMEAISEVF  629
              AL    DP + V++++   +
Sbjct  239  PLALKAAADPARLVLDSLEGFY  260



>ref|XP_006366815.1| PREDICTED: FRIGIDA-like protein 3-like isoform X1 [Solanum tuberosum]
 ref|XP_006366816.1| PREDICTED: FRIGIDA-like protein 3-like isoform X2 [Solanum tuberosum]
Length=545

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 86/193 (45%), Gaps = 42/193 (22%)
 Frame = +3

Query  186  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  365
             +  L WK+L +HF  L++ L R+   L+ + +  +T+  QS E+LEKR+ ++ A+   +
Sbjct  34   VTLNLQWKQLEEHFNGLQKSLKRRFTELEDQEKEFETKIVQSTEILEKRQAAVIATEQAS  93

Query  366  LKKVDESKRAALVEFG-----------------NAGGSEEPEV-----DNSAGL------  461
            L+++ E + AA+                     N    +EP V     DN   +      
Sbjct  94   LQRLQEKRDAAVSAISIALEKHRNPCSVEPTVINCEVQDEPSVLEEKPDNVTEIGHVTGD  153

Query  462  --------LLKLRSF------CVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPK  599
                    +++++S+      C  MDS     F+   +K L +LR EI  AL    +P  
Sbjct  154  TWKSFQDGVVEVKSYPELVNLCRNMDSEGLHKFISDNRKNLAALREEIPFALRASTNPAS  213

Query  600  FVMEAISEVFPVD  638
             V+++++  +  D
Sbjct  214  LVLDSLNGFYNSD  226



>ref|XP_008780981.1| PREDICTED: truncated FRIGIDA-like protein 1 [Phoenix dactylifera]
Length=496

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 69/150 (46%), Gaps = 32/150 (21%)
 Frame = +3

Query  183  MTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISI  362
              S T+ WK+L DH +++E+ L  + + L+AK                  E   AA  + 
Sbjct  32   FASFTVEWKDLDDHISAIEKSLQERFKDLQAK------------------EPPRAAGAAS  73

Query  363  TLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKEL  542
            +  +   +  AA          EEPE         +L+S CV MDSR   SF+  R+K+ 
Sbjct  74   SPPEAKTTPAAA----------EEPEATPRP----ELKSLCVAMDSRGLRSFLSERRKDF  119

Query  543  ESLRSEIRKALGDCVDPPKFVMEAISEVFP  632
             ++R+E+  A+    DP K V++A+   +P
Sbjct  120  SAVRNELTPAIRAASDPAKLVLDAMEGFYP  149



>ref|XP_010551997.1| PREDICTED: FRIGIDA-like protein 3 [Tarenaya hassleriana]
 ref|XP_010551998.1| PREDICTED: FRIGIDA-like protein 3 [Tarenaya hassleriana]
Length=559

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/228 (23%), Positives = 99/228 (43%), Gaps = 58/228 (25%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  24   AFAELESQRAI--TLNLKWKELEEHFHGLERSLKRRFHELEDQEREYETKTRKAQELLEK  81

Query  330  RETSIAASISITLKKVDESKRAALV-------EFGNAGGSEE------------------  434
            ++ ++ A    +L+++ + + AA++       ++ N   +E                   
Sbjct  82   KKAAVEAKEKASLERLQKKRDAAVLAITSALDKYKNVPSAEPVSVTTLGEIRAENAVEDS  141

Query  435  ------------------------PEVDN----SAGLLLKLRSFCVQMDSRSFWSFVIVR  530
                                    PE++N    +   LLKL   C  MDS     FV   
Sbjct  142  PDGFAHDGITDDYPDGTVEDVQSSPEMENFEVKAYPQLLKL---CEDMDSTGLHKFVSDN  198

Query  531  KKELESLRSEIRKALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
            +K L +L+ EI  AL    +P   V+ +    +PV+ +    ++  +L
Sbjct  199  RKNLAALKEEIPFALKAAANPASLVLNSFEGFYPVEAQNADGKKDPNL  246



>gb|ABK24390.1| unknown [Picea sitchensis]
Length=519

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/168 (29%), Positives = 74/168 (44%), Gaps = 15/168 (9%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E Q  +S + + T+ WKEL D F  LE+ L+R  E     L    T+        EK
Sbjct  14   AFLELQSHSSALVNITVQWKELEDEFNELEK-LIRFEE-----LGPKGTEN-------EK  60

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSF  509
             + S A   +   K   E K  A    GN   +  P + +      +L+S C +MD    
Sbjct  61   EKKSAAEKSTGNPKNTSEKKSVAEKSIGNPNKTS-PALKDDVKPCPQLKSLCEKMDGEGL  119

Query  510  WSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPV-DKREL  650
              F+     +   +R+E+  AL    DP K V++A+   +P  + REL
Sbjct  120  KQFLADSPSDFRVIRNEVSAALRCAADPAKLVLQALKGFYPACNYREL  167



>gb|ABR17421.1| unknown [Picea sitchensis]
Length=519

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/168 (29%), Positives = 74/168 (44%), Gaps = 15/168 (9%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E Q  +S + + T+ WKEL D F  LE+ L+R  E     L    T+        EK
Sbjct  14   AFLELQSHSSALVNITVQWKELEDEFNELEK-LIRFEE-----LGPKGTEN-------EK  60

Query  330  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCVQMDSRSF  509
             + S A   +   K   E K  A    GN   +  P + +      +L+S C +MD    
Sbjct  61   EKKSAAEKSTGNPKNTSEKKSVAEKSIGNPNKTS-PALKDDVKPCPQLKSLCEKMDGEGL  119

Query  510  WSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAISEVFPV-DKREL  650
              F+     +   +R+E+  AL    DP K V++A+   +P  + REL
Sbjct  120  KQFLADSPSDFRVIRNEVSAALRCAADPAKLVLQALKGFYPACNYREL  167



>ref|XP_010442259.1| PREDICTED: FRIGIDA-like protein 3 [Camelina sativa]
 ref|XP_010442260.1| PREDICTED: FRIGIDA-like protein 3 [Camelina sativa]
 ref|XP_010442261.1| PREDICTED: FRIGIDA-like protein 3 [Camelina sativa]
Length=556

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 92/210 (44%), Gaps = 49/210 (23%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  24   AFAELESQRAV--TLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQELLEK  81

Query  330  RETSIAASISITLKKVDESKRAALV-------EFGNA--------------GGSEEPEV-  443
            ++ ++ A    +L+++ + + AA+        ++ NA              G  + P   
Sbjct  82   KKAAVEAKEKASLERLQKKRDAAMFTINSALDKYSNAPISKPSIGERWPQNGVRDSPNAF  141

Query  444  --------DNSAGLL-----------------LKLRSFCVQMDSRSFWSFVIVRKKELES  548
                    DN  G +                  +L   C  MDS     FV   +K L S
Sbjct  142  AADSSIADDNPDGTVQDVQISPVMGNFEVKAYPQLLKLCGDMDSTGLHKFVSDNRKNLAS  201

Query  549  LRSEIRKALGDCVDPPKFVMEAISEVFPVD  638
            L+ EI  A     +P   V++++   +P++
Sbjct  202  LKEEIPIAFRAAANPASLVLDSLEGFYPME  231



>ref|XP_008458100.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Cucumis melo]
Length=549

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 94/217 (43%), Gaps = 44/217 (20%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E +   +L  +  L WKEL +HF  LE+ L R+ + L+ + +  +T+T ++ ++LEK
Sbjct  24   AFAELESHKAL--TLNLKWKELEEHFHGLEKSLKRRFDELEDQEKEYETKTTEARQMLEK  81

Query  330  RETSIAASISITLKK----------------------------------------VDESK  389
            RE +I A   ++L+                                         VD+  
Sbjct  82   REAAILAKEHVSLESLQKKRDAAAFAVASAREKHKKVASEMPSPSDDYLSAEPNVVDKPP  141

Query  390  RAALVEFGNAGGSEEPEVDNSAGL--LLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEI  563
             +   E  +    + PE D   G+    +L   C +MDS     F+   +K L ++R EI
Sbjct  142  DSLTSENNSEDLKDTPEEDRHFGVKSYPQLVQLCEEMDSAGLHKFISDNRKNLAAIREEI  201

Query  564  RKALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
              AL    +P   V++++ + +  +   L  ++++DL
Sbjct  202  PFALKAAANPACMVLDSLEDFYSGEVANLDGKKNSDL  238



>emb|CDY05684.1| BnaC02g38530D [Brassica napus]
Length=517

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/185 (24%), Positives = 85/185 (46%), Gaps = 26/185 (14%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q ++  +  L W EL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  24   AFAELESQRAV--TLNLRWNELEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQELLEK  81

Query  330  RETSIAASISITLKKVDESKRAALVEFGNA----GGSEEPEV---------DNSAGLL--  464
            ++ ++ A    +L+++ + +  A+     A      +  P +         +N  G +  
Sbjct  82   KKAAVEAKEKASLERLQKKRDGAVFAINTALDKYNNNNAPNISAKAFAAEDENLDGTVQD  141

Query  465  ---------LKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEAI  617
                      +L   C  MDS     FV   +K L  L+ EI  AL    +P   V++++
Sbjct  142  VEISPVKAYPELVKLCRDMDSAGLHKFVSDNRKNLALLKEEIPVALKYAANPGTLVLDSL  201

Query  618  SEVFP  632
               +P
Sbjct  202  EGFYP  206



>gb|KCW48710.1| hypothetical protein EUGRSUZ_K02358 [Eucalyptus grandis]
 gb|KCW48711.1| hypothetical protein EUGRSUZ_K02358 [Eucalyptus grandis]
 gb|KCW48712.1| hypothetical protein EUGRSUZ_K02358 [Eucalyptus grandis]
Length=402

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 90/206 (44%), Gaps = 50/206 (24%)
 Frame = +3

Query  195  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSI----------  344
             L WKEL +HF  LE+ L R+   L+ + + L+T+  ++ E+LEKRE  +          
Sbjct  37   NLKWKELEEHFHGLERSLKRRFHELEGQEKELETKASKARELLEKREADVLAKEQASLEK  96

Query  345  --------AASISITLKKVDESKRAALVEFG------NAGG----------------SEE  434
                    A +IS  LKK    +RA+ VE        +AGG                SE+
Sbjct  97   LQVNRDAAAIAISNALKK---HRRASSVELAVGTGEDDAGGAISEENSSSVVTTESYSED  153

Query  435  PEVDNSAGLLLKLRSF------CVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPP  596
             E DNS     ++ S+      C  MDS     F+   +K L  +R EI  AL     P 
Sbjct  154  TE-DNSEVCSAEVTSYPLLDRLCKDMDSEGLHRFISDNRKNLAMIREEIPFALKAAPSPA  212

Query  597  KFVMEAISEVFPVDKRELKSERSNDL  674
              V+ ++ + + +D   +  ++ ++L
Sbjct  213  GLVLRSLEDFYSMDLPNVDGKKDSNL  238



>ref|XP_007134303.1| hypothetical protein PHAVU_010G035900g [Phaseolus vulgaris]
 gb|ESW06297.1| hypothetical protein PHAVU_010G035900g [Phaseolus vulgaris]
Length=543

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/186 (24%), Positives = 80/186 (43%), Gaps = 41/186 (22%)
 Frame = +3

Query  195  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  374
             L WK+L +HF  LE+ L R+   L+ + +  + +T+++ E+LEKR+ ++ A    TL++
Sbjct  37   NLKWKDLEEHFHGLEKTLKRRFHELEDQEKEFENKTRKAREILEKRQAAVYAKEQDTLQR  96

Query  375  VDESKRAA-------------------------------------LVEFGNAGGSEE---  434
            + E + AA                                     +V FG  G  EE   
Sbjct  97   LQEKRDAAVFDIMNARENRKVSPSDLAIVSNRGNGALCGEEKPVDVVSFGAQGKVEELEL  156

Query  435  -PEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVME  611
             P+++N       L   C +MD+     F+   +K L ++R EI  AL    +    V++
Sbjct  157  SPKIENVELSYPDLVKLCKEMDATGLHKFISDNRKNLAAVREEIPYALRAAPNAACLVLD  216

Query  612  AISEVF  629
            ++   +
Sbjct  217  SLEGFY  222



>ref|XP_001752883.1| predicted protein [Physcomitrella patens]
 gb|EDQ82387.1| predicted protein, partial [Physcomitrella patens]
Length=436

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 80/185 (43%), Gaps = 40/185 (22%)
 Frame = +3

Query  159  EFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRET  338
            + + Q + + +CTL WKE  D+FT LE  + ++ E L AK +  + + ++  + L+ RE 
Sbjct  3    DLEIQRAAIVNCTLEWKEFEDYFTELEAVMQKRLEDLVAKEKAFEIKYQEMQKALDNREE  62

Query  339  SIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLL-----------------  467
            ++++     L +V E K +A+         EE     +A LL                  
Sbjct  63   AVSSREQAMLSRVQEQKDSAIASL-----FEEKRNTTTAALLTSNTVSPSPTTTSPTSNG  117

Query  468  ------------------KLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDP  593
                              +L+  C  MD      +++  KK++ +LR+E+  AL   +DP
Sbjct  118  LTPTPAPTALGAEVRVRPELKVLCEIMDGDGLRKYIVNHKKDVGALRNELPSALQCAIDP  177

Query  594  PKFVM  608
             + V+
Sbjct  178  ARMVL  182



>emb|CDX85335.1| BnaC07g26460D [Brassica napus]
Length=1617

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/208 (24%), Positives = 95/208 (46%), Gaps = 35/208 (17%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q ++  +  L WKE+ +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  148  AFAELESQRAV--TLNLKWKEIEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQELLEK  205

Query  330  RETSIAASISITLKKVDESKRA-------ALVEFGNA-----------------------  419
            ++ ++ A   ++L+++ + + A       ALV++ N                        
Sbjct  206  KKAAVEAKEKVSLERLQKKRDAAVFAINSALVKYNNPPPITITSAEDSPNNAFVADGTDE  265

Query  420  ---GGSEEPEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVD  590
               G  +E E+        +L   C  MDS     FV   +K L SL+ EI  A     +
Sbjct  266  NPDGTVQEAEISPEVKAYPQLLKLCGDMDSAGLHKFVSDNRKNLASLKEEIPAAFKAAAN  325

Query  591  PPKFVMEAISEVFPVDKRELKSERSNDL  674
            P   V++++   +PV+      ++  +L
Sbjct  326  PASLVLDSLEGFYPVEAPNGDGKKDGNL  353



>ref|XP_010482087.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Camelina sativa]
 ref|XP_010482088.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Camelina sativa]
Length=555

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 92/209 (44%), Gaps = 48/209 (23%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  24   AFAELESQRAV--TLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQELLEK  81

Query  330  RETSIAASISITLKKVDESKRAALV-------EFGNAG------GSEEPEV---------  443
            ++ ++ A    +L+++ + + AA+        ++ NA       G   P+          
Sbjct  82   KKAAVEAKEKASLERLQKKRDAAMFTINSALDKYNNAPISKPSIGERWPQNAVRDSPNAF  141

Query  444  -------DNSAGLL-----------------LKLRSFCVQMDSRSFWSFVIVRKKELESL  551
                   DN  G +                  +L   C  MDS     FV   +K L SL
Sbjct  142  VADSIADDNPDGTVQDVQISPVMGNFEVKAYPQLLKLCGDMDSTGLHKFVSDNRKNLASL  201

Query  552  RSEIRKALGDCVDPPKFVMEAISEVFPVD  638
            + EI  A     +P   V++++   +P++
Sbjct  202  KEEIPIAFRAAANPASLVLDSLEGFYPME  230



>ref|XP_004242450.1| PREDICTED: FRIGIDA-like protein 3 [Solanum lycopersicum]
 ref|XP_010323105.1| PREDICTED: FRIGIDA-like protein 3 [Solanum lycopersicum]
Length=545

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 42/192 (22%)
 Frame = +3

Query  189  SCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITL  368
            +  L WK+L +HF  L++ L R+   L+ + +  +T+  QS E+LEKR+ ++ A    +L
Sbjct  35   TLNLQWKQLEEHFNGLQKSLKRRFTELEDQEKEFETKIVQSTEILEKRQAAVIAKEQSSL  94

Query  369  KKVDESKRAAL------VEFGNAGGSEEPEVDN------------------SAGLLL---  467
            +++ E + AA+      +E   +  S EP V N                    GL+    
Sbjct  95   QRLQEKRDAAVSAISIALEKHRSPCSVEPTVINCEVEDEPSVLEEKPDNLTEIGLVTGDT  154

Query  468  ---------------KLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKF  602
                           +L + C  MDS     F+   +K L +LR EI  AL    +P   
Sbjct  155  WKSFQDSVVEVKSYPELVNLCRNMDSEGLHKFISDNRKNLAALREEIPLALRASTNPASL  214

Query  603  VMEAISEVFPVD  638
            V++++   +  D
Sbjct  215  VLDSLHGFYNSD  226



>ref|XP_010482089.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Camelina sativa]
Length=554

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 92/209 (44%), Gaps = 48/209 (23%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  24   AFAELESQRAV--TLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQELLEK  81

Query  330  RETSIAASISITLKKVDESKRAALV-------EFGNAG------GSEEPEV---------  443
            ++ ++ A    +L+++ + + AA+        ++ NA       G   P+          
Sbjct  82   KKAAVEAKEKASLERLQKKRDAAMFTINSALDKYNNAPISKPSIGERWPQNAVRDSPNAF  141

Query  444  -------DNSAGLL-----------------LKLRSFCVQMDSRSFWSFVIVRKKELESL  551
                   DN  G +                  +L   C  MDS     FV   +K L SL
Sbjct  142  VADSIADDNPDGTVQDVQISPVMGNFEVKAYPQLLKLCGDMDSTGLHKFVSDNRKNLASL  201

Query  552  RSEIRKALGDCVDPPKFVMEAISEVFPVD  638
            + EI  A     +P   V++++   +P++
Sbjct  202  KEEIPIAFRAAANPASLVLDSLEGFYPME  230



>ref|XP_002283922.2| PREDICTED: FRIGIDA-like protein 3 [Vitis vinifera]
Length=577

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/189 (24%), Positives = 86/189 (46%), Gaps = 43/189 (23%)
 Frame = +3

Query  204  WKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDE  383
            W E+ +HF +LE  + +KSE L+A+ +  D Q  +   V+ +RE ++AA     L ++ E
Sbjct  40   WLEIEEHFGNLETMVKKKSEELEAREKEFDAQETEMQSVIAEREAAVAAKEQDLLDQIQE  99

Query  384  SKRAALVEFGNAGGSEEP-------EVDNSA-----------------------------  455
             K AA+     A    +P       +VDN+                              
Sbjct  100  VKDAAVAAIAEARAKYQPTTSEPVDDVDNNETKVSSSLGDTNELLTASEEKSPRKTGENV  159

Query  456  -GLLLKLR------SFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVMEA  614
             G+ ++++       FC QMD++   +F +  +K L ++R E+  AL   ++P + V+++
Sbjct  160  EGIPVEVKPRAELTQFCEQMDAKGLLNFTMENRKNLSAIREELSVALESAMEPARLVLDS  219

Query  615  ISEVFPVDK  641
            +   +P D+
Sbjct  220  LEGFYPSDQ  228



>ref|XP_003521013.1| PREDICTED: FRIGIDA-like protein 3-like [Glycine max]
Length=544

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 78/187 (42%), Gaps = 42/187 (22%)
 Frame = +3

Query  195  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  374
             L WKEL +HF  LE+ L R+   L+ + +  + +T+++ E+LEKR+ ++ A    TL++
Sbjct  37   NLKWKELEEHFHGLEKSLKRRFHELEDQEKEFENKTRKAQEILEKRQAAVYAKEQATLQR  96

Query  375  VDESKRAALVEFGNA--------------------------------------GGSEE--  434
            + E + AA+ +  NA                                      G  EE  
Sbjct  97   LQEKRDAAVFDIVNAREKQRKVTISDLAIVSNGGKGTFHVEDKPVDAVSFAANGNVEEVV  156

Query  435  --PEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVM  608
              PE  N       L   C +MD+     F+   +K L ++R EI  AL    +    V+
Sbjct  157  LSPENGNVELSYPDLVKLCKEMDAAGLHKFISDNRKNLAAVREEIPHALRAAPNAACLVL  216

Query  609  EAISEVF  629
            +++   +
Sbjct  217  DSLKGFY  223



>gb|KHN30845.1| Protein FRIGIDA [Glycine soja]
Length=544

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 78/187 (42%), Gaps = 42/187 (22%)
 Frame = +3

Query  195  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  374
             L WKEL +HF  LE+ L R+   L+ + +  + +T+++ E+LEKR+ ++ A    TL++
Sbjct  37   NLKWKELEEHFHGLEKSLKRRFHELEDQEKEFENKTRKAQEILEKRQAAVYAKEQATLQR  96

Query  375  VDESKRAALVEFGNA--------------------------------------GGSEE--  434
            + E + AA+ +  NA                                      G  EE  
Sbjct  97   LQEKRDAAVFDIVNAREKQRKVTISDLAIVSNGGKGTFHVEDKPVDAVSFAANGNVEEVV  156

Query  435  --PEVDNSAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFVM  608
              PE  N       L   C +MD+     F+   +K L ++R EI  AL    +    V+
Sbjct  157  LSPENGNVELSYPDLVKLCKEMDAAGLHKFISDNRKNLAAVREEIPHALRAAPNAACLVL  216

Query  609  EAISEVF  629
            +++   +
Sbjct  217  DSLKGFY  223



>ref|XP_006660447.1| PREDICTED: FRIGIDA-like protein 3-like [Oryza brachyantha]
Length=545

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/214 (25%), Positives = 93/214 (43%), Gaps = 41/214 (19%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q+++  S  L WK+L DHF  LEQ L +K + LK +    +    +S ++LE+
Sbjct  24   AFAELESQSAV--SLNLKWKQLEDHFHGLEQSLKKKFDDLKRQEMEFEETVAKSEQMLEQ  81

Query  330  RETSIAASISITLKKVDESKRAALVEF---------------------------GNAGGS  428
            +E  + A    +L+++ + + AAL                              GN G  
Sbjct  82   KEAVVVAKELTSLERLQQKRDAALAVIFGKSKLNLSMPVINPINKLVSNDTLLNGNMGSL  141

Query  429  ----EEPEVDNSAGL----LLKLRS----FCVQMDSRSFWSFVIVRKKELESLRSEIRKA  572
                 +P  ++ A L     +K RS     C +M+      F+   +K+L S+R EI  A
Sbjct  142  VVKWPKPATEHGADLQDYTAVKPRSELVVLCEEMNVNGLHKFISDNRKDLTSIREEIPVA  201

Query  573  LGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
            L    DP   V+ ++ + +  D   L  ++  +L
Sbjct  202  LRRVSDPYGLVLASLEDFYFGDNLILDGKKDGNL  235



>ref|XP_003521014.1| PREDICTED: FRIGIDA-like protein 3-like isoform X1 [Glycine max]
 ref|XP_006576663.1| PREDICTED: FRIGIDA-like protein 3-like isoform X2 [Glycine max]
 ref|XP_006576664.1| PREDICTED: FRIGIDA-like protein 3-like isoform X3 [Glycine max]
Length=546

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 83/188 (44%), Gaps = 43/188 (23%)
 Frame = +3

Query  195  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  374
             L WKEL +HF  LE+ L R+ + L+ + +  + +T+++ E+LEKRE ++ A    +L++
Sbjct  37   NLKWKELEEHFHGLEKSLKRRFDELEDQEKEFENKTRKAREILEKREAAVFAKEQDSLQR  96

Query  375  VDESKRAA------------------LVEFGNAG-----GSEEPEVD-------------  446
            + E + AA                  L  F N G     G EE  VD             
Sbjct  97   LQEKRDAASFAIVNAREKQRKISSRELATFSNGGKGGMPGVEEKPVDTLSTAAEGNVEDV  156

Query  447  ---NSAGLLL----KLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFV  605
               ++  + L    +L   C +MD+     F+   +K L ++R EI  AL    +    V
Sbjct  157  KLPDNGNVELVSYPELVKLCKEMDAAGLHKFISDNRKNLAAVRDEIPNALRAAPNAACLV  216

Query  606  MEAISEVF  629
            ++++   +
Sbjct  217  LDSLEGFY  224



>ref|XP_008458098.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Cucumis melo]
Length=638

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 94/217 (43%), Gaps = 44/217 (20%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E +   +L  +  L WKEL +HF  LE+ L R+ + L+ + +  +T+T ++ ++LEK
Sbjct  113  AFAELESHKAL--TLNLKWKELEEHFHGLEKSLKRRFDELEDQEKEYETKTTEARQMLEK  170

Query  330  RETSIAASISITLKK----------------------------------------VDESK  389
            RE +I A   ++L+                                         VD+  
Sbjct  171  REAAILAKEHVSLESLQKKRDAAAFAVASAREKHKKVASEMPSPSDDYLSAEPNVVDKPP  230

Query  390  RAALVEFGNAGGSEEPEVDNSAGL--LLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEI  563
             +   E  +    + PE D   G+    +L   C +MDS     F+   +K L ++R EI
Sbjct  231  DSLTSENNSEDLKDTPEEDRHFGVKSYPQLVQLCEEMDSAGLHKFISDNRKNLAAIREEI  290

Query  564  RKALGDCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
              AL    +P   V++++ + +  +   L  ++++DL
Sbjct  291  PFALKAAANPACMVLDSLEDFYSGEVANLDGKKNSDL  327



>ref|XP_006280261.1| hypothetical protein CARUB_v10026179mg [Capsella rubella]
 gb|EOA13159.1| hypothetical protein CARUB_v10026179mg [Capsella rubella]
Length=556

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 91/210 (43%), Gaps = 50/210 (24%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  24   AFAELESQRAV--TLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQELLEK  81

Query  330  RETSIAASISITLKKVDESKRAALV-------EFGNAGGSEEPEV---------------  443
            ++ ++ A    +L+++ + + AA+         + NA  S +P +               
Sbjct  82   KKAAVEAKEKASLERLQKKRDAAMFAINSALDNYNNAPIS-KPSIGERWRQSVVRDSPNA  140

Query  444  --------DNSAG-----------------LLLKLRSFCVQMDSRSFWSFVIVRKKELES  548
                    DN  G                    +L   C  MDS     FV   +K L S
Sbjct  141  FAADSITDDNPDGSVQDVQISPVMGNFEVKAYPQLLKLCGDMDSTGLHKFVSDNRKNLAS  200

Query  549  LRSEIRKALGDCVDPPKFVMEAISEVFPVD  638
            L+ EI  A     +P   V++++   +P++
Sbjct  201  LKEEIPIAFRAAANPASLVLDSLEGFYPME  230



>ref|XP_009401032.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401033.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=594

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 93/206 (45%), Gaps = 36/206 (17%)
 Frame = +3

Query  159  EFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRET  338
            E  +++SL +   + W E+ +HF SLE+ L  K E +K K +  + +  ++  ++ ++E 
Sbjct  34   ESHKESSLQSK--IKWDEIKEHFQSLERLLKDKLEEVKVKKKAFEEKQSEAQALIAEKEA  91

Query  339  SIAASISITLKKVDESKRAALVEFGNA---------------------------------  419
            +++A    +L ++ E + +A+     A                                 
Sbjct  92   AVSAKEHASLARLQELRDSAVSAIAEARHKYKVASPEPIDVRGSKEKKVSTSPNDINAPN  151

Query  420  GGSEEPEVDN-SAGLLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPP  596
              SEE   DN S  +  +L+  C QMD++    F++ +K+ L SLR E+  AL    +P 
Sbjct  152  PASEEKNPDNASCEVRPRLKQLCQQMDAKGLLKFILEKKRNLGSLREELSLALKYATEPA  211

Query  597  KFVMEAISEVFPVDKRELKSERSNDL  674
            + V+E++   +P+D+        N L
Sbjct  212  RLVLESLEGFYPLDQSNSPGNEDNTL  237



>ref|XP_002961449.1| hypothetical protein SELMODRAFT_76871 [Selaginella moellendorffii]
 gb|EFJ36709.1| hypothetical protein SELMODRAFT_76871 [Selaginella moellendorffii]
Length=579

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 88/186 (47%), Gaps = 35/186 (19%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLD------------  293
            +F E + + + + SCT+ WK+L +HF  +E  L ++ E L  + + LD            
Sbjct  31   AFQELESRRAALESCTIEWKQLEEHFAQVEAALRKRYEELSDREKALDDVEEGLSRREEA  90

Query  294  --TQTKQSL-EVLEKRETSIAASISITLKKVDESKRAALVEFGNAG------------GS  428
               + + SL  V E+RE +IAA     ++  +ES  +     G++G              
Sbjct  91   IAAREEASLARVQEQREAAIAA-----IQHSEESNDSPTNGQGSSGTPTTEATPVPSPAP  145

Query  429  EEPEVDNSAG---LLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPK  599
            ++P V++      +  +L++ C  MD      +V   +K++ +LR E+  A+   +DP +
Sbjct  146  KQPTVNSVVAEVRVRPELKTLCENMDGEGLRRYVSEHRKDVSALRLELPVAIRCAIDPAR  205

Query  600  FVMEAI  617
             V++A+
Sbjct  206  LVLDAL  211



>ref|NP_001062668.1| Os09g0248300 [Oryza sativa Japonica Group]
 dbj|BAF24582.1| Os09g0248300 [Oryza sativa Japonica Group]
 dbj|BAG94353.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84155.1| hypothetical protein OsI_30526 [Oryza sativa Indica Group]
 gb|EEE69257.1| hypothetical protein OsJ_28511 [Oryza sativa Japonica Group]
Length=542

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 55/212 (26%), Positives = 96/212 (45%), Gaps = 39/212 (18%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q+++  S  L WK+L DHF  LEQ L +K + LK + +       +S ++LE+
Sbjct  24   AFAELESQSAV--SLNLKWKQLEDHFHGLEQSLKKKFDELKEQEKEFKETVTKSEQMLEQ  81

Query  330  RETSIAASISITLKKVDESKRAALVE-FG--------------------NA--GGS----  428
            +E ++ A    +L+++ + + AAL   FG                    NA   G+    
Sbjct  82   QEAAVVAKELTSLERLQQKRDAALAMIFGKSKLNLSMPVINPISKSVSNNAVLNGNIASL  141

Query  429  -EEPEVDNSAGL-----LLKLRS----FCVQMDSRSFWSFVIVRKKELESLRSEIRKALG  578
              +P   + A L      +K RS     C +M+      F+   +K+L S+R EI  AL 
Sbjct  142  WPKPATAHGAYLQDGNTAVKPRSQLVILCEEMNVNGLHKFISDNRKDLTSIREEIPVALR  201

Query  579  DCVDPPKFVMEAISEVFPVDKRELKSERSNDL  674
               DP   V+ ++ + +  D   L  ++  +L
Sbjct  202  GATDPYGLVLASLEDFYFGDNLILDGKKDGNL  233



>ref|XP_004510190.1| PREDICTED: protein FRIGIDA-like [Cicer arietinum]
Length=546

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 45/191 (24%), Positives = 83/191 (43%), Gaps = 43/191 (23%)
 Frame = +3

Query  186  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  365
             +  L WKEL +HF  LE+ L R+   L+ + +  +++T+++ EVLEK+E ++ A    T
Sbjct  34   VTLNLKWKELEEHFHGLEKSLKRRFHELEDQEKVFESKTRKAREVLEKQEAAVFAKEQAT  93

Query  366  LKKVDESKRAALVEFGNA-----------------GGSEEPEV-----------------  443
            L+++ E + A++    NA                 GG   P V                 
Sbjct  94   LQRLQEKRDASVFTIVNAQEKHRKVSTKDLGILFNGGQGPPSVEEKPLDAASTGAKGNLE  153

Query  444  -------DNSAGLL--LKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPP  596
                   + +A L+   +L   C +MD+     F+   +K L ++R EI  AL    +  
Sbjct  154  NVKLSPENGNADLMSYPELVRLCKEMDAAGLHKFISDNRKNLATVRDEIPHALRAAPNAA  213

Query  597  KFVMEAISEVF  629
              V++++   +
Sbjct  214  CLVLDSLEGFY  224



>ref|XP_009802214.1| PREDICTED: FRIGIDA-like protein 3 [Nicotiana sylvestris]
 ref|XP_009802223.1| PREDICTED: FRIGIDA-like protein 3 [Nicotiana sylvestris]
Length=545

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 45/189 (24%), Positives = 78/189 (41%), Gaps = 40/189 (21%)
 Frame = +3

Query  186  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  365
             +  L WK+L +HF  LE+ L R+   L+ + +  +T+  QS ++LEKR+ ++ +    +
Sbjct  34   VTLNLKWKQLEEHFHGLEKSLKRRFTELEDQEKEFETKIVQSRKILEKRQAAVISKEQAS  93

Query  366  LKKVDESKRAAL------VEFGNAGGSEEPEVDNSAG-----------------------  458
            L+ + E + AA+      +E      S EP  +   G                       
Sbjct  94   LESLQEKRDAAVSAITIALEKHRKPYSVEPSCEVQGGPSMFEARPLDFIPLENNNTEDHI  153

Query  459  -----------LLLKLRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPKFV  605
                          +L   C  MDS     F+   +K L ++R EI  AL   VDP   V
Sbjct  154  KPFKNDVGEVKFYPELVKLCQDMDSEGLHKFISDNRKNLAAVREEIPPALRAAVDPAFLV  213

Query  606  MEAISEVFP  632
            ++++   +P
Sbjct  214  LDSLKGFYP  222



>ref|XP_010493658.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Camelina sativa]
 ref|XP_010493659.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Camelina sativa]
Length=551

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 49/207 (24%), Positives = 90/207 (43%), Gaps = 48/207 (23%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E + Q ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  24   AFAELESQRAV--TLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQELLEK  81

Query  330  RETSIAASISITLKKVDESKRAALV-------EFGNAG------GSEEPEV---------  443
            ++ ++ A    +L+++ + + AA+        ++ NA       G   P+          
Sbjct  82   KKAAVEAKEKASLERLQKKRDAAMFTINSALDKYKNAPISKPSIGERWPQNAVRDSPNAF  141

Query  444  -------DNSAGLL-----------------LKLRSFCVQMDSRSFWSFVIVRKKELESL  551
                   DN  G +                  +L   C  MDS     FV   +K L SL
Sbjct  142  AADSITDDNPDGTVQDVQISPVMGNFEVKAYPQLLKLCGDMDSTGLHKFVSDNRKNLASL  201

Query  552  RSEIRKALGDCVDPPKFVMEAISEVFP  632
            + EI  A     +P   V++++   +P
Sbjct  202  KEEIPIAFRAAANPASLVLDSLEGFYP  228



>ref|XP_009385695.1| PREDICTED: FRIGIDA-like protein 3 [Musa acuminata subsp. malaccensis]
 ref|XP_009385705.1| PREDICTED: FRIGIDA-like protein 3 [Musa acuminata subsp. malaccensis]
Length=538

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 91/196 (46%), Gaps = 38/196 (19%)
 Frame = +3

Query  150  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  329
            +F E +R +++  S  L WKEL +HF  LE+ L  + + L+ + +   T+  ++ ++LEK
Sbjct  24   AFAELERHSAI--SLNLKWKELEEHFHGLEKSLKTRFDELEDQEKEYVTEVTEAQQMLEK  81

Query  330  RETSIAASISITLKKVDESKRAAL-VEFGNAGGSE-EP---EVDNS-AGLLLK-------  470
            +ET++ A    +L+++ E + AAL V F   G S  EP    V+NS    +LK       
Sbjct  82   QETAVVAKELASLERLQEKRDAALSVLFDKHGTSSLEPVVKGVNNSMTDPILKENSGVGA  141

Query  471  -----------------------LRSFCVQMDSRSFWSFVIVRKKELESLRSEIRKALGD  581
                                   L   C +MD++    F+    K + S+R EI  AL  
Sbjct  142  AKSGMEDVCPAEKGSVCIEPPTELMKLCEEMDAQGLHKFISDNHKNVISIREEIPVALKR  201

Query  582  CVDPPKFVMEAISEVF  629
              +P   V++++   +
Sbjct  202  AANPFSLVLDSLKGFY  217



>ref|XP_009771266.1| PREDICTED: FRIGIDA-like protein 3 [Nicotiana sylvestris]
Length=545

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 84/193 (44%), Gaps = 42/193 (22%)
 Frame = +3

Query  186  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  365
             +  L WK+L +HF  L++ L R+   L+ + +  +T+  QS E+LEKR+ ++ A    +
Sbjct  34   VTLNLQWKQLEEHFHGLQKSLKRRFNELEDQEKEFETKIFQSREMLEKRQAAVIAKEQAS  93

Query  366  LKKVDESKRAAL------VEFGNAGGSEEPEVDN--------------------------  449
            L+++ E + AA+      +E      S +P V N                          
Sbjct  94   LQRLQEKRDAAVSAIAIALEKHRKPCSVQPAVINCEVQDGPSILEQKPDDFIEIGHVIED  153

Query  450  ----SAGLLLKLRSF------CVQMDSRSFWSFVIVRKKELESLRSEIRKALGDCVDPPK  599
                S G  ++++S+      C  MDS     F+   +K L +LR EI  AL    +P  
Sbjct  154  TGKPSQGGGVEVKSYPELVKLCQNMDSEGLHKFISDNRKNLAALREEIPLALRAATNPAS  213

Query  600  FVMEAISEVFPVD  638
             V++++   +  D
Sbjct  214  LVLDSLKGFYNSD  226



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1133412046677