BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7284

Length=560
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009786809.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          218   2e-64   Nicotiana sylvestris
ref|XP_009603383.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          218   3e-64   Nicotiana tomentosiformis
ref|XP_006340129.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     211   1e-61   Solanum tuberosum [potatoes]
ref|XP_004251107.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          208   2e-60   Solanum lycopersicum
ref|XP_010111818.1|  4-coumarate--CoA ligase-like 7                     204   5e-58   
ref|XP_004291645.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          201   6e-58   Fragaria vesca subsp. vesca
ref|XP_008226338.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          200   1e-57   
gb|AHL44983.1|  4-coumarate:coenzyme A ligase 4                         200   2e-57   Fraxinus mandshurica [Manchurian ash]
ref|XP_010422413.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          199   4e-57   Camelina sativa [gold-of-pleasure]
ref|XP_007016850.1|  AMP-dependent synthetase and ligase family p...    196   4e-57   
ref|XP_006488032.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     199   5e-57   Citrus sinensis [apfelsine]
ref|NP_192425.1|  4-coumarate--CoA ligase-like 7                        198   8e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006424490.1|  hypothetical protein CICLE_v10028138mg             197   2e-56   Citrus clementina [clementine]
ref|XP_010455853.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          197   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010538202.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          197   4e-56   Tarenaya hassleriana [spider flower]
ref|XP_010431672.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          196   4e-56   Camelina sativa [gold-of-pleasure]
ref|XP_009345749.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          193   4e-56   
ref|XP_007208457.1|  hypothetical protein PRUPE_ppa003893mg             196   4e-56   Prunus persica
ref|XP_007016849.1|  AMP-dependent synthetase and ligase family p...    196   5e-56   
ref|XP_006396625.1|  hypothetical protein EUTSA_v10028563mg             196   7e-56   Eutrema salsugineum [saltwater cress]
gb|KDO60233.1|  hypothetical protein CISIN_1g0436011mg                  191   8e-56   Citrus sinensis [apfelsine]
ref|XP_006396627.1|  hypothetical protein EUTSA_v10028562mg             195   1e-55   Eutrema salsugineum [saltwater cress]
gb|KJB83875.1|  hypothetical protein B456_013G269100                    193   2e-55   Gossypium raimondii
ref|XP_010529378.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...    195   2e-55   Tarenaya hassleriana [spider flower]
gb|ADG46006.1|  4-coumarate coenzyme A ligase                           194   2e-55   Isatis tinctoria [woad]
gb|AGO89328.1|  Ca4CL11                                                 194   5e-55   Salix arbutifolia
ref|XP_002872738.1|  hypothetical protein ARALYDRAFT_490166             194   5e-55   Arabidopsis lyrata subsp. lyrata
gb|AIR95612.1|  4-coumarate:CoA ligase-like protein                     193   7e-55   Betula pendula [white birch]
emb|CDY39153.1|  BnaC09g21910D                                          193   8e-55   Brassica napus [oilseed rape]
ref|XP_010042863.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          189   8e-55   Eucalyptus grandis [rose gum]
ref|XP_002523698.1|  AMP dependent CoA ligase, putative                 193   8e-55   Ricinus communis
ref|XP_006287440.1|  hypothetical protein CARUB_v10000646mg             193   1e-54   Capsella rubella
gb|KJB83876.1|  hypothetical protein B456_013G269100                    192   1e-54   Gossypium raimondii
ref|XP_002305282.1|  4-coumarate--CoA ligase family protein             192   1e-54   Populus trichocarpa [western balsam poplar]
ref|XP_009335967.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          192   1e-54   Pyrus x bretschneideri [bai li]
ref|XP_011089239.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...    192   2e-54   
gb|KJB83874.1|  hypothetical protein B456_013G269100                    192   2e-54   Gossypium raimondii
ref|XP_012064724.1|  PREDICTED: 4-coumarate--CoA ligase-like 7 is...    190   3e-54   
ref|XP_011004441.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          191   3e-54   Populus euphratica
ref|XP_009356915.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          191   4e-54   Pyrus x bretschneideri [bai li]
ref|XP_010267197.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          191   5e-54   Nelumbo nucifera [Indian lotus]
gb|AGA17924.1|  CCL7                                                    191   6e-54   Humulus lupulus [common hop]
emb|CDY39155.1|  BnaC09g21890D                                          191   7e-54   Brassica napus [oilseed rape]
ref|XP_008359628.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          191   7e-54   
ref|XP_012064722.1|  PREDICTED: 4-coumarate--CoA ligase-like 7 is...    190   1e-53   Jatropha curcas
gb|EPS70306.1|  hypothetical protein M569_04447                         190   1e-53   Genlisea aurea
ref|XP_006488030.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     189   2e-53   
ref|XP_010045319.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          189   3e-53   Eucalyptus grandis [rose gum]
gb|KHG26822.1|  4-coumarate--CoA ligase-like 7                          187   3e-53   Gossypium arboreum [tree cotton]
gb|KHG22750.1|  4-coumarate--CoA ligase-like 7                          187   4e-53   Gossypium arboreum [tree cotton]
ref|XP_009114500.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          188   5e-53   Brassica rapa
emb|CDY46376.1|  BnaA09g19900D                                          188   5e-53   Brassica napus [oilseed rape]
gb|KDO60238.1|  hypothetical protein CISIN_1g0137801mg                  183   7e-53   Citrus sinensis [apfelsine]
gb|AIA24410.1|  4-coumarate-CoA ligase                                  187   7e-53   Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_008384715.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          187   8e-53   
gb|KCW87478.1|  hypothetical protein EUGRSUZ_B03942                     189   8e-53   Eucalyptus grandis [rose gum]
gb|KCW87479.1|  hypothetical protein EUGRSUZ_B03943                     189   1e-52   Eucalyptus grandis [rose gum]
gb|AFD33347.1|  acyl-activating enzyme 3                                187   1e-52   Cannabis sativa
ref|XP_006373451.1|  4-coumarate--CoA ligase family protein             186   2e-52   
gb|EYU18792.1|  hypothetical protein MIMGU_mgv1a004091mg                186   2e-52   Erythranthe guttata [common monkey flower]
emb|CDY46375.1|  BnaA09g19890D                                          186   4e-52   Brassica napus [oilseed rape]
ref|XP_002276353.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          185   7e-52   Vitis vinifera
ref|XP_006424487.1|  hypothetical protein CICLE_v10029864mg             184   8e-52   
gb|KDO60236.1|  hypothetical protein CISIN_1g0137801mg                  182   1e-51   Citrus sinensis [apfelsine]
gb|KDO60235.1|  hypothetical protein CISIN_1g0137801mg                  182   1e-51   Citrus sinensis [apfelsine]
gb|AGO89329.1|  Ca4CL12                                                 184   1e-51   Salix arbutifolia
emb|CAN70560.1|  hypothetical protein VITISV_031619                     186   2e-51   Vitis vinifera
ref|XP_006424481.1|  hypothetical protein CICLE_v100281392mg            179   2e-51   
gb|AGO89327.1|  Ca4CL10                                                 184   2e-51   Salix arbutifolia
gb|AGW27195.1|  4-coumarate:coenzyme A ligase 5                         184   3e-51   Salvia miltiorrhiza [Chinese salvia]
ref|XP_011021223.1|  PREDICTED: 4-coumarate--CoA ligase-like 7 is...    180   2e-50   Populus euphratica
ref|XP_011021222.1|  PREDICTED: 4-coumarate--CoA ligase-like 7 is...    180   3e-50   Populus euphratica
ref|XP_010689117.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          181   3e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011021221.1|  PREDICTED: 4-coumarate--CoA ligase-like 7 is...    180   5e-50   Populus euphratica
gb|KEH29988.1|  4-coumarate:CoA ligase-like protein                     178   6e-50   Medicago truncatula
ref|XP_011021220.1|  PREDICTED: 4-coumarate--CoA ligase-like 7 is...    180   6e-50   Populus euphratica
ref|XP_006488029.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     179   8e-50   Citrus sinensis [apfelsine]
gb|KEH29987.1|  4-coumarate:CoA ligase-like protein                     178   1e-49   Medicago truncatula
gb|KFK32221.1|  hypothetical protein AALP_AA6G213500                    179   2e-49   Arabis alpina [alpine rockcress]
gb|KEH29989.1|  4-coumarate:CoA ligase-like protein                     178   4e-49   Medicago truncatula
ref|XP_004147290.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          177   4e-49   Cucumis sativus [cucumbers]
gb|KHN38721.1|  4-coumarate--CoA ligase-like 7                          171   3e-47   Glycine soja [wild soybean]
ref|XP_009114499.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          172   3e-47   Brassica rapa
ref|XP_006591122.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-li...    172   9e-47   Glycine max [soybeans]
ref|XP_006591121.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-li...    171   1e-46   Glycine max [soybeans]
gb|AGW47873.1|  4-coumarate:coenzyme A ligase 8                         171   1e-46   Phaseolus vulgaris [French bean]
gb|ABR18186.1|  unknown                                                 170   3e-46   Picea sitchensis
ref|XP_008463063.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          169   4e-46   Cucumis melo [Oriental melon]
ref|XP_007132315.1|  hypothetical protein PHAVU_011G084300g             167   8e-46   Phaseolus vulgaris [French bean]
ref|XP_007132313.1|  hypothetical protein PHAVU_011G084300g             167   1e-45   Phaseolus vulgaris [French bean]
gb|ABR17274.1|  unknown                                                 168   1e-45   Picea sitchensis
ref|XP_007132314.1|  hypothetical protein PHAVU_011G084300g             167   3e-45   Phaseolus vulgaris [French bean]
ref|XP_008808867.1|  PREDICTED: 4-coumarate--CoA ligase-like 1          166   6e-45   Phoenix dactylifera
ref|XP_006843037.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          163   7e-44   Amborella trichopoda
ref|XP_010918638.1|  PREDICTED: 4-coumarate--CoA ligase-like 1 is...    158   5e-42   
ref|XP_010918637.1|  PREDICTED: 4-coumarate--CoA ligase-like 1 is...    158   7e-42   Elaeis guineensis
gb|AGW47869.1|  4-coumarate:coenzyme A ligase 4                         156   3e-41   Phaseolus vulgaris [French bean]
ref|NP_001243292.1|  4-coumarate--CoA ligase-like 7-like                155   6e-41   Glycine max [soybeans]
ref|XP_007150153.1|  hypothetical protein PHAVU_005G131400g             154   1e-40   Phaseolus vulgaris [French bean]
gb|KEH39398.1|  4-coumarate:CoA ligase-like protein                     152   6e-40   Medicago truncatula
gb|AGA17927.1|  CCL10                                                   151   1e-39   Humulus lupulus [common hop]
gb|KEH39397.1|  4-coumarate:CoA ligase-like protein                     151   2e-39   Medicago truncatula
ref|XP_009413145.1|  PREDICTED: 4-coumarate--CoA ligase-like 1          150   4e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|AID56315.1|  4-coumarate coenzyme A ligase 2                         138   2e-38   Eriobotrya japonica [loquat]
ref|XP_010654332.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          139   3e-38   Vitis vinifera
ref|XP_011651966.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          147   4e-38   Cucumis sativus [cucumbers]
ref|XP_004487067.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     147   4e-38   Cicer arietinum [garbanzo]
ref|XP_004304462.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          145   1e-37   Fragaria vesca subsp. vesca
ref|XP_008442710.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          145   2e-37   Cucumis melo [Oriental melon]
gb|AIY34663.1|  4-coumarate:CoA ligase-like protein                     145   4e-37   Ornithogalum longebracteatum [sea-onion]
ref|XP_011087155.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          144   6e-37   Sesamum indicum [beniseed]
ref|XP_009401821.1|  PREDICTED: 4-coumarate--CoA ligase-like 1          144   9e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007203616.1|  hypothetical protein PRUPE_ppa003871mg             141   5e-36   Prunus persica
emb|CBI30139.3|  unnamed protein product                                141   1e-35   Vitis vinifera
gb|KHN21493.1|  4-coumarate--CoA ligase-like 7                          140   1e-35   Glycine soja [wild soybean]
emb|CDP06777.1|  unnamed protein product                                140   1e-35   Coffea canephora [robusta coffee]
ref|XP_008241410.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          140   2e-35   Prunus mume [ume]
gb|KJB20368.1|  hypothetical protein B456_003G144900                    139   2e-35   Gossypium raimondii
gb|KJB20367.1|  hypothetical protein B456_003G144900                    139   2e-35   Gossypium raimondii
gb|KJB20365.1|  hypothetical protein B456_003G144900                    139   2e-35   Gossypium raimondii
gb|KJB20366.1|  hypothetical protein B456_003G144900                    139   3e-35   Gossypium raimondii
gb|KJB20364.1|  hypothetical protein B456_003G144900                    139   3e-35   Gossypium raimondii
gb|KDO60237.1|  hypothetical protein CISIN_1g0137801mg                  137   5e-35   Citrus sinensis [apfelsine]
ref|XP_006424482.1|  hypothetical protein CICLE_v100281392mg            135   9e-35   
gb|KJB36450.1|  hypothetical protein B456_006G162900                    134   7e-34   Gossypium raimondii
gb|KJB36451.1|  hypothetical protein B456_006G162900                    134   2e-33   Gossypium raimondii
ref|XP_007027423.1|  AMP-dependent synthetase and ligase family p...    134   3e-33   
ref|XP_002519487.1|  AMP dependent CoA ligase, putative                 133   4e-33   
ref|XP_010037647.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          133   4e-33   Eucalyptus grandis [rose gum]
gb|KEH42182.1|  4-coumarate:CoA ligase-like protein                     133   6e-33   Medicago truncatula
ref|XP_004497538.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     129   2e-31   Cicer arietinum [garbanzo]
ref|XP_011087272.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          129   2e-31   
dbj|BAJ88705.1|  predicted protein                                      128   5e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010101621.1|  4-coumarate--CoA ligase-like 7                     119   4e-28   Morus notabilis
ref|XP_004982543.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-like     119   8e-28   Setaria italica
ref|XP_010037648.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          118   1e-27   Eucalyptus grandis [rose gum]
ref|XP_004985664.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-like     117   5e-27   
ref|XP_003558787.1|  PREDICTED: 4-coumarate--CoA ligase-like 1          116   5e-27   Brachypodium distachyon [annual false brome]
tpg|DAA43421.1|  TPA: LOW QUALITY PROTEIN: putative AMP-dependent...    115   7e-27   
ref|XP_004982544.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-like     114   4e-26   Setaria italica
ref|XP_008672616.1|  PREDICTED: uncharacterized protein LOC100191...    114   4e-26   Zea mays [maize]
gb|AFK46688.1|  unknown                                                 105   9e-26   Medicago truncatula
ref|XP_001759551.1|  predicted protein                                  112   2e-25   
ref|XP_008673103.1|  PREDICTED: uncharacterized protein LOC100280...    111   2e-25   Zea mays [maize]
tpg|DAA50089.1|  TPA: putative AMP-dependent synthetase and ligas...    111   3e-25   
gb|KEH42183.1|  4-coumarate:CoA ligase-like protein                     110   7e-25   Medicago truncatula
ref|XP_002466906.1|  hypothetical protein SORBIDRAFT_01g016420          110   9e-25   
gb|KDP29158.1|  hypothetical protein JCGZ_16547                         109   1e-24   Jatropha curcas
ref|XP_001752801.1|  predicted protein                                  110   1e-24   
ref|XP_004985666.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-li...    109   2e-24   Setaria italica
ref|XP_004985665.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-li...    109   2e-24   Setaria italica
sp|Q0DV32.2|4CLL1_ORYSJ  RecName: Full=4-coumarate--CoA ligase-li...    100   4e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74534.1|  hypothetical protein OsI_10054                          100   4e-21   Oryza sativa Indica Group [Indian rice]
gb|EEE58336.1|  hypothetical protein OsJ_09444                          100   4e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002982252.1|  hypothetical protein SELMODRAFT_179406           99.0    1e-20   Selaginella moellendorffii
ref|XP_001761993.1|  predicted protein                                99.0    1e-20   
ref|XP_002985866.1|  hypothetical protein SELMODRAFT_446445           98.6    2e-20   Selaginella moellendorffii
ref|XP_002984802.1|  hypothetical protein SELMODRAFT_181279           98.6    2e-20   Selaginella moellendorffii
gb|EPS72162.1|  hypothetical protein M569_02598                       98.2    3e-20   Genlisea aurea
ref|XP_006416394.1|  hypothetical protein EUTSA_v10007272mg           97.8    3e-20   Eutrema salsugineum [saltwater cress]
ref|XP_010087995.1|  4-coumarate--CoA ligase-like 6                   95.5    2e-19   Morus notabilis
ref|XP_002966178.1|  hypothetical protein SELMODRAFT_143817           94.4    5e-19   
gb|AJT43268.1|  4-coumarate: coenzyme A ligase                        93.6    1e-18   Plagiochasma appendiculatum
ref|XP_006416393.1|  hypothetical protein EUTSA_v10007280mg           93.2    1e-18   Eutrema salsugineum [saltwater cress]
gb|AHI15919.1|  4-coumarate:CoA ligase 3                              92.4    2e-18   Dryopteris fragrans
ref|XP_006307155.1|  hypothetical protein CARUB_v10008746mg           92.4    2e-18   Capsella rubella
ref|XP_002512781.1|  AMP dependent CoA ligase, putative               92.4    2e-18   Ricinus communis
ref|XP_006290853.1|  hypothetical protein CARUB_v10016963mg           92.0    3e-18   Capsella rubella
ref|XP_010463387.1|  PREDICTED: 4-coumarate--CoA ligase 1-like        89.7    5e-18   
gb|AGA17922.1|  CCL5                                                  91.7    5e-18   Humulus lupulus [common hop]
ref|XP_010935869.1|  PREDICTED: 4-coumarate--CoA ligase-like 5        91.3    6e-18   Elaeis guineensis
ref|XP_010479663.1|  PREDICTED: 4-coumarate--CoA ligase 1             91.3    6e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010459732.1|  PREDICTED: 4-coumarate--CoA ligase-like 4        90.9    7e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010463388.1|  PREDICTED: 4-coumarate--CoA ligase 1-like        89.0    9e-18   
gb|ACF80143.2|  unknown                                               89.0    1e-17   Zea mays [maize]
gb|AIE16382.1|  4-coumarate:CoA ligase                                87.0    2e-17   Glycine max [soybeans]
emb|CDY33628.1|  BnaC08g19280D                                        90.1    2e-17   Brassica napus [oilseed rape]
gb|AIE16393.1|  4-coumarate:CoA ligase                                87.0    2e-17   Glycine soja [wild soybean]
ref|XP_010664596.1|  PREDICTED: 4-coumarate--CoA ligase-like 6 is...  89.7    2e-17   
gb|AAF91309.1|AF239686_1  4-coumarate:coA ligase 2                    89.7    2e-17   Rubus idaeus [European raspberry]
ref|XP_010111547.1|  4-coumarate--CoA ligase-like 6                   90.1    2e-17   
gb|AFG26323.1|  4-coumarate-CoA ligase                                89.7    2e-17   Cinnamomum osmophloeum
gb|AIE16387.1|  4-coumarate:CoA ligase                                86.7    2e-17   Glycine soja [wild soybean]
ref|XP_002979037.1|  hypothetical protein SELMODRAFT_268211           89.4    3e-17   
ref|XP_010500746.1|  PREDICTED: 4-coumarate--CoA ligase 1-like is...  89.4    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010090435.1|  4-coumarate--CoA ligase-like 5                   89.7    3e-17   Morus notabilis
ref|XP_001754050.1|  predicted protein                                89.4    3e-17   
ref|XP_010462003.1|  PREDICTED: 4-coumarate--CoA ligase 1-like is...  89.4    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006307145.1|  hypothetical protein CARUB_v10008735mg           89.4    3e-17   
ref|NP_173473.2|  4-coumarate--CoA ligase-like 3                      88.6    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303947.1|  hypothetical protein CARUB_v10008763mg           89.4    3e-17   Capsella rubella
ref|XP_002270360.1|  PREDICTED: 4-coumarate--CoA ligase-like 6 is...  89.4    3e-17   Vitis vinifera
ref|XP_006307164.1|  hypothetical protein CARUB_v10008755mg           89.4    3e-17   Capsella rubella
ref|NP_001237750.1|  4-coumarate:coenzyme A ligase                    89.4    3e-17   
emb|CDP11727.1|  unnamed protein product                              89.4    3e-17   Coffea canephora [robusta coffee]
gb|KJB29670.1|  hypothetical protein B456_005G113000                  88.6    4e-17   Gossypium raimondii
gb|AIE16397.1|  4-coumarate:CoA ligase                                86.3    4e-17   Glycine soja [wild soybean]
ref|XP_006304883.1|  hypothetical protein CARUB_v10012648mg           89.0    4e-17   Capsella rubella
ref|XP_010477291.1|  PREDICTED: 4-coumarate--CoA ligase-like 4 is...  88.6    4e-17   
ref|XP_004253129.1|  PREDICTED: 4-coumarate--CoA ligase-like 5        89.0    4e-17   Solanum lycopersicum
ref|XP_006416396.1|  hypothetical protein EUTSA_v10007285mg           89.0    4e-17   Eutrema salsugineum [saltwater cress]
gb|KJB29669.1|  hypothetical protein B456_005G113000                  88.6    5e-17   Gossypium raimondii
ref|XP_006414022.1|  hypothetical protein EUTSA_v10024787mg           89.0    5e-17   Eutrema salsugineum [saltwater cress]
ref|XP_002867963.1|  hypothetical protein ARALYDRAFT_492955           88.6    5e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_007158204.1|  hypothetical protein PHAVU_002G132900g           88.6    5e-17   Phaseolus vulgaris [French bean]
ref|XP_002979110.1|  hypothetical protein SELMODRAFT_177466           88.6    5e-17   Selaginella moellendorffii
dbj|BAJ33983.1|  unnamed protein product                              88.6    6e-17   Eutrema halophilum
ref|XP_006393012.1|  hypothetical protein EUTSA_v10011357mg           88.6    6e-17   
gb|EYU17530.1|  hypothetical protein MIMGU_mgv1a003887mg              88.6    6e-17   Erythranthe guttata [common monkey flower]
gb|ADE95828.1|  4-coumarate:CoA ligase 1                              88.6    6e-17   Corchorus capsularis [jute]
gb|AIE16384.1|  4-coumarate:CoA ligase                                85.5    6e-17   Glycine max [soybeans]
gb|AAF79611.1|AC027665_12  F5M15.17                                   88.6    6e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002986342.1|  hypothetical protein SELMODRAFT_182368           88.2    7e-17   Selaginella moellendorffii
gb|AHI15920.1|  4-coumarate:CoA ligase 4                              88.2    7e-17   Dryopteris fragrans
gb|KEP50630.1|  4-coumarate-CoA ligase-like protein                   88.2    8e-17   Rhizoctonia solani 123E
ref|XP_002894328.1|  4-cumarate-COA-ligase                            88.2    8e-17   Arabidopsis lyrata subsp. lyrata
gb|AGW27194.1|  4-coumarate:coenzyme A ligase 4                       88.2    8e-17   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010477290.1|  PREDICTED: 4-coumarate--CoA ligase-like 4 is...  88.2    8e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002991507.1|  hypothetical protein SELMODRAFT_133629           88.2    8e-17   
emb|CAP08804.1|  4-cumarate-COA-ligase                                88.2    8e-17   Arabidopsis lyrata [lyrate rockcress]
ref|XP_009110226.1|  PREDICTED: 4-coumarate--CoA ligase-like 8 is...  88.2    8e-17   Brassica rapa
ref|XP_009110227.1|  PREDICTED: 4-coumarate--CoA ligase-like 8 is...  87.8    8e-17   Brassica rapa
sp|Q3E6Y4.2|4CLL3_ARATH  RecName: Full=4-coumarate--CoA ligase-li...  88.2    9e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010094597.1|  4-coumarate--CoA ligase-like 5                   87.8    9e-17   Morus notabilis
ref|XP_010498483.1|  PREDICTED: 4-coumarate--CoA ligase-like 5        87.8    9e-17   Camelina sativa [gold-of-pleasure]
ref|NP_173474.5|  4-coumarate--CoA ligase-like 4                      87.8    9e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KHG05050.1|  4-coumarate--CoA ligase-like 5                        87.8    9e-17   Gossypium arboreum [tree cotton]
gb|KJB29668.1|  hypothetical protein B456_005G113000                  87.8    9e-17   Gossypium raimondii
gb|KJB29671.1|  hypothetical protein B456_005G113000                  87.8    1e-16   Gossypium raimondii
ref|XP_010459734.1|  PREDICTED: 4-coumarate--CoA ligase-like 5        87.8    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_004507842.1|  PREDICTED: 4-coumarate--CoA ligase-like isof...  87.4    1e-16   
ref|XP_004507841.1|  PREDICTED: 4-coumarate--CoA ligase-like isof...  87.4    1e-16   Cicer arietinum [garbanzo]
ref|XP_008787558.1|  PREDICTED: 4-coumarate--CoA ligase-like 5        87.4    1e-16   
gb|EPS60018.1|  hypothetical protein M569_14786                       87.4    1e-16   Genlisea aurea
ref|WP_019489935.1|  hypothetical protein                             88.2    2e-16   Calothrix sp. PCC 7103
gb|EUC54434.1|  4-coumarate-CoA ligase-like protein                   87.4    2e-16   Rhizoctonia solani AG-3 Rhs1AP
gb|AAF79612.1|AC027665_13  F5M15.18                                   88.2    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477286.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...  87.0    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010477287.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...  87.0    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_007017972.1|  OPC-8:0 CoA ligase1 isoform 1                    87.0    2e-16   
ref|XP_007017973.1|  OPC-8:0 CoA ligase1 isoform 2                    87.0    2e-16   
gb|AGW47870.1|  4-coumarate:coenzyme A ligase 5                       87.0    2e-16   Phaseolus vulgaris [French bean]
ref|XP_003517649.2|  PREDICTED: 4-coumarate--CoA ligase-like 6-li...  87.0    2e-16   Glycine max [soybeans]
gb|KHN40402.1|  4-coumarate--CoA ligase-like 6                        87.0    2e-16   Glycine soja [wild soybean]
ref|XP_010536451.1|  PREDICTED: 4-coumarate--CoA ligase-like 5        87.0    2e-16   Tarenaya hassleriana [spider flower]
emb|CAP09678.1|  cinnamyl alcohol dehydrogenase                       85.1    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010439777.1|  PREDICTED: 4-coumarate--CoA ligase-like 6        87.0    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009774473.1|  PREDICTED: 4-coumarate--CoA ligase-like 5        86.7    2e-16   Nicotiana sylvestris
ref|NP_973872.1|  OPC-8:0 CoA ligase1                                 86.3    2e-16   Arabidopsis thaliana [mouse-ear cress]
pdb|3TSY|A  Chain A, 4-Coumaroyl-Coa Ligase::stilbene Synthase Fu...  87.4    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149529.1|  PREDICTED: 4-coumarate--CoA ligase-like 4        86.7    3e-16   Brassica rapa
emb|CDY43921.1|  BnaA05g15310D                                        86.7    3e-16   Brassica napus [oilseed rape]
gb|AAP03015.1|  4-coumarate-CoA ligase-like protein                   86.7    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007150832.1|  hypothetical protein PHAVU_005G184500g           86.3    3e-16   Phaseolus vulgaris [French bean]
gb|EPB88659.1|  hypothetical protein HMPREF1544_04531                 86.3    3e-16   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_010551073.1|  PREDICTED: 4-coumarate--CoA ligase 3             86.7    3e-16   Tarenaya hassleriana [spider flower]
emb|CDY29526.1|  BnaA06g14440D                                        87.4    3e-16   Brassica napus [oilseed rape]
ref|XP_010477292.1|  PREDICTED: 4-coumarate--CoA ligase-like 4        86.3    3e-16   
dbj|BAJ88016.1|  predicted protein                                    86.3    3e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_564115.1|  OPC-8:0 CoA ligase1                                 86.3    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198628.2|  4-coumarate--CoA ligase-like 8                      86.3    3e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAP03021.1|  4-coumarate-CoA ligase-like protein                   86.3    3e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AHM88424.1|  4CL6                                                  86.3    4e-16   Fraxinus mandshurica [Manchurian ash]
gb|ACI23348.1|  4-coumarate CoA ligase 1                              86.3    4e-16   Leucaena leucocephala [cassie]
ref|NP_193636.1|  4-coumarate--CoA ligase-like 6                      86.3    4e-16   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB11279.1|  AMP-binding protein-like                             85.9    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011076955.1|  PREDICTED: 4-coumarate--CoA ligase-like 5        86.3    4e-16   
gb|KFK44164.1|  hypothetical protein AALP_AA1G223100                  85.9    4e-16   Arabis alpina [alpine rockcress]
gb|AAP03017.1|  4-coumarate-CoA ligase-like protein                   86.3    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|WP_019326587.1|  AMP-dependent synthetase                         85.9    4e-16   Streptomyces sp. TOR3209
ref|WP_031016118.1|  AMP-dependent synthetase                         85.9    4e-16   Streptomyces sp. NRRL WC-3795
ref|XP_002893114.1|  opc-8:0 CoA ligase1                              85.9    4e-16   
emb|CDX96637.1|  BnaA08g21800D                                        85.9    4e-16   
ref|WP_030975108.1|  AMP-dependent synthetase                         85.9    4e-16   Streptomyces
ref|XP_009103340.1|  PREDICTED: 4-coumarate--CoA ligase-like 4        85.9    4e-16   Brassica rapa
emb|CDX87831.1|  BnaC06g08930D                                        85.9    5e-16   
emb|CDY01370.1|  BnaA07g11430D                                        85.9    5e-16   
ref|WP_036339353.1|  AMP-dependent synthetase                         85.9    5e-16   Modestobacter caceresii
ref|XP_011099557.1|  PREDICTED: 4-coumarate--CoA ligase-like 5        85.9    5e-16   Sesamum indicum [beniseed]
ref|XP_009064023.1|  hypothetical protein LOTGIDRAFT_221356           85.5    5e-16   
emb|CDX96633.1|  BnaA08g21760D                                        85.5    5e-16   
gb|KFK35830.1|  hypothetical protein AALP_AA4G042700                  85.5    6e-16   
emb|CDX78914.1|  BnaA01g09810D                                        85.5    7e-16   
emb|CDY31474.1|  BnaC05g15830D                                        85.5    7e-16   
gb|AHJ60263.1|  4-coumarate-CoA ligase                                85.5    7e-16   
ref|XP_004973586.1|  PREDICTED: probable 4-coumarate--CoA ligase ...  85.5    7e-16   
ref|NP_849793.1|  4-coumarate--CoA ligase 1                           85.1    7e-16   
ref|XP_009334566.1|  PREDICTED: 4-coumarate--CoA ligase 2-like        85.5    7e-16   
tpg|DAA43424.1|  TPA: putative AMP-dependent synthetase and ligas...  80.9    7e-16   
gb|EPB87312.1|  hypothetical protein HMPREF1544_05933                 85.1    7e-16   
gb|AAD47192.1|AF106085_1  4-coumarate:CoA ligase 2                    85.1    8e-16   
ref|WP_030888372.1|  AMP-dependent synthetase                         85.1    9e-16   
emb|CAP08794.1|  4-cumarate-COA-ligase                                85.1    9e-16   
ref|NP_001077697.1|  4-coumarate--CoA ligase 1                        85.1    9e-16   
ref|NP_188761.1|  4-coumarate--CoA ligase 2                           85.1    9e-16   
emb|CAP08799.1|  4-cumarate-COA-ligase                                85.1    9e-16   
dbj|BAC42032.1|  putative 4-coumarate-CoA ligase                      85.1    9e-16   
emb|CAP09661.1|  cinnamyl alcohol dehydrogenase                       85.1    9e-16   
emb|CAP09663.1|  cinnamyl alcohol dehydrogenase                       85.1    9e-16   
emb|CAP09662.1|  cinnamyl alcohol dehydrogenase                       85.1    9e-16   
ref|XP_002991506.1|  hypothetical protein SELMODRAFT_429785           84.7    9e-16   
gb|KFK44163.1|  hypothetical protein AALP_AA1G223000                  84.7    9e-16   
emb|CAP08802.1|  4-cumarate-COA-ligase                                85.1    9e-16   
emb|CAP08791.1|  4-cumarate-COA-ligase                                85.1    9e-16   
ref|XP_010235187.1|  PREDICTED: probable 4-coumarate--CoA ligase 5    85.1    1e-15   
ref|NP_175579.1|  4-coumarate--CoA ligase 1                           85.1    1e-15   
emb|CAP09667.1|  cinnamyl alcohol dehydrogenase                       85.1    1e-15   
emb|CAP09657.1|  cinnamyl alcohol dehydrogenase                       85.1    1e-15   
emb|CAP08784.1|  4-cumarate-COA-ligase                                85.1    1e-15   
ref|XP_010905239.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...  84.7    1e-15   
ref|XP_009132455.1|  PREDICTED: 4-coumarate--CoA ligase-like 6 is...  84.7    1e-15   
gb|KCW80925.1|  hypothetical protein EUGRSUZ_C02284                   84.0    1e-15   
emb|CAP08789.1|  4-cumarate-COA-ligase                                84.7    1e-15   
ref|XP_009144890.1|  PREDICTED: 4-coumarate--CoA ligase 1             84.7    1e-15   
gb|KHG07976.1|  4-coumarate--CoA ligase-like 6                        84.7    1e-15   
gb|KEH32559.1|  4-coumarate:CoA ligase-like protein                   84.7    1e-15   
ref|XP_010488114.1|  PREDICTED: 4-coumarate--CoA ligase 4             84.7    1e-15   
gb|ERN15571.1|  hypothetical protein AMTR_s00048p00141400             84.7    1e-15   
gb|ACY66928.1|  4-coumarate:CoA ligase                                84.7    1e-15   
emb|CAP09672.1|  cinnamyl alcohol dehydrogenase                       84.7    1e-15   
gb|KJB70020.1|  hypothetical protein B456_011G053700                  84.3    1e-15   
ref|XP_009110224.1|  PREDICTED: 4-coumarate--CoA ligase-like 5        84.7    1e-15   
ref|XP_007010053.1|  Acyl:coa ligase                                  84.7    1e-15   
emb|CEP07992.1|  hypothetical protein                                 84.3    1e-15   
ref|XP_010509953.1|  PREDICTED: 4-coumarate--CoA ligase 4-like        84.3    1e-15   
ref|XP_010539807.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...  84.3    1e-15   
emb|CDY33631.1|  BnaC08g19310D                                        84.3    2e-15   
tpg|DAA48843.1|  TPA: putative AMP-dependent synthetase and ligas...  83.6    2e-15   
ref|NP_001130893.1|  putative AMP-dependent synthetase and ligase...  83.6    2e-15   
ref|WP_030427261.1|  AMP-dependent synthetase                         84.3    2e-15   
ref|XP_010539806.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...  84.3    2e-15   
ref|XP_003545004.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like   84.3    2e-15   
gb|KJB70019.1|  hypothetical protein B456_011G053700                  84.3    2e-15   
ref|XP_008461218.1|  PREDICTED: 4-coumarate--CoA ligase 2-like        84.3    2e-15   
ref|XP_002870867.1|  hypothetical protein ARALYDRAFT_494165           84.3    2e-15   
ref|WP_031037030.1|  AMP-dependent synthetase                         84.0    2e-15   
ref|XP_011627004.1|  PREDICTED: 4-coumarate--CoA ligase-like 6        84.3    2e-15   
ref|XP_009110225.1|  PREDICTED: 4-coumarate--CoA ligase-like 8        84.3    2e-15   
ref|XP_010449426.1|  PREDICTED: 4-coumarate--CoA ligase-like 6        84.3    2e-15   
ref|XP_010048612.1|  PREDICTED: 4-coumarate--CoA ligase 2-like        84.0    2e-15   
gb|KJB21189.1|  hypothetical protein B456_003G186800                  84.0    2e-15   
gb|AGO89325.1|  Ca4CL8                                                84.0    2e-15   
dbj|GAN01228.1|  phenylacetyl-CoA ligase                              84.0    2e-15   
ref|XP_010459729.1|  PREDICTED: 4-coumarate--CoA ligase-like 2        84.0    2e-15   
gb|KFK44161.1|  hypothetical protein AALP_AA1G222800                  84.0    2e-15   
ref|XP_003610843.1|  4-coumarate CoA ligase                           84.0    2e-15   
ref|XP_009132447.1|  PREDICTED: 4-coumarate--CoA ligase-like 6 is...  84.0    2e-15   
ref|XP_003550658.1|  PREDICTED: 4-coumarate--CoA ligase 2-like        84.0    2e-15   
ref|XP_007024802.1|  4-coumarate:CoA ligase 2 isoform 1               83.6    2e-15   
emb|CBI31386.3|  unnamed protein product                              83.2    3e-15   
gb|KFK44162.1|  hypothetical protein AALP_AA1G222900                  83.6    3e-15   
ref|WP_030399323.1|  MULTISPECIES: AMP-dependent synthetase           83.6    3e-15   
ref|WP_026847223.1|  AMP-dependent synthetase                         83.6    3e-15   
ref|XP_006416390.1|  hypothetical protein EUTSA_v10007270mg           83.6    3e-15   
gb|AJK93382.1|  4-coumarate:coenzyme A ligase                         83.6    3e-15   
ref|XP_010692849.1|  PREDICTED: 4-coumarate--CoA ligase-like 5        83.6    3e-15   
gb|EIE78540.1|  hypothetical protein RO3G_03244                       83.6    3e-15   
ref|XP_006297366.1|  hypothetical protein CARUB_v10013386mg           83.6    3e-15   
ref|XP_007222242.1|  hypothetical protein PRUPE_ppa003854mg           83.6    3e-15   
emb|CDH48664.1|  amp-dependent synthetase ligase                      83.6    3e-15   
ref|XP_009145502.1|  PREDICTED: 4-coumarate--CoA ligase 2             83.6    3e-15   
ref|WP_014066333.1|  AMP-dependent synthetase                         83.2    3e-15   
emb|CEJ90162.1|  hypothetical protein VHEMI05963                      83.6    3e-15   
ref|XP_002739084.1|  PREDICTED: 4-coumarate--CoA ligase 1-like is...  83.6    3e-15   
emb|CDY19568.1|  BnaA05g19760D                                        83.2    3e-15   
ref|XP_010488122.1|  PREDICTED: 4-coumarate--CoA ligase 2 isoform X1  83.2    3e-15   
ref|WP_028931208.1|  hypothetical protein                             83.2    4e-15   
ref|XP_002271586.3|  PREDICTED: 4-coumarate--CoA ligase-like 5        83.2    4e-15   
dbj|GAN02557.1|  4-coumarate- ligase protein                          83.2    4e-15   
ref|XP_006283429.1|  hypothetical protein CARUB_v10004477mg           83.2    4e-15   
emb|CDY31472.1|  BnaC05g15810D                                        83.2    4e-15   
ref|XP_004309949.1|  PREDICTED: 4-coumarate--CoA ligase 2-like        83.2    4e-15   
ref|XP_009613176.1|  PREDICTED: 4-coumarate--CoA ligase-like 5        83.2    4e-15   
ref|WP_004930069.1|  AMP-dependent synthetase                         83.2    4e-15   
gb|EYU32443.1|  hypothetical protein MIMGU_mgv1a019706mg              83.2    4e-15   
ref|XP_010242836.1|  PREDICTED: 4-coumarate--CoA ligase-like 5        83.2    4e-15   
ref|XP_007029575.1|  4-coumarate:CoA ligase 3                         83.2    4e-15   
ref|XP_002970786.1|  hypothetical protein SELMODRAFT_231716           82.8    4e-15   
ref|XP_010440913.1|  PREDICTED: 4-coumarate--CoA ligase-like 8        82.8    4e-15   
ref|XP_010498480.1|  PREDICTED: 4-coumarate--CoA ligase-like 8 is...  83.2    5e-15   
ref|XP_010498479.1|  PREDICTED: 4-coumarate--CoA ligase-like 8 is...  83.2    5e-15   
gb|KFK39430.1|  hypothetical protein AALP_AA3G243900                  82.8    5e-15   
gb|KHG00008.1|  4-coumarate--CoA ligase 1                             82.8    5e-15   
ref|NP_173472.1|  AMP-dependent synthetase and ligase family protein  82.8    5e-15   
gb|AGE10609.1|  4-coumarate CoA ligase                                80.5    5e-15   
ref|XP_008777804.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...  82.8    5e-15   
ref|XP_010498481.1|  PREDICTED: 4-coumarate--CoA ligase-like 8 is...  82.8    6e-15   
emb|CAP09677.1|  cinnamyl alcohol dehydrogenase                       82.8    6e-15   
emb|CCO36972.1|  4-coumarate--CoA ligase-like 7                       79.7    6e-15   
ref|XP_006352919.1|  PREDICTED: 4-coumarate--CoA ligase-like 6-like   82.8    6e-15   
ref|WP_030835346.1|  AMP-dependent synthetase                         82.4    6e-15   
emb|CEP19440.1|  hypothetical protein                                 82.4    6e-15   
ref|XP_010488123.1|  PREDICTED: 4-coumarate--CoA ligase 2 isoform X2  82.4    6e-15   
ref|XP_007040775.1|  Acyl:coa ligase                                  82.4    6e-15   
ref|XP_006366955.1|  PREDICTED: 4-coumarate--CoA ligase 2-like        82.8    6e-15   
ref|XP_003550660.1|  PREDICTED: 4-coumarate--CoA ligase 2-like        82.4    6e-15   
gb|KJB74784.1|  hypothetical protein B456_012G007500                  82.4    6e-15   
emb|CDY06436.1|  BnaC05g30940D                                        79.3    7e-15   
ref|NP_849844.1|  4-coumarate--CoA ligase 3                           82.4    7e-15   
ref|WP_010985295.1|  AMP-dependent synthetase                         82.4    7e-15   
ref|XP_007160602.1|  hypothetical protein PHAVU_001G001300g           82.4    7e-15   
ref|WP_026850267.1|  hypothetical protein                             82.4    7e-15   
gb|KEH40260.1|  4-coumarate-CoA ligase-like protein                   81.6    7e-15   
ref|XP_010509987.1|  PREDICTED: 4-coumarate--CoA ligase 2-like        82.4    7e-15   
gb|KEZ44641.1|  hypothetical protein SAPIO_CDS3684                    82.4    7e-15   
gb|KEH40262.1|  4-coumarate-CoA ligase-like protein                   81.6    7e-15   
ref|XP_002445590.1|  hypothetical protein SORBIDRAFT_07g022040        82.4    7e-15   
ref|XP_007154776.1|  hypothetical protein PHAVU_003G146900g           82.4    7e-15   
emb|CDY33627.1|  BnaC08g19270D                                        82.4    7e-15   
ref|XP_007199256.1|  hypothetical protein PRUPE_ppa022562mg           82.4    8e-15   
ref|XP_003637266.1|  4-coumarate CoA ligase                           82.4    8e-15   
ref|XP_003612659.1|  4-coumarate-CoA ligase                           82.4    8e-15   
ref|WP_006134250.1|  MULTISPECIES: 4-coumarate:CoA ligase             82.0    8e-15   
ref|WP_031021572.1|  AMP-dependent synthetase                         82.0    8e-15   
gb|AAP03016.1|  4-coumarate-CoA ligase-like protein                   82.0    9e-15   
ref|XP_009347855.1|  PREDICTED: 4-coumarate--CoA ligase 2-like        82.0    9e-15   
emb|CDO99816.1|  unnamed protein product                              81.6    9e-15   
gb|AGW47868.1|  4-coumarate:coenzyme A ligase 3                       82.0    9e-15   
emb|CDS03397.1|  hypothetical protein LRAMOSA00799                    82.0    9e-15   
ref|WP_033276522.1|  AMP-dependent synthetase                         82.0    9e-15   
ref|XP_007154777.1|  hypothetical protein PHAVU_003G147000g           82.0    1e-14   
ref|XP_002893113.1|  F5M15.18                                         82.8    1e-14   
ref|XP_002888305.1|  4-coumarate:CoA ligase 3                         82.0    1e-14   
ref|WP_025361529.1|  AMP-dependent synthetase                         82.0    1e-14   
ref|NP_176686.1|  4-coumarate--CoA ligase 3                           82.0    1e-14   
gb|KFK44167.1|  hypothetical protein AALP_AA1G223400                  82.0    1e-14   
gb|ELU40892.1|  AMP binding protein                                   81.6    1e-14   
ref|XP_004242790.1|  PREDICTED: 4-coumarate--CoA ligase 2             82.0    1e-14   
ref|XP_006297290.1|  hypothetical protein CARUB_v10013305mg           82.0    1e-14   
ref|XP_004486593.1|  PREDICTED: 4-coumarate--CoA ligase-like          82.0    1e-14   
gb|AGO50638.1|  4-coumarate-CoA ligase                                81.6    1e-14   
gb|ABY60843.1|  4-coumarate CoA ligase 2                              81.6    1e-14   
ref|XP_009382607.1|  PREDICTED: 4-coumarate--CoA ligase-like 6        81.6    1e-14   
gb|ABY81911.1|  4-coumarate:CoA ligase 2                              81.6    1e-14   
gb|AGA17918.1|  CCL1                                                  81.6    1e-14   
dbj|BAJ17664.1|  4-coumarate:CoA ligase                               81.6    1e-14   
gb|EAZ05563.1|  hypothetical protein OsI_27777                        81.6    1e-14   
gb|AID56318.1|  4-coumarate coenzyme A ligase 5                       81.6    1e-14   
ref|WP_026857963.1|  AMP-dependent synthetase                         81.6    1e-14   
ref|XP_012067426.1|  PREDICTED: 4-coumarate--CoA ligase 1-like        81.6    1e-14   
ref|XP_011034909.1|  PREDICTED: 4-coumarate--CoA ligase-like 5        81.6    1e-14   
ref|XP_009413046.1|  PREDICTED: 4-coumarate--CoA ligase-like 4        81.6    1e-14   
ref|XP_002300662.2|  4-coumarate--CoA ligase family protein           81.3    1e-14   
ref|WP_037873133.1|  AMP-dependent synthetase                         81.3    1e-14   
ref|XP_010110729.1|  4-coumarate--CoA ligase 1                        80.5    1e-14   
ref|XP_009149527.1|  PREDICTED: 4-coumarate--CoA ligase-like 2        81.3    1e-14   
emb|CEG63885.1|  hypothetical protein RMATCC62417_00959               81.3    2e-14   
gb|KHG23973.1|  4-coumarate--CoA ligase-like 7                        81.3    2e-14   
ref|XP_010943943.1|  PREDICTED: 4-coumarate--CoA ligase-like 4        81.3    2e-14   
ref|XP_009798281.1|  PREDICTED: 4-coumarate--CoA ligase 2-like        81.3    2e-14   
emb|CEG78105.1|  hypothetical protein RMATCC62417_12758               81.3    2e-14   
gb|KFK39428.1|  hypothetical protein AALP_AA3G243700                  81.3    2e-14   
dbj|BAA08366.2|  4-coumarate:CoA ligase                               81.3    2e-14   
emb|CDY01369.1|  BnaA07g11420D                                        81.3    2e-14   
ref|XP_009103339.1|  PREDICTED: 4-coumarate--CoA ligase-like 4        81.3    2e-14   
ref|WP_043501843.1|  AMP-dependent synthetase                         81.3    2e-14   
gb|AGW24660.1|  4-coumarate:coenzyme A ligase                         81.3    2e-14   
gb|AGE10621.1|  4-coumarate CoA ligase                                79.3    2e-14   
ref|XP_004982559.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like   81.3    2e-14   
ref|NP_001175376.1|  Os08g0143300                                     81.3    2e-14   
gb|AIR95613.1|  4-coumarate:CoA ligase 4                              81.3    2e-14   
gb|AGO89319.1|  Ca4CL2                                                80.9    2e-14   
ref|XP_006366277.1|  PREDICTED: 4-coumarate--CoA ligase 2-like        81.3    2e-14   
gb|AFL93685.1|  4-coumarate: coenzyme A ligase                        80.9    2e-14   
ref|XP_007222465.1|  hypothetical protein PRUPE_ppa003506mg           81.3    2e-14   
sp|P14912.1|4CL1_PETCR  RecName: Full=4-coumarate--CoA ligase 1; ...  80.9    2e-14   
gb|KEH40252.1|  acyl:CoA ligase                                       80.9    2e-14   
ref|XP_010092099.1|  4-coumarate--CoA ligase 1                        80.9    2e-14   
ref|XP_011670903.1|  PREDICTED: 4-coumarate--CoA ligase isoform X4    80.5    2e-14   
ref|XP_011628973.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...  80.5    2e-14   
emb|CAP09676.1|  cinnamyl alcohol dehydrogenase                       80.9    2e-14   
ref|XP_002510640.1|  AMP dependent CoA ligase, putative               80.9    2e-14   
ref|XP_010259828.1|  PREDICTED: 4-coumarate--CoA ligase 2-like        80.9    2e-14   
ref|XP_011670902.1|  PREDICTED: 4-coumarate--CoA ligase 1 isoform X3  80.5    2e-14   
ref|XP_011670901.1|  PREDICTED: 4-coumarate--CoA ligase 1 isoform X2  80.5    2e-14   
ref|WP_029340586.1|  AMP-dependent synthetase                         80.9    2e-14   
ref|WP_014738382.1|  AMP-dependent synthetase                         80.9    2e-14   
ref|XP_786981.3|  PREDICTED: 4-coumarate--CoA ligase 1 isoform X1     80.5    3e-14   
ref|XP_006435318.1|  hypothetical protein CICLE_v10000764mg           80.9    3e-14   
ref|XP_006473755.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like   80.5    3e-14   
ref|XP_004292919.2|  PREDICTED: 4-coumarate--CoA ligase-like 5        80.9    3e-14   
ref|XP_010063109.1|  PREDICTED: 4-coumarate--CoA ligase-like 5        80.5    3e-14   
ref|XP_011628972.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...  80.5    3e-14   
gb|ERM96395.1|  hypothetical protein AMTR_s00001p00239750             80.5    3e-14   
ref|XP_006342547.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like   80.5    3e-14   
ref|XP_007203932.1|  hypothetical protein PRUPE_ppa017093mg           80.5    3e-14   
ref|XP_002464864.1|  hypothetical protein SORBIDRAFT_01g027820        80.5    3e-14   
gb|KHG05801.1|  4-coumarate--CoA ligase 1                             80.5    3e-14   
emb|CDY07442.1|  BnaA07g25210D                                        80.5    3e-14   
ref|XP_009105144.1|  PREDICTED: 4-coumarate--CoA ligase 3             80.5    4e-14   
gb|ERN12890.1|  hypothetical protein AMTR_s00050p00171700             80.1    4e-14   
ref|XP_002979073.1|  4-coumarate:CoA ligase                           80.5    4e-14   
ref|XP_011082754.1|  PREDICTED: 4-coumarate--CoA ligase 1-like is...  80.1    4e-14   
ref|XP_002986545.1|  4-coumarate:CoA ligase                           80.1    4e-14   
ref|XP_002533186.1|  AMP dependent CoA ligase, putative               80.5    4e-14   
ref|WP_018330748.1|  hypothetical protein                             80.1    4e-14   
ref|XP_011082745.1|  PREDICTED: 4-coumarate--CoA ligase 2-like is...  80.1    4e-14   
emb|CDY31883.1|  BnaC07g15330D                                        80.1    4e-14   
gb|AIT52344.1|  deep purple 4-hydroxylase 1                           80.1    4e-14   
ref|XP_006851309.2|  PREDICTED: 4-coumarate--CoA ligase 1             80.1    4e-14   



>ref|XP_009786809.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Nicotiana sylvestris]
Length=538

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+ LP+D NLSMVSFLFRNIS +P++PA+ D D+G+TLTFSQ 
Sbjct  1    MEKSGYGRDGIYRSLRPPLFLPKDQNLSMVSFLFRNISSFPEKPALFDGDSGQTLTFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            K+ VS+++HGL HQ G++KNDVVLIF+PNSI FPLCF G IA GAIATTVNPMYTV ELS
Sbjct  61   KTIVSKISHGLIHQFGIKKNDVVLIFAPNSIQFPLCFFGVIALGAIATTVNPMYTVSELS  120

Query  494  KQIKDCSPKLIVTVPQLLDKV  556
            KQIKDC PKLI+TVP+LLDK+
Sbjct  121  KQIKDCKPKLIITVPELLDKI  141



>ref|XP_009603383.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Nicotiana tomentosiformis]
Length=538

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+ LP+D NLSMVSFLFRNIS +P++PA+ DAD+G+TLTFSQ 
Sbjct  1    MEKSGYGRDGIYRSLRPPLFLPKDQNLSMVSFLFRNISSFPEKPALFDADSGQTLTFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            K+ VS+++HGL HQ G++KNDVVLIF+PNSI FPLCF G IA GAIATTVNPMYT+ ELS
Sbjct  61   KTIVSKISHGLIHQFGIKKNDVVLIFAPNSIQFPLCFFGVIALGAIATTVNPMYTISELS  120

Query  494  KQIKDCSPKLIVTVPQLLDKV  556
            KQIKDC PKLI++VP+LLDK+
Sbjct  121  KQIKDCKPKLIISVPELLDKI  141



>ref|XP_006340129.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Solanum tuberosum]
Length=541

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+  P+D NLSMVSFLFRN S YP++PA  DAD G TL+FSQ 
Sbjct  1    MEKSGYGRDGIYRSLRPPLFYPKDENLSMVSFLFRNSSSYPEKPAFFDADNGETLSFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS VSR++HGL HQ+G++KNDVVLIF+PNS+ FPL F G IA GAIATTVNPMYTV ELS
Sbjct  61   KSMVSRISHGLIHQMGIKKNDVVLIFAPNSVQFPLSFFGVIAIGAIATTVNPMYTVSELS  120

Query  494  KQIKDCSPKLIVTVPQLLDKV  556
            KQIKDC PKLI+T P+L DKV
Sbjct  121  KQIKDCKPKLIITSPELFDKV  141



>ref|XP_004251107.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Solanum lycopersicum]
Length=538

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDG+YRSLRPP+  P+D NLSMVSFLFR IS YP++PA  DAD G TL+FSQ 
Sbjct  1    MEKSGYGRDGVYRSLRPPVFYPKDENLSMVSFLFRKISSYPEKPAFFDADNGGTLSFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS VSR++HGL HQ+G++KNDVVLIF+PNS+ FPL F G IA GAIATTVNPMYTV ELS
Sbjct  61   KSMVSRISHGLIHQMGIKKNDVVLIFAPNSVQFPLSFFGVIAIGAIATTVNPMYTVAELS  120

Query  494  KQIKDCSPKLIVTVPQLLDKV  556
            KQIKDC P LI+T P+L DKV
Sbjct  121  KQIKDCKPSLIITSPELFDKV  141



>ref|XP_010111818.1| 4-coumarate--CoA ligase-like 7 [Morus notabilis]
 gb|EXC31783.1| 4-coumarate--CoA ligase-like 7 [Morus notabilis]
Length=665

 Score =   204 bits (518),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+VLP+DPNLS VSFLFRN S YP++PA+ DAD+G  L+FSQL
Sbjct  1    MEKSGYGRDGIFRSLRPPLVLPKDPNLSAVSFLFRNSSSYPNKPALIDADSGEILSFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V++V+HG  H LG++KNDVVLIF+PNSI FP+CFLG IA GAIATT NP+YTV ELS
Sbjct  61   KSTVAKVSHGFLH-LGIKKNDVVLIFAPNSIHFPVCFLGIIAIGAIATTSNPLYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKLI+TVP+L +KVK
Sbjct  120  KQVKDSNPKLIITVPELWEKVK  141



>ref|XP_004291645.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Fragaria vesca subsp. 
vesca]
Length=543

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDG++RSLRPP+VLPRDPN +MVSFLF N S YP++PA+ DA++  TL+FSQL
Sbjct  1    MEKSGYGRDGVFRSLRPPLVLPRDPNFTMVSFLFNNSSSYPNKPALIDAESSETLSFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +VAHGL H LGV+KNDVVLIF+PNSI FP+CFLG IA GAIATT NP+YTV ELS
Sbjct  61   KSMVIKVAHGLVH-LGVKKNDVVLIFAPNSIQFPVCFLGIIAIGAIATTSNPLYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKL++TVP+L +KVK
Sbjct  120  KQVKDSNPKLVITVPELWEKVK  141



>ref|XP_008226338.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Prunus mume]
Length=532

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+VLPRDPNLSMVSFLFRN S Y ++PA+ DA++  TL+FSQ 
Sbjct  1    MEKSGYGRDGIFRSLRPPLVLPRDPNLSMVSFLFRNSSSYSNKPALIDAESSETLSFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +V+HGL H LG++KNDVVLIF+PNSI FP+CFLG  A+GAIATT NP+YTV ELS
Sbjct  61   KSLVIKVSHGLLH-LGIKKNDVVLIFAPNSIQFPICFLGITASGAIATTSNPLYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKL++TVP+L +KVK
Sbjct  120  KQVKDSNPKLVITVPELFEKVK  141



>gb|AHL44983.1| 4-coumarate:coenzyme A ligase 4 [Fraxinus mandshurica]
Length=543

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP++LP+DPNLSMVSFLFRNIS +PD+PA+ D +TG+TLTF + 
Sbjct  1    MEKSGYGRDGIYRSLRPPLILPKDPNLSMVSFLFRNISSFPDKPALVDFNTGQTLTFIEF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS VS+V++GL  QLG++K DVVLI+SPNSI FP+CF G I  GAIATTVNPMYT+ ELS
Sbjct  61   KSVVSKVSYGL-LQLGIKKKDVVLIYSPNSIQFPICFFGIIGIGAIATTVNPMYTISELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ++DC PK+I+TV +LL KVK
Sbjct  120  KQVQDCKPKVIITVQELLPKVK  141



>ref|XP_010422413.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Camelina sativa]
Length=543

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPN S+VSFLFRN S YP + A+ D+DTG +LTFSQL
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPKDPNTSLVSFLFRNSSSYPSKLALADSDTGESLTFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V+R+AHG  H+LGVRKNDVVLIF+PNS  FPLCFL   A G + TT NP+YTV E+S
Sbjct  61   KSAVARLAHGF-HRLGVRKNDVVLIFAPNSYQFPLCFLAVTAIGGVFTTANPLYTVNEVS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PK+I++V QL DKVK
Sbjct  120  KQVKDSNPKIIISVNQLFDKVK  141



>ref|XP_007016850.1| AMP-dependent synthetase and ligase family protein isoform 2, 
partial [Theobroma cacao]
 gb|EOY34469.1| AMP-dependent synthetase and ligase family protein isoform 2, 
partial [Theobroma cacao]
Length=422

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+VLP+DPNLSMVSFLFRN+S YPD+PA+ DADT  TL+FSQ 
Sbjct  13   MEKSGYGRDGIFRSLRPPLVLPKDPNLSMVSFLFRNVSSYPDKPALIDADTEETLSFSQF  72

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +++H   + LG+ KND VLIF+PNSI +PLCF    A GAIATT NP+YTV ELS
Sbjct  73   KSAVIKLSHAFLN-LGISKNDRVLIFAPNSIQYPLCFFAVTAIGAIATTANPIYTVNELS  131

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD  PKL+VTVP+L DKVK
Sbjct  132  KQIKDSIPKLVVTVPELFDKVK  153



>ref|XP_006488032.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Citrus sinensis]
Length=545

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+VLP +PNLSMV FLFRN + YP +PA+ DAD+G +LTFSQL
Sbjct  1    MEKSGYGRDGIYRSLRPPLVLPSEPNLSMVHFLFRNSASYPSKPALIDADSGESLTFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V + +HG +H LG+ KNDVV+IF+PNSI FP+CFLG IA GAIATT NP+Y+V ELS
Sbjct  61   KSTVIKASHGFRH-LGITKNDVVMIFAPNSIQFPVCFLGVIATGAIATTANPVYSVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+ D +PKLIVTVP+L DKVK
Sbjct  120  KQVIDSNPKLIVTVPELWDKVK  141



>ref|NP_192425.1| 4-coumarate--CoA ligase-like 7 [Arabidopsis thaliana]
 sp|Q9M0X9.1|4CLL7_ARATH RecName: Full=4-coumarate--CoA ligase-like 7; AltName: Full=4-coumarate--CoA 
ligase isoform 6; Short=At4CL6 [Arabidopsis 
thaliana]
 emb|CAB81058.1| 4-coumarate--CoA ligase-like protein [Arabidopsis thaliana]
 gb|AAM13899.1| putative 4-coumarate--CoA ligase [Arabidopsis thaliana]
 gb|AAM67483.1| putative 4-coumarate--CoA ligase [Arabidopsis thaliana]
 gb|AAP03022.1| 4-coumarate-CoA ligase-like protein [Arabidopsis thaliana]
 gb|AEE82486.1| 4-coumarate--CoA ligase-like 7 [Arabidopsis thaliana]
Length=544

 Score =   198 bits (504),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPN S+VSFLFRN S YP + AI D+DTG +LTFSQL
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPKDPNTSLVSFLFRNSSSYPSKLAIADSDTGDSLTFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V+R+AHG  H+LG+RKNDVVLIF+PNS  FPLCFL   A G + TT NP+YTV E+S
Sbjct  61   KSAVARLAHGF-HRLGIRKNDVVLIFAPNSYQFPLCFLAVTAIGGVFTTANPLYTVNEVS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PK+I++V QL DK+K
Sbjct  120  KQIKDSNPKIIISVNQLFDKIK  141



>ref|XP_006424490.1| hypothetical protein CICLE_v10028138mg [Citrus clementina]
 gb|ESR37730.1| hypothetical protein CICLE_v10028138mg [Citrus clementina]
Length=545

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 120/142 (85%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+VLP +PNLSMV FLFRN + YP +PA+ DAD+G +LTFSQL
Sbjct  1    MEKSGYGRDGIYRSLRPPLVLPSEPNLSMVHFLFRNSASYPSKPALIDADSGESLTFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V + +HG +H LG+ KNDVV+IF+PNS  FP+CFLG IA GAIATT NP+Y+V ELS
Sbjct  61   KSTVIKASHGFRH-LGITKNDVVMIFAPNSTQFPVCFLGVIATGAIATTANPVYSVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+ D +PKLIVTVP+L DKVK
Sbjct  120  KQVIDSNPKLIVTVPELWDKVK  141



>ref|XP_010455853.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Camelina sativa]
Length=543

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPN S+VSFLFRN S YP + A+ D+DTG TLTFSQL
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPKDPNTSLVSFLFRNSSSYPSKLALADSDTGETLTFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V+R+AHG + +LGVRKNDV+LIF+PNS  FPLCFL   A G + TT NP+YTV E+S
Sbjct  61   KSAVARLAHGFQ-RLGVRKNDVLLIFAPNSYQFPLCFLAVTAIGGVFTTANPLYTVNEVS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PK+I++V QL DKVK
Sbjct  120  KQVKDSNPKMIISVNQLFDKVK  141



>ref|XP_010538202.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Tarenaya hassleriana]
Length=546

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+VLP+DPNLS+VSFLFR+ S YP +PA+ DAD+G +L+FSQL
Sbjct  1    MEKSGYGRDGIFRSLRPPLVLPKDPNLSLVSFLFRDSSSYPMKPALIDADSGESLSFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V+R+AHG   +LG+ KNDVVLIF+PNS  FPLCF    A G +ATT NP+YTV ELS
Sbjct  61   KSTVARLAHGF-LRLGIHKNDVVLIFAPNSFQFPLCFFAVTAIGGVATTANPLYTVEELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD  PK+IV+V QLLDK+K
Sbjct  120  KQIKDSKPKIIVSVHQLLDKIK  141



>ref|XP_010431672.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Camelina sativa]
Length=542

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPN S+VSFLFRN S YP + A+ D+DTG +LTFSQL
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPKDPNTSLVSFLFRNSSSYPSKLALADSDTGESLTFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V+R+AHG  H+LGVRK DVVLIF+PNS  FPLCFL   A G + TT NP+YTV E+S
Sbjct  61   KSAVARLAHGF-HRLGVRKTDVVLIFAPNSYQFPLCFLAVTAIGGVFTTANPLYTVNEVS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PK+I++V QL DKVK
Sbjct  120  KQVKDSNPKIIISVIQLFDKVK  141



>ref|XP_009345749.1| PREDICTED: 4-coumarate--CoA ligase-like 7, partial [Pyrus x bretschneideri]
Length=402

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+VLPRDPNLSM SFLFRN S Y  +PA+ + ++  TL+FSQ 
Sbjct  1    MEKSGYGRDGIFRSLRPPLVLPRDPNLSMASFLFRNSSSYSHKPALIEGESSETLSFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS+V +V+HGL H LG++KNDVVLI +PNSI FP+CFLG IA+G IATT NP+YTV ELS
Sbjct  61   KSKVIQVSHGLIH-LGIKKNDVVLILAPNSIQFPICFLGIIASGGIATTSNPLYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ++D +PKL++T+P+L DKVK
Sbjct  120  KQVRDSNPKLVITLPELWDKVK  141



>ref|XP_007208457.1| hypothetical protein PRUPE_ppa003893mg [Prunus persica]
 gb|EMJ09656.1| hypothetical protein PRUPE_ppa003893mg [Prunus persica]
Length=542

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+VLPRD NLSMVSFLFRN S Y ++PA+ DA++  TL+FSQ 
Sbjct  1    MEKSGYGRDGIFRSLRPPLVLPRDLNLSMVSFLFRNSSSYSNKPALIDAESSETLSFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +V+HGL H LG++KNDVVLIF+PNSI FP+CFLG IA+GAIATT NP+YTV ELS
Sbjct  61   KSLVIKVSHGLLH-LGIKKNDVVLIFAPNSIQFPICFLGIIASGAIATTSNPLYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKL++TVP+L +KVK
Sbjct  120  KQVKDSNPKLVITVPELFEKVK  141



>ref|XP_007016849.1| AMP-dependent synthetase and ligase family protein isoform 1 
[Theobroma cacao]
 gb|EOY34468.1| AMP-dependent synthetase and ligase family protein isoform 1 
[Theobroma cacao]
Length=545

 Score =   196 bits (499),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+VLP+DPNLSMVSFLFRN+S YPD+PA+ DADT  TL+FSQ 
Sbjct  1    MEKSGYGRDGIFRSLRPPLVLPKDPNLSMVSFLFRNVSSYPDKPALIDADTEETLSFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +++H   + LG+ KND VLIF+PNSI +PLCF    A GAIATT NP+YTV ELS
Sbjct  61   KSAVIKLSHAFLN-LGISKNDRVLIFAPNSIQYPLCFFAVTAIGAIATTANPIYTVNELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD  PKL+VTVP+L DKVK
Sbjct  120  KQIKDSIPKLVVTVPELFDKVK  141



>ref|XP_006396625.1| hypothetical protein EUTSA_v10028563mg [Eutrema salsugineum]
 dbj|BAJ33700.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ38078.1| hypothetical protein EUTSA_v10028563mg [Eutrema salsugineum]
Length=543

 Score =   196 bits (498),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPN S+VSFLFRN S YP +PA+ D+D+G TL+FSQL
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPKDPNTSLVSFLFRNTSSYPSKPALVDSDSGDTLSFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS VSR+AHG   +LG+R+NDVVLIF+PNS  FPLCFL   A G + TT NP+YT  E+S
Sbjct  61   KSAVSRLAHGF-LRLGIRQNDVVLIFAPNSYQFPLCFLAVSAIGGVFTTANPLYTTSEIS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PK+I++V QL DK+K
Sbjct  120  KQIKDSNPKIIISVEQLFDKIK  141



>gb|KDO60233.1| hypothetical protein CISIN_1g0436011mg, partial [Citrus sinensis]
Length=340

 Score =   191 bits (485),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPNLSMV FLFRN + Y  + A+ DAD+G +LTFSQ 
Sbjct  1    MEKSGYGRDGIYRSLRPALVLPQDPNLSMVHFLFRNSASYGSKSALIDADSGESLTFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +V+HG +H LGV K+DVVLIF+PNSI FP+C LG IA G IATT NP+YTV ELS
Sbjct  61   KSIVIKVSHGFRH-LGVTKHDVVLIFAPNSIQFPICLLGVIAIGGIATTANPVYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD SPKL+VTVP+L ++VK
Sbjct  120  KQVKDSSPKLVVTVPELWERVK  141



>ref|XP_006396627.1| hypothetical protein EUTSA_v10028562mg [Eutrema salsugineum]
 gb|ESQ38080.1| hypothetical protein EUTSA_v10028562mg [Eutrema salsugineum]
Length=543

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 116/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYG+DGIYRSLRP +VLP+DPN S+VSFLFRN S YP +PA+ D+D+G TL+FSQL
Sbjct  1    MEKSGYGKDGIYRSLRPTLVLPKDPNTSLVSFLFRNTSSYPSKPALVDSDSGDTLSFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS VSR+AHG   +LGVRK+DVVL F+PNS  FPLCFL     G + TTVNP+YTV E S
Sbjct  61   KSAVSRLAHGFI-RLGVRKHDVVLTFAPNSYKFPLCFLAVTGIGGVFTTVNPLYTVSEFS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQI DC+PK+I++V QL DK+K
Sbjct  120  KQINDCNPKIIISVHQLFDKIK  141



>gb|KJB83875.1| hypothetical protein B456_013G269100, partial [Gossypium raimondii]
Length=452

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP++LP++PNLSMVSFLFRNI  YP++PA+ D+D+  TLTFSQ 
Sbjct  39   MEKSGYGRDGIFRSLRPPLLLPKEPNLSMVSFLFRNIGSYPEKPALIDSDSDETLTFSQS  98

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +++HG   +LG+ KND VLIF+PNSI FPLCF    + GAIATT NP+YT+ ELS
Sbjct  99   KSTVIKLSHGF-LKLGINKNDRVLIFAPNSIQFPLCFFAVTSIGAIATTANPIYTINELS  157

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKL+VTVP+L DKVK
Sbjct  158  KQVKDSNPKLVVTVPELFDKVK  179



>ref|XP_010529378.1| PREDICTED: LOW QUALITY PROTEIN: 4-coumarate--CoA ligase-like 
7 [Tarenaya hassleriana]
Length=546

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYG DGI+RSLRPP VLP DPNLS+VSFLFR+ S YP +PA+ D+D+G +LTF+QL
Sbjct  1    MEKSGYGSDGIFRSLRPPFVLPSDPNLSLVSFLFRDSSSYPTKPALIDSDSGESLTFAQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V+R+AHG   +LGVRKNDVVLIF+PNS+ FPLCFL   A G ++TT NP+YTV ELS
Sbjct  61   KSAVARLAHGF-LRLGVRKNDVVLIFAPNSLQFPLCFLALAAIGGVSTTANPLYTVEELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQI D  PK+IV+V QLLDK+K
Sbjct  120  KQIMDSKPKVIVSVHQLLDKIK  141



>gb|ADG46006.1| 4-coumarate coenzyme A ligase [Isatis tinctoria]
Length=543

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPNLS+VSFLFRN S YP +PAI D+D+G +L+FSQL
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPKDPNLSLVSFLFRNSSSYPSKPAIVDSDSGDSLSFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS VSR+A G   +LG+RKNDVVLIF+PNS  FPLCFL   A G + TT NP+YT  E+S
Sbjct  61   KSAVSRLAQGF-LRLGIRKNDVVLIFAPNSYQFPLCFLAVSAIGGVFTTANPLYTTNEVS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PKLIV+V +L DKVK
Sbjct  120  KQIKDSNPKLIVSVERLFDKVK  141



>gb|AGO89328.1| Ca4CL11 [Salix arbutifolia]
Length=543

 Score =   194 bits (492),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPNLSMVSFLFRN   YP +PA+ DAD   TL++S+L
Sbjct  1    MEKSGYGRDGIYRSLRPKLVLPKDPNLSMVSFLFRNSDSYPHKPALIDADLSITLSYSEL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +VAHGL + LGV KNDVVLIF+PNS  FP+CFL  I+ GAIATT NP+YT  ELS
Sbjct  61   KSVVIKVAHGLLN-LGVSKNDVVLIFAPNSYQFPICFLAIISTGAIATTANPLYTTSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD  PKLI+TVP+L DKVK
Sbjct  120  KQIKDSDPKLIITVPELWDKVK  141



>ref|XP_002872738.1| hypothetical protein ARALYDRAFT_490166 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48997.1| hypothetical protein ARALYDRAFT_490166 [Arabidopsis lyrata subsp. 
lyrata]
Length=544

 Score =   194 bits (492),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPN S+VSFLFRN S YP + AI D+D+G +L+FSQL
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPKDPNTSLVSFLFRNSSSYPSKLAIADSDSGDSLSFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V+R+AHG + +LGVRKNDVVLIF+PNS  FPLCFL   A G + TT NP+YTV E+S
Sbjct  61   KSAVARLAHGFQ-RLGVRKNDVVLIFAPNSYQFPLCFLAVTAIGGVFTTANPLYTVNEVS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PK+I++V QL DK+K
Sbjct  120  KQIKDSNPKIIISVNQLFDKIK  141



>gb|AIR95612.1| 4-coumarate:CoA ligase-like protein [Betula pendula]
Length=545

 Score =   193 bits (491),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRS+RPP+VLP+DPNLSMV+FLFRN S YP +PA+ DAD+ +TL+FSQ 
Sbjct  1    MEKSGYGRDGIYRSVRPPLVLPKDPNLSMVTFLFRNSSSYPHKPALIDADSSQTLSFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V+ ++ G    LG+ KNDVVLIF+PNSI FPLCFLG +A GAIATT NP+YTV EL+
Sbjct  61   KSTVATISRGFL-GLGITKNDVVLIFAPNSIQFPLCFLGIVAIGAIATTANPLYTVHELA  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            +Q+KD +PKLI+TVP+L DKVK
Sbjct  120  RQVKDSNPKLIITVPELWDKVK  141



>emb|CDY39153.1| BnaC09g21910D [Brassica napus]
Length=539

 Score =   193 bits (490),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            ME SGYGRDGIYRSLRP +VLP+DPN S+VSFLF N S YP +PA+ D+DTG +L+FSQL
Sbjct  1    MENSGYGRDGIYRSLRPTLVLPKDPNTSLVSFLFGNTSSYPTKPALVDSDTGDSLSFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            K+ VSR+AHGL  +LG+RKNDVV+IF+PNS  FPLCFL   A G + TTVNP YTV E+S
Sbjct  61   KAAVSRLAHGL-LRLGIRKNDVVMIFAPNSHRFPLCFLAVTAIGGVFTTVNPSYTVNEVS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KDC+PK+I +V +LLDKVK
Sbjct  120  KQVKDCNPKIIFSVQELLDKVK  141



>ref|XP_010042863.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Eucalyptus grandis]
Length=357

 Score =   189 bits (479),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP + LPRDP+LSMVSFLFRN + Y D+PA+ +ADT  TLTF+Q 
Sbjct  1    MEKSGYGRDGIYRSLRPSLALPRDPDLSMVSFLFRNSASYADKPALVEADTDETLTFAQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            +S+V ++AHGL   LG+RK DVVLIF+PNSI FPLCF G  + GAIATT NP+YT  ELS
Sbjct  61   ESRVIKLAHGLL-SLGLRKGDVVLIFAPNSIQFPLCFFGVTSIGAIATTANPLYTSFELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKLIVTVP L +KVK
Sbjct  120  KQVKDSNPKLIVTVPGLWEKVK  141



>ref|XP_002523698.1| AMP dependent CoA ligase, putative [Ricinus communis]
 gb|EEF38638.1| AMP dependent CoA ligase, putative [Ricinus communis]
Length=542

 Score =   193 bits (490),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPNLSMVSFLFRN + YP +PA+ DAD  +TL+FSQL
Sbjct  1    MEKSGYGRDGIYRSLRPLLVLPKDPNLSMVSFLFRNCNSYPHKPALIDADLSKTLSFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +V+HGL  +LG+ KNDVVLIF+PNS  FP+CFL   + GAIATT NP+YT  E+S
Sbjct  61   KSIVIKVSHGL-LKLGISKNDVVLIFAPNSYQFPICFLAITSIGAIATTANPLYTTTEIS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PKL++TVP+L +KVK
Sbjct  120  KQIKDSNPKLVITVPELWNKVK  141



>ref|XP_006287440.1| hypothetical protein CARUB_v10000646mg [Capsella rubella]
 gb|EOA20338.1| hypothetical protein CARUB_v10000646mg [Capsella rubella]
Length=544

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 116/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPN S+VSFLFRN S Y  + A+ D+D+G +LTFSQL
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPKDPNTSLVSFLFRNSSSYSSKLALADSDSGESLTFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V+R+AHG  H+LGVRKND VLIF+PNS  FPLCFL   A G + TT NP+YTV E+S
Sbjct  61   KSAVARLAHGF-HRLGVRKNDAVLIFAPNSYQFPLCFLAVTAIGGVFTTANPLYTVNEVS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PK+I++V QL D++K
Sbjct  120  KQIKDSNPKIIISVNQLFDRIK  141



>gb|KJB83876.1| hypothetical protein B456_013G269100, partial [Gossypium raimondii]
Length=520

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP++LP++PNLSMVSFLFRNI  YP++PA+ D+D+  TLTFSQ 
Sbjct  39   MEKSGYGRDGIFRSLRPPLLLPKEPNLSMVSFLFRNIGSYPEKPALIDSDSDETLTFSQS  98

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +++HG   +LG+ KND VLIF+PNSI FPLCF    + GAIATT NP+YT+ ELS
Sbjct  99   KSTVIKLSHGF-LKLGINKNDRVLIFAPNSIQFPLCFFAVTSIGAIATTANPIYTINELS  157

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKL+VTVP+L DKVK
Sbjct  158  KQVKDSNPKLVVTVPELFDKVK  179



>ref|XP_002305282.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa]
 gb|EEE85793.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa]
Length=543

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPNLS+VSFLFRN + YP +PA+ DAD   TL+FS+L
Sbjct  1    MEKSGYGRDGIYRSLRPKLVLPKDPNLSLVSFLFRNSNSYPHKPALIDADLSITLSFSEL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +VAHGL + LG+ KNDVVLIF+PNS  FP+CFL   + GAIATT NP+YT  ELS
Sbjct  61   KSIVIKVAHGLLN-LGISKNDVVLIFAPNSYQFPICFLAITSTGAIATTANPLYTTSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PKLI+TVP+L DKVK
Sbjct  120  KQIKDSNPKLIITVPELWDKVK  141



>ref|XP_009335967.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Pyrus x bretschneideri]
Length=545

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+VLPRDPNLSM SFLFRN S Y  +PA+ + ++  TL+FSQ 
Sbjct  1    MEKSGYGRDGIFRSLRPPLVLPRDPNLSMASFLFRNSSSYSHKPALIEGESSETLSFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS+V +V+HGL H LG++KNDVVLI +PNSI FP+CFLG IA+G IATT NP+YTV ELS
Sbjct  61   KSKVIQVSHGLIH-LGIKKNDVVLILAPNSIQFPICFLGIIASGGIATTSNPLYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ++D +PKL++T+P+L DKVK
Sbjct  120  KQVRDSNPKLVITLPELWDKVK  141



>ref|XP_011089239.1| PREDICTED: LOW QUALITY PROTEIN: 4-coumarate--CoA ligase-like 
7 [Sesamum indicum]
Length=549

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 120/142 (85%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDG+YRSLRPP+ LP+DPNLSMVSFLFRN S + D+PA+ D+ TG+ LTF+Q 
Sbjct  1    MEKSGYGRDGVYRSLRPPLFLPKDPNLSMVSFLFRNASSFADKPALIDSHTGKILTFAQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS VSRV+HGL  QLG++KND+VLI++PNSI +PLCF G +A GA+ATTVNP+YTV ELS
Sbjct  61   KSMVSRVSHGL-LQLGIKKNDIVLIYAPNSIQYPLCFFGIVAIGAVATTVNPIYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ++D   KLI+TV  LL KVK
Sbjct  120  KQVQDSKAKLIITVEDLLPKVK  141



>gb|KJB83874.1| hypothetical protein B456_013G269100, partial [Gossypium raimondii]
Length=583

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP++LP++PNLSMVSFLFRNI  YP++PA+ D+D+  TLTFSQ 
Sbjct  39   MEKSGYGRDGIFRSLRPPLLLPKEPNLSMVSFLFRNIGSYPEKPALIDSDSDETLTFSQS  98

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +++HG   +LG+ KND VLIF+PNSI FPLCF    + GAIATT NP+YT+ ELS
Sbjct  99   KSTVIKLSHGF-LKLGINKNDRVLIFAPNSIQFPLCFFAVTSIGAIATTANPIYTINELS  157

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKL+VTVP+L DKVK
Sbjct  158  KQVKDSNPKLVVTVPELFDKVK  179



>ref|XP_012064724.1| PREDICTED: 4-coumarate--CoA ligase-like 7 isoform X2 [Jatropha 
curcas]
Length=455

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP IV P+DPNLSMVSFLFRN S YP +PA+ DAD   TL+FSQL
Sbjct  1    MEKSGYGRDGIYRSLRPTIVFPKDPNLSMVSFLFRNSSSYPHKPALIDADLSLTLSFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +V+HGL  +LG+ KNDVVLIF+PNS  +P+CFL   + GAIATT NP+YT  E+S
Sbjct  61   KSIVIKVSHGL-LRLGISKNDVVLIFAPNSYHYPICFLAITSIGAIATTANPVYTTTEVS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PKLI+TVP+L +KVK
Sbjct  120  KQIKDSNPKLIITVPELWNKVK  141



>ref|XP_011004441.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Populus euphratica]
Length=543

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPNLS+VSFLFRN + YP +PA+ DAD   TL+FS+L
Sbjct  1    MEKSGYGRDGIYRSLRPKLVLPKDPNLSLVSFLFRNSNSYPHKPALIDADLSITLSFSEL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +VAHGL + LG+ KNDVVLIF+PNS  FP+CFL   + GAIATT NP+YT  ELS
Sbjct  61   KSIVIKVAHGLLN-LGISKNDVVLIFAPNSYQFPICFLAITSTGAIATTANPLYTTSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +P+LI+TVP+L DKVK
Sbjct  120  KQIKDSNPRLIITVPELWDKVK  141



>ref|XP_009356915.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Pyrus x bretschneideri]
Length=545

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSG+GRDGI+RSLRPP+VLPRDPNLSMVSFLFRN S Y  +PA+ D ++  TL+FSQ 
Sbjct  1    MEKSGFGRDGIFRSLRPPLVLPRDPNLSMVSFLFRNSSSYSHKPALIDGESSETLSFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS+V +V+HGL + LG++KNDVVLIF+PNSI FP+C  G IA+GAIATT NP+YTV ELS
Sbjct  61   KSKVIQVSHGLIN-LGIKKNDVVLIFAPNSIQFPICLFGIIASGAIATTSNPLYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ++D +PKL++TVP+L DKVK
Sbjct  120  KQVRDSNPKLVITVPELWDKVK  141



>ref|XP_010267197.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Nelumbo nucifera]
Length=543

 Score =   191 bits (485),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDG+YRSLRPP+V P+DPNLSMVSFLFRN S Y D+ A+ DAD+G  L FSQL
Sbjct  1    MEKSGYGRDGVYRSLRPPVVFPKDPNLSMVSFLFRNSSSYSDKLALVDADSGDALNFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS +++VAHGL  +LG++K DVVLI +PNS+ FP+CFLG +A GAIATTVNP+YT  E++
Sbjct  61   KSTIAKVAHGLV-RLGIKKGDVVLILAPNSVQFPICFLGVVAIGAIATTVNPLYTTAEIA  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+ D  PKL++TVP L DKVK
Sbjct  120  KQVNDSGPKLVITVPPLWDKVK  141



>gb|AGA17924.1| CCL7 [Humulus lupulus]
Length=544

 Score =   191 bits (484),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 122/142 (86%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDG++RSLRPP+VLP+D NLSMVSF+FRN S YP +PA+ D+DT  TL+FSQ 
Sbjct  1    MEKSGYGRDGVFRSLRPPLVLPKDHNLSMVSFVFRNSSSYPQKPALIDSDTNETLSFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +V+HG  + LGV+KNDVVLIF+PNSI  P+CFLG +A+GAIATT NP+YTV ELS
Sbjct  61   KSMVIKVSHGFLN-LGVQKNDVVLIFAPNSIHVPVCFLGIVASGAIATTSNPLYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKLIVTVP+L +KVK
Sbjct  120  KQVKDSNPKLIVTVPELFEKVK  141



>emb|CDY39155.1| BnaC09g21890D [Brassica napus]
Length=542

 Score =   191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQ-YPDQPAIHDADTGRTLTFSQ  310
            MEKSGYGRDGIYRSLRPP+VLP+DPN S+VSFLFRN S  YP +PAI D+D+G +L+FS 
Sbjct  1    MEKSGYGRDGIYRSLRPPLVLPKDPNTSLVSFLFRNSSSSYPSKPAIIDSDSGDSLSFSD  60

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
            LKS V+R+AHG   +LG+R+NDVVLIF+PNS  FPLCFL   A GA+ TT NP+YT  E+
Sbjct  61   LKSSVARLAHGF-LRLGIRQNDVVLIFAPNSYQFPLCFLAVSAIGAVFTTANPLYTTNEV  119

Query  491  SKQIKDCSPKLIVTVPQLLDKVK  559
            SKQIKD +PKLI++V QL DKVK
Sbjct  120  SKQIKDSNPKLIISVEQLFDKVK  142



>ref|XP_008359628.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Malus domestica]
Length=545

 Score =   191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+VLPRDPNLSMVSFLFRN S Y  +PA+ + ++  TL+FSQ 
Sbjct  1    MEKSGYGRDGIFRSLRPPLVLPRDPNLSMVSFLFRNSSSYSHKPALIEGESSETLSFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS+V +V+HGL H LG++KNDVVLI +PNSI FP+CFLG IA+G IATT NP+YTV ELS
Sbjct  61   KSKVIQVSHGLIH-LGIKKNDVVLILAPNSIQFPICFLGIIASGGIATTSNPLYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ++D +PKL++T+ +L DKVK
Sbjct  120  KQVRDSNPKLVITLRELWDKVK  141



>ref|XP_012064722.1| PREDICTED: 4-coumarate--CoA ligase-like 7 isoform X1 [Jatropha 
curcas]
 gb|KDP43987.1| hypothetical protein JCGZ_05454 [Jatropha curcas]
Length=542

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP IV P+DPNLSMVSFLFRN S YP +PA+ DAD   TL+FSQL
Sbjct  1    MEKSGYGRDGIYRSLRPTIVFPKDPNLSMVSFLFRNSSSYPHKPALIDADLSLTLSFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +V+HGL  +LG+ KNDVVLIF+PNS  +P+CFL   + GAIATT NP+YT  E+S
Sbjct  61   KSIVIKVSHGLL-RLGISKNDVVLIFAPNSYHYPICFLAITSIGAIATTANPVYTTTEVS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PKLI+TVP+L +KVK
Sbjct  120  KQIKDSNPKLIITVPELWNKVK  141



>gb|EPS70306.1| hypothetical protein M569_04447, partial [Genlisea aurea]
Length=540

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDG+YRSLRPP+ LP DPNLSMVSFLFRN S Y D+PA+ DA TG  ++FSQ 
Sbjct  1    MEKSGYGRDGVYRSLRPPVSLPEDPNLSMVSFLFRNSSTYSDKPALIDAHTGNVVSFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            ++ V+++A GL  QLGV KNDVVLIFSPNSI+FPL F GA+A GAIA+TVNP YTV ELS
Sbjct  61   ETLVAKLALGLL-QLGVGKNDVVLIFSPNSIEFPLAFFGAVAIGAIASTVNPAYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKDCSPKLI TV  LL KVK
Sbjct  120  KQIKDCSPKLIFTVVDLLPKVK  141



>ref|XP_006488030.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Citrus sinensis]
Length=546

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPNLSMV FLFRN + Y  + A+ DAD+G +LTFSQ 
Sbjct  1    MEKSGYGRDGIYRSLRPALVLPQDPNLSMVHFLFRNSASYGSKSALIDADSGESLTFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +V+HG +H LGV K+DVVLIF+PNSI FP+C LG IA G IATT NP+YTV ELS
Sbjct  61   KSIVIKVSHGFRH-LGVTKHDVVLIFAPNSIQFPICLLGVIAIGGIATTANPVYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD SPKL+VTVP+L ++VK
Sbjct  120  KQVKDSSPKLVVTVPELWERVK  141



>ref|XP_010045319.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Eucalyptus grandis]
Length=544

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP + LPRDP+LSMVSFLFRN + Y D+PA+ +ADT  TLTF+Q 
Sbjct  1    MEKSGYGRDGIYRSLRPSLALPRDPDLSMVSFLFRNSASYADKPALVEADTDETLTFAQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            +S+V ++AHGL   LG+RK DVVLIF+PNSI FPLCF G  + GAIATT NP+YT  ELS
Sbjct  61   ESRVIKLAHGL-LSLGLRKGDVVLIFAPNSIQFPLCFFGVTSIGAIATTANPLYTSFELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKLIVTVP L +KVK
Sbjct  120  KQVKDSNPKLIVTVPGLWEKVK  141



>gb|KHG26822.1| 4-coumarate--CoA ligase-like 7 [Gossypium arboreum]
Length=443

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 114/142 (80%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+  P++PNLSMVSFL RN+S YPD+PA+ DAD+G TLTFSQL
Sbjct  1    MEKSGYGRDGIYRSLRPPVDFPKEPNLSMVSFLLRNVSCYPDKPALIDADSGETLTFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +++HG  + LG+ K+D VLIF+PNSI FPLCF    A GAIATT NP Y V ELS
Sbjct  61   KSTVIKLSHGFLN-LGINKSDRVLIFAPNSIHFPLCFFAITAIGAIATTANPNYPVNELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+ D +PK  VTVP+L DKVK
Sbjct  120  KQLNDSNPKFAVTVPELFDKVK  141



>gb|KHG22750.1| 4-coumarate--CoA ligase-like 7 [Gossypium arboreum]
Length=453

 Score =   187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 114/142 (80%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+  P++PNLSMVSFL RN+S YPD+PA+ DAD+G TLTFSQL
Sbjct  1    MEKSGYGRDGIYRSLRPPVDFPKEPNLSMVSFLLRNVSCYPDKPALIDADSGETLTFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +++HG  + LG+ K+D VLIF+PNSI FPLCF    A GAIATT NP Y V ELS
Sbjct  61   KSTVIKLSHGFLN-LGINKSDRVLIFAPNSIHFPLCFFAITAIGAIATTANPNYPVNELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+ D +PK  VTVP+L DKVK
Sbjct  120  KQLNDSNPKFAVTVPELFDKVK  141



>ref|XP_009114500.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Brassica rapa]
Length=541

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 115/141 (82%), Gaps = 1/141 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            ME SGYGRDGIYRSLRP +VLP DPN S+VSFLF N S  P +PA+ D+DTG +L+FSQL
Sbjct  1    MENSGYGRDGIYRSLRPTLVLPEDPNTSLVSFLFANTSSCPSKPALVDSDTGDSLSFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            K+ VSR+AHG   +LG+RKNDVV+IF+PNS  FPLCFL   A G + TTVNP YTV E+S
Sbjct  61   KAAVSRLAHGF-LRLGIRKNDVVMIFAPNSHQFPLCFLAVTAIGGVFTTVNPSYTVNEVS  119

Query  494  KQIKDCSPKLIVTVPQLLDKV  556
            KQ+KDC+PK+I++V +LLDKV
Sbjct  120  KQVKDCNPKIIISVQELLDKV  140



>emb|CDY46376.1| BnaA09g19900D [Brassica napus]
Length=539

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 115/141 (82%), Gaps = 1/141 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            ME SGYGRDGIYRSLRP +VLP DPN S+VSFLF N S  P +PA+ D+DTG +L+FSQL
Sbjct  1    MENSGYGRDGIYRSLRPTLVLPEDPNTSLVSFLFANTSSCPSKPALVDSDTGDSLSFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            K+ VSR+AHG   +LG+RKNDVV+IF+PNS  FPLCFL   A G + TTVNP YTV E+S
Sbjct  61   KAAVSRLAHGF-LRLGIRKNDVVMIFAPNSHQFPLCFLAVTAIGGVFTTVNPSYTVNEVS  119

Query  494  KQIKDCSPKLIVTVPQLLDKV  556
            KQ+KDC+PK+I++V +LLDKV
Sbjct  120  KQVKDCNPKIIISVQELLDKV  140



>gb|KDO60238.1| hypothetical protein CISIN_1g0137801mg [Citrus sinensis]
Length=342

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 116/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+VLP DP+ SMV FLFRN + Y  + A+ DAD+  +L+FSQ 
Sbjct  1    MEKSGYGRDGIYRSLRPPLVLPSDPSFSMVHFLFRNSASYSSKLALIDADSDESLSFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +V+H  +H LG+ K DVVLIF+PNSI FP+CFLG IA GAIA+T NP+YTV ELS
Sbjct  61   KSIVIKVSHSFRH-LGITKKDVVLIFAPNSIHFPICFLGVIAIGAIASTANPVYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKL++TVP+L DKVK
Sbjct  120  KQVKDSNPKLVITVPELWDKVK  141



>gb|AIA24410.1| 4-coumarate-CoA ligase [Sinopodophyllum hexandrum]
Length=533

 Score =   187 bits (476),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+ LP +PNLSM+SFLFRN + YP+Q A+ D+D+ +TLTF Q 
Sbjct  1    MEKSGYGRDGIYRSLRPPLTLPTNPNLSMISFLFRNSNSYPNQLALIDSDSNKTLTFHQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V++++H L  QLG++K DVVLIF+PNSI FPLCF   IA GAIATT NP+YTV ELS
Sbjct  61   KSTVAKISHSL-IQLGIKKGDVVLIFAPNSIKFPLCFFSVIALGAIATTTNPLYTVGELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PKLI+T+  LLDKVK
Sbjct  120  KQIKDSNPKLIITILPLLDKVK  141



>ref|XP_008384715.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Malus domestica]
Length=544

 Score =   187 bits (476),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 122/142 (86%), Gaps = 2/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSG+GRDGI+RSLRPP+VLPRDPNLSMVSFLFRN S Y  +PA+ D ++  TL+FSQ 
Sbjct  1    MEKSGFGRDGIFRSLRPPLVLPRDPNLSMVSFLFRN-SSYSHKPALIDGESSETLSFSQF  59

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS+V +V+HGL + LG++KNDVVLIF+PNSI FP+C  G IA+GAIATT NP+YTV ELS
Sbjct  60   KSKVIQVSHGLIN-LGIKKNDVVLIFAPNSIQFPICLFGIIASGAIATTSNPLYTVSELS  118

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ++D +PKL++TVP+L DKVK
Sbjct  119  KQVRDSNPKLVITVPELWDKVK  140



>gb|KCW87478.1| hypothetical protein EUGRSUZ_B03942 [Eucalyptus grandis]
Length=626

 Score =   189 bits (479),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP + LPRDP+LSMVSFLFRN + Y D+PA+ +ADT  TLTF+Q 
Sbjct  93   MEKSGYGRDGIYRSLRPSLALPRDPDLSMVSFLFRNSASYADKPALVEADTDETLTFAQF  152

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            +S+V ++AHGL   LG+RK DVVLIF+PNSI FPLCF G  + GAIATT NP+YT  ELS
Sbjct  153  ESRVIKLAHGLL-SLGLRKGDVVLIFAPNSIQFPLCFFGVTSIGAIATTANPLYTSFELS  211

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKLIVTVP L +KVK
Sbjct  212  KQVKDSNPKLIVTVPGLWEKVK  233



>gb|KCW87479.1| hypothetical protein EUGRSUZ_B03943 [Eucalyptus grandis]
Length=670

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP + LPRDP+LSMVSFLFRN + Y D+PA+ +ADT  TLTF+Q 
Sbjct  127  MEKSGYGRDGIYRSLRPSLALPRDPDLSMVSFLFRNSASYADKPALVEADTDETLTFAQF  186

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            +S+V ++AHGL   LG+RK DVVLIF+PNSI FPLCF G  + GAIATT NP+YT  ELS
Sbjct  187  ESRVIKLAHGLL-SLGLRKGDVVLIFAPNSIQFPLCFFGVTSIGAIATTANPLYTSFELS  245

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKLIVTVP L +KVK
Sbjct  246  KQVKDSNPKLIVTVPGLWEKVK  267



>gb|AFD33347.1| acyl-activating enzyme 3 [Cannabis sativa]
Length=543

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+ LP + NLSMVSFLFRN S YP +PA+ D++T + L+FS  
Sbjct  1    MEKSGYGRDGIYRSLRPPLHLPNNNNLSMVSFLFRNSSSYPQKPALIDSETNQILSFSHF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +V+HG  + LG++KNDVVLI++PNSI FP+CFLG IA+GAIATT NP+YTV ELS
Sbjct  61   KSTVIKVSHGFLN-LGIKKNDVVLIYAPNSIHFPVCFLGIIASGAIATTSNPLYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKLI+TVPQLL+KVK
Sbjct  120  KQVKDSNPKLIITVPQLLEKVK  141



>ref|XP_006373451.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa]
 gb|ERP51248.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa]
Length=543

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 115/142 (81%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLPRD NLS+VSFLFRN + YP +PA+ DAD   TL+FS+L
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPRDSNLSLVSFLFRNSNSYPHKPALIDADLSITLSFSEL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V + AHGL + LG+ KNDV+LIF+PNS  FP CFL   + GA+ATT NP+YT  ELS
Sbjct  61   KSIVIKFAHGLLN-LGISKNDVILIFAPNSYQFPTCFLAITSIGAVATTANPLYTTSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PKL++TVP+L DKVK
Sbjct  120  KQIKDSNPKLVITVPELWDKVK  141



>gb|EYU18792.1| hypothetical protein MIMGU_mgv1a004091mg [Erythranthe guttata]
Length=544

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDG+YRSLRPP   P+DPN+SMVSFLFRNIS + D+ A+ D+ TG TL F+Q 
Sbjct  1    MEKSGYGRDGVYRSLRPPFFPPKDPNISMVSFLFRNISSFSDKRALVDSHTGETLNFAQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V++VA GL  QLGV+KNDVVLIFSPNSI FPLCFLG +A GAIATTVNP+YTV ELS
Sbjct  61   KSMVNKVAQGL-LQLGVKKNDVVLIFSPNSIQFPLCFLGIVAVGAIATTVNPLYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+ D   KLI+TV +L+ KVK
Sbjct  120  KQVHDSKSKLIITVEELIPKVK  141



>emb|CDY46375.1| BnaA09g19890D [Brassica napus]
Length=542

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 117/143 (82%), Gaps = 2/143 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQ-YPDQPAIHDADTGRTLTFSQ  310
            MEKSGYGRDGIYRSLRPP++LP+DPN S+VSFLFRN S  YP +PAI D+D+G +L+FS 
Sbjct  1    MEKSGYGRDGIYRSLRPPLLLPKDPNTSLVSFLFRNSSSSYPSKPAIIDSDSGVSLSFSD  60

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
            LKS V+R+A G   +LG+R+NDVVLIF+PNS  FPLCFL   A GA+ TT NP+YT  E+
Sbjct  61   LKSSVARLARGF-LRLGIRQNDVVLIFAPNSYQFPLCFLAVSAIGAVFTTANPLYTTNEI  119

Query  491  SKQIKDCSPKLIVTVPQLLDKVK  559
            SKQIKD +PKLI++V QL DKVK
Sbjct  120  SKQIKDSNPKLIISVQQLFDKVK  142



>ref|XP_002276353.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Vitis vinifera]
Length=544

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSL PP+VLP+DPNLS+VSFLFR  S YP +PA+ +A +G T+ F+Q 
Sbjct  1    MEKSGYGRDGIYRSLSPPLVLPKDPNLSLVSFLFRKASSYPRRPALIEAHSGETVNFAQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +V+HGL  +LG++KNDVVLIF+PNSI +PLCF G IA GAIATT NP+YTV E+ 
Sbjct  61   KSMVIKVSHGLT-RLGLKKNDVVLIFAPNSIQYPLCFFGVIAIGAIATTANPLYTVAEIQ  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD + KL++T+PQL +KVK
Sbjct  120  KQVKDSNAKLVITIPQLWEKVK  141



>ref|XP_006424487.1| hypothetical protein CICLE_v10029864mg [Citrus clementina]
 gb|ESR37727.1| hypothetical protein CICLE_v10029864mg [Citrus clementina]
Length=509

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPNLSMV FLFR+ + Y  + A+ D+D+G  LTFSQ 
Sbjct  1    MEKSGYGRDGIYRSLRPALVLPQDPNLSMVHFLFRSSASYGSKSALIDSDSGECLTFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +V+HG +H LGV K+DVVLIF+PNSI FP+C LG IA G IATT NP+YTV ELS
Sbjct  61   KSIVIKVSHGFRH-LGVTKHDVVLIFAPNSIQFPICLLGVIAIGGIATTANPVYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD SPKL+VTVP+L ++VK
Sbjct  120  KQVKDSSPKLVVTVPELGERVK  141



>gb|KDO60236.1| hypothetical protein CISIN_1g0137801mg [Citrus sinensis]
Length=436

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 116/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+VLP DP+ SMV FLFRN + Y  + A+ DAD+  +L+FSQ 
Sbjct  1    MEKSGYGRDGIYRSLRPPLVLPSDPSFSMVHFLFRNSASYSSKLALIDADSDESLSFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +V+H  +H LG+ K DVVLIF+PNSI FP+CFLG IA GAIA+T NP+YTV ELS
Sbjct  61   KSIVIKVSHSFRH-LGITKKDVVLIFAPNSIHFPICFLGVIAIGAIASTANPVYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKL++TVP+L DKVK
Sbjct  120  KQVKDSNPKLVITVPELWDKVK  141



>gb|KDO60235.1| hypothetical protein CISIN_1g0137801mg [Citrus sinensis]
Length=435

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 116/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+VLP DP+ SMV FLFRN + Y  + A+ DAD+  +L+FSQ 
Sbjct  1    MEKSGYGRDGIYRSLRPPLVLPSDPSFSMVHFLFRNSASYSSKLALIDADSDESLSFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +V+H  +H LG+ K DVVLIF+PNSI FP+CFLG IA GAIA+T NP+YTV ELS
Sbjct  61   KSIVIKVSHSFRH-LGITKKDVVLIFAPNSIHFPICFLGVIAIGAIASTANPVYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKL++TVP+L DKVK
Sbjct  120  KQVKDSNPKLVITVPELWDKVK  141



>gb|AGO89329.1| Ca4CL12 [Salix arbutifolia]
Length=529

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 115/142 (81%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+D NLS+VSFLFRN   YP +PA+ DAD   TL+FS+L
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPKDSNLSLVSFLFRNSDSYPHKPALIDADLSITLSFSEL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +VAHGL + LG+ K+DVVLIF+PNS  FP+CFL   + GA+ATT NP+YT  ELS
Sbjct  61   KSIVIKVAHGLLN-LGISKSDVVLIFAPNSYQFPICFLAITSIGAVATTANPLYTTSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PKL++TVP+L  KVK
Sbjct  120  KQIKDSNPKLVITVPELWGKVK  141



>emb|CAN70560.1| hypothetical protein VITISV_031619 [Vitis vinifera]
Length=663

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSL PP+VLP+DPNLS+VSFLFR  S YP +PA+ +A +G T+ F Q 
Sbjct  84   MEKSGYGRDGIYRSLSPPLVLPKDPNLSLVSFLFRKASSYPRRPALIEAHSGETVNFXQF  143

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +V+HGL  +LG++KNDVVLIF+PNSI +PLCF G IA GAIATT NP+YTV E  
Sbjct  144  KSMVIKVSHGLT-RLGLKKNDVVLIFAPNSIQYPLCFFGVIAIGAIATTANPLYTVAEXQ  202

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKL++T+PQL +KVK
Sbjct  203  KQVKDSNPKLVITIPQLWEKVK  224



>ref|XP_006424481.1| hypothetical protein CICLE_v100281392mg, partial [Citrus clementina]
 ref|XP_006424483.1| hypothetical protein CICLE_v100281392mg, partial [Citrus clementina]
 gb|ESR37721.1| hypothetical protein CICLE_v100281392mg, partial [Citrus clementina]
 gb|ESR37723.1| hypothetical protein CICLE_v100281392mg, partial [Citrus clementina]
Length=339

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 116/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSL PP+VLP DP+ SMV+FLFRN + Y  + A+ DA++  +L+FSQ 
Sbjct  1    MEKSGYGRDGIYRSLTPPLVLPSDPSFSMVNFLFRNSASYSSKLALIDANSDESLSFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +V+H  +H LG+ K DVVLIF+PNSI FP+CFLG IA GAIA+T NP+YTV ELS
Sbjct  61   KSIVIKVSHSFRH-LGITKKDVVLIFAPNSIHFPICFLGVIAIGAIASTANPVYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKL++TVP+L DKVK
Sbjct  120  KQVKDSNPKLVITVPELWDKVK  141



>gb|AGO89327.1| Ca4CL10 [Salix arbutifolia]
Length=548

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 115/142 (81%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+D NLS+VSFLFRN   YP +PA+ DAD   TL+FS+L
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPKDSNLSLVSFLFRNSDSYPHKPALIDADLSITLSFSEL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +VAHGL + LG+ K+DVVLIF+PNS  FP+CFL   + GA+ATT NP+YT  ELS
Sbjct  61   KSIVIKVAHGLLN-LGISKSDVVLIFAPNSYQFPICFLAITSIGAVATTANPLYTTSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PKL++TVP+L  KVK
Sbjct  120  KQIKDSNPKLVITVPELWGKVK  141



>gb|AGW27195.1| 4-coumarate:coenzyme A ligase 5 [Salvia miltiorrhiza]
Length=545

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDG++RSLRPP+ LP +PNLS+VSFLFRN S + ++ A+ DA TG TLTFS  
Sbjct  1    MEKSGYGRDGVFRSLRPPLSLPTNPNLSLVSFLFRNTSSFAEKRALIDAHTGETLTFSHF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS VSRVAHGL  QLG++KNDVVLIFSPNSI FPLCF G IA GA+ATTVNP+YT  E+S
Sbjct  61   KSMVSRVAHGL-LQLGIKKNDVVLIFSPNSIQFPLCFFGIIAIGAVATTVNPVYTAREVS  119

Query  494  KQIKDCSPKLIVTVPQLLDKV  556
            KQ+KD   K+I+TV +LL KV
Sbjct  120  KQLKDSMAKMIITVEELLPKV  140



>ref|XP_011021223.1| PREDICTED: 4-coumarate--CoA ligase-like 7 isoform X4 [Populus 
euphratica]
Length=472

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 114/142 (80%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYG DGIYRSLRP +VLP+D NLS+VSFLFRN + YP + A+ DAD   TL+FS+L
Sbjct  1    MEKSGYGCDGIYRSLRPTLVLPKDSNLSLVSFLFRNSNSYPHKSALIDADLSITLSFSEL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V + AHGL + LG+ KND VLIF+PNS  FP+CFL   + GA+ATTVNP+YT  ELS
Sbjct  61   KSIVIKFAHGLLN-LGISKNDAVLIFAPNSYQFPICFLAITSIGAVATTVNPLYTTSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PKL++TVP+L DKVK
Sbjct  120  KQIKDSNPKLVITVPELWDKVK  141



>ref|XP_011021222.1| PREDICTED: 4-coumarate--CoA ligase-like 7 isoform X3 [Populus 
euphratica]
Length=514

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 114/142 (80%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYG DGIYRSLRP +VLP+D NLS+VSFLFRN + YP + A+ DAD   TL+FS+L
Sbjct  1    MEKSGYGCDGIYRSLRPTLVLPKDSNLSLVSFLFRNSNSYPHKSALIDADLSITLSFSEL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V + AHGL + LG+ KND VLIF+PNS  FP+CFL   + GA+ATTVNP+YT  ELS
Sbjct  61   KSIVIKFAHGLLN-LGISKNDAVLIFAPNSYQFPICFLAITSIGAVATTVNPLYTTSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PKL++TVP+L DKVK
Sbjct  120  KQIKDSNPKLVITVPELWDKVK  141



>ref|XP_010689117.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Beta vulgaris subsp. 
vulgaris]
Length=540

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            ME+SGYGRDGIYRSLRP ++ P +PNL+MVSFLFRNIS YP++PA+ D+D+G  L FS+L
Sbjct  1    MERSGYGRDGIYRSLRPSLITPTNPNLNMVSFLFRNISSYPEKPALIDSDSGEILNFSKL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
             S VS +++GL  QLG++K  VVLI +PNSI +P+ FLG IA GAIATTVNP+YTV E+ 
Sbjct  61   NSMVSNLSYGLT-QLGIQKGHVVLILAPNSIQYPVTFLGVIATGAIATTVNPIYTVTEIK  119

Query  494  KQIKDCSPKLIVTVPQLLDKV  556
            KQ+ DC PKLIVTVP+L DKV
Sbjct  120  KQVDDCKPKLIVTVPELWDKV  140



>ref|XP_011021221.1| PREDICTED: 4-coumarate--CoA ligase-like 7 isoform X2 [Populus 
euphratica]
Length=543

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 114/142 (80%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYG DGIYRSLRP +VLP+D NLS+VSFLFRN + YP + A+ DAD   TL+FS+L
Sbjct  1    MEKSGYGCDGIYRSLRPTLVLPKDSNLSLVSFLFRNSNSYPHKSALIDADLSITLSFSEL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V + AHGL + LG+ KND VLIF+PNS  FP+CFL   + GA+ATTVNP+YT  ELS
Sbjct  61   KSIVIKFAHGLLN-LGISKNDAVLIFAPNSYQFPICFLAITSIGAVATTVNPLYTTSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PKL++TVP+L DKVK
Sbjct  120  KQIKDSNPKLVITVPELWDKVK  141



>gb|KEH29988.1| 4-coumarate:CoA ligase-like protein [Medicago truncatula]
Length=453

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M++SGYG DGIYRSLRP + LP +PNLS+VSFLF ++S  P++ A+ DAD+ +TL+FSQL
Sbjct  1    MQRSGYGPDGIYRSLRPSLALPNNPNLSLVSFLFTSVSSSPNKTALIDADSSQTLSFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            K+QV+++AH L +  G+ KNDVVLI SPN+I+FP+CFL A + GAI TT NP+YTV ELS
Sbjct  61   KTQVAKLAHSLLN-FGINKNDVVLILSPNNIEFPVCFLAAASIGAIVTTANPLYTVAELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PKL++TVP+L  KVK
Sbjct  120  KQIKDSNPKLVITVPELWSKVK  141



>ref|XP_011021220.1| PREDICTED: 4-coumarate--CoA ligase-like 7 isoform X1 [Populus 
euphratica]
Length=543

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 114/142 (80%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYG DGIYRSLRP +VLP+D NLS+VSFLFRN + YP + A+ DAD   TL+FS+L
Sbjct  1    MEKSGYGCDGIYRSLRPTLVLPKDSNLSLVSFLFRNSNSYPHKSALIDADLSITLSFSEL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V + AHGL + LG+ KND VLIF+PNS  FP+CFL   + GA+ATTVNP+YT  ELS
Sbjct  61   KSIVIKFAHGLLN-LGISKNDAVLIFAPNSYQFPICFLAITSIGAVATTVNPLYTTSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PKL++TVP+L DKVK
Sbjct  120  KQIKDSNPKLVITVPELWDKVK  141



>ref|XP_006488029.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Citrus sinensis]
Length=546

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 115/142 (81%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+VLP DP+ SMV FLFRN + Y  + A+ DAD+  +L+FSQ 
Sbjct  1    MEKSGYGRDGIYRSLRPPLVLPSDPSFSMVHFLFRNSASYSSKLALIDADSDESLSFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +V+H  +H LG+ K DVVLIF+PNSI FP+CFLG IA GAIA+T N +YTV ELS
Sbjct  61   KSIVIKVSHSFRH-LGITKKDVVLIFAPNSIQFPICFLGVIAIGAIASTANTVYTVSELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKL++TVP+L DKVK
Sbjct  120  KQVKDSNPKLVITVPELWDKVK  141



>gb|KEH29987.1| 4-coumarate:CoA ligase-like protein [Medicago truncatula]
Length=471

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M++SGYG DGIYRSLRP + LP +PNLS+VSFLF ++S  P++ A+ DAD+ +TL+FSQL
Sbjct  1    MQRSGYGPDGIYRSLRPSLALPNNPNLSLVSFLFTSVSSSPNKTALIDADSSQTLSFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            K+QV+++AH L +  G+ KNDVVLI SPN+I+FP+CFL A + GAI TT NP+YTV ELS
Sbjct  61   KTQVAKLAHSLLN-FGINKNDVVLILSPNNIEFPVCFLAAASIGAIVTTANPLYTVAELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PKL++TVP+L  KVK
Sbjct  120  KQIKDSNPKLVITVPELWSKVK  141



>gb|KFK32221.1| hypothetical protein AALP_AA6G213500 [Arabis alpina]
Length=542

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 111/142 (78%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP + LP+DPN S+VSFLFRN S Y    A+ D+D+G + TFS L
Sbjct  1    MEKSGYGRDGIYRSLRPMLTLPKDPNTSLVSFLFRNSSSYSSNLALADSDSGHSFTFSDL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS VSR+A+G   +LG+RK+DVVLIF+PNS  FPLCFL   A G + TT NP+YTV E+S
Sbjct  61   KSAVSRLANGF-LRLGIRKHDVVLIFAPNSYQFPLCFLAVTAIGGVFTTANPLYTVNEIS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PK+I++V QL D +K
Sbjct  120  KQIKDSNPKIIISVAQLFDTIK  141



>gb|KEH29989.1| 4-coumarate:CoA ligase-like protein [Medicago truncatula]
Length=542

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M++SGYG DGIYRSLRP + LP +PNLS+VSFLF ++S  P++ A+ DAD+ +TL+FSQL
Sbjct  1    MQRSGYGPDGIYRSLRPSLALPNNPNLSLVSFLFTSVSSSPNKTALIDADSSQTLSFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            K+QV+++AH L +  G+ KNDVVLI SPN+I+FP+CFL A + GAI TT NP+YTV ELS
Sbjct  61   KTQVAKLAHSLLN-FGINKNDVVLILSPNNIEFPVCFLAAASIGAIVTTANPLYTVAELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQIKD +PKL++TVP+L  KVK
Sbjct  120  KQIKDSNPKLVITVPELWSKVK  141



>ref|XP_004147290.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Cucumis sativus]
 gb|KGN64806.1| hypothetical protein Csa_1G108800 [Cucumis sativus]
Length=543

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+V P+DPNLSM+SFLFRN+  YP++ AI DA++  ++++SQL
Sbjct  1    MEKSGYGRDGIFRSLRPPLVFPKDPNLSMISFLFRNLLSYPNRLAIVDAESSNSVSYSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            K+   RV++GL  QLG+ KNDVVLIF+PNS+ F +CF+G IA GAI TT NP+YTV EL+
Sbjct  61   KALAIRVSNGL-IQLGIEKNDVVLIFAPNSVQFTICFIGVIAIGAIVTTCNPVYTVSELT  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ++D  PKL+++V +L DKVK
Sbjct  120  KQVRDAKPKLVISVAELWDKVK  141



>gb|KHN38721.1| 4-coumarate--CoA ligase-like 7 [Glycine soja]
Length=435

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 116/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M+K+GYG DGIYRSLRP +VLP DPNLS+VSFLF+++S +P + A+ D+ + +TLT + L
Sbjct  1    MQKAGYGGDGIYRSLRPCLVLPNDPNLSLVSFLFQSVSSFPSKIALVDSHSSQTLTLAHL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KSQV+++AHG   +LG+ KNDVVL+ +PNSI +P+CFL A A GA+ +T NP+YTV E+S
Sbjct  61   KSQVAKLAHGF-LKLGINKNDVVLLLAPNSIHYPICFLAATAIGAVVSTANPIYTVNEIS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+ D +PKL++TVP+L DKVK
Sbjct  120  KQVDDSNPKLLITVPELWDKVK  141



>ref|XP_009114499.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Brassica rapa]
Length=542

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 112/143 (78%), Gaps = 2/143 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPA-IHDADTGRTLTFSQ  310
            MEKSGYGRDGIYRSLRPP+VLP+DPN S+VSFLFRN S        I D+D+G +L+FS 
Sbjct  1    MEKSGYGRDGIYRSLRPPLVLPKDPNTSLVSFLFRNSSSSYPSKPSIIDSDSGVSLSFSD  60

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
            LKS V+R+A G   +LG+R+NDVVLIF+PNS  FPLCFL   A GA+ TT NP+YT  E+
Sbjct  61   LKSSVARLARGF-LRLGIRQNDVVLIFAPNSYQFPLCFLAVSAIGAVFTTANPLYTTNEV  119

Query  491  SKQIKDCSPKLIVTVPQLLDKVK  559
            SKQIKD +PKLI++V QL DKVK
Sbjct  120  SKQIKDSNPKLIISVQQLFDKVK  142



>ref|XP_006591122.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like isoform X2 [Glycine 
max]
Length=558

 Score =   172 bits (435),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 116/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M+K+GYG DGIYRSLRP +VLP DPNLS+VSFLF+++S +P + A+ D+ + +TLT + L
Sbjct  11   MQKAGYGGDGIYRSLRPCLVLPNDPNLSLVSFLFQSVSSFPSKIALVDSHSSQTLTLAHL  70

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KSQV+++AHG   +LG+ KNDVVL+ +PNSI +P+CFL A A GA+ +T NP+YTV E+S
Sbjct  71   KSQVAKLAHGF-LKLGINKNDVVLLLAPNSIHYPICFLAATAIGAVVSTANPIYTVNEIS  129

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+ D +PKL++TVP+L DKVK
Sbjct  130  KQVDDSNPKLLITVPELWDKVK  151



>ref|XP_006591121.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like isoform X1 [Glycine 
max]
Length=567

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 116/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M+K+GYG DGIYRSLRP +VLP DPNLS+VSFLF+++S +P + A+ D+ + +TLT + L
Sbjct  11   MQKAGYGGDGIYRSLRPCLVLPNDPNLSLVSFLFQSVSSFPSKIALVDSHSSQTLTLAHL  70

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KSQV+++AHG   +LG+ KNDVVL+ +PNSI +P+CFL A A GA+ +T NP+YTV E+S
Sbjct  71   KSQVAKLAHGFL-KLGINKNDVVLLLAPNSIHYPICFLAATAIGAVVSTANPIYTVNEIS  129

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+ D +PKL++TVP+L DKVK
Sbjct  130  KQVDDSNPKLLITVPELWDKVK  151



>gb|AGW47873.1| 4-coumarate:coenzyme A ligase 8 [Phaseolus vulgaris]
Length=548

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            AM +SGY  DG YRS RP +VLP++PNLS+VSFLF+++S +P + A+ DAD+ +TLTF+Q
Sbjct  4    AMHRSGYCSDGTYRSQRPSLVLPKNPNLSLVSFLFQSVSSFPSKTALVDADSSQTLTFAQ  63

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
            LK++V+ +AHG   +LG++KNDVVL+ +PN+I FP+CFL   A GAI +T NP+YTV EL
Sbjct  64   LKARVATLAHGF-LKLGIKKNDVVLLLAPNTIHFPVCFLAVTAIGAIVSTANPIYTVHEL  122

Query  491  SKQIKDCSPKLIVTVPQLLDKVK  559
            S Q+KD +PKL++TVP+L DK K
Sbjct  123  SNQVKDSNPKLVITVPELWDKAK  145



>gb|ABR18186.1| unknown [Picea sitchensis]
Length=540

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 112/142 (79%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+ LP+D N +MVSF+FR+ S Y  + A+ DAD+G  L+F + 
Sbjct  1    MEKSGYGRDGIFRSLRPPLKLPKDENANMVSFMFRDSSSYAHRLALADADSGEKLSFREF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            K +VS V  GL  QLG+RK DVVL+FSPNSI FP+CF G ++ GA+ATTVNP+YT  E+S
Sbjct  61   KDKVSIVGSGLS-QLGLRKGDVVLLFSPNSIYFPVCFFGIVSIGAVATTVNPLYTTMEIS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQI+D   KLIVTVP+L DKVK
Sbjct  120  KQIQDSKLKLIVTVPELWDKVK  141



>ref|XP_008463063.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Cucumis melo]
Length=543

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 116/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSG GRDGI+RSLRPP+V P+DPNLSM+SFLFRN+  YP++ AI DA++  ++++SQL
Sbjct  1    MEKSGCGRDGIFRSLRPPLVFPKDPNLSMISFLFRNLLSYPNRLAIVDAESSYSVSYSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            K+   R+++GL  QLG+ KNDVV+IF+PNS+   +CF+G IA GAI TT NP+YTV EL+
Sbjct  61   KALAIRLSNGL-IQLGIEKNDVVMIFAPNSVQLSICFIGVIAIGAIVTTCNPVYTVSELT  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ++D  PKL+++V +L DKVK
Sbjct  120  KQVRDAKPKLVISVAELWDKVK  141



>ref|XP_007132315.1| hypothetical protein PHAVU_011G084300g [Phaseolus vulgaris]
 gb|ESW04309.1| hypothetical protein PHAVU_011G084300g [Phaseolus vulgaris]
Length=462

 Score =   167 bits (424),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A+ +SGY  DG YRS RP +VLP +PNLS+VSFLF+++S +P + A+ DAD+ +TLTF+Q
Sbjct  4    AIHRSGYCSDGTYRSQRPSLVLPDNPNLSLVSFLFQSVSSFPSKTALVDADSSQTLTFAQ  63

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
            LK++V+ +AHG   +LG++KNDVVL+ +PN+I FP+CFL A A GAI +T NP+YTV EL
Sbjct  64   LKARVATLAHGFL-KLGIKKNDVVLLLAPNTIHFPVCFLAATAIGAIVSTANPIYTVHEL  122

Query  491  SKQIKDCSPKLIVTVPQLLDKVK  559
            S Q+KD +PKL++TVP+L DK K
Sbjct  123  SNQVKDSNPKLVITVPELCDKAK  145



>ref|XP_007132313.1| hypothetical protein PHAVU_011G084300g [Phaseolus vulgaris]
 gb|ESW04307.1| hypothetical protein PHAVU_011G084300g [Phaseolus vulgaris]
Length=477

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A+ +SGY  DG YRS RP +VLP +PNLS+VSFLF+++S +P + A+ DAD+ +TLTF+Q
Sbjct  4    AIHRSGYCSDGTYRSQRPSLVLPDNPNLSLVSFLFQSVSSFPSKTALVDADSSQTLTFAQ  63

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
            LK++V+ +AHG   +LG++KNDVVL+ +PN+I FP+CFL A A GAI +T NP+YTV EL
Sbjct  64   LKARVATLAHGFL-KLGIKKNDVVLLLAPNTIHFPVCFLAATAIGAIVSTANPIYTVHEL  122

Query  491  SKQIKDCSPKLIVTVPQLLDKVK  559
            S Q+KD +PKL++TVP+L DK K
Sbjct  123  SNQVKDSNPKLVITVPELCDKAK  145



>gb|ABR17274.1| unknown [Picea sitchensis]
Length=540

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 110/142 (77%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYG+DGI+RSLRPP+ LP+D N +MVSF+FR+ S Y D+ A+ DAD+G  L+F   
Sbjct  1    MEKSGYGKDGIFRSLRPPLNLPKDENANMVSFMFRDSSSYADKLALADADSGEKLSFRDF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            K +VS V  GL  QLG+RK DVVL+FSPNSI  P CFLG ++ GA+ATTVNP+YT  EL+
Sbjct  61   KDKVSMVGSGLS-QLGIRKGDVVLLFSPNSIHVPPCFLGIVSIGAVATTVNPLYTAMELA  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ++D   KLI+TVP+L DK K
Sbjct  120  KQVQDSQSKLIITVPELWDKAK  141



>ref|XP_007132314.1| hypothetical protein PHAVU_011G084300g [Phaseolus vulgaris]
 gb|ESW04308.1| hypothetical protein PHAVU_011G084300g [Phaseolus vulgaris]
Length=548

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A+ +SGY  DG YRS RP +VLP +PNLS+VSFLF+++S +P + A+ DAD+ +TLTF+Q
Sbjct  4    AIHRSGYCSDGTYRSQRPSLVLPDNPNLSLVSFLFQSVSSFPSKTALVDADSSQTLTFAQ  63

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
            LK++V+ +AHG   +LG++KNDVVL+ +PN+I FP+CFL A A GAI +T NP+YTV EL
Sbjct  64   LKARVATLAHGFL-KLGIKKNDVVLLLAPNTIHFPVCFLAATAIGAIVSTANPIYTVHEL  122

Query  491  SKQIKDCSPKLIVTVPQLLDKVK  559
            S Q+KD +PKL++TVP+L DK K
Sbjct  123  SNQVKDSNPKLVITVPELCDKAK  145



>ref|XP_008808867.1| PREDICTED: 4-coumarate--CoA ligase-like 1 [Phoenix dactylifera]
Length=544

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 108/138 (78%), Gaps = 1/138 (1%)
 Frame = +2

Query  143  SGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQ  322
            S YG DG++RSLRPPI  P DP+LSMV FLFR  + +PD+ A+ DAD+GR+LTF QL+S 
Sbjct  5    SSYGPDGVHRSLRPPIAFPSDPDLSMVPFLFRRTAAFPDRLALADADSGRSLTFLQLRSA  64

Query  323  VSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQI  502
            VS  A GL   LG+ K DVVLIFSPNS+ FP+CFL  ++ GAIATTVNP+YTV ELSKQ 
Sbjct  65   VSSTAVGLA-SLGISKGDVVLIFSPNSLHFPVCFLAVLSLGAIATTVNPLYTVAELSKQA  123

Query  503  KDCSPKLIVTVPQLLDKV  556
            KD +PKL++TVP+L  KV
Sbjct  124  KDSNPKLVITVPELWHKV  141



>ref|XP_006843037.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Amborella trichopoda]
 ref|XP_011622865.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Amborella trichopoda]
 ref|XP_011622866.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Amborella trichopoda]
 gb|ERN04712.1| hypothetical protein AMTR_s00076p00189570 [Amborella trichopoda]
Length=543

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 111/141 (79%), Gaps = 1/141 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYG+DGIYRSLRPP+V P+DP L+M+SF+FRN S Y ++ A+ DA+T   L F +L
Sbjct  1    MEKSGYGKDGIYRSLRPPVVFPKDPYLNMMSFMFRNSSLYGEKLAVADAETDEGLNFREL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            +  V RV +GL +++G+R+ DVVLIF+PNS+ F  CF G ++ GAIATTVNPMYT  E++
Sbjct  61   EVVVDRVRNGL-NKIGIRRGDVVLIFAPNSMHFATCFFGVVSLGAIATTVNPMYTSMEVA  119

Query  494  KQIKDCSPKLIVTVPQLLDKV  556
            KQ+KD   KL++TVPQL +KV
Sbjct  120  KQVKDSGSKLVITVPQLWEKV  140



>ref|XP_010918638.1| PREDICTED: 4-coumarate--CoA ligase-like 1 isoform X2 [Elaeis 
guineensis]
Length=512

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 105/138 (76%), Gaps = 1/138 (1%)
 Frame = +2

Query  143  SGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQ  322
            S +  DG+YRSL PPI  P DP+LSM+ FLFR  + +PD+ A+ DAD+GR+LTF QL+S 
Sbjct  5    SSFHPDGVYRSLSPPIAFPSDPDLSMLPFLFRRTAAFPDRLALADADSGRSLTFLQLRSA  64

Query  323  VSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQI  502
            +S  A GL   LG+ K DVVLIFSPNS+ FP+CFL  ++ GAIATTVNP+YTV E+SKQ 
Sbjct  65   ISSAAAGLA-SLGISKGDVVLIFSPNSLHFPVCFLAILSLGAIATTVNPLYTVAEISKQA  123

Query  503  KDCSPKLIVTVPQLLDKV  556
            KD +PKL++TVP L  KV
Sbjct  124  KDSNPKLVITVPDLWPKV  141



>ref|XP_010918637.1| PREDICTED: 4-coumarate--CoA ligase-like 1 isoform X1 [Elaeis 
guineensis]
Length=544

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 105/138 (76%), Gaps = 1/138 (1%)
 Frame = +2

Query  143  SGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQ  322
            S +  DG+YRSL PPI  P DP+LSM+ FLFR  + +PD+ A+ DAD+GR+LTF QL+S 
Sbjct  5    SSFHPDGVYRSLSPPIAFPSDPDLSMLPFLFRRTAAFPDRLALADADSGRSLTFLQLRSA  64

Query  323  VSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQI  502
            +S  A GL   LG+ K DVVLIFSPNS+ FP+CFL  ++ GAIATTVNP+YTV E+SKQ 
Sbjct  65   ISSAAAGLA-SLGISKGDVVLIFSPNSLHFPVCFLAILSLGAIATTVNPLYTVAEISKQA  123

Query  503  KDCSPKLIVTVPQLLDKV  556
            KD +PKL++TVP L  KV
Sbjct  124  KDSNPKLVITVPDLWPKV  141



>gb|AGW47869.1| 4-coumarate:coenzyme A ligase 4 [Phaseolus vulgaris]
Length=536

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 108/142 (76%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M++SGYG DGI+RSLRP IVLP+ PNL++VS LF  ++ +P + A+ DAD+ +TL+F+QL
Sbjct  1    MQRSGYGSDGIFRSLRPSIVLPKQPNLTLVSHLFNRVAPFPSKHALIDADSSQTLSFAQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS   +V+HGL  +LGV KNDVVL  +PN I + +CFL   + GAI TTVNP YT  E++
Sbjct  61   KSLTVKVSHGLL-RLGVAKNDVVLFLAPNDIRYIVCFLAVTSLGAIVTTVNPAYTAAEVA  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ KD +PK +VTVP+L DK++
Sbjct  120  KQAKDSNPKFVVTVPELWDKLQ  141



>ref|NP_001243292.1| 4-coumarate--CoA ligase-like 7-like [Glycine max]
 gb|AEX25890.1| 4-coumarate:CoA ligase [Glycine max]
Length=540

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M++SGYG DGIYRSLRP IV P++ NLS+VS LF  ++ +P +PA+ DAD+  TL+F++L
Sbjct  1    MQRSGYGSDGIYRSLRPSIVFPKNSNLSLVSHLFNRVAAFPSKPALIDADSSETLSFAEL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            K    RVAHGL  +LGV KNDVVL  +PN I + +CFL   + GA  TTVNP YT  E+S
Sbjct  61   KLLTVRVAHGLL-RLGVTKNDVVLFLAPNDIRYIVCFLAVASLGAAVTTVNPAYTAAEVS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ  D  PKL+VTV +L DK++
Sbjct  120  KQANDSKPKLLVTVAELWDKLE  141



>ref|XP_007150153.1| hypothetical protein PHAVU_005G131400g [Phaseolus vulgaris]
 gb|ESW22147.1| hypothetical protein PHAVU_005G131400g [Phaseolus vulgaris]
Length=536

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M++SGYG DGI+RSLRP I LP+ PNL++VS LF  ++ +P + A+ DAD+ +TL+F+QL
Sbjct  1    MQRSGYGSDGIFRSLRPSIALPKQPNLTLVSHLFNRVAPFPSKHALIDADSSQTLSFAQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS   +V+HGL  +LGV KNDVVL  +PN I + +CFL   + GAI TTVNP YT  E++
Sbjct  61   KSLTVKVSHGLL-RLGVAKNDVVLFLAPNDIRYIVCFLAVTSLGAIVTTVNPAYTAAEVA  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ KD +PK +VTVP+L DK++
Sbjct  120  KQAKDSNPKFVVTVPELWDKLQ  141



>gb|KEH39398.1| 4-coumarate:CoA ligase-like protein [Medicago truncatula]
Length=457

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 108/141 (77%), Gaps = 1/141 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M+KSGYG DGIYRSLRP ++LP++PNLS+V+ LF  ++  P++ A+ DAD+ +TLTF+QL
Sbjct  1    MQKSGYGSDGIYRSLRPSLILPKNPNLSLVTHLFNKVTSSPNKTALIDADSSQTLTFAQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS   ++AH L  ++G+ KNDVVL  +PNS  +P+ FL   + GA+A+TVNP YT  E+S
Sbjct  61   KSLTIKLAHSLI-KIGLTKNDVVLFLAPNSYLYPVFFLAVASIGAVASTVNPQYTTVEVS  119

Query  494  KQIKDCSPKLIVTVPQLLDKV  556
            KQ KD +PKLI+TV +L +KV
Sbjct  120  KQAKDSNPKLIITVAELWEKV  140



>gb|AGA17927.1| CCL10 [Humulus lupulus]
Length=543

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 103/142 (73%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEK       IY S RPP+  P DP LS+ SFLFR+ + YP++ A+ DAD+G+TLTF +L
Sbjct  1    MEKCFNPETQIYSSHRPPVNFPTDPKLSLTSFLFRSSASYPNRTALIDADSGQTLTFLKL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            K+QVS++AH L  QL ++KNDVVLIF+PNSI FP+CF    A GAI TT NP YT  ELS
Sbjct  61   KTQVSKLAHSLV-QLNIKKNDVVLIFAPNSIHFPVCFFSIAALGAITTTCNPSYTFTELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
             Q KDC+P L++TVP+L +K +
Sbjct  120  NQAKDCNPTLVITVPELWEKAR  141



>gb|KEH39397.1| 4-coumarate:CoA ligase-like protein [Medicago truncatula]
Length=539

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 108/141 (77%), Gaps = 1/141 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M+KSGYG DGIYRSLRP ++LP++PNLS+V+ LF  ++  P++ A+ DAD+ +TLTF+QL
Sbjct  1    MQKSGYGSDGIYRSLRPSLILPKNPNLSLVTHLFNKVTSSPNKTALIDADSSQTLTFAQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS   ++AH L  ++G+ KNDVVL  +PNS  +P+ FL   + GA+A+TVNP YT  E+S
Sbjct  61   KSLTIKLAHSLI-KIGLTKNDVVLFLAPNSYLYPVFFLAVASIGAVASTVNPQYTTVEVS  119

Query  494  KQIKDCSPKLIVTVPQLLDKV  556
            KQ KD +PKLI+TV +L +KV
Sbjct  120  KQAKDSNPKLIITVAELWEKV  140



>ref|XP_009413145.1| PREDICTED: 4-coumarate--CoA ligase-like 1 [Musa acuminata subsp. 
malaccensis]
Length=543

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M KSGYG DGIYRSLRP I  P DP LSMV FLFR+ + +PD+ A+ DADTG  L+F+ L
Sbjct  1    MGKSGYGPDGIYRSLRPRIAFPADPALSMVPFLFRSAAAHPDRLALVDADTGDALSFADL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            +S V   A  L    G+RK DVVLIF+PNS+ FP+ FL A++ GAIATTVNP+YTVPEL+
Sbjct  61   RSSVLSAAASLSSLFGLRKGDVVLIFAPNSVHFPVAFLAALSLGAIATTVNPLYTVPELT  120

Query  494  KQIKDCSPKLIVTVPQLLDK  553
            +Q +D   K++VTVPQL  K
Sbjct  121  RQARDARAKVVVTVPQLWSK  140



>gb|AID56315.1| 4-coumarate coenzyme A ligase 2, partial [Eriobotrya japonica]
Length=94

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSG+GRDGI+RSLRPP+VLPR+PNLSMVSFLFRN S Y  +PA+ D ++  TL+FSQ 
Sbjct  1    MEKSGFGRDGIFRSLRPPLVLPREPNLSMVSFLFRNSSSYSHKPALIDGESSETLSFSQF  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPL  418
            KS+V +V+HGL + LG++KNDVVLIF+PNSI FP+
Sbjct  61   KSKVIQVSHGLIN-LGIKKNDVVLIFAPNSIQFPI  94



>ref|XP_010654332.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Vitis vinifera]
Length=134

 Score =   139 bits (351),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = +2

Query  164  IYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHG  343
            +YRS RP + +P DP++SM+SFLFR  S +  + A+ D+D+G TLTF QLKS VSR+AH 
Sbjct  6    VYRSPRPHVDIPNDPSISMLSFLFRKTSSFSTRLALVDSDSGETLTFFQLKSTVSRLAHS  65

Query  344  LKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKL  523
               QLG+ KNDVVLIF+PNS+ FP+CFL  +A GAIATT NP+YT+ ELSKQ+KD +PK 
Sbjct  66   FA-QLGITKNDVVLIFAPNSVRFPVCFLAIVALGAIATTANPLYTISELSKQVKDSNPKF  124

Query  524  IVTV  535
            ++ V
Sbjct  125  VINV  128



>ref|XP_011651966.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Cucumis sativus]
 gb|KGN58984.1| hypothetical protein Csa_3G740270 [Cucumis sativus]
Length=545

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 104/143 (73%), Gaps = 1/143 (1%)
 Frame = +2

Query  128  LAMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFS  307
            + M KS   +  +Y S RPPI  P DP +S+VSFLFRN S YP+  A+ DAD+G +LTF 
Sbjct  3    ITMNKSFNPQSQVYTSRRPPIHFPTDPTISIVSFLFRNSSSYPNALALVDADSGESLTFR  62

Query  308  QLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPE  487
            QL+ QVS++AH +  QLG++K DVVLIFSPNSI F +CF   +A GAIATT NP YT  E
Sbjct  63   QLQIQVSKLAH-VFIQLGIQKGDVVLIFSPNSIHFLVCFFAIVAIGAIATTCNPAYTSAE  121

Query  488  LSKQIKDCSPKLIVTVPQLLDKV  556
            LSKQ+ +C PKL++TVP+L D +
Sbjct  122  LSKQVANCKPKLVITVPELWDVI  144



>ref|XP_004487067.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Cicer arietinum]
Length=539

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 104/142 (73%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M++SGYG DGIYRSLRP + LP+ PNLS+V+ LF  ++    +PA+ DAD+ +TLTF+QL
Sbjct  1    MQRSGYGSDGIYRSLRPSLTLPKHPNLSLVTHLFTKVASSLTKPALIDADSLQTLTFAQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS   +++H L H +GV KNDVVL  +PNS  +P+ FL   + GA+A+TVNP YT+ E+S
Sbjct  61   KSLTIKLSHALIH-IGVTKNDVVLFLAPNSYLYPVFFLAVASIGAVASTVNPAYTIAEVS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ  D  PKLI+TV +L  KVK
Sbjct  120  KQANDSKPKLIITVAELYSKVK  141



>ref|XP_004304462.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Fragaria vesca subsp. 
vesca]
Length=527

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 102/142 (72%), Gaps = 1/142 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M KS     G Y S RPP+  P +PNLS+ SFLF++ S  P   A+ DAD+G TLTF QL
Sbjct  1    MAKSFDSETGTYTSPRPPVHFPENPNLSLTSFLFQSSSSTPHSLALADADSGETLTFLQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            K+ VSR+A  L  QL + K+DVVLI SPNSI FP CFL  +A GAIAT+ NP+YTV ELS
Sbjct  61   KTLVSRLARALI-QLHINKDDVVLILSPNSIHFPACFLSVVAIGAIATSCNPVYTVYELS  119

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
             QIKDC+PKL++TVP+L  K++
Sbjct  120  DQIKDCNPKLVITVPELWHKIE  141



>ref|XP_008442710.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Cucumis melo]
Length=545

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 104/143 (73%), Gaps = 1/143 (1%)
 Frame = +2

Query  128  LAMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFS  307
            + M KS   +  IY S RPPI  P DP +S+VSFLFRN S YP+  A+ DAD+G +LTF 
Sbjct  3    ITMNKSFNPQSRIYSSPRPPIHFPTDPKISIVSFLFRNSSSYPNALALADADSGESLTFR  62

Query  308  QLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPE  487
            QL+ QVS++A  +  QLG++K DVVLIF+PNSI F +CF   +A GAIATT NP YT  E
Sbjct  63   QLQIQVSKLAR-VFSQLGIQKGDVVLIFAPNSIHFLVCFFAIVAIGAIATTCNPAYTFAE  121

Query  488  LSKQIKDCSPKLIVTVPQLLDKV  556
            LSKQ+ +C+PKL++TVP+L D +
Sbjct  122  LSKQVANCNPKLVITVPELWDVI  144



>gb|AIY34663.1| 4-coumarate:CoA ligase-like protein [Ornithogalum saundersiae]
Length=547

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 102/133 (77%), Gaps = 1/133 (1%)
 Frame = +2

Query  161  GIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAH  340
            GIY S RPP+  P DP+LSM+SFLFRN+  YP++ A+ DA++GR+ TF++L+S VS  A 
Sbjct  12   GIYTSPRPPLSFPSDPDLSMISFLFRNVDLYPNRLALVDAESGRSFTFAELRSTVSSFAV  71

Query  341  GLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPK  520
            GL  +LG+ K DVVLIFSPNS+ FP+ FL  ++ GA+ATTVNP+YTVPELSKQ  D   K
Sbjct  72   GL-SRLGIEKGDVVLIFSPNSVLFPISFLSIVSLGAVATTVNPLYTVPELSKQALDSRAK  130

Query  521  LIVTVPQLLDKVK  559
            L++T P+L+ K +
Sbjct  131  LVLTSPELVAKAR  143



>ref|XP_011087155.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Sesamum indicum]
Length=545

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 99/137 (72%), Gaps = 1/137 (1%)
 Frame = +2

Query  149  YGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVS  328
            YG DGIYRS RPP+ LP+DP  SM+ +LFRN+S     PA+ DA+TG+T TFS L++QV 
Sbjct  7    YGNDGIYRSPRPPLSLPQDPKFSMIPYLFRNLSSISHLPALVDAETGQTSTFSVLRTQVL  66

Query  329  RVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKD  508
              +  L   L V KNDVVLI SPNS+ FP+ F   +A GAIATT NP+YT  E+SKQ+KD
Sbjct  67   NFSKAL-LDLSVSKNDVVLIISPNSLLFPVAFFAVVAIGAIATTANPLYTAAEISKQVKD  125

Query  509  CSPKLIVTVPQLLDKVK  559
              PKLI+T+P L DK+K
Sbjct  126  SDPKLIITIPPLYDKIK  142



>ref|XP_009401821.1| PREDICTED: 4-coumarate--CoA ligase-like 1 [Musa acuminata subsp. 
malaccensis]
Length=544

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 94/138 (68%), Gaps = 0/138 (0%)
 Frame = +2

Query  140  KSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKS  319
            KSGYG DG+YRSLR  I  P DP+LSMV F FR    YPD+ A+ DADTG +L+F  L+S
Sbjct  4    KSGYGSDGVYRSLRAHIAFPDDPDLSMVPFFFRRAVAYPDRLALADADTGASLSFQALRS  63

Query  320  QVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQ  499
             V   A G     G+RK DVVL+F+PNS+ FP+ FL  ++ GAI TTVNP+YT  EL+ Q
Sbjct  64   AVLSAAAGFSSLCGIRKGDVVLMFAPNSLHFPVSFLAVVSFGAIVTTVNPIYTGHELASQ  123

Query  500  IKDCSPKLIVTVPQLLDK  553
             +D   KL+VT P+L  K
Sbjct  124  ARDAGAKLVVTTPELWPK  141



>ref|XP_007203616.1| hypothetical protein PRUPE_ppa003871mg [Prunus persica]
 gb|EMJ04815.1| hypothetical protein PRUPE_ppa003871mg [Prunus persica]
Length=543

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 99/131 (76%), Gaps = 1/131 (1%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHGL  346
            Y S RPP+  P DPNLS+ SFLF++ + +P+  A+ ++DT  TLTF QLKS VS++A+ L
Sbjct  13   YTSPRPPVPFPTDPNLSLTSFLFQSSTSFPNNLALAESDTAETLTFLQLKSLVSKLAYAL  72

Query  347  KHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKLI  526
             + L ++KNDVVLIF+PNSI FP+CF   +A GAIATT NP YTV ELS Q+ DC PKL+
Sbjct  73   LN-LNIKKNDVVLIFAPNSIHFPVCFFSIVAIGAIATTCNPQYTVSELSSQVNDCDPKLV  131

Query  527  VTVPQLLDKVK  559
            +TVP+L  K+K
Sbjct  132  ITVPELWPKIK  142



>emb|CBI30139.3| unnamed protein product [Vitis vinifera]
Length=649

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 100/132 (76%), Gaps = 4/132 (3%)
 Frame = +2

Query  164  IYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHG  343
            +YRS RP + +P DP++SM+SFLFR  S +  + A+ D+D+G TLTF QLKS VSR+AH 
Sbjct  6    VYRSPRPHVDIPNDPSISMLSFLFRKTSSFSTRLALVDSDSGETLTFFQLKSTVSRLAHS  65

Query  344  LKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKL  523
               QLG+ KNDVVLIF+PNS+ FP+CFL  +A GAIATT NP+YT+ ELSKQ+KD +PK 
Sbjct  66   FA-QLGITKNDVVLIFAPNSVRFPVCFLAIVALGAIATTANPLYTISELSKQVKDSNPKF  124

Query  524  IVTVPQLLDKVK  559
            ++    L DKVK
Sbjct  125  VI---NLWDKVK  133



>gb|KHN21493.1| 4-coumarate--CoA ligase-like 7 [Glycine soja]
Length=533

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 96/142 (68%), Gaps = 8/142 (6%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M++SGYG DGIYRSLRP IV P++ NLS+VS LF  ++ +P +PA+ DAD+  TL+F++L
Sbjct  1    MQRSGYGSDGIYRSLRPSIVFPKNSNLSLVSHLFNRVAAFPSKPALIDADSSETLSFAEL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            K    RVAHGL  +LGV KNDVVL  +PN I + +CFL          ++    T  E+S
Sbjct  61   KLLTVRVAHGLL-RLGVTKNDVVLFLAPNDIRYIVCFL-------AVASLGAAGTTAEVS  112

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ  D  PKL+VTV +L DK++
Sbjct  113  KQANDSKPKLLVTVAELWDKLE  134



>emb|CDP06777.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 94/128 (73%), Gaps = 1/128 (1%)
 Frame = +2

Query  149  YGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVS  328
            YG+DGIYRS +PP+VLP DPNLSMV FLFRN        A+ DA T  + TF  L +QVS
Sbjct  6    YGKDGIYRSQKPPVVLPEDPNLSMVPFLFRNFPSLSQSTALIDAGTAESFTFFDLLTQVS  65

Query  329  RVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKD  508
            +++H L  +L + KNDVVLIFSPNS+ FP+ FL  +  GAIATTVNP+YT+ ELS Q+ D
Sbjct  66   KLSHALL-KLNINKNDVVLIFSPNSVLFPISFLAVVGIGAIATTVNPLYTINELSNQVND  124

Query  509  CSPKLIVT  532
             +PKLI+T
Sbjct  125  SNPKLIIT  132



>ref|XP_008241410.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Prunus mume]
Length=576

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 97/131 (74%), Gaps = 1/131 (1%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHGL  346
            Y S RPP   P DPNLS+ SFLF++ + +P+  A+ D+DT  TLTF QLKS VS++AH L
Sbjct  46   YSSPRPPAPFPTDPNLSLTSFLFQSSTSFPNNLALADSDTAETLTFLQLKSLVSKLAHSL  105

Query  347  KHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKLI  526
             + L ++KNDVVLIF+PNSI FP+CF   +A GAIATT NP YTV ELS Q+ DC PKL+
Sbjct  106  LN-LNIKKNDVVLIFAPNSIHFPVCFFSIVAIGAIATTCNPQYTVSELSSQVNDCDPKLV  164

Query  527  VTVPQLLDKVK  559
            +TV +L  K+K
Sbjct  165  ITVSELWPKIK  175



>gb|KJB20368.1| hypothetical protein B456_003G144900 [Gossypium raimondii]
Length=434

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = +2

Query  218  MVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSP  397
            MVSFLFRN+S YP +PA+ DAD+G TLTFSQLKS V +++HG   +LG+ K+D VLIF+P
Sbjct  1    MVSFLFRNVSCYPYKPALIDADSGETLTFSQLKSTVIKLSHGF-LKLGINKSDRVLIFAP  59

Query  398  NSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKLIVTVPQLLDKVK  559
            NS+ FPLCF    A GAIATT NP YT  ELSKQ+KD +PKL+VTVP+L DKVK
Sbjct  60   NSVQFPLCFFAITAIGAIATTANPNYTANELSKQLKDSNPKLVVTVPELFDKVK  113



>gb|KJB20367.1| hypothetical protein B456_003G144900 [Gossypium raimondii]
Length=446

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = +2

Query  218  MVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSP  397
            MVSFLFRN+S YP +PA+ DAD+G TLTFSQLKS V +++HG   +LG+ K+D VLIF+P
Sbjct  1    MVSFLFRNVSCYPYKPALIDADSGETLTFSQLKSTVIKLSHGFL-KLGINKSDRVLIFAP  59

Query  398  NSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKLIVTVPQLLDKVK  559
            NS+ FPLCF    A GAIATT NP YT  ELSKQ+KD +PKL+VTVP+L DKVK
Sbjct  60   NSVQFPLCFFAITAIGAIATTANPNYTANELSKQLKDSNPKLVVTVPELFDKVK  113



>gb|KJB20365.1| hypothetical protein B456_003G144900 [Gossypium raimondii]
Length=464

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = +2

Query  218  MVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSP  397
            MVSFLFRN+S YP +PA+ DAD+G TLTFSQLKS V +++HG   +LG+ K+D VLIF+P
Sbjct  1    MVSFLFRNVSCYPYKPALIDADSGETLTFSQLKSTVIKLSHGFL-KLGINKSDRVLIFAP  59

Query  398  NSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKLIVTVPQLLDKVK  559
            NS+ FPLCF    A GAIATT NP YT  ELSKQ+KD +PKL+VTVP+L DKVK
Sbjct  60   NSVQFPLCFFAITAIGAIATTANPNYTANELSKQLKDSNPKLVVTVPELFDKVK  113



>gb|KJB20366.1| hypothetical protein B456_003G144900 [Gossypium raimondii]
Length=518

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = +2

Query  218  MVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSP  397
            MVSFLFRN+S YP +PA+ DAD+G TLTFSQLKS V +++HG   +LG+ K+D VLIF+P
Sbjct  1    MVSFLFRNVSCYPYKPALIDADSGETLTFSQLKSTVIKLSHGF-LKLGINKSDRVLIFAP  59

Query  398  NSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKLIVTVPQLLDKVK  559
            NS+ FPLCF    A GAIATT NP YT  ELSKQ+KD +PKL+VTVP+L DKVK
Sbjct  60   NSVQFPLCFFAITAIGAIATTANPNYTANELSKQLKDSNPKLVVTVPELFDKVK  113



>gb|KJB20364.1| hypothetical protein B456_003G144900 [Gossypium raimondii]
Length=517

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = +2

Query  218  MVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSP  397
            MVSFLFRN+S YP +PA+ DAD+G TLTFSQLKS V +++HG   +LG+ K+D VLIF+P
Sbjct  1    MVSFLFRNVSCYPYKPALIDADSGETLTFSQLKSTVIKLSHGF-LKLGINKSDRVLIFAP  59

Query  398  NSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKLIVTVPQLLDKVK  559
            NS+ FPLCF    A GAIATT NP YT  ELSKQ+KD +PKL+VTVP+L DKVK
Sbjct  60   NSVQFPLCFFAITAIGAIATTANPNYTANELSKQLKDSNPKLVVTVPELFDKVK  113



>gb|KDO60237.1| hypothetical protein CISIN_1g0137801mg, partial [Citrus sinensis]
Length=373

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 95/142 (67%), Gaps = 31/142 (22%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+VLP DP                              +FS  
Sbjct  1    MEKSGYGRDGIYRSLRPPLVLPSDP------------------------------SFSMF  30

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +V+H  +H LG+ K DVVLIF+PNSI FP+CFLG IA GAIA+T NP+YTV ELS
Sbjct  31   KSIVIKVSHSFRH-LGITKKDVVLIFAPNSIHFPICFLGVIAIGAIASTANPVYTVSELS  89

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKL++TVP+L DKVK
Sbjct  90   KQVKDSNPKLVITVPELWDKVK  111



>ref|XP_006424482.1| hypothetical protein CICLE_v100281392mg, partial [Citrus clementina]
 gb|ESR37722.1| hypothetical protein CICLE_v100281392mg, partial [Citrus clementina]
Length=309

 Score =   135 bits (340),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 94/142 (66%), Gaps = 31/142 (22%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSL PP+VLP DP                              +FS  
Sbjct  1    MEKSGYGRDGIYRSLTPPLVLPSDP------------------------------SFSMF  30

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            KS V +V+H  +H LG+ K DVVLIF+PNSI FP+CFLG IA GAIA+T NP+YTV ELS
Sbjct  31   KSIVIKVSHSFRH-LGITKKDVVLIFAPNSIHFPICFLGVIAIGAIASTANPVYTVSELS  89

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ+KD +PKL++TVP+L DKVK
Sbjct  90   KQVKDSNPKLVITVPELWDKVK  111



>gb|KJB36450.1| hypothetical protein B456_006G162900 [Gossypium raimondii]
Length=415

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 96/134 (72%), Gaps = 0/134 (0%)
 Frame = +2

Query  155  RDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            +   Y S RPP+ LP  P+LS+ SF+F++ S  P   A+ DA +  TLTF QLK+ VS +
Sbjct  9    KSQTYTSPRPPLKLPTSPDLSLTSFIFQSTSSIPHHTALIDATSNETLTFLQLKAHVSSL  68

Query  335  AHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCS  514
            A+ L+HQ  V K+DVVLIF+PNSI FP+ FL  ++ GAIATT NP +T  E+SKQ+KD +
Sbjct  69   AYALRHQFHVAKHDVVLIFAPNSIRFPISFLAIVSLGAIATTANPSFTFTEISKQVKDSN  128

Query  515  PKLIVTVPQLLDKV  556
            PKLI+T+PQL  KV
Sbjct  129  PKLIITIPQLYSKV  142



>gb|KJB36451.1| hypothetical protein B456_006G162900 [Gossypium raimondii]
Length=546

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 95/130 (73%), Gaps = 0/130 (0%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHGL  346
            Y S RPP+ LP  P+LS+ SF+F++ S  P   A+ DA +  TLTF QLK+ VS +A+ L
Sbjct  13   YTSPRPPLKLPTSPDLSLTSFIFQSTSSIPHHTALIDATSNETLTFLQLKAHVSSLAYAL  72

Query  347  KHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKLI  526
            +HQ  V K+DVVLIF+PNSI FP+ FL  ++ GAIATT NP +T  E+SKQ+KD +PKLI
Sbjct  73   RHQFHVAKHDVVLIFAPNSIRFPISFLAIVSLGAIATTANPSFTFTEISKQVKDSNPKLI  132

Query  527  VTVPQLLDKV  556
            +T+PQL  KV
Sbjct  133  ITIPQLYSKV  142



>ref|XP_007027423.1| AMP-dependent synthetase and ligase family protein, putative 
[Theobroma cacao]
 gb|EOY07925.1| AMP-dependent synthetase and ligase family protein, putative 
[Theobroma cacao]
Length=617

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 101/146 (69%), Gaps = 1/146 (1%)
 Frame = +2

Query  122  RILAMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDA-DTGRTL  298
            + LAM KS   +   Y S RPPI LP +P LS+ SF+F + S  P + A+ D+ ++  TL
Sbjct  66   QTLAMAKSFNPKTQTYTSPRPPIKLPTNPELSLTSFIFESTSSIPHETALIDSSNSNETL  125

Query  299  TFSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYT  478
            TF QLK+QVS +A+ L HQ  + K+DVVLI +PNSI FP+ FL  I+ GAIATT NP +T
Sbjct  126  TFLQLKAQVSSLAYALHHQFHIAKSDVVLILAPNSIRFPISFLAIISLGAIATTANPSFT  185

Query  479  VPELSKQIKDCSPKLIVTVPQLLDKV  556
              E+SKQ+ DC PKLI+T+P+L  KV
Sbjct  186  FNEISKQVNDCRPKLIITIPELYSKV  211



>ref|XP_002519487.1| AMP dependent CoA ligase, putative [Ricinus communis]
 gb|EEF42901.1| AMP dependent CoA ligase, putative [Ricinus communis]
Length=543

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 95/131 (73%), Gaps = 1/131 (1%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHGL  346
            Y S RPPI LP DPNLS+ SFLF +    P   A+ D+D+  TLTF  L+ +VS++A  L
Sbjct  12   YISPRPPIHLPTDPNLSLTSFLFNSTLSVPHSTALIDSDSNETLTFHDLRIRVSKLAQAL  71

Query  347  KHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKLI  526
             + L + KNDVVLI SPNSI FP+ FL  ++ GAIA+T NP YT+ ELSKQ+ DC+PKLI
Sbjct  72   LN-LNIAKNDVVLILSPNSIHFPVIFLAIVSIGAIASTCNPSYTISELSKQVTDCNPKLI  130

Query  527  VTVPQLLDKVK  559
            +TVPQL+ KVK
Sbjct  131  ITVPQLITKVK  141



>ref|XP_010037647.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Eucalyptus grandis]
 gb|KCW49389.1| hypothetical protein EUGRSUZ_K02927 [Eucalyptus grandis]
Length=548

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 99/136 (73%), Gaps = 5/136 (4%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQ-----PAIHDADTGRTLTFSQLKSQVSR  331
            Y S RPP+  P +P+L++ S LFR+ S          PA+ DAD+G +LTF QLK++VS 
Sbjct  14   YTSPRPPLRFPSEPDLTLTSHLFRSYSSCSSSASLQSPALIDADSGESLTFRQLKTRVST  73

Query  332  VAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDC  511
            ++H L  +L + K DVVLIF PNS+ +P+CFL  ++ GA+ATT NPMYT+PELSKQ+ DC
Sbjct  74   LSHVLLRELHLGKGDVVLIFCPNSVHYPVCFLSVVSVGAVATTCNPMYTLPELSKQVDDC  133

Query  512  SPKLIVTVPQLLDKVK  559
             PKL++T+P+L DKV+
Sbjct  134  KPKLVITLPELYDKVR  149



>gb|KEH42182.1| 4-coumarate:CoA ligase-like protein [Medicago truncatula]
Length=551

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 96/131 (73%), Gaps = 1/131 (1%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHGL  346
            Y S R PI LP DPNLS+ SFLF++ S   D  A+ DA+TG +LTF QLK  VS ++H L
Sbjct  13   YSSPRQPINLPTDPNLSLTSFLFQSTSSVADTIALADAETGNSLTFRQLKIHVSALSHSL  72

Query  347  KHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKLI  526
             H LG+R+ DVVL+ +PNSI FP+CFL  +A GAIATT +P+YT+ ELS+QI D  PKL+
Sbjct  73   LH-LGIRRGDVVLLLAPNSIRFPVCFLAIVAIGAIATTSSPLYTLSELSRQIHDSKPKLV  131

Query  527  VTVPQLLDKVK  559
            +TV +L  K++
Sbjct  132  ITVSELFKKIE  142



>ref|XP_004497538.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Cicer arietinum]
Length=558

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 96/131 (73%), Gaps = 1/131 (1%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHGL  346
            Y S RPPI LP DPNLS+ +FLF++ S   D  A+ DA +  +LTF QLK+QV  ++H L
Sbjct  15   YSSPRPPIHLPTDPNLSLTTFLFQSTSSAADSIALADAHSNDSLTFHQLKTQVIALSHSL  74

Query  347  KHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKLI  526
              +LG+++ D+VL+F+PNSI FP+CFL  +A GAIATT +P+YT  ELSKQI D  PKL+
Sbjct  75   -LRLGIKRGDIVLLFAPNSIRFPVCFLAVVAIGAIATTCSPLYTPSELSKQINDSKPKLV  133

Query  527  VTVPQLLDKVK  559
            +TV +L  K+K
Sbjct  134  ITVSELYQKIK  144



>ref|XP_011087272.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Sesamum indicum]
Length=546

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 94/137 (69%), Gaps = 4/137 (3%)
 Frame = +2

Query  149  YGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVS  328
            Y  DGI+RS RPPI LP   NLSM+SFLFR +      PA+  A+TG+TLTFS LK+QV 
Sbjct  12   YSEDGIHRSPRPPIFLP---NLSMISFLFRKLPSNAHSPALIQAETGQTLTFSDLKTQVF  68

Query  329  RVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKD  508
              +  L     + KNDVVLI SPNS+ FP+     +A GAIATT NP+ T  E+SKQ+KD
Sbjct  69   NFSKTLL-DFNISKNDVVLIISPNSLLFPVAIFAVVAVGAIATTANPLCTAAEISKQVKD  127

Query  509  CSPKLIVTVPQLLDKVK  559
             +PKLI+T PQL DK+K
Sbjct  128  SNPKLIITTPQLHDKIK  144



>dbj|BAJ88705.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=574

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 87/137 (64%), Gaps = 0/137 (0%)
 Frame = +2

Query  146  GYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQV  325
            GYG DG+YRSLRPP  +P DP LS+   L R     P  PA+ DA TGR L+F+ L+S V
Sbjct  36   GYGADGVYRSLRPPARIPSDPGLSVADLLLRRADACPSAPALIDAATGRALSFAGLRSAV  95

Query  326  SRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIK  505
               A  L  + GVR  D VL+ +PN + +P+CF    A GA+A+T NP+YT  E++KQ  
Sbjct  96   LTTAVALASRAGVRPGDAVLLLAPNCVLYPVCFFAVTAVGAVASTANPLYTPREIAKQAS  155

Query  506  DCSPKLIVTVPQLLDKV  556
            D   KL+VTV +LL KV
Sbjct  156  DARVKLVVTVAELLPKV  172



>ref|XP_010101621.1| 4-coumarate--CoA ligase-like 7 [Morus notabilis]
 gb|EXB89002.1| 4-coumarate--CoA ligase-like 7 [Morus notabilis]
Length=547

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 94/131 (72%), Gaps = 0/131 (0%)
 Frame = +2

Query  164  IYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHG  343
            IY S RPP+  P D + S+ SFLF++ S +P   A+ D D+G TLTF +LK+ VS ++H 
Sbjct  11   IYTSPRPPVNFPSDHHHSLTSFLFQSSSSFPHNTALIDDDSGETLTFLELKTLVSNLSHA  70

Query  344  LKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKL  523
            L++ +G++K DVVLI + NSI +P+CF    A GAI TT NP YT  ELSKQ+KDC+PKL
Sbjct  71   LRNAMGIKKGDVVLIVAANSIRYPICFFAIAALGAITTTCNPAYTFFELSKQVKDCNPKL  130

Query  524  IVTVPQLLDKV  556
            ++TVP+L +K 
Sbjct  131  VITVPELYEKT  141



>ref|XP_004982543.1| PREDICTED: 4-coumarate--CoA ligase-like 1-like [Setaria italica]
Length=550

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 89/142 (63%), Gaps = 0/142 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A   +GYG DG+YRS R    +P DP LS+  F+    +  P   A+ DA TGR LTF  
Sbjct  5    ASPAAGYGSDGVYRSPRSAAPIPSDPALSLSDFVLSRAAVCPSALALVDAATGRALTFEA  64

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
            L+S V   A  L  +  VR+ DVVL+ +PNS+ +P+CFL   A GA+ATT NP+YT  E+
Sbjct  65   LRSAVLATAAALSSRARVRRGDVVLLLAPNSVLYPVCFLAVTAIGAVATTANPLYTPREI  124

Query  491  SKQIKDCSPKLIVTVPQLLDKV  556
            +KQ+ D   KL+VT+ +LL K+
Sbjct  125  AKQVDDAGVKLVVTISELLPKI  146



>ref|XP_010037648.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Eucalyptus grandis]
 gb|KCW49390.1| hypothetical protein EUGRSUZ_K02929 [Eucalyptus grandis]
Length=549

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 93/136 (68%), Gaps = 5/136 (4%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPA-----IHDADTGRTLTFSQLKSQVSR  331
            YRS RPP+  P +P+L++ S LFR+ S      +     + D D+G +LTF QLK++VS 
Sbjct  14   YRSPRPPLRFPSEPDLTLTSHLFRSYSSSSSSASPQSPALIDPDSGESLTFRQLKTRVST  73

Query  332  VAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDC  511
            ++H L   L + K DVV I  PNS+ +P+CFL  ++ GA+ATT NPMYT  ELSKQ+ DC
Sbjct  74   LSHVLLRDLHLGKGDVVFILCPNSVHYPVCFLSVVSIGAVATTCNPMYTRLELSKQVDDC  133

Query  512  SPKLIVTVPQLLDKVK  559
             PKL++T+P+L DKV+
Sbjct  134  KPKLVITLPELYDKVR  149



>ref|XP_004985664.1| PREDICTED: 4-coumarate--CoA ligase-like 1-like [Setaria italica]
Length=575

 Score =   117 bits (292),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 67/142 (47%), Positives = 88/142 (62%), Gaps = 0/142 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A+  +GYG DG+YRSLRP + +P DP LS+   +FR     P   A+ DA TGR LTF+ 
Sbjct  6    AVPTAGYGEDGVYRSLRPAVPIPSDPGLSLNDLIFRRADACPAALALVDAATGRALTFAG  65

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
            L+S     A  L  + GVR  DVVL+ +PN + +P+CFL   A GA+ATT NP YT  E+
Sbjct  66   LRSAALTAAAALSTRAGVRPGDVVLLLAPNCVLYPVCFLAVTALGAVATTANPHYTTREI  125

Query  491  SKQIKDCSPKLIVTVPQLLDKV  556
            + Q+ D   KLI+T   LL KV
Sbjct  126  ATQVADARAKLIITFADLLPKV  147



>ref|XP_003558787.1| PREDICTED: 4-coumarate--CoA ligase-like 1 [Brachypodium distachyon]
Length=545

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 87/142 (61%), Gaps = 0/142 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A+  +GYG DG+YRSLRP   +  +P LS V  L R  +  P   A+ DA TG  LTFS 
Sbjct  5    AVPSAGYGADGVYRSLRPAARIESNPGLSAVDLLLRRAAACPSALALVDAATGHALTFSG  64

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
            L+S +   A  L  + GVR  D VL+ +PN + +P+CF    A GA+A+T NP+YT  E+
Sbjct  65   LRSAILASAVALSSRAGVRPGDSVLLVAPNCVLYPVCFFAVTALGAVASTANPLYTPREI  124

Query  491  SKQIKDCSPKLIVTVPQLLDKV  556
            +KQ  D   +L++TV +LL KV
Sbjct  125  AKQASDARARLVITVAELLPKV  146



>tpg|DAA43421.1| TPA: LOW QUALITY PROTEIN: putative AMP-dependent synthetase and 
ligase superfamily protein [Zea mays]
Length=420

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 86/142 (61%), Gaps = 0/142 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A   +GYG DG+YRS RP + +  D  LS+   LFR     P   A+ D+ TG++LTF+ 
Sbjct  5    AAPAAGYGEDGVYRSPRPAVRIESDTGLSLNDLLFRRADVCPSALALVDSATGQSLTFAA  64

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
             +S V   A  L  + GVR+ DVVL F+PN   +P+CF    A GA+ATT NP+YT  E+
Sbjct  65   FRSAVLTTAVALSSRAGVRRGDVVLFFAPNCFLYPVCFFAVTALGAVATTANPLYTPREV  124

Query  491  SKQIKDCSPKLIVTVPQLLDKV  556
            +KQ  D   KL +TV +LL K+
Sbjct  125  AKQATDSRAKLAITVSELLPKI  146



>ref|XP_004982544.1| PREDICTED: 4-coumarate--CoA ligase-like 1-like [Setaria italica]
Length=550

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 86/138 (62%), Gaps = 0/138 (0%)
 Frame = +2

Query  143  SGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQ  322
            +GYG DG+YRS RP   +P DP LS+   + R  +  P  PA+ DA TG  LTF  L+S 
Sbjct  10   AGYGSDGVYRSPRPAAPIPSDPALSLSDLVLRRAAACPSAPALVDAATGAALTFGALRSA  69

Query  323  VSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQI  502
            V   A  L  +  +R+ DVVL+ +PN + +P+CFL   A GA+ATT NP+YT  E++KQ 
Sbjct  70   VLGAAAALSSRARIRRGDVVLLLAPNCVLYPVCFLAVTAIGAVATTANPLYTPREIAKQA  129

Query  503  KDCSPKLIVTVPQLLDKV  556
             D   KL+VTV  LL K+
Sbjct  130  ADARAKLVVTVSDLLPKI  147



>ref|XP_008672616.1| PREDICTED: uncharacterized protein LOC100191850 isoform X1 [Zea 
mays]
 tpg|DAA43419.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein isoform 1 [Zea mays]
 tpg|DAA43420.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein isoform 2 [Zea mays]
Length=555

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 86/142 (61%), Gaps = 0/142 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A   +GYG DG+YRS RP + +  D  LS+   LFR     P   A+ D+ TG++LTF+ 
Sbjct  5    AAPAAGYGEDGVYRSPRPAVRIESDTGLSLNDLLFRRADVCPSALALVDSATGQSLTFAA  64

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
             +S V   A  L  + GVR+ DVVL F+PN   +P+CF    A GA+ATT NP+YT  E+
Sbjct  65   FRSAVLTTAVALSSRAGVRRGDVVLFFAPNCFLYPVCFFAVTALGAVATTANPLYTPREV  124

Query  491  SKQIKDCSPKLIVTVPQLLDKV  556
            +KQ  D   KL +TV +LL K+
Sbjct  125  AKQATDSRAKLAITVSELLPKI  146



>gb|AFK46688.1| unknown [Medicago truncatula]
Length=92

 Score =   105 bits (263),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 69/86 (80%), Gaps = 1/86 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M++SGYG DGIYRSLRP + LP +PNLS+VSFLF ++S  P++ A+ DAD+ +TL+FSQL
Sbjct  1    MQRSGYGPDGIYRSLRPSLALPNNPNLSLVSFLFTSVSSSPNKTALIDADSSQTLSFSQL  60

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIF  391
            K+QV+++AH L +  G+ KND+ L+ 
Sbjct  61   KTQVAKLAHSLLN-FGINKNDIYLML  85



>ref|XP_001759551.1| predicted protein [Physcomitrella patens]
 gb|EDQ75463.1| predicted protein [Physcomitrella patens]
Length=535

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 92/145 (63%), Gaps = 3/145 (2%)
 Frame = +2

Query  125  ILAMEKSGY-GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLT  301
            ++   +SGY   +G+Y S  PP+V+P D +L +VSF+F    Q+ D+ A+ D  TGR+ T
Sbjct  6    VIVDRRSGYCSSNGVYYSKLPPVVIPEDDSLDLVSFVFAG--QFGDKVALIDPLTGRSFT  63

Query  302  FSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTV  481
            + +L+  V  +A GL   +GVR++DVV I SPNSIDFP  FL     GA+   +NP+ +V
Sbjct  64   YKELERNVRALAAGLFTTVGVRQHDVVAILSPNSIDFPSVFLAITWLGAVVALLNPLNSV  123

Query  482  PELSKQIKDCSPKLIVTVPQLLDKV  556
             EL KQ+ +   K I+T  +LL+KV
Sbjct  124  QELRKQMNNAGAKYIITTAKLLEKV  148



>ref|XP_008673103.1| PREDICTED: uncharacterized protein LOC100280100 isoform X1 [Zea 
mays]
Length=493

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 85/138 (62%), Gaps = 0/138 (0%)
 Frame = +2

Query  143  SGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQ  322
            +GYG DG+YRS R    +  DP LS+   + R  +  P  PA+ DA TGR LTF  L+S 
Sbjct  9    AGYGSDGVYRSPRLVAAIASDPGLSVTDLVLRRAAACPSAPALVDAATGRALTFGALRSA  68

Query  323  VSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQI  502
            V   A  L  + GVR+ D VL+ +PN + +P+CFL   A GA+ATT NP+YT  E++KQ 
Sbjct  69   VLVAAAALSSRAGVRRGDAVLLLAPNCVLYPVCFLAVTALGAVATTANPLYTPREIAKQA  128

Query  503  KDCSPKLIVTVPQLLDKV  556
             D   +L+VTV  LL K+
Sbjct  129  ADARARLVVTVSDLLPKI  146



>tpg|DAA50089.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein [Zea mays]
Length=550

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 85/138 (62%), Gaps = 0/138 (0%)
 Frame = +2

Query  143  SGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQ  322
            +GYG DG+YRS R    +  DP LS+   + R  +  P  PA+ DA TGR LTF  L+S 
Sbjct  9    AGYGSDGVYRSPRLVAAIASDPGLSVTDLVLRRAAACPSAPALVDAATGRALTFGALRSA  68

Query  323  VSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQI  502
            V   A  L  + GVR+ D VL+ +PN + +P+CFL   A GA+ATT NP+YT  E++KQ 
Sbjct  69   VLVAAAALSSRAGVRRGDAVLLLAPNCVLYPVCFLAVTALGAVATTANPLYTPREIAKQA  128

Query  503  KDCSPKLIVTVPQLLDKV  556
             D   +L+VTV  LL K+
Sbjct  129  ADARARLVVTVSDLLPKI  146



>gb|KEH42183.1| 4-coumarate:CoA ligase-like protein [Medicago truncatula]
Length=555

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 88/127 (69%), Gaps = 1/127 (1%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHGL  346
            Y S R  I LP D NLS+ SFLF++ S   D  A+ DA TG  LTF QL+ +VS ++   
Sbjct  13   YSSPRQSINLPTDQNLSLTSFLFQSTSSAADTIALTDAQTGEFLTFRQLEKEVSYLSR-S  71

Query  347  KHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKLI  526
               LG+++ DVV++++PNSI FP+CFL   A GAIATT +P+YTV EL+KQ++D  PKL+
Sbjct  72   LLSLGIKRGDVVMLYAPNSIRFPVCFLAVAAIGAIATTCSPLYTVSELTKQLEDSKPKLV  131

Query  527  VTVPQLL  547
            VTV +L 
Sbjct  132  VTVSELF  138



>ref|XP_002466906.1| hypothetical protein SORBIDRAFT_01g016420 [Sorghum bicolor]
 gb|EER93904.1| hypothetical protein SORBIDRAFT_01g016420 [Sorghum bicolor]
Length=564

 Score =   110 bits (276),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 64/142 (45%), Positives = 85/142 (60%), Gaps = 0/142 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A   +GYG DG+YRS R    +  DP LS+   + R  +  P  PA+ DA TGR LTF  
Sbjct  5    ASPAAGYGSDGVYRSPRAAAQIASDPGLSLADLVLRRAAACPSAPALVDAATGRALTFGS  64

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
            L+S V   A  L  + GVR+ D VL+ +PN + +P+CFL   + GA+ATT NP YT  E+
Sbjct  65   LRSAVLVAAAALSSRAGVRRGDAVLLLAPNCVLYPVCFLAVTSLGAVATTANPRYTPREI  124

Query  491  SKQIKDCSPKLIVTVPQLLDKV  556
            +KQ  D   KL+VTV  LL K+
Sbjct  125  AKQAADARAKLVVTVSDLLPKI  146



>gb|KDP29158.1| hypothetical protein JCGZ_16547 [Jatropha curcas]
Length=479

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHGL  346
            Y S RP + LP DPNLS+ SFLF +         I DAD+  TLTF QL+ QVS++A+ L
Sbjct  12   YVSPRPQVYLPSDPNLSLTSFLFHSTRSTSYSTGIIDADSDETLTFQQLRVQVSKLAYAL  71

Query  347  KHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKD  508
              +L V K+DVVLIF+PNSI FP+CFL  ++  AIA+T NP Y + ELSKQ+KD
Sbjct  72   -LKLNVAKHDVVLIFAPNSIYFPICFLAIVSTAAIASTCNPAYAIFELSKQVKD  124



>ref|XP_001752801.1| predicted protein [Physcomitrella patens]
 gb|EDQ82305.1| predicted protein [Physcomitrella patens]
Length=552

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 90/140 (64%), Gaps = 3/140 (2%)
 Frame = +2

Query  140  KSGY-GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SGY   DGIY S RPP+ +P   N  +VSF+F    Q+ D+ A+ DA TGR+LT++QL+
Sbjct  11   RSGYCSSDGIYYSKRPPVWIPPTRNFDLVSFVFA--PQFGDRVAMVDAPTGRSLTYAQLE  68

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V  VA GL   LGVR+ DVV++ SPNSI+F + F   ++ GA+ TTVN + T  E+ K
Sbjct  69   RNVRVVAAGLYKNLGVRQYDVVMLLSPNSIEFAVVFFAVMSLGAVLTTVNSVNTTGEIQK  128

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            Q+ D   K I+T   L +K+
Sbjct  129  QMNDAGAKFIITTAALTEKI  148



>ref|XP_004985666.1| PREDICTED: 4-coumarate--CoA ligase-like 1-like isoform X2 [Setaria 
italica]
Length=546

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 87/142 (61%), Gaps = 0/142 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A   +GYG DG+YRS RP + +  +P LS+   LFR     P   A+ DA +G+TLTF+ 
Sbjct  5    AAPAAGYGADGVYRSPRPAVRIDSNPGLSLTDLLFRRADACPSALALADAASGQTLTFAA  64

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
             +S V   A  L  + GVR  DVVL+ +PN + +P+CF    A GA+ATT NP+YT  E+
Sbjct  65   FRSAVLTTAVALASRAGVRPGDVVLLLAPNCVLYPVCFFAVTALGAVATTANPLYTPREI  124

Query  491  SKQIKDCSPKLIVTVPQLLDKV  556
            +KQ  D   KL +TV +LL K+
Sbjct  125  AKQATDARAKLAITVSELLPKI  146



>ref|XP_004985665.1| PREDICTED: 4-coumarate--CoA ligase-like 1-like isoform X1 [Setaria 
italica]
Length=546

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 87/142 (61%), Gaps = 0/142 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A   +GYG DG+YRS RP + +  +P LS+   LFR     P   A+ DA +G+TLTF+ 
Sbjct  5    AAPAAGYGADGVYRSPRPAVRIDSNPGLSLTDLLFRRADACPSALALADAASGQTLTFAA  64

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
             +S V   A  L  + GVR  DVVL+ +PN + +P+CF    A GA+ATT NP+YT  E+
Sbjct  65   FRSAVLTTAVALASRAGVRPGDVVLLLAPNCVLYPVCFFAVTALGAVATTANPLYTPREI  124

Query  491  SKQIKDCSPKLIVTVPQLLDKV  556
            +KQ  D   KL +TV +LL K+
Sbjct  125  AKQATDARAKLAITVSELLPKI  146



>sp|Q0DV32.2|4CLL1_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 1 [Oryza sativa Japonica 
Group]
 gb|ABF94022.1| AMP-binding enzyme family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAH01189.1| unnamed protein product [Oryza sativa Japonica Group]
Length=552

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 83/139 (60%), Gaps = 1/139 (1%)
 Frame = +2

Query  143  SGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTL-TFSQLKS  319
            +GYG DG+YRSLRPP  +  DP LS+   L R     P   A+ DA  G    TF++L+S
Sbjct  9    AGYGADGVYRSLRPPAPVASDPGLSLTDLLLRRADACPSAVALADAAAGGRALTFAELRS  68

Query  320  QVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQ  499
             V   A  L  + GVR  D VL+ +PN + +P+CF    A GA+ TTVNP YT  E++KQ
Sbjct  69   AVLSTAVALSSRAGVRPGDAVLLLAPNCVLYPVCFFAVTALGAVGTTVNPDYTPREIAKQ  128

Query  500  IKDCSPKLIVTVPQLLDKV  556
            + D   KL++T+  L+ K+
Sbjct  129  VSDARAKLVITISALVPKI  147



>gb|EEC74534.1| hypothetical protein OsI_10054 [Oryza sativa Indica Group]
Length=587

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 83/139 (60%), Gaps = 1/139 (1%)
 Frame = +2

Query  143  SGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTL-TFSQLKS  319
            +GYG DG+YRSLRPP  +  DP LS+   L R     P   A+ DA  G    TF++L+S
Sbjct  9    AGYGADGVYRSLRPPAPVASDPGLSLTDLLLRRADACPSALALADAAAGGRALTFAELRS  68

Query  320  QVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQ  499
             V   A  L  + GVR  D VL+ +PN + +P+CF    A GA+ TTVNP YT  E++KQ
Sbjct  69   AVLSTAVALSSRAGVRPGDAVLLLAPNCVLYPVCFFAVTALGAVGTTVNPDYTPREIAKQ  128

Query  500  IKDCSPKLIVTVPQLLDKV  556
            + D   KL++T+  L+ K+
Sbjct  129  VSDARAKLVITISALVPKI  147



>gb|EEE58336.1| hypothetical protein OsJ_09444 [Oryza sativa Japonica Group]
Length=598

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 83/139 (60%), Gaps = 1/139 (1%)
 Frame = +2

Query  143  SGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTL-TFSQLKS  319
            +GYG DG+YRSLRPP  +  DP LS+   L R     P   A+ DA  G    TF++L+S
Sbjct  9    AGYGADGVYRSLRPPAPVASDPGLSLTDLLLRRADACPSAVALADAAAGGRALTFAELRS  68

Query  320  QVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQ  499
             V   A  L  + GVR  D VL+ +PN + +P+CF    A GA+ TTVNP YT  E++KQ
Sbjct  69   AVLSTAVALSSRAGVRPGDAVLLLAPNCVLYPVCFFAVTALGAVGTTVNPDYTPREIAKQ  128

Query  500  IKDCSPKLIVTVPQLLDKV  556
            + D   KL++T+  L+ K+
Sbjct  129  VSDARAKLVITISALVPKI  147



>ref|XP_002982252.1| hypothetical protein SELMODRAFT_179406 [Selaginella moellendorffii]
 gb|EFJ16497.1| hypothetical protein SELMODRAFT_179406 [Selaginella moellendorffii]
Length=553

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 91/145 (63%), Gaps = 5/145 (3%)
 Frame = +2

Query  137  EKSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQP---AIHDADTGRTLTF  304
            + SGY   DGIY SL  P+ +P  P+L  VS++F      P+     AI D  +G++LT 
Sbjct  6    QGSGYRECDGIYASLASPVAMPLHPHLDFVSYMFSQRFGRPESASNVAIVDGKSGQSLTC  65

Query  305  SQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVP  484
            SQL+  +  VA GL H+ G+R+ DVV+I  PNS++FP+ F  A+  GA+ TT+NP  T  
Sbjct  66   SQLRRSIEAVATGL-HESGIRQGDVVMILLPNSLEFPVMFNAALRIGAVVTTMNPQNTPA  124

Query  485  ELSKQIKDCSPKLIVTVPQLLDKVK  559
            E+++Q+ D  PK+++T    +DKV+
Sbjct  125  EIARQMLDSRPKMVLTNRAGVDKVR  149



>ref|XP_001761993.1| predicted protein [Physcomitrella patens]
 gb|EDQ73097.1| predicted protein [Physcomitrella patens]
Length=552

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 89/140 (64%), Gaps = 3/140 (2%)
 Frame = +2

Query  140  KSGY-GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SGY   DGIY S R P+ +P+  +L + S++F    Q+ D+ A+ DA +GR LT+ QL+
Sbjct  11   RSGYRSSDGIYFSKRKPVWIPQACDLDLGSYVFA--PQFGDKKALMDAPSGRHLTYDQLE  68

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
             QV  +A GL   L VR+ DVV++ SPN I+FP+ FL  ++ GA+ TTV+   T  E+ K
Sbjct  69   RQVRALAAGLYKCLNVRQYDVVMLLSPNCIEFPVIFLAVVSLGAVLTTVHQANTAGEVQK  128

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            Q+KD   +LI T   L +K+
Sbjct  129  QMKDSGTRLIFTTAALTEKI  148



>ref|XP_002985866.1| hypothetical protein SELMODRAFT_446445 [Selaginella moellendorffii]
 gb|EFJ13043.1| hypothetical protein SELMODRAFT_446445 [Selaginella moellendorffii]
Length=545

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 84/136 (62%), Gaps = 4/136 (3%)
 Frame = +2

Query  161  GIYRSLRPPIVLPR-DPNLSMVSFLFRNISQ--YPDQPAIHDADTGRTLTFSQLKSQVSR  331
            GIY S RP + +P       +V FL    S      + A+ DA TG  +TFSQL+ ++S 
Sbjct  10   GIYSSCRPALSMPSPGATGGIVQFLLERTSDPGISSKLALVDAITGERVTFSQLRRRISV  69

Query  332  VAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDC  511
            +A GL  +LGVR+ DVVLI SPNSI F   FL  I  GAI TTVNP+ T  E++KQ +D 
Sbjct  70   IAQGLI-ELGVRRGDVVLILSPNSIQFVESFLAVIFVGAILTTVNPLNTAEEIAKQARDS  128

Query  512  SPKLIVTVPQLLDKVK  559
            SP L++T  +L DKV+
Sbjct  129  SPSLVITTLELADKVQ  144



>ref|XP_002984802.1| hypothetical protein SELMODRAFT_181279 [Selaginella moellendorffii]
 gb|EFJ14052.1| hypothetical protein SELMODRAFT_181279 [Selaginella moellendorffii]
Length=545

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 84/136 (62%), Gaps = 4/136 (3%)
 Frame = +2

Query  161  GIYRSLRPPIVLPR-DPNLSMVSFLFRNISQ--YPDQPAIHDADTGRTLTFSQLKSQVSR  331
            GIY S RP + +P       +V FL    S      + A+ DA TG  +TFSQL+ ++S 
Sbjct  10   GIYSSCRPALSMPSPGATGGIVQFLLERTSDPGISSKLALVDAITGERVTFSQLRRRISV  69

Query  332  VAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDC  511
            +A GL  +LGVR+ DVVLI SPNSI F   FL  I  GAI TTVNP+ T  E++KQ +D 
Sbjct  70   IAQGLI-ELGVRRGDVVLILSPNSIQFVESFLAVIFVGAILTTVNPLNTAEEIAKQARDS  128

Query  512  SPKLIVTVPQLLDKVK  559
            SP L++T  +L DKV+
Sbjct  129  SPSLVITTLELADKVQ  144



>gb|EPS72162.1| hypothetical protein M569_02598, partial [Genlisea aurea]
Length=546

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 85/136 (63%), Gaps = 7/136 (5%)
 Frame = +2

Query  161  GIYRSLRPPIVLPRDPNLSMVSFLF--RNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            GIY S  P + LP  PNL +VS++F  R+     D PA+ D+ +G ++T S L+S V  V
Sbjct  7    GIYTSKYPSVNLPSSPNLDVVSYIFSHRHGGGGDDAPAVIDSSSGISITHSTLRSLVKTV  66

Query  335  AHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCS  514
            A G+ H +GV+K D V+I  PNS  FP+ FL A++ GA+A   NP+ ++PE+ KQ  DC 
Sbjct  67   ASGM-HSIGVQKGDAVMILLPNSPFFPVVFLAALSLGAVAAPANPLCSLPEIGKQAVDCM  125

Query  515  PKLIVTV----PQLLD  550
            P ++ TV    P+L D
Sbjct  126  PAVVFTVQNRAPELAD  141



>ref|XP_006416394.1| hypothetical protein EUTSA_v10007272mg [Eutrema salsugineum]
 gb|ESQ34747.1| hypothetical protein EUTSA_v10007272mg [Eutrema salsugineum]
Length=552

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 86/142 (61%), Gaps = 7/142 (5%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQ--PAIHDADTGRTLTFSQ  310
            +SG+ R +  + S R P+ LP +P+L + +F    IS  P +   A  DA TG  L+FS 
Sbjct  18   RSGFCRSNSTFYSKRTPLTLPANPSLDVTTF----ISSQPHRGTTAFIDAATGHRLSFSD  73

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
            L   V RVA  L H++G+RK DVVLI SPNSI  P+  L  ++ GA+ TT N + TV E+
Sbjct  74   LWRAVDRVADYLHHEIGIRKGDVVLILSPNSIHVPVVCLSVMSLGAVLTTANTLNTVGEI  133

Query  491  SKQIKDCSPKLIVTVPQLLDKV  556
            SKQI D +PKL  T P L  K+
Sbjct  134  SKQISDSNPKLAFTTPDLAPKL  155



>ref|XP_010087995.1| 4-coumarate--CoA ligase-like 6 [Morus notabilis]
 gb|EXB31005.1| 4-coumarate--CoA ligase-like 6 [Morus notabilis]
Length=554

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 3/130 (2%)
 Frame = +2

Query  161  GIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAH  340
            GIY S  PP  LP D  L +VSFLF    Q+    A+ DA +G ++ +S+L S V  +A 
Sbjct  26   GIYNSTHPPRNLPSDTFLDVVSFLFS--CQHKGVSALIDASSGVSIPYSELYSSVKSMAS  83

Query  341  GLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPK  520
            GL H  GV K DVVL+  PNSI FP+  LG + +GAI T +NP+ +V E+ K++ DC P 
Sbjct  84   GL-HSTGVTKGDVVLVMLPNSIYFPVVLLGVLHSGAIFTPMNPLSSVTEIEKRVADCKPC  142

Query  521  LIVTVPQLLD  550
            L  TVP+ +D
Sbjct  143  LAFTVPEKVD  152



>ref|XP_002966178.1| hypothetical protein SELMODRAFT_143817 [Selaginella moellendorffii]
 gb|EFJ32205.1| hypothetical protein SELMODRAFT_143817 [Selaginella moellendorffii]
Length=553

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 90/145 (62%), Gaps = 5/145 (3%)
 Frame = +2

Query  137  EKSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQP---AIHDADTGRTLTF  304
            + SGY   DGIY SL  P+ +P  P+L  VS++F      P+     AI D  +G++LT 
Sbjct  6    QGSGYRECDGIYSSLASPVAMPLHPHLDFVSYMFSQRFGRPESASNVAILDGKSGQSLTC  65

Query  305  SQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVP  484
            SQL+  +  VA GL H+ G+ + DVV+I  PN+++FP+ F  A+  GA+ TT+NP  T  
Sbjct  66   SQLRRSIEAVATGL-HESGICQGDVVMILLPNTLEFPVMFNAALRIGAVVTTMNPQNTPA  124

Query  485  ELSKQIKDCSPKLIVTVPQLLDKVK  559
            E+++Q+ D  PK+++T    +DKV+
Sbjct  125  EIARQMLDSRPKMVLTNRAGVDKVR  149



>gb|AJT43268.1| 4-coumarate: coenzyme A ligase [Plagiochasma appendiculatum]
Length=547

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 89/144 (62%), Gaps = 5/144 (3%)
 Frame = +2

Query  128  LAMEKSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTF  304
            +  EKSGY   DGIY S  P I  PRD +++    +F+   QY D+ A+ DA TG  LT+
Sbjct  1    MGYEKSGYRESDGIYDSSFPSIPTPRDIDVTTYC-IFQQ--QYGDRVALIDAVTGAKLTY  57

Query  305  SQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVP  484
            S+L+S +  VA GL  Q GV++ DVV+I  PNSI +P+   G++  GA+ TT NP+  V 
Sbjct  58   SELRSAIDSVAAGLA-QSGVKQGDVVMICMPNSIHWPILLFGSLRIGAVVTTANPVGNVQ  116

Query  485  ELSKQIKDCSPKLIVTVPQLLDKV  556
            E+ +Q KD     ++TVP+L  K+
Sbjct  117  EIGRQAKDSRTAYLITVPELCGKL  140



>ref|XP_006416393.1| hypothetical protein EUTSA_v10007280mg [Eutrema salsugineum]
 gb|ESQ34746.1| hypothetical protein EUTSA_v10007280mg [Eutrema salsugineum]
Length=549

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 89/155 (57%), Gaps = 7/155 (5%)
 Frame = +2

Query  101  FTNFHFLRILAMEKSGY-GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQ--PAI  271
             TN   L  L   ++G+   +  + S R P+ LP + +L + +F    IS  P +   A 
Sbjct  1    MTNSQKLSSLIDSRNGFCNANSTFYSKRNPLPLPANTSLDITTF----ISSQPHRGTTAF  56

Query  272  HDADTGRTLTFSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagai  451
             DA TG  ++FS L   V+RVA  L H +G+R+ DVVLI SPNSI  P+  L  ++ GA+
Sbjct  57   IDAATGHRISFSDLWRAVNRVADCLHHDVGIRRGDVVLILSPNSISIPVVCLAVMSLGAV  116

Query  452  attVNPMYTVPELSKQIKDCSPKLIVTVPQLLDKV  556
             TT NP+ T  E+S+QI D +PKL  T P+L  KV
Sbjct  117  VTTSNPLNTAGEISRQISDSNPKLAFTTPELAPKV  151



>gb|AHI15919.1| 4-coumarate:CoA ligase 3 [Dryopteris fragrans]
Length=543

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 85/133 (64%), Gaps = 3/133 (2%)
 Frame = +2

Query  155  RDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            R  ++ S R PI +P  P + M+S LF    ++  + AI DA TG+ LTF QL+  +  V
Sbjct  9    RSFVFSSPRAPIHIP--PEVDMLSCLFSLGRRFHHRLAIADASTGQALTFLQLQRHIHSV  66

Query  335  AHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCS  514
            A  L   +G++++DVVLI SPNS+ FP+ F   I+ GA+ATTVNP+    E+ KQ+ D  
Sbjct  67   ARALSF-VGIKQHDVVLILSPNSVHFPVLFFAIISLGAVATTVNPVCVPSEICKQVTDSK  125

Query  515  PKLIVTVPQLLDK  553
             KLI+TVP+L DK
Sbjct  126  AKLILTVPELSDK  138



>ref|XP_006307155.1| hypothetical protein CARUB_v10008746mg [Capsella rubella]
 gb|EOA40053.1| hypothetical protein CARUB_v10008746mg [Capsella rubella]
Length=555

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 84/142 (59%), Gaps = 3/142 (2%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEK     D I+RS  P I +P   +LS+  ++F+NIS +  +P + +  TG   T+S +
Sbjct  8    MEKQSNNGDVIFRSKLPDIYIPN--HLSLHDYVFQNISDFASKPCLINGPTGHVYTYSDV  65

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
                 R+A G  H+LGV +NDV++I  PN  +F L FL A   GA AT  NP +T  E++
Sbjct  66   HVISRRIAAGF-HKLGVNQNDVIMILLPNCPEFVLSFLAASFRGATATAANPFFTPAEIA  124

Query  494  KQIKDCSPKLIVTVPQLLDKVK  559
            KQ K  + KLIVT  + +DK+K
Sbjct  125  KQAKASNTKLIVTESRYVDKIK  146



>ref|XP_002512781.1| AMP dependent CoA ligase, putative [Ricinus communis]
 gb|EEF49284.1| AMP dependent CoA ligase, putative [Ricinus communis]
Length=544

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 88/135 (65%), Gaps = 3/135 (2%)
 Frame = +2

Query  155  RDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
             D ++RS  P I +P+  NLS+ S++F+NIS Y  +P + +  TGR  T+++++    RV
Sbjct  10   EDIVFRSKLPDIYIPK--NLSLHSYIFQNISDYSSKPCLINGATGRVYTYAEVEITSRRV  67

Query  335  AHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCS  514
            A GL ++LGV++ +V+++   NS +F L FLGA   GAIAT  NP++T  E++KQ K  +
Sbjct  68   ASGL-NKLGVKQGEVIMLLLHNSPEFVLSFLGASYRGAIATAANPLFTSAEIAKQAKASN  126

Query  515  PKLIVTVPQLLDKVK  559
             KLI+T     DKVK
Sbjct  127  TKLIITQAAYADKVK  141



>ref|XP_006290853.1| hypothetical protein CARUB_v10016963mg [Capsella rubella]
 gb|EOA23751.1| hypothetical protein CARUB_v10016963mg [Capsella rubella]
Length=550

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 80/133 (60%), Gaps = 2/133 (2%)
 Frame = +2

Query  158  DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVA  337
            D  + S R P+ LP + +L++ +F+  +   +    A  DA T   ++FS L   V RVA
Sbjct  21   DSTFYSKRKPLALPSNDSLNVTTFI--SSQTHHGTTAFIDASTDHCISFSDLWRAVDRVA  78

Query  338  HGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSP  517
              L+H +G+RK DVVL+ SPNSI  P+  L  ++ GA+ TT NP+ T  E+S+QI D +P
Sbjct  79   DSLQHDVGIRKGDVVLVLSPNSITIPIVCLSVMSLGAVVTTANPLNTSGEISRQIADSNP  138

Query  518  KLIVTVPQLLDKV  556
            KL  T P+L  K+
Sbjct  139  KLAFTTPELAPKL  151



>ref|XP_010463387.1| PREDICTED: 4-coumarate--CoA ligase 1-like [Camelina sativa]
Length=360

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 88/146 (60%), Gaps = 4/146 (3%)
 Frame = +2

Query  122  RILAMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLT  301
             ++  ++S  G D I+RS  P I +P   +LS+  ++F+N+SQ+  +P + +  TG   T
Sbjct  6    EVMEKKQSNNG-DVIFRSKLPDIYIPN--HLSLHDYIFQNLSQFASKPCLINGPTGHVYT  62

Query  302  FSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTV  481
            +S +     ++A G  H+LGV +NDVV+I  PN  +F L FL A   GA AT  NP +T 
Sbjct  63   YSDVHVISRQIAAGF-HKLGVNQNDVVMILLPNCPEFVLSFLAASFRGATATAANPFFTP  121

Query  482  PELSKQIKDCSPKLIVTVPQLLDKVK  559
             E++KQ K  + KLIVT  + +DKVK
Sbjct  122  AEIAKQAKASNTKLIVTESRYVDKVK  147



>gb|AGA17922.1| CCL5 [Humulus lupulus]
Length=551

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 87/141 (62%), Gaps = 4/141 (3%)
 Frame = +2

Query  137  EKSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            E+SGY + + I+ S R P+ LP++ ++ + +F+      +  + A  DA TGR LTF QL
Sbjct  11   ERSGYCKSNSIFYSKREPVQLPQNHSVDVTTFISSR--AHHGKIAFIDAATGRHLTFPQL  68

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
               V  VA  L   +G+RK DV+L+ SPNSI FP+  L  ++ GAI TT NP+ T  E++
Sbjct  69   WRAVDSVATCLS-AMGIRKGDVILLLSPNSIYFPVVCLAVMSLGAIITTTNPLNTPREIA  127

Query  494  KQIKDCSPKLIVTVPQLLDKV  556
            KQI D  P L  T+PQL+ K+
Sbjct  128  KQITDSKPVLAFTIPQLVSKI  148



>ref|XP_010935869.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Elaeis guineensis]
Length=568

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 60/136 (44%), Positives = 83/136 (61%), Gaps = 10/136 (7%)
 Frame = +2

Query  155  RDGIYRS-LRPPIVLPRDPNLSMVSFLFRNISQYPD------QPAIHDADTGRTLTFSQL  313
            R GIYRS  RP   LP +P L   SF+   +SQ+P       + A+ DA TGR +TFS L
Sbjct  25   RTGIYRSPHRPCHQLPANPALDAASFV---LSQFPPPHLAEIKIALVDAATGRRVTFSDL  81

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
            +     +A  L+H LG++K DVVL+ SPNSI +P   LG ++AGA+ TT NP+ T  E++
Sbjct  82   RRSALALAATLRHALGIQKGDVVLLLSPNSILYPAIVLGVLSAGAVVTTANPLNTAAEVA  141

Query  494  KQIKDCSPKLIVTVPQ  541
            KQ +D   KL +  P+
Sbjct  142  KQARDSGAKLAIAAPE  157



>ref|XP_010479663.1| PREDICTED: 4-coumarate--CoA ligase 1 [Camelina sativa]
Length=556

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 88/146 (60%), Gaps = 4/146 (3%)
 Frame = +2

Query  122  RILAMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLT  301
             ++  ++S  G D I+RS  P I +P   +LS+  ++F+N+SQ+  +P + +  TG   T
Sbjct  6    EVMEKKQSNNG-DVIFRSKLPDIYIPN--HLSLHDYIFQNLSQFASKPCLINGPTGHVYT  62

Query  302  FSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTV  481
            +S +     R+A G  H+LGV +NDVV+I  PN  +F L FL A   GA AT  NP +T 
Sbjct  63   YSDVHVISRRIAAGF-HKLGVNQNDVVMILLPNCPEFVLSFLAASFRGATATAANPFFTP  121

Query  482  PELSKQIKDCSPKLIVTVPQLLDKVK  559
             E++KQ K  + KLIVT  + +DKVK
Sbjct  122  AEIAKQAKASNTKLIVTESRYVDKVK  147



>ref|XP_010459732.1| PREDICTED: 4-coumarate--CoA ligase-like 4 [Camelina sativa]
Length=551

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 83/137 (61%), Gaps = 3/137 (2%)
 Frame = +2

Query  137  EKSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            ++SG+ + +  + S R P+ LP +P+L + +F+  +   +    A  DA TG  L+F+ L
Sbjct  12   QRSGFCKSNSTFYSKRNPLSLPPNPSLDVTTFI--SSQTHGGTTAFIDAATGHRLSFTDL  69

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
               V RVA  L H++G+R+ DVVLI SPNSI  P+  L  ++ GA+ TT N + T  E+S
Sbjct  70   WKAVDRVADCLYHEVGIRRGDVVLILSPNSIYIPVVCLSVMSLGAVVTTANTLNTAGEIS  129

Query  494  KQIKDCSPKLIVTVPQL  544
            KQI DC+P L  T  QL
Sbjct  130  KQIADCNPTLAFTTRQL  146



>ref|XP_010463388.1| PREDICTED: 4-coumarate--CoA ligase 1-like [Camelina sativa]
Length=370

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 88/146 (60%), Gaps = 4/146 (3%)
 Frame = +2

Query  122  RILAMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLT  301
             ++  ++S  G D I+RS  P I +P   +LS+  ++F+N+SQ+  +P + +  TG   T
Sbjct  6    EVMEKKQSNNG-DVIFRSKLPDIYIPN--HLSLHDYIFQNLSQFASKPCLINGPTGHVYT  62

Query  302  FSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTV  481
            +S +     ++A G  H+LGV +NDVV+I  PN  +F L FL A   GA AT  NP +T 
Sbjct  63   YSDVHVISRQIAAGF-HKLGVNQNDVVMILLPNCPEFVLSFLAASFRGATATAANPFFTP  121

Query  482  PELSKQIKDCSPKLIVTVPQLLDKVK  559
             E++KQ K  + KLIVT  + +DKVK
Sbjct  122  AEIAKQAKASNTKLIVTESRYVDKVK  147



>gb|ACF80143.2| unknown [Zea mays]
 tpg|DAA43422.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein [Zea mays]
 tpg|DAA43423.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein [Zea mays]
Length=408

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 59/99 (60%), Gaps = 0/99 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A   +GYG DG+YRS RP + +  D  LS+   LFR     P   A+ D+ TG++LTF+ 
Sbjct  5    AAPAAGYGEDGVYRSPRPAVRIESDTGLSLNDLLFRRADVCPSALALVDSATGQSLTFAA  64

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFL  427
             +S V   A  L  + GVR+ DVVL F+PN   +P+CFL
Sbjct  65   FRSAVLTTAVALSSRAGVRRGDVVLFFAPNCFLYPVCFL  103



>gb|AIE16382.1| 4-coumarate:CoA ligase, partial [Glycine max]
 gb|AIE16383.1| 4-coumarate:CoA ligase, partial [Glycine max]
 gb|AIE16386.1| 4-coumarate:CoA ligase, partial [Glycine max]
 gb|AIE16390.1| 4-coumarate:CoA ligase, partial [Glycine soja]
 gb|AIE16391.1| 4-coumarate:CoA ligase, partial [Glycine soja]
 gb|AIE16392.1| 4-coumarate:CoA ligase, partial [Glycine soja]
 gb|AIE16394.1| 4-coumarate:CoA ligase, partial [Glycine soja]
 gb|AIE16395.1| 4-coumarate:CoA ligase, partial [Glycine soja]
 gb|AIE16399.1| 4-coumarate:CoA ligase, partial [Glycine soja]
 gb|AIE16400.1| 4-coumarate:CoA ligase, partial [Glycine soja]
 gb|AIE16401.1| 4-coumarate:CoA ligase, partial [Glycine soja]
 gb|AIE16402.1| 4-coumarate:CoA ligase, partial [Glycine max]
 gb|AIE16403.1| 4-coumarate:CoA ligase, partial [Glycine soja]
 gb|AIE16407.1| 4-coumarate:CoA ligase, partial [Glycine max]
 gb|AIE16408.1| 4-coumarate:CoA ligase, partial [Glycine max]
 gb|AIE16409.1| 4-coumarate:CoA ligase, partial [Glycine max]
 gb|AIE16410.1| 4-coumarate:CoA ligase, partial [Glycine max]
 gb|AIE16411.1| 4-coumarate:CoA ligase, partial [Glycine max]
Length=224

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 81/131 (62%), Gaps = 3/131 (2%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHGL  346
            +RS  P I +P   +L + S+ F+N+SQ+ D+P + D DTG TLT++ +     R+A GL
Sbjct  1    FRSPLPDIPIPT--HLPLYSYCFQNLSQFHDRPCLIDGDTGETLTYADVDLAARRIASGL  58

Query  347  KHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKLI  526
             H++G+R+ DV+++   N   F L FLGA   GA+ TT NP YT  EL+KQ      +L+
Sbjct  59   -HKIGIRQGDVIMLVLRNCPQFALAFLGATHRGAVVTTANPFYTPAELAKQATATKTRLV  117

Query  527  VTVPQLLDKVK  559
            +T    ++K+K
Sbjct  118  ITQSAYVEKIK  128



>emb|CDY33628.1| BnaC08g19280D [Brassica napus]
Length=552

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 86/142 (61%), Gaps = 7/142 (5%)
 Frame = +2

Query  140  KSGY-GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQ--PAIHDADTGRTLTFSQ  310
            +SG+   +  + S R P+ LP + +L + +F    IS  P +   A  DA TGR ++FS+
Sbjct  17   RSGFCNENSTFYSKRNPLPLPANTSLDVTTF----ISSQPHRGTTAFIDAATGRRISFSE  72

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
            L + V+RVA  L   +GVRK DVVL+ SPNSI  P+  L  ++ GA+ TT NP+ T  E+
Sbjct  73   LWTAVNRVADCLHRDVGVRKGDVVLVLSPNSISIPIVCLSVMSLGAVVTTANPLNTAGEI  132

Query  491  SKQIKDCSPKLIVTVPQLLDKV  556
            S+Q+ D +P L  T P+L  K+
Sbjct  133  SRQMADSNPVLAFTTPELSQKL  154



>gb|AIE16393.1| 4-coumarate:CoA ligase, partial [Glycine soja]
Length=224

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 81/131 (62%), Gaps = 3/131 (2%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHGL  346
            +RS  P I +P   +L + S+ F+N+SQ+ D+P + D DTG TLT++ +     R+A GL
Sbjct  1    FRSPLPDIPIPT--HLPLYSYCFQNLSQFHDRPCLIDGDTGETLTYADVDLAARRIASGL  58

Query  347  KHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKLI  526
             H++G+R+ DV+++   N   F L FLGA   GA+ TT NP YT  EL+KQ      +L+
Sbjct  59   -HKIGIRQGDVIMLVLRNCPQFALAFLGATHRGAVVTTANPFYTPAELAKQATATKTRLV  117

Query  527  VTVPQLLDKVK  559
            +T    ++K+K
Sbjct  118  ITQSAYVEKIK  128



>ref|XP_010664596.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X2 [Vitis vinifera]
Length=513

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 82/134 (61%), Gaps = 3/134 (2%)
 Frame = +2

Query  155  RDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
              GIY S  P + +P DP+L +VSF+F     +    A+ D  +G ++++SQL   V  +
Sbjct  37   ETGIYSSTYPSLPIPSDPHLDIVSFIFSK--NHNGVSALTDYSSGFSISYSQLHPLVKSM  94

Query  335  AHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCS  514
            A GL HQ+G  + DV+L+  PNSI FP+ FL  ++ G IATT+NP+ ++ E+ KQ   CS
Sbjct  95   ASGL-HQMGFSQGDVILLLLPNSIYFPVIFLAVLSLGGIATTMNPLSSLTEIRKQTVGCS  153

Query  515  PKLIVTVPQLLDKV  556
              L  TVP+  +K+
Sbjct  154  LSLAFTVPETSEKL  167



>gb|AAF91309.1|AF239686_1 4-coumarate:coA ligase 2 [Rubus idaeus]
Length=544

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 85/132 (64%), Gaps = 3/132 (2%)
 Frame = +2

Query  164  IYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHG  343
            I+RS  P I +P   +L + ++ F NISQ+ D+P + + +TG T T+++++    RVA G
Sbjct  12   IFRSKLPDIYIPN--HLPLHTYCFENISQFHDRPCLINGNTGETFTYAEVELTSRRVAAG  69

Query  344  LKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKL  523
            L  +LG+++NDVV++   N  +F   FLGA   GA++TT NP YT  E++KQ K  + KL
Sbjct  70   LD-KLGIQQNDVVMLLLQNCPEFAFAFLGASYIGAMSTTANPFYTPAEVAKQAKASNAKL  128

Query  524  IVTVPQLLDKVK  559
            I+T    +DKVK
Sbjct  129  IITQSAYVDKVK  140



>ref|XP_010111547.1| 4-coumarate--CoA ligase-like 6 [Morus notabilis]
 gb|EXC31205.1| 4-coumarate--CoA ligase-like 6 [Morus notabilis]
Length=619

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 76/127 (60%), Gaps = 3/127 (2%)
 Frame = +2

Query  161  GIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAH  340
            GIY S  PPI LP DP L  VSFLF    Q+    A+ DA +G ++ +S+L   V   A 
Sbjct  26   GIYNSTYPPINLPSDPFLDAVSFLFSR--QHEGVTALIDAPSGISIPYSELYPLVKSFAS  83

Query  341  GLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPK  520
            GL H  GV K DVVL+  PNS+ FP+  +G +  GAI T +NP+ +V E+ K++ DC P 
Sbjct  84   GL-HSKGVSKGDVVLVLLPNSVYFPVIIMGVMYLGAIFTPMNPLSSVTEIKKRVTDCKPC  142

Query  521  LIVTVPQ  541
            L  T P+
Sbjct  143  LAFTAPE  149



>gb|AFG26323.1| 4-coumarate-CoA ligase [Cinnamomum osmophloeum]
Length=539

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 81/135 (60%), Gaps = 3/135 (2%)
 Frame = +2

Query  155  RDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            +D I++S  P I +P   ++ + S+ F+NI  + D+P I D  TG   T++ ++    +V
Sbjct  5    KDHIFKSKLPDIYIPN--HIPLHSYCFQNIHHFADRPCIIDGATGDIFTYADVELTSRKV  62

Query  335  AHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCS  514
            A GL H LGV K DV++I  PN  +F   FLGA   GA  TT NP YT  E+SKQ K C+
Sbjct  63   AAGL-HHLGVEKGDVIMILLPNCPEFVFAFLGASYRGATTTTANPFYTPQEVSKQAKACN  121

Query  515  PKLIVTVPQLLDKVK  559
              +++T  Q +DK++
Sbjct  122  ACVVITQSQYVDKLR  136



>gb|AIE16387.1| 4-coumarate:CoA ligase, partial [Glycine soja]
Length=224

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 80/131 (61%), Gaps = 3/131 (2%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHGL  346
            +RS  P I +P    L + S+ F+N+SQ+ D+P + D DTG TLT++ +     R+A GL
Sbjct  1    FRSPLPDISIPT--YLPLYSYCFQNLSQFHDRPCLIDGDTGETLTYADVDLAARRIASGL  58

Query  347  KHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKLI  526
             H++G+R+ DV+++   N   F L FLGA   GA+ TT NP YT  EL+KQ      +L+
Sbjct  59   -HKIGIRQGDVIMLVLRNCPQFALAFLGATHRGAVVTTANPFYTPAELAKQATATKTRLV  117

Query  527  VTVPQLLDKVK  559
            +T    ++K+K
Sbjct  118  ITQSAYVEKIK  128



>ref|XP_002979037.1| hypothetical protein SELMODRAFT_268211 [Selaginella moellendorffii]
 gb|EFJ19994.1| hypothetical protein SELMODRAFT_268211 [Selaginella moellendorffii]
Length=532

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 81/146 (55%), Gaps = 3/146 (2%)
 Frame = +2

Query  128  LAMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQ---PAIHDADTGRTL  298
            +A  K GYG DGIYRSL PP+ +P   + S+ + LF      P     P + D+ TG T+
Sbjct  1    MAEVKGGYGEDGIYRSLFPPVPIPLQTHHSLPALLFSGPLADPSNSSSPLLVDSTTGFTI  60

Query  299  TFSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYT  478
                 +     VA GL   LGV + DVVL+   N++ FP+ F   ++ GA+ATT NP  T
Sbjct  61   HCGDFQRLAKSVASGLSSILGVSQGDVVLLLLGNTVYFPILFAAILSIGAVATTANPANT  120

Query  479  VPELSKQIKDCSPKLIVTVPQLLDKV  556
              E+ +Q++D     +VT+P L+ K+
Sbjct  121  AAEIERQLRDSRAGFVVTMPDLIAKI  146



>ref|XP_010500746.1| PREDICTED: 4-coumarate--CoA ligase 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010500747.1| PREDICTED: 4-coumarate--CoA ligase 1-like isoform X2 [Camelina 
sativa]
Length=556

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 88/146 (60%), Gaps = 4/146 (3%)
 Frame = +2

Query  122  RILAMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLT  301
             ++  ++S  G D I+RS  P I +P   +LS+  ++F+N+SQ+  +P + +  TG   T
Sbjct  6    EVMEKKQSNNG-DVIFRSKLPDIYIPN--HLSLHDYIFQNLSQFASKPCLINGPTGHVYT  62

Query  302  FSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTV  481
            +S +     ++A G  H+LGV +NDVV+I  PN  +F L FL A   GA AT  NP +T 
Sbjct  63   YSDVHVISRQIAAGF-HKLGVNQNDVVMILLPNCPEFVLSFLAASFRGATATAANPFFTP  121

Query  482  PELSKQIKDCSPKLIVTVPQLLDKVK  559
             E++KQ K  + KLIVT  + +DKVK
Sbjct  122  AEIAKQAKASNTKLIVTESRYVDKVK  147



>ref|XP_010090435.1| 4-coumarate--CoA ligase-like 5 [Morus notabilis]
 gb|EXB39450.1| 4-coumarate--CoA ligase-like 5 [Morus notabilis]
Length=572

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 87/143 (61%), Gaps = 12/143 (8%)
 Frame = +2

Query  155  RDGIYRSLR---PPIVLPRDPNLSMVSFLFRNISQYPD------QPAIHDADTGRTLTFS  307
            R+GIYRSL        +P+DPNL   +F+   +SQ+P       + A+ D+ T + +T++
Sbjct  28   RNGIYRSLHCLGERHKIPKDPNLDTATFV---LSQFPSLHHAELRIALIDSATNQRVTYA  84

Query  308  QLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPE  487
            QL   V  +A GL+H L ++KNDVV + SPNS+ +P   L  ++ GAI TT NP+ T  E
Sbjct  85   QLHRSVLSLASGLQHALKIQKNDVVFVLSPNSLLYPTICLAVLSIGAILTTANPLNTESE  144

Query  488  LSKQIKDCSPKLIVTVPQLLDKV  556
            ++KQ+ D  PKL ++ P  L K+
Sbjct  145  IAKQVSDSDPKLAISGPDELHKL  167



>ref|XP_001754050.1| predicted protein [Physcomitrella patens]
 gb|EDQ80951.1| predicted protein [Physcomitrella patens]
Length=521

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 85/141 (60%), Gaps = 4/141 (3%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+ + +GIY S+ P   LP  P + +V+ +F    +  D  A+ DA +G+ LTF++L+
Sbjct  9    RSGFCKSNGIYYSMMPSTPLPSYP-IDLVTHIFA--PKCGDTVAVVDARSGKKLTFAELE  65

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V  VA GL   L ++K+DVV I SPNSI+F + FL   + G I TT+NP+ T  ++ K
Sbjct  66   ETVRVVAAGLWQHLRIKKSDVVCILSPNSIEFEILFLAIASLGGIMTTLNPLNTNADIKK  125

Query  497  QIKDCSPKLIVTVPQLLDKVK  559
            Q      K I TVP+LL K +
Sbjct  126  QTATAGAKYIFTVPELLSKAQ  146



>ref|XP_010462003.1| PREDICTED: 4-coumarate--CoA ligase 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010462004.1| PREDICTED: 4-coumarate--CoA ligase 1-like isoform X2 [Camelina 
sativa]
Length=556

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 88/146 (60%), Gaps = 4/146 (3%)
 Frame = +2

Query  122  RILAMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLT  301
             ++  ++S  G D I+RS  P I +P   +LS+  ++F+N+SQ+  +P + +  TG   T
Sbjct  6    EVMEKKQSNNG-DVIFRSKLPDIYIPN--HLSLHDYIFQNLSQFASKPCLINGPTGHVYT  62

Query  302  FSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTV  481
            +S +     ++A G  H+LGV +NDVV+I  PN  +F L FL A   GA AT  NP +T 
Sbjct  63   YSDVHVISRQIAAGF-HKLGVNQNDVVMILLPNCPEFVLSFLAASFRGATATAANPFFTP  121

Query  482  PELSKQIKDCSPKLIVTVPQLLDKVK  559
             E++KQ K  + KLIVT  + +DKVK
Sbjct  122  AEIAKQAKASNTKLIVTESRYVDKVK  147



>ref|XP_006307145.1| hypothetical protein CARUB_v10008735mg [Capsella rubella]
 gb|EOA40043.1| hypothetical protein CARUB_v10008735mg [Capsella rubella]
Length=560

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 66/149 (44%), Positives = 88/149 (59%), Gaps = 9/149 (6%)
 Frame = +2

Query  122  RILAME-KSGYGRD-GIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPD--QPAIHDADTG  289
            R L+++ KSG+     I+ S R P+ LP + NL + +F    IS  P   +    DA TG
Sbjct  12   RTLSLDRKSGFCESTSIFYSKREPVALPPNQNLDVTTF----ISSQPHGGKTVFVDAVTG  67

Query  290  RTLTFSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNP  469
            R LTFS+L   V RVA  L + LGVRK +VV++ SPNSI FP+  L  +  GAI TT NP
Sbjct  68   RRLTFSELWLGVERVAASL-YALGVRKGNVVIVLSPNSILFPIVSLSVMTLGAIITTANP  126

Query  470  MYTVPELSKQIKDCSPKLIVTVPQLLDKV  556
            + T  E+SKQI +  P L  T  QL+ K+
Sbjct  127  INTSDEISKQINNSRPVLAFTTCQLVSKL  155



>ref|NP_173473.2| 4-coumarate--CoA ligase-like 3 [Arabidopsis thaliana]
 gb|AEE29978.1| 4-coumarate--CoA ligase-like 3 [Arabidopsis thaliana]
Length=447

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 84/142 (59%), Gaps = 7/142 (5%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQ--PAIHDADTGRTLTFSQ  310
            +SG+ + +  + S R P+ LP +P+L + +F    IS  P +   A  DA TG  LTFS 
Sbjct  13   RSGFCKSNSTFYSKRNPLCLPPNPSLDVTTF----ISSQPQRGTTAFIDASTGHRLTFSD  68

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
            L   V RVA  L H++G+R+ DVVLI SPNSI  P+  L  ++ GA+ TT N + T  E+
Sbjct  69   LWRVVDRVADCLYHEVGIRRGDVVLILSPNSIYIPVVCLSVMSLGAVVTTANTLNTSGEI  128

Query  491  SKQIKDCSPKLIVTVPQLLDKV  556
            SKQI   +P L+ T  QL  K+
Sbjct  129  SKQIAQSNPTLVFTTSQLAPKL  150



>ref|XP_006303947.1| hypothetical protein CARUB_v10008763mg [Capsella rubella]
 gb|EOA36845.1| hypothetical protein CARUB_v10008763mg [Capsella rubella]
Length=549

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 82/130 (63%), Gaps = 3/130 (2%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHGL  346
            + S R PI LP +P+L + +F+  +   +  + A  DA TG+ LTFS+L   V  VA  L
Sbjct  17   FYSKRTPIPLPPNPSLDVTTFI--SSQAHRGRIAFIDASTGKNLTFSELWRAVESVADCL  74

Query  347  KHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKLI  526
             +Q+G+RK  VVL+ SPNSI FP+  L  ++ GAI TT NP+ T  E++KQIKD +P + 
Sbjct  75   -YQMGIRKGHVVLLLSPNSILFPVVCLSVMSLGAIITTTNPLNTSGEIAKQIKDSNPVIA  133

Query  527  VTVPQLLDKV  556
             T  QLL K+
Sbjct  134  FTTAQLLPKI  143



>ref|XP_002270360.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X1 [Vitis vinifera]
 emb|CBI23270.3| unnamed protein product [Vitis vinifera]
Length=571

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 82/134 (61%), Gaps = 3/134 (2%)
 Frame = +2

Query  155  RDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
              GIY S  P + +P DP+L +VSF+F     +    A+ D  +G ++++SQL   V  +
Sbjct  37   ETGIYSSTYPSLPIPSDPHLDIVSFIFSK--NHNGVSALTDYSSGFSISYSQLHPLVKSM  94

Query  335  AHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCS  514
            A GL HQ+G  + DV+L+  PNSI FP+ FL  ++ G IATT+NP+ ++ E+ KQ   CS
Sbjct  95   ASGL-HQMGFSQGDVILLLLPNSIYFPVIFLAVLSLGGIATTMNPLSSLTEIRKQTVGCS  153

Query  515  PKLIVTVPQLLDKV  556
              L  TVP+  +K+
Sbjct  154  LSLAFTVPETSEKL  167



>ref|XP_006307164.1| hypothetical protein CARUB_v10008755mg [Capsella rubella]
 gb|EOA40062.1| hypothetical protein CARUB_v10008755mg [Capsella rubella]
Length=553

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 83/138 (60%), Gaps = 7/138 (5%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQ--PAIHDADTGRTLTFSQ  310
            +SG+ + +  + S R P+ LP +P++ + +F    IS  P +   A  DA TG  L+FS 
Sbjct  13   RSGFCKSNSTFYSKRNPLSLPPNPSIDVTTF----ISSLPHRGTTAFIDAATGHRLSFSD  68

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
            L   V RVA  L H++G+R+ DV+LI SPNSI  P+  L  ++ GA+ TT N + T  E+
Sbjct  69   LWRAVDRVADFLYHEIGIRRGDVILILSPNSIYIPVVCLSVMSLGAVVTTANTLNTAGEI  128

Query  491  SKQIKDCSPKLIVTVPQL  544
            SKQI DC+P L  T  QL
Sbjct  129  SKQIADCNPTLAFTTRQL  146



>ref|NP_001237750.1| 4-coumarate:coenzyme A ligase [Glycine max]
 gb|AAL98709.1|AF279267_1 4-coumarate:coenzyme A ligase [Glycine max]
Length=546

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 82/132 (62%), Gaps = 3/132 (2%)
 Frame = +2

Query  164  IYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHG  343
            I+RS  P I +P   +L + S+ F+N+SQ+ D+P + D DTG TLT++ +     R+A G
Sbjct  9    IFRSPLPDIPIPT--HLPLYSYCFQNLSQFHDRPCLIDGDTGETLTYADVDLAARRIASG  66

Query  344  LKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKL  523
            L H++G+R+ DV+++   N   F L FLGA   GA+ TT NP YT  EL+KQ      +L
Sbjct  67   L-HKIGIRQGDVIMLVLRNCPQFALAFLGATHRGAVVTTANPFYTPAELAKQATATKTRL  125

Query  524  IVTVPQLLDKVK  559
            ++T    ++K+K
Sbjct  126  VITQSAYVEKIK  137



>emb|CDP11727.1| unnamed protein product [Coffea canephora]
Length=573

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 89/132 (67%), Gaps = 3/132 (2%)
 Frame = +2

Query  161  GIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAH  340
            GIY S  P + LP DP L +VSF+F +  ++  Q A+ D+ +G +L++S++   V+ VA 
Sbjct  40   GIYHSKHPSVTLPSDPFLDVVSFIFSH--EHSGQTALIDSSSGFSLSYSKIFPLVNSVAS  97

Query  341  GLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPK  520
            GL HQ+GV + DVVLI  PNSI FP+ FLG ++ GAI T +NP+ ++ E+ KQ+ DC P 
Sbjct  98   GL-HQMGVSQGDVVLISLPNSIHFPIVFLGILSLGAIVTAINPLSSLSEVKKQVIDCKPS  156

Query  521  LIVTVPQLLDKV  556
              + +P+ +D++
Sbjct  157  FGLCLPEKVDEL  168



>gb|KJB29670.1| hypothetical protein B456_005G113000 [Gossypium raimondii]
Length=467

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 85/140 (61%), Gaps = 4/140 (3%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+ R +  + S R PI LP++ +L + +F+  +   +  + A  DA TGR LTFS+L 
Sbjct  12   RSGFCRSNSTFYSKRKPIPLPKNHSLDVTTFI--SARAHHGKVAFIDAATGRHLTFSELW  69

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V  VA  L   +G+RK  VVL+ SPNSI FP+  L  ++ GAI TT NP+ T  E+ K
Sbjct  70   RAVDSVATCLS-DMGIRKGHVVLLLSPNSIFFPIVCLSVMSLGAIITTTNPLNTANEIGK  128

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            Q+ D  P L  T+PQLL K+
Sbjct  129  QVADSKPVLAFTIPQLLPKL  148



>gb|AIE16397.1| 4-coumarate:CoA ligase, partial [Glycine soja]
Length=224

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 80/131 (61%), Gaps = 3/131 (2%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHGL  346
            +RS  P I +P    L + S+ F+N+SQ+ D+P + D DTG TLT++ +     R+A GL
Sbjct  1    FRSPLPDIPIPT--YLPLYSYCFQNLSQFHDRPCLIDGDTGETLTYADVDLAARRIASGL  58

Query  347  KHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKLI  526
             H++G+R+ DV+++   N   F L FLGA   GA+ TT NP YT  EL+KQ      +L+
Sbjct  59   -HKIGIRQGDVIMLVLRNCPQFALAFLGATHRGAVVTTANPFYTPAELAKQATATKTRLV  117

Query  527  VTVPQLLDKVK  559
            +T    ++K+K
Sbjct  118  ITQSAYVEKIK  128



>ref|XP_006304883.1| hypothetical protein CARUB_v10012648mg [Capsella rubella]
 gb|EOA37781.1| hypothetical protein CARUB_v10012648mg [Capsella rubella]
Length=562

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 81/142 (57%), Gaps = 7/142 (5%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQ--PAIHDADTGRTLTFSQ  310
            K G+ + +  + S R P+ LP D +L + +F+    S  P +   A  DA TG  ++FS 
Sbjct  17   KKGFCKANSTFYSKRSPLPLPADTSLDVTTFM----SSQPHRGTTAFIDASTGHRISFSD  72

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
                V RVA  L H +G+R+ DVVLI SPNSI  P+  L  ++ GA+ TT NP+ T  E+
Sbjct  73   FWRSVDRVADCLHHDIGIRRGDVVLILSPNSISIPVVSLAVMSLGAVITTANPLNTAGEI  132

Query  491  SKQIKDCSPKLIVTVPQLLDKV  556
            S+QI D  PKL    P+L  K+
Sbjct  133  SRQIADSKPKLAFATPELAPKL  154



>ref|XP_010477291.1| PREDICTED: 4-coumarate--CoA ligase-like 4 isoform X2 [Camelina 
sativa]
Length=476

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 81/135 (60%), Gaps = 3/135 (2%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+ + +  + S R P+ LP +P+L + +F+  +   +    A  DA TG  L+F+ L 
Sbjct  13   RSGFCKSNSTFYSKRNPLSLPPNPSLDVTTFI--SSQTHGGTTAFIDAATGHRLSFTDLW  70

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V RVA  L H++G+R+ DVVLI SPNSI  P+  L  ++ GA+ TT N + T  E+SK
Sbjct  71   RAVDRVADCLYHEVGIRRGDVVLILSPNSIYIPVVCLSVMSLGAVVTTANTLNTAGEISK  130

Query  497  QIKDCSPKLIVTVPQ  541
            QI DC+P L  T  Q
Sbjct  131  QIADCNPTLAFTTRQ  145



>ref|XP_004253129.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Solanum lycopersicum]
Length=552

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 84/140 (60%), Gaps = 3/140 (2%)
 Frame = +2

Query  140  KSGYG-RDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            KSGY   +  + S R PI  P + ++ + +F+      +  + A  DA TGR L+FS + 
Sbjct  14   KSGYSPANSTFYSKRRPIPFPANESIDVTTFISSR--AHSGKIAFIDATTGRKLSFSDVW  71

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
            + V  +A  L   + +RK DVVL+ SPNSI FP+  L  ++ GAI TT NP+ T  E++K
Sbjct  72   NAVESLATSLSVDMSIRKGDVVLLLSPNSIFFPIICLAVMSLGAIITTTNPLNTNSEIAK  131

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            QIKD +P L  T+PQLL K+
Sbjct  132  QIKDSNPVLAFTIPQLLPKL  151



>ref|XP_006416396.1| hypothetical protein EUTSA_v10007285mg [Eutrema salsugineum]
 gb|ESQ34749.1| hypothetical protein EUTSA_v10007285mg [Eutrema salsugineum]
Length=547

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 85/142 (60%), Gaps = 7/142 (5%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQ--PAIHDADTGRTLTFSQ  310
            +SG+ R +  + + R P+ LP +P+L + +F    IS  P +   A  DA TG  L+FS 
Sbjct  12   RSGFCRANSTFFTKRNPLNLPANPSLDVTTF----ISSQPHRGTTAFIDAATGHRLSFSD  67

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
            L   V RVA  L H++G+R+ DVVLI SPNS+  P+ +L  ++ GA+ TT N + T  E+
Sbjct  68   LWRAVDRVADCLHHEIGIRRGDVVLILSPNSVYIPVVYLSVLSLGAVVTTANTLNTAGEI  127

Query  491  SKQIKDCSPKLIVTVPQLLDKV  556
            S+QI D +P L  T  QL  K+
Sbjct  128  SRQISDSNPTLAFTTRQLAPKL  149



>gb|KJB29669.1| hypothetical protein B456_005G113000 [Gossypium raimondii]
Length=478

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 85/140 (61%), Gaps = 4/140 (3%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+ R +  + S R PI LP++ +L + +F+  +   +  + A  DA TGR LTFS+L 
Sbjct  12   RSGFCRSNSTFYSKRKPIPLPKNHSLDVTTFI--SARAHHGKVAFIDAATGRHLTFSELW  69

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V  VA  L   +G+RK  VVL+ SPNSI FP+  L  ++ GAI TT NP+ T  E+ K
Sbjct  70   RAVDSVATCLS-DMGIRKGHVVLLLSPNSIFFPIVCLSVMSLGAIITTTNPLNTANEIGK  128

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            Q+ D  P L  T+PQLL K+
Sbjct  129  QVADSKPVLAFTIPQLLPKL  148



>ref|XP_006414022.1| hypothetical protein EUTSA_v10024787mg [Eutrema salsugineum]
 gb|ESQ55475.1| hypothetical protein EUTSA_v10024787mg [Eutrema salsugineum]
Length=570

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 82/134 (61%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  GIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPD--QPAIHDADTGRTLTFSQLKSQVSRV  334
            G+Y S  P + LP DPNL  VS LF +I    D    A  D+ TG ++++++L+  V  +
Sbjct  30   GMYTSKFPSLHLPVDPNLDAVSALFSHIHDGDDAASAAFVDSSTGFSISYTELRVMVKSM  89

Query  335  AHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCS  514
            A G+ H LGVR+ DVV +  PNS+ FP+ FL  I+ GAI TTVNP  ++ E+ KQ+ +C+
Sbjct  90   AAGIYHDLGVRQGDVVSLVLPNSVYFPVIFLSLISLGAIVTTVNPSSSLGEIKKQVSECN  149

Query  515  PKLIVTVPQLLDKV  556
              L  T  +  +K+
Sbjct  150  VGLAFTSHENFEKL  163



>ref|XP_002867963.1| hypothetical protein ARALYDRAFT_492955 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44222.1| hypothetical protein ARALYDRAFT_492955 [Arabidopsis lyrata subsp. 
lyrata]
Length=566

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 84/134 (63%), Gaps = 2/134 (1%)
 Frame = +2

Query  155  RDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            + GIY S  P + LP DPNL  VS LF +  ++    A+ D+ TG +++ ++L+  V  +
Sbjct  28   KTGIYSSKFPSVHLPVDPNLDAVSALFSH--RHGGDAALVDSLTGFSISHTELQIMVQSM  85

Query  335  AHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCS  514
            A G+ H LGVR+ DVV +  PNS+ FP+ FL  I+ GAI TT+NP  ++ E+ KQ+ +CS
Sbjct  86   AAGIYHVLGVRQGDVVSLVLPNSVYFPMIFLSLISLGAIVTTMNPSSSLGEIKKQVSECS  145

Query  515  PKLIVTVPQLLDKV  556
              L  T  + +DK+
Sbjct  146  VGLAFTSAENVDKL  159



>ref|XP_007158204.1| hypothetical protein PHAVU_002G132900g [Phaseolus vulgaris]
 gb|ESW30198.1| hypothetical protein PHAVU_002G132900g [Phaseolus vulgaris]
Length=552

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 85/135 (63%), Gaps = 3/135 (2%)
 Frame = +2

Query  155  RDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            + GIY S   P+ LP DP L +VSF+F +  ++    A+ D  +G ++++S+L   V  V
Sbjct  20   KSGIYHSKHAPVDLPSDPFLDVVSFIFSH--RHDGVSALVDFSSGCSISYSKLLPLVKSV  77

Query  335  AHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCS  514
            A GL H++GV + DVVLI  PNSI +P+ FLG +  GAI T +NP+ +V E+ +Q+ +C 
Sbjct  78   ASGL-HKMGVSQGDVVLILLPNSIYYPIVFLGVLYLGAIVTPLNPLSSVYEIRRQVAECG  136

Query  515  PKLIVTVPQLLDKVK  559
              +  TVP+   K++
Sbjct  137  VSVAFTVPENFKKLE  151



>ref|XP_002979110.1| hypothetical protein SELMODRAFT_177466 [Selaginella moellendorffii]
 gb|EFJ20067.1| hypothetical protein SELMODRAFT_177466 [Selaginella moellendorffii]
Length=542

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 82/144 (57%), Gaps = 4/144 (3%)
 Frame = +2

Query  137  EKSGYGRD-GIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPD---QPAIHDADTGRTLTF  304
            + SGY  D G+YRS R  I LP  P+ S  +FLF     +P    +P I D+ +G  ++ 
Sbjct  3    DSSGYQEDEGVYRSSRAAISLPAHPHQSFAAFLFSGPVGHPSNSSKPLIVDSSSGSFISC  62

Query  305  SQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVP  484
             + + +V  VA GL    GV + DVVL+   N++ FP+ F  A++ GA+ TTVNP  T  
Sbjct  63   REFRERVEAVAGGLWSLAGVAQGDVVLVLLANTVHFPVIFHAALSIGAVVTTVNPANTAG  122

Query  485  ELSKQIKDCSPKLIVTVPQLLDKV  556
            E+ +Q++D   K  VT P+L  K+
Sbjct  123  EIDRQLRDSGAKFAVTSPELAAKL  146



>dbj|BAJ33983.1| unnamed protein product [Thellungiella halophila]
Length=550

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 85/144 (59%), Gaps = 4/144 (3%)
 Frame = +2

Query  131  AMEK-SGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFS  307
            AM+K S    D I+RS  P I +P   +L +  ++F+NIS++  +P + +  TG   T+S
Sbjct  7    AMQKQSSNSSDVIFRSKLPDIYIPN--HLPLHDYIFQNISEFASKPCLINGPTGHVYTYS  64

Query  308  QLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPE  487
             +     R+A G + +LGV +NDVV+I  PN  +F L FL A   GA AT  NP +T  E
Sbjct  65   DVHVTSRRIAAGFQ-KLGVNRNDVVMILLPNCPEFVLSFLAASFRGATATAANPFFTPAE  123

Query  488  LSKQIKDCSPKLIVTVPQLLDKVK  559
            ++KQ K    KLIVT  + +DK+K
Sbjct  124  IAKQAKASGSKLIVTESRYVDKIK  147



>ref|XP_006393012.1| hypothetical protein EUTSA_v10011357mg [Eutrema salsugineum]
 gb|ESQ30298.1| hypothetical protein EUTSA_v10011357mg [Eutrema salsugineum]
Length=565

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 85/144 (59%), Gaps = 4/144 (3%)
 Frame = +2

Query  131  AMEK-SGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFS  307
            AM+K S    D I+RS  P I +P   +L +  ++F+NIS++  +P + +  TG   T+S
Sbjct  51   AMQKQSSNSSDVIFRSKLPDIYIPN--HLPLHDYIFQNISEFASKPCLINGPTGHVYTYS  108

Query  308  QLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPE  487
             +     R+A G + +LGV +NDVV+I  PN  +F L FL A   GA AT  NP +T  E
Sbjct  109  DVHVTSRRIAAGFQ-KLGVNRNDVVMILLPNCPEFVLSFLAASFRGATATAANPFFTPAE  167

Query  488  LSKQIKDCSPKLIVTVPQLLDKVK  559
            ++KQ K    KLIVT  + +DK+K
Sbjct  168  IAKQAKASGSKLIVTESRYVDKIK  191



>gb|EYU17530.1| hypothetical protein MIMGU_mgv1a003887mg [Erythranthe guttata]
Length=557

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 82/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  140  KSGY-GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+ G D  + S R PI LP + +L + +F+      +  + A  DA TGR LTF+ + 
Sbjct  14   RSGFCGADSTFYSKRTPIPLPSNESLDVTTFISSR--AHRGKVAFIDAATGRRLTFADVW  71

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V  V+  L  + G+RK  V+L+ +PNSI FP+  L  ++ GA+ TT NP+ T  E+ K
Sbjct  72   RAVDAVSTSLSAEFGIRKGHVILLLTPNSIYFPIVCLAVMSLGAVITTTNPLNTPREIGK  131

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            QI D  P L  TVP+LL K+
Sbjct  132  QISDSKPVLAFTVPELLPKL  151



>gb|ADE95828.1| 4-coumarate:CoA ligase 1 [Corchorus capsularis]
Length=545

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 84/135 (62%), Gaps = 3/135 (2%)
 Frame = +2

Query  155  RDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
             D I+RS  P I +P+  +L + S+ F NIS+   +P + +  TG+  T+ +++    RV
Sbjct  11   EDFIFRSKLPDIYIPK--HLPLHSYCFENISKVASKPCLINGTTGQIYTYEEVELTARRV  68

Query  335  AHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCS  514
            A GL H+LGV++  V+++  PN+ +F L FLGA   GA+ T  NP +T PE++KQ K  +
Sbjct  69   AAGL-HKLGVQQRQVIMLLLPNTPEFVLSFLGASFLGAVCTAANPFFTAPEVAKQAKASN  127

Query  515  PKLIVTVPQLLDKVK  559
             ++I+T    +DKVK
Sbjct  128  ARIIITQASYVDKVK  142



>gb|AIE16384.1| 4-coumarate:CoA ligase, partial [Glycine max]
 gb|AIE16385.1| 4-coumarate:CoA ligase, partial [Glycine max]
 gb|AIE16388.1| 4-coumarate:CoA ligase, partial [Glycine soja]
 gb|AIE16389.1| 4-coumarate:CoA ligase, partial [Glycine soja]
 gb|AIE16396.1| 4-coumarate:CoA ligase, partial [Glycine soja]
 gb|AIE16398.1| 4-coumarate:CoA ligase, partial [Glycine soja]
 gb|AIE16404.1| 4-coumarate:CoA ligase, partial [Glycine max]
 gb|AIE16405.1| 4-coumarate:CoA ligase, partial [Glycine max]
 gb|AIE16406.1| 4-coumarate:CoA ligase, partial [Glycine max]
 gb|AIE16412.1| 4-coumarate:CoA ligase, partial [Glycine max]
 gb|AIE16413.1| 4-coumarate:CoA ligase, partial [Glycine max]
 gb|AIE16414.1| 4-coumarate:CoA ligase, partial [Glycine max]
Length=224

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 81/131 (62%), Gaps = 3/131 (2%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHGL  346
            +RS  P I +P   +L + S+ F+N+S++ D+P + D DTG TLT++ +     R+A GL
Sbjct  1    FRSPLPDIPIPT--HLPLYSYCFQNLSKFHDRPCLIDGDTGETLTYADVDLAARRIASGL  58

Query  347  KHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKLI  526
             H++G+R+ DV+++   N   F L FLGA   GA+ TT NP YT  EL+KQ      +L+
Sbjct  59   -HKIGIRQGDVIMLVLRNCPQFALAFLGATHRGAVVTTANPFYTPAELAKQATATKTRLV  117

Query  527  VTVPQLLDKVK  559
            +T    ++K+K
Sbjct  118  ITQSAYVEKIK  128



>gb|AAF79611.1|AC027665_12 F5M15.17 [Arabidopsis thaliana]
Length=580

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 59/140 (42%), Positives = 86/140 (61%), Gaps = 4/140 (3%)
 Frame = +2

Query  140  KSGY-GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+   +  + S R PI LP +P+L + +F+  +   +  + A  DA TG+ LTF++L 
Sbjct  7    RSGFCNSNSTFYSKRTPIPLPPNPSLDVTTFI--SSQAHRGRIAFIDASTGQNLTFTELW  64

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V  VA  L  ++G+RK  VVL+ SPNSI FP+  L  ++ GAI TT NP+ T  E++K
Sbjct  65   RAVESVADCLS-EIGIRKGHVVLLLSPNSILFPVVCLSVMSLGAIITTTNPLNTSNEIAK  123

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            QIKD +P L  T  QLL K+
Sbjct  124  QIKDSNPVLAFTTSQLLPKI  143



>ref|XP_002986342.1| hypothetical protein SELMODRAFT_182368 [Selaginella moellendorffii]
 gb|EFJ12551.1| hypothetical protein SELMODRAFT_182368 [Selaginella moellendorffii]
Length=542

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 82/144 (57%), Gaps = 4/144 (3%)
 Frame = +2

Query  137  EKSGYGRD-GIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPD---QPAIHDADTGRTLTF  304
            + SGY  D G+YRS R  I LP  P+ S  +FLF     +P    +P I D+ +G  ++ 
Sbjct  3    DSSGYQEDEGVYRSSRAAISLPAHPHQSFAAFLFSGPVGHPSNSSKPLIVDSSSGSFISC  62

Query  305  SQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVP  484
             + + +V  VA GL    GV + DVVL+   N++ FP+ F  A+A GA+ TTVNP  T  
Sbjct  63   REFRERVEAVAGGLWSLAGVAQGDVVLVLLGNTVHFPVIFHAALAIGAVVTTVNPANTAG  122

Query  485  ELSKQIKDCSPKLIVTVPQLLDKV  556
            E+ +Q++D   K  VT P+L  K+
Sbjct  123  EIDRQLRDSGAKFAVTSPELAAKL  146



>gb|AHI15920.1| 4-coumarate:CoA ligase 4 [Dryopteris fragrans]
Length=550

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 82/140 (59%), Gaps = 2/140 (1%)
 Frame = +2

Query  140  KSGY-GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+   +GI+ S R P+ LP DP+L+   F+       P   A  D+ +G+TL++ +LK
Sbjct  8    RSGFCSSNGIFYSKREPVKLPADPSLTFPRFILERPDFDPSAIAYIDSKSGQTLSYGELK  67

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
            +Q+   A GL    GV+  DVVL+  PNSI F +  L  ++ GAI TT NP+    E++K
Sbjct  68   AQIQAAASGL-LAFGVKPGDVVLVLCPNSIAFAVILLAIMSMGAIVTTTNPLNHAIEIAK  126

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            Q  D +   + ++P LLDKV
Sbjct  127  QAADSNALFVASLPSLLDKV  146



>gb|KEP50630.1| 4-coumarate-CoA ligase-like protein [Rhizoctonia solani 123E]
Length=567

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 74/129 (57%), Gaps = 4/129 (3%)
 Frame = +2

Query  164  IYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQ-PAIHDADTGRTLTFSQLKSQVSRVAH  340
            IY+S  P  V+PR    S+ S+LF N S Y D  PA  +A TG TL+   +K    RVA 
Sbjct  4    IYKSQYPDYVIPRQ---SVASYLFPNESPYADSLPAFIEAATGLTLSRGDIKDLTFRVAS  60

Query  341  GLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPK  520
            G+++ LG ++ D V+IFSPNSI +P    G +AAG   T  N  YT PEL+ Q+KD    
Sbjct  61   GVRNVLGTKRGDTVMIFSPNSIAWPFTLFGCVAAGLRITLANSSYTPPELAHQLKDSGAG  120

Query  521  LIVTVPQLL  547
             +   P LL
Sbjct  121  YVFVYPALL  129



>ref|XP_002894328.1| 4-cumarate-COA-ligase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70587.1| 4-cumarate-COA-ligase [Arabidopsis lyrata subsp. lyrata]
Length=557

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 86/146 (59%), Gaps = 3/146 (2%)
 Frame = +2

Query  122  RILAMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLT  301
             ++  + +    D I+RS  P I +P   +LS+  ++F+NIS++  +P + +  TG   T
Sbjct  6    EVMEKQSNNNNSDVIFRSKLPDIYIPN--HLSLHDYIFQNISEFATKPCLINGPTGHVYT  63

Query  302  FSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTV  481
            +S +     R+A G  H+LGV  NDVV++  PN  +F L FL A   GAIAT  NP +T 
Sbjct  64   YSDVHVISRRIAAGF-HKLGVNHNDVVMLLLPNCPEFVLSFLAASFRGAIATAANPFFTP  122

Query  482  PELSKQIKDCSPKLIVTVPQLLDKVK  559
             E++KQ K  + KLI+T  + +DK+K
Sbjct  123  AEIAKQAKASNTKLIITESRYVDKIK  148



>gb|AGW27194.1| 4-coumarate:coenzyme A ligase 4 [Salvia miltiorrhiza]
Length=552

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 84/140 (60%), Gaps = 3/140 (2%)
 Frame = +2

Query  140  KSGY-GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+   +  + S R PI LP + +L + +F+  +   +  + A  DA +GR+LTF++L 
Sbjct  14   RSGFCSANSTFYSKRKPIPLPANQSLDVTTFI--SSRAHHGEVAFIDAASGRSLTFAELW  71

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V  V+  L    G+RK  V+L+ +PNSI FP+  L  ++ GAI TT NP+ T  E++K
Sbjct  72   RAVDAVSTSLSSDFGIRKGHVILLLTPNSIYFPIVCLAVMSLGAIITTTNPLNTAREIAK  131

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            QI D  P L  TVPQLL K+
Sbjct  132  QIADSKPSLAFTVPQLLPKL  151



>ref|XP_010477290.1| PREDICTED: 4-coumarate--CoA ligase-like 4 isoform X1 [Camelina 
sativa]
Length=555

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 81/135 (60%), Gaps = 3/135 (2%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+ + +  + S R P+ LP +P+L + +F+  +   +    A  DA TG  L+F+ L 
Sbjct  13   RSGFCKSNSTFYSKRNPLSLPPNPSLDVTTFI--SSQTHGGTTAFIDAATGHRLSFTDLW  70

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V RVA  L H++G+R+ DVVLI SPNSI  P+  L  ++ GA+ TT N + T  E+SK
Sbjct  71   RAVDRVADCLYHEVGIRRGDVVLILSPNSIYIPVVCLSVMSLGAVVTTANTLNTAGEISK  130

Query  497  QIKDCSPKLIVTVPQ  541
            QI DC+P L  T  Q
Sbjct  131  QIADCNPTLAFTTRQ  145



>ref|XP_002991507.1| hypothetical protein SELMODRAFT_133629 [Selaginella moellendorffii]
 gb|EFJ07429.1| hypothetical protein SELMODRAFT_133629 [Selaginella moellendorffii]
Length=551

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 81/146 (55%), Gaps = 3/146 (2%)
 Frame = +2

Query  128  LAMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQ---PAIHDADTGRTL  298
            +A  K GYG DGIYRSL PP+ +P   + S+ + LF      P     P + D+ TG T+
Sbjct  1    MAEVKGGYGEDGIYRSLFPPVPIPLQTHHSLPALLFSGPLADPSNSSSPLLVDSTTGFTI  60

Query  299  TFSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYT  478
                 +     VA GL   +GV + DVVL+   N++ FP+ F   ++ GA+ATT NP  T
Sbjct  61   HCGDFQRLAKSVASGLSSIVGVSQGDVVLLLLGNTVYFPILFAAILSIGAVATTANPANT  120

Query  479  VPELSKQIKDCSPKLIVTVPQLLDKV  556
              E+ +Q++D     +VT+P L+ K+
Sbjct  121  AAEIERQLRDSRAGFVVTMPDLVAKI  146



>emb|CAP08804.1| 4-cumarate-COA-ligase [Arabidopsis lyrata]
Length=552

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 86/146 (59%), Gaps = 3/146 (2%)
 Frame = +2

Query  122  RILAMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLT  301
             ++  + +    D I+RS  P I +P   +LS+  ++F+NIS++  +P + +  TG   T
Sbjct  6    EVMEKQSNNNNSDVIFRSKLPDIYIPN--HLSLHDYIFQNISEFATKPCLINGPTGHVYT  63

Query  302  FSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTV  481
            +S +     R+A G  H+LGV  NDVV++  PN  +F L FL A   GAIAT  NP +T 
Sbjct  64   YSDVHVISRRIAAGF-HKLGVNHNDVVMLLLPNCPEFVLSFLAASFRGAIATAANPFFTP  122

Query  482  PELSKQIKDCSPKLIVTVPQLLDKVK  559
             E++KQ K  + KLI+T  + +DK+K
Sbjct  123  AEIAKQAKASNTKLIITESRYVDKIK  148



>ref|XP_009110226.1| PREDICTED: 4-coumarate--CoA ligase-like 8 isoform X1 [Brassica 
rapa]
Length=553

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 85/142 (60%), Gaps = 7/142 (5%)
 Frame = +2

Query  140  KSGY-GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQ--PAIHDADTGRTLTFSQ  310
            +SG+   +  + S R P+ LP + +L + +F    IS  P +   A  DA TG  L+FS+
Sbjct  18   RSGFCNANSTFYSKRKPLPLPANTSLDVTTF----ISSQPHRGTTAFIDAATGHHLSFSE  73

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
            L + V+RVA  L   +GVRK DVVL+ SPNSI  P+  L  ++ GA+ TT NP+ T  E+
Sbjct  74   LWTAVNRVADCLHRDVGVRKGDVVLVLSPNSISIPIVCLSVMSLGAVVTTANPLNTAGEI  133

Query  491  SKQIKDCSPKLIVTVPQLLDKV  556
            S+Q+ D +P L  T P+L  K+
Sbjct  134  SRQMADSNPVLAFTTPELSQKL  155



>ref|XP_009110227.1| PREDICTED: 4-coumarate--CoA ligase-like 8 isoform X2 [Brassica 
rapa]
Length=541

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 85/142 (60%), Gaps = 7/142 (5%)
 Frame = +2

Query  140  KSGY-GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQ--PAIHDADTGRTLTFSQ  310
            +SG+   +  + S R P+ LP + +L + +F    IS  P +   A  DA TG  L+FS+
Sbjct  18   RSGFCNANSTFYSKRKPLPLPANTSLDVTTF----ISSQPHRGTTAFIDAATGHHLSFSE  73

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
            L + V+RVA  L   +GVRK DVVL+ SPNSI  P+  L  ++ GA+ TT NP+ T  E+
Sbjct  74   LWTAVNRVADCLHRDVGVRKGDVVLVLSPNSISIPIVCLSVMSLGAVVTTANPLNTAGEI  133

Query  491  SKQIKDCSPKLIVTVPQLLDKV  556
            S+Q+ D +P L  T P+L  K+
Sbjct  134  SRQMADSNPVLAFTTPELSQKL  155



>sp|Q3E6Y4.2|4CLL3_ARATH RecName: Full=4-coumarate--CoA ligase-like 3 [Arabidopsis thaliana]
Length=552

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 84/142 (59%), Gaps = 7/142 (5%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQ--PAIHDADTGRTLTFSQ  310
            +SG+ + +  + S R P+ LP +P+L + +F    IS  P +   A  DA TG  LTFS 
Sbjct  13   RSGFCKSNSTFYSKRNPLCLPPNPSLDVTTF----ISSQPQRGTTAFIDASTGHRLTFSD  68

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
            L   V RVA  L H++G+R+ DVVLI SPNSI  P+  L  ++ GA+ TT N + T  E+
Sbjct  69   LWRVVDRVADCLYHEVGIRRGDVVLILSPNSIYIPVVCLSVMSLGAVVTTANTLNTSGEI  128

Query  491  SKQIKDCSPKLIVTVPQLLDKV  556
            SKQI   +P L+ T  QL  K+
Sbjct  129  SKQIAQSNPTLVFTTSQLAPKL  150



>ref|XP_010094597.1| 4-coumarate--CoA ligase-like 5 [Morus notabilis]
 gb|EXB56351.1| 4-coumarate--CoA ligase-like 5 [Morus notabilis]
Length=554

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 86/141 (61%), Gaps = 3/141 (2%)
 Frame = +2

Query  137  EKSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            ++SG+ + + I+ S R P+ LP++ ++ + +F+  +   +  + A  DA TGR LTF QL
Sbjct  11   KRSGFCKSNSIFYSKRTPVALPQNQSVDIATFI--SSRAHNGKIAFVDAATGRHLTFPQL  68

Query  314  KSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELS  493
               V  VA  L   +G+RK DV+L+ SPNSI FP+  L  ++ GA+ TT NP+ T  E++
Sbjct  69   WRAVYSVATCLSTDMGIRKGDVILLLSPNSIVFPVVCLAVMSLGAVITTTNPLNTSREIA  128

Query  494  KQIKDCSPKLIVTVPQLLDKV  556
            KQI D  P L  T  QL+ K+
Sbjct  129  KQIADSKPVLAFTTLQLIPKI  149



>ref|XP_010498483.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Camelina sativa]
 ref|XP_010498484.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Camelina sativa]
Length=549

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 86/140 (61%), Gaps = 4/140 (3%)
 Frame = +2

Query  140  KSGY-GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+   +  + S R PI LP +P+L + +F+  +   +  + A  DA TG  LTFS+L 
Sbjct  7    RSGFCNSNSTFYSKRTPIPLPPNPSLDVTTFI--SSQAHRGRIAFIDASTGNNLTFSELW  64

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V  VA  L +++G+RK  VVL+ SPNSI FP+  L  ++ GAI TT NP+ T  E++K
Sbjct  65   RAVDSVADCL-YEMGIRKGHVVLLLSPNSILFPVVCLSVMSLGAIITTTNPLNTSGEIAK  123

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            QIKD +P L  T  QLL K+
Sbjct  124  QIKDSNPVLAFTTSQLLPKI  143



>ref|NP_173474.5| 4-coumarate--CoA ligase-like 4 [Arabidopsis thaliana]
 sp|P0C5B6.1|4CLL4_ARATH RecName: Full=4-coumarate--CoA ligase-like 4 [Arabidopsis thaliana]
 gb|AEE29979.1| 4-coumarate--CoA ligase-like 4 [Arabidopsis thaliana]
Length=550

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 83/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+ + +  + S R P+ LP  PNLS     F +   +  + A  DA TG+ LTFS L 
Sbjct  13   RSGFCKSNSTFYSKRQPLSLP--PNLSRDVTTFISSQPHRGKTAFIDAATGQCLTFSDLW  70

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V RVA  L H++G+R+ DVVLI SPNSI  P+  L  ++ GA+ TT N + T  E+SK
Sbjct  71   RAVDRVADCLYHEVGIRRGDVVLILSPNSIFIPVVCLSVMSLGAVFTTANTLNTSGEISK  130

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            QI D +P L+ T  QL  K+
Sbjct  131  QIADSNPTLVFTTRQLAPKL  150



>gb|KHG05050.1| 4-coumarate--CoA ligase-like 5 [Gossypium arboreum]
Length=549

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 85/140 (61%), Gaps = 4/140 (3%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+ R +  + S R PI LP++ +L + +F+  +   +  + A  DA TGR LTFS+L 
Sbjct  12   RSGFFRSNSTFYSKRKPIPLPKNDSLDVTTFI--SARAHHGKVAFIDAATGRHLTFSELW  69

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V  VA  L   +G+RK  VVL+ SPNSI FP+  L  ++ GAI TT NP+ T  E+ K
Sbjct  70   RAVDSVATCLS-DMGIRKGHVVLLLSPNSIFFPIVCLSVMSLGAIITTTNPLNTANEIGK  128

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            Q+ D  P L  T+PQLL K+
Sbjct  129  QVADSKPVLAFTIPQLLPKL  148



>gb|KJB29668.1| hypothetical protein B456_005G113000 [Gossypium raimondii]
Length=549

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 85/140 (61%), Gaps = 4/140 (3%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+ R +  + S R PI LP++ +L + +F+  +   +  + A  DA TGR LTFS+L 
Sbjct  12   RSGFCRSNSTFYSKRKPIPLPKNHSLDVTTFI--SARAHHGKVAFIDAATGRHLTFSELW  69

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V  VA  L   +G+RK  VVL+ SPNSI FP+  L  ++ GAI TT NP+ T  E+ K
Sbjct  70   RAVDSVATCLS-DMGIRKGHVVLLLSPNSIFFPIVCLSVMSLGAIITTTNPLNTANEIGK  128

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            Q+ D  P L  T+PQLL K+
Sbjct  129  QVADSKPVLAFTIPQLLPKL  148



>gb|KJB29671.1| hypothetical protein B456_005G113000 [Gossypium raimondii]
Length=576

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 85/140 (61%), Gaps = 4/140 (3%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+ R +  + S R PI LP++ +L + +F+  +   +  + A  DA TGR LTFS+L 
Sbjct  12   RSGFCRSNSTFYSKRKPIPLPKNHSLDVTTFI--SARAHHGKVAFIDAATGRHLTFSELW  69

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V  VA  L   +G+RK  VVL+ SPNSI FP+  L  ++ GAI TT NP+ T  E+ K
Sbjct  70   RAVDSVATCLS-DMGIRKGHVVLLLSPNSIFFPIVCLSVMSLGAIITTTNPLNTANEIGK  128

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            Q+ D  P L  T+PQLL K+
Sbjct  129  QVADSKPVLAFTIPQLLPKL  148



>ref|XP_010459734.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Camelina sativa]
Length=549

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 86/140 (61%), Gaps = 4/140 (3%)
 Frame = +2

Query  140  KSGY-GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+   +  + S R PI LP +P+L + +F+  +   +  + A  DA TG  LTFS+L 
Sbjct  7    RSGFCNSNSTFYSKRTPIPLPPNPSLDVTTFI--SSQAHCGRIAFIDASTGNNLTFSELW  64

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V  VA  L +++G+RK  VVL+ SPNSI FP+  L  ++ GAI TT NP+ T  E++K
Sbjct  65   RAVDSVADCL-YEMGIRKGHVVLLLSPNSILFPVVCLSVMSLGAIITTTNPLNTSGEIAK  123

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            QIKD +P L  T  QLL K+
Sbjct  124  QIKDSNPVLAFTTSQLLPKI  143



>ref|XP_004507842.1| PREDICTED: 4-coumarate--CoA ligase-like isoform X2 [Cicer arietinum]
Length=550

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 80/131 (61%), Gaps = 2/131 (2%)
 Frame = +2

Query  164  IYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHG  343
            I+RS  P I +P   +L + S+ F+N+SQ+ ++P + + DTG TLT+S +   V ++A G
Sbjct  13   IFRSKLPDIQIPT--HLPLHSYCFQNLSQFHNRPCLINGDTGETLTYSDVHLTVRKIAAG  70

Query  344  LKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKL  523
            L   LG+ + DV+++   NS  F L FLGA   GA+ TT NP YT  EL+KQ      KL
Sbjct  71   LNSTLGINQGDVIMLVLRNSHQFALTFLGASYRGAVVTTANPFYTSSELAKQATATKTKL  130

Query  524  IVTVPQLLDKV  556
            IVT    ++K+
Sbjct  131  IVTQSAYINKI  141



>ref|XP_004507841.1| PREDICTED: 4-coumarate--CoA ligase-like isoform X1 [Cicer arietinum]
Length=552

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 80/131 (61%), Gaps = 2/131 (2%)
 Frame = +2

Query  164  IYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHG  343
            I+RS  P I +P   +L + S+ F+N+SQ+ ++P + + DTG TLT+S +   V ++A G
Sbjct  13   IFRSKLPDIQIPT--HLPLHSYCFQNLSQFHNRPCLINGDTGETLTYSDVHLTVRKIAAG  70

Query  344  LKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKL  523
            L   LG+ + DV+++   NS  F L FLGA   GA+ TT NP YT  EL+KQ      KL
Sbjct  71   LNSTLGINQGDVIMLVLRNSHQFALTFLGASYRGAVVTTANPFYTSSELAKQATATKTKL  130

Query  524  IVTVPQLLDKV  556
            IVT    ++K+
Sbjct  131  IVTQSAYINKI  141



>ref|XP_008787558.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Phoenix dactylifera]
Length=571

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 60/142 (42%), Positives = 85/142 (60%), Gaps = 13/142 (9%)
 Frame = +2

Query  140  KSGY--GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPD------QPAIHDADTGRT  295
            +SGY   R G+YRS  P  V  + P L   SF+   +SQ+P       + A+ D+ TGR 
Sbjct  24   QSGYYCPRTGVYRS--PHRVCHQIPALDAASFV---LSQFPPPHLAEIKTALVDSATGRR  78

Query  296  LTFSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMY  475
            LTFS L+     +A  L+H LG++K DVVL+ SPNSI +P   LG ++AGA+ TT NP+ 
Sbjct  79   LTFSDLRRSALALAATLRHGLGIQKGDVVLLLSPNSILYPAIVLGVLSAGAVVTTANPLN  138

Query  476  TVPELSKQIKDCSPKLIVTVPQ  541
            T  E++KQ +D   KL +  P+
Sbjct  139  TAAEVAKQARDSGAKLAIAAPE  160



>gb|EPS60018.1| hypothetical protein M569_14786, partial [Genlisea aurea]
Length=534

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 83/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+ + +  + S R P+ LP   ++ + +F+  + S +  + A  +A TGR LTF+QL 
Sbjct  4    RSGFCKGNSTFYSKRKPLALPSTDSIDVTTFI--SSSPHRGEVAFIEASTGRRLTFAQLW  61

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V  VA  L  + G+RK DVVLI SPNSI FP+  L  ++ GA+ TT NP+ T  E+S+
Sbjct  62   KAVDAVAGCLSAEYGLRKGDVVLILSPNSIYFPVVCLAVMSLGAVVTTTNPINTAGEISR  121

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            QI D  P +    P L+ K+
Sbjct  122  QISDSKPVIAFATPDLVPKI  141



>ref|WP_019489935.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=1027

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 76/130 (58%), Gaps = 4/130 (3%)
 Frame = +2

Query  164  IYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRVAHG  343
            I+ S  P I +P  P   +   + +   ++ D+ A+ D  TGRT+T+ +L   +++VA G
Sbjct  2    IFHSTEPDISIPEQP---ITEIILQRAVEFADKRAMIDGLTGRTITYRELTDSINKVAAG  58

Query  344  LKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPKL  523
               + G  K DVV I+SPN +++P+ F      G +++T NP YT  EL+ Q+ D   K 
Sbjct  59   FAAR-GFCKGDVVAIYSPNCLEYPIAFQAIALLGGVSSTANPSYTASELAYQLNDAGAKY  117

Query  524  IVTVPQLLDK  553
            ++TVP+LLD+
Sbjct  118  LLTVPELLDR  127



>gb|EUC54434.1| 4-coumarate-CoA ligase-like protein [Rhizoctonia solani AG-3 
Rhs1AP]
Length=567

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 74/129 (57%), Gaps = 4/129 (3%)
 Frame = +2

Query  164  IYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQ-PAIHDADTGRTLTFSQLKSQVSRVAH  340
            IY+S  P  V+PR    S+ S+LF N S Y D  PA  +A TG TL+   +K    RVA 
Sbjct  4    IYKSQYPDYVIPRQ---SVASYLFPNESPYADSLPAFIEAATGLTLSRGDVKDLTFRVAS  60

Query  341  GLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCSPK  520
            G+++ LG ++ D V+IFSPNSI +P    G +AAG   T  N  YT PEL+ Q+KD    
Sbjct  61   GVRNVLGTKRGDTVMIFSPNSIAWPFTLFGCVAAGLRITLANSSYTPPELAHQLKDSGAG  120

Query  521  LIVTVPQLL  547
             +   P LL
Sbjct  121  YVFVHPALL  129



>gb|AAF79612.1|AC027665_13 F5M15.18 [Arabidopsis thaliana]
Length=1549

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 84/142 (59%), Gaps = 7/142 (5%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQ--PAIHDADTGRTLTFSQ  310
            +SG+ + +  + S R P+ LP +P+L + +F    IS  P +   A  DA TG  LTFS 
Sbjct  560  RSGFCKSNSTFYSKRNPLCLPPNPSLDVTTF----ISSQPQRGTTAFIDASTGHRLTFSD  615

Query  311  LKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPEL  490
            L   V RVA  L H++G+R+ DVVLI SPNSI  P+  L  ++ GA+ TT N + T  E+
Sbjct  616  LWRVVDRVADCLYHEVGIRRGDVVLILSPNSIYIPVVCLSVMSLGAVVTTANTLNTSGEI  675

Query  491  SKQIKDCSPKLIVTVPQLLDKV  556
            SKQI   +P L+ T  QL  K+
Sbjct  676  SKQIAQSNPTLVFTTSQLAPKL  697


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 83/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+ + +  + S R P+ LP  PNLS     F +   +  + A  DA TG+ LTFS L 
Sbjct  13   RSGFCKSNSTFYSKRQPLSLP--PNLSRDVTTFISSQPHRGKTAFIDAATGQCLTFSDLW  70

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V RVA  L H++G+R+ DVVLI SPNSI  P+  L  ++ GA+ TT N + T  E+SK
Sbjct  71   RAVDRVADCLYHEVGIRRGDVVLILSPNSIFIPVVCLSVMSLGAVFTTANTLNTSGEISK  130

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            QI D +P L+ T  QL  K+
Sbjct  131  QIADSNPTLVFTTRQLAPKL  150


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 61/94 (65%), Gaps = 1/94 (1%)
 Frame = +2

Query  275   DADTGRTLTFSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaia  454
             DA TGR L+F +L   V RVA G  + LGVRK +VV+I SPNSI FP+  L  ++ GAI 
Sbjct  1052  DAVTGRRLSFPELWLGVERVA-GCLYALGVRKGNVVIILSPNSILFPIVSLSVMSLGAII  1110

Query  455   ttVNPMYTVPELSKQIKDCSPKLIVTVPQLLDKV  556
             TT NP+ T  E+SKQI D  P L  T  +L+ K+
Sbjct  1111  TTANPINTSDEISKQIGDSRPVLAFTTCKLVSKL  1144



>ref|XP_010477286.1| PREDICTED: 4-coumarate--CoA ligase-like 5 isoform X1 [Camelina 
sativa]
Length=549

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 86/140 (61%), Gaps = 4/140 (3%)
 Frame = +2

Query  140  KSGY-GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+   +  + S R PI LP +P+L + +F+  +   +  + A  DA TG  LTFS+L 
Sbjct  7    RSGFCNSNSTFYSKRTPIPLPPNPSLDVTTFI--SSQAHRGRIAFIDASTGNNLTFSELW  64

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V  VA  L +++G+RK  VVL+ SPNSI FP+  L  ++ GAI TT NP+ T  E++K
Sbjct  65   RAVECVADCL-YEMGIRKGHVVLLLSPNSILFPVVCLSVMSLGAIITTTNPLNTSGEIAK  123

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            QIKD +P L  T  QLL K+
Sbjct  124  QIKDSNPVLAFTTSQLLPKI  143



>ref|XP_010477287.1| PREDICTED: 4-coumarate--CoA ligase-like 5 isoform X2 [Camelina 
sativa]
 ref|XP_010477288.1| PREDICTED: 4-coumarate--CoA ligase-like 5 isoform X2 [Camelina 
sativa]
Length=542

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 86/140 (61%), Gaps = 4/140 (3%)
 Frame = +2

Query  140  KSGY-GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+   +  + S R PI LP +P+L + +F+  +   +  + A  DA TG  LTFS+L 
Sbjct  7    RSGFCNSNSTFYSKRTPIPLPPNPSLDVTTFI--SSQAHRGRIAFIDASTGNNLTFSELW  64

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V  VA  L +++G+RK  VVL+ SPNSI FP+  L  ++ GAI TT NP+ T  E++K
Sbjct  65   RAVECVADCL-YEMGIRKGHVVLLLSPNSILFPVVCLSVMSLGAIITTTNPLNTSGEIAK  123

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            QIKD +P L  T  QLL K+
Sbjct  124  QIKDSNPVLAFTTSQLLPKI  143



>ref|XP_007017972.1| OPC-8:0 CoA ligase1 isoform 1 [Theobroma cacao]
 gb|EOY15197.1| OPC-8:0 CoA ligase1 isoform 1 [Theobroma cacao]
Length=549

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 84/140 (60%), Gaps = 4/140 (3%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+ R +  + S R PI L ++ +L + +F+  +   +  + A  DA TGR LTFS+L 
Sbjct  12   RSGFCRSNSTFYSKRKPIPLAKNDSLDVTTFI--SSRAHHGKVAFIDAGTGRQLTFSELW  69

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V  VA  L   +G+RK  VVL+ SPNSI FP+  L  ++ GAI TT NP+ T  E+ K
Sbjct  70   RAVDSVATCLS-DMGIRKGHVVLLLSPNSIYFPVVCLSVMSLGAIITTTNPLNTAAEIGK  128

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            QI D  P L  T+PQLL K+
Sbjct  129  QISDSKPVLAFTIPQLLPKL  148



>ref|XP_007017973.1| OPC-8:0 CoA ligase1 isoform 2 [Theobroma cacao]
 gb|EOY15198.1| OPC-8:0 CoA ligase1 isoform 2 [Theobroma cacao]
Length=550

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 84/140 (60%), Gaps = 4/140 (3%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+ R +  + S R PI L ++ +L + +F+  +   +  + A  DA TGR LTFS+L 
Sbjct  12   RSGFCRSNSTFYSKRKPIPLAKNDSLDVTTFI--SSRAHHGKVAFIDAGTGRQLTFSELW  69

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V  VA  L   +G+RK  VVL+ SPNSI FP+  L  ++ GAI TT NP+ T  E+ K
Sbjct  70   RAVDSVATCLS-DMGIRKGHVVLLLSPNSIYFPVVCLSVMSLGAIITTTNPLNTAAEIGK  128

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            QI D  P L  T+PQLL K+
Sbjct  129  QISDSKPVLAFTIPQLLPKL  148



>gb|AGW47870.1| 4-coumarate:coenzyme A ligase 5 [Phaseolus vulgaris]
Length=548

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 84/136 (62%), Gaps = 3/136 (2%)
 Frame = +2

Query  152  GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSR  331
            G+D I+RS  P I +P+  +L + ++ F+N+  +  +P + +A TG   T+S + +   +
Sbjct  8    GKDFIFRSKLPDIYIPK--HLPLHAYCFQNLPDHASRPCLINAPTGEVFTYSDVDATARK  65

Query  332  VAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDC  511
            VA GL H+LGVR+ +V++I  PN  +F   FLGA   GA+AT  NP +T  E++KQ K  
Sbjct  66   VAAGL-HKLGVRQGEVIMILLPNCPEFVFAFLGASHRGAMATAANPFFTAAEIAKQAKAS  124

Query  512  SPKLIVTVPQLLDKVK  559
            + K+++T     +KVK
Sbjct  125  NAKVLITQASYYEKVK  140



>ref|XP_003517649.2| PREDICTED: 4-coumarate--CoA ligase-like 6-like isoform X1 [Glycine 
max]
Length=553

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 81/129 (63%), Gaps = 3/129 (2%)
 Frame = +2

Query  155  RDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            + GIY S   P+ LP DP L +VSF+F +  ++    A+ D+ +G ++++ +L   V  V
Sbjct  21   KSGIYHSKHAPVDLPNDPFLDLVSFIFSH--RHNGVSALVDSSSGCSISYPKLLPLVKSV  78

Query  335  AHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCS  514
            A GL H++GV + DVVL+  PNSI +P+ FL  +  GAI T +NP+ +V E+ +Q+ +C 
Sbjct  79   ASGL-HRMGVSQGDVVLLLLPNSIYYPIVFLAVLYIGAIVTPLNPLSSVYEIRRQVSECG  137

Query  515  PKLIVTVPQ  541
              L  TVP+
Sbjct  138  VSLAFTVPE  146



>gb|KHN40402.1| 4-coumarate--CoA ligase-like 6 [Glycine soja]
Length=553

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 81/129 (63%), Gaps = 3/129 (2%)
 Frame = +2

Query  155  RDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            + GIY S   P+ LP DP L +VSF+F +  ++    A+ D+ +G ++++ +L   V  V
Sbjct  21   KSGIYHSKHAPVDLPNDPFLDLVSFIFSH--RHNGVSALVDSSSGCSISYPKLLPLVKSV  78

Query  335  AHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCS  514
            A GL H++GV + DVVL+  PNSI +P+ FL  +  GAI T +NP+ +V E+ +Q+ +C 
Sbjct  79   ASGL-HRMGVSQGDVVLLLLPNSIYYPIVFLAVLYIGAIVTPLNPLSSVYEIRRQVSECG  137

Query  515  PKLIVTVPQ  541
              L  TVP+
Sbjct  138  VSLAFTVPE  146



>ref|XP_010536451.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Tarenaya hassleriana]
Length=548

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 86/140 (61%), Gaps = 4/140 (3%)
 Frame = +2

Query  140  KSGYGR-DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+ + +  + S R PI LP +P+L + +F+  +   +  + A+ DA TGR L+FS+L 
Sbjct  7    RSGFCKSNSTFYSKRTPIPLPPNPSLDVTTFI--SSQAHRGKTALIDAATGRNLSFSELW  64

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V  VA  L   +G+RK DVVL+ SPNSI FP+  L  ++ GA+ TT NP+ T  E+SK
Sbjct  65   RSVESVASCLS-DMGIRKGDVVLLLSPNSILFPVVCLSVMSLGAVITTTNPLNTSGEISK  123

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            QI D +P +  T   LL K+
Sbjct  124  QISDSNPVIAFTTVDLLPKI  143



>emb|CAP09678.1| cinnamyl alcohol dehydrogenase [Arabidopsis thaliana]
Length=368

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = +2

Query  155  RDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
             D I+RS  P I +P   +L +  ++F NIS++  +P + +  TG   T++ +     ++
Sbjct  19   NDVIFRSKLPDIYIPN--HLPLHDYIFENISEFAAKPCLINGPTGEVYTYADVHVTSRKL  76

Query  335  AHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCS  514
            A GL H LGV+++DVV+I  PNS +  L FL A   GAI T+ NP +T  E+SKQ K  +
Sbjct  77   AAGL-HNLGVKQHDVVMILLPNSPEVVLTFLAASFVGAITTSANPFFTPAEISKQAKASA  135

Query  515  PKLIVTVPQLLDKVK  559
             KLIVT  + +DK+K
Sbjct  136  AKLIVTQSRYVDKIK  150



>ref|XP_010439777.1| PREDICTED: 4-coumarate--CoA ligase-like 6 [Camelina sativa]
Length=567

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 84/135 (62%), Gaps = 2/135 (1%)
 Frame = +2

Query  155  RDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            + GIY S  P + LP DPNL  VS LF + S + D  A+ D+ TG +++  +L+  V  +
Sbjct  29   KTGIYTSKFPSVHLPVDPNLDAVSALFSH-SHHGDV-ALVDSLTGFSISHVELRVMVQSM  86

Query  335  AHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSKQIKDCS  514
            A G+ H LGVR+ DVV +  PNSI FP+ FL  ++ GA+ TT+NP  ++ E+ KQ+ +C+
Sbjct  87   AAGIYHDLGVRQGDVVSLVLPNSIYFPMIFLSLVSLGAVVTTMNPSSSLGEIKKQVSECN  146

Query  515  PKLIVTVPQLLDKVK  559
              L  T  +  +K+K
Sbjct  147  VGLAFTSSENAEKLK  161



>ref|XP_009774473.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Nicotiana sylvestris]
Length=556

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 86/140 (61%), Gaps = 3/140 (2%)
 Frame = +2

Query  140  KSGYG-RDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            ++GY   D  + S R PI LP +  L + +F+  +   +  + A  DA TG+ LTFS + 
Sbjct  13   RTGYSPADSTFYSKRDPIPLPANEALDVTTFI--SSRAHRGKVAFIDATTGQQLTFSDVW  70

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
            + V  +A  L   +G+RK +VVL+ SPNSI FP+  L  ++ GAI TT NP+ T  E++K
Sbjct  71   NAVESLATCLSIDMGIRKGNVVLLLSPNSIYFPIVCLAVMSLGAIITTTNPLNTPREINK  130

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            QIKD +P +  T+P+LL K+
Sbjct  131  QIKDSNPVIAFTIPELLPKL  150



>ref|NP_973872.1| OPC-8:0 CoA ligase1 [Arabidopsis thaliana]
 gb|AEE29981.1| OPC-8:0 CoA ligase1 [Arabidopsis thaliana]
Length=473

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 86/140 (61%), Gaps = 4/140 (3%)
 Frame = +2

Query  140  KSGY-GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SG+   +  + S R PI LP +P+L + +F+  +   +  + A  DA TG+ LTF++L 
Sbjct  7    RSGFCNSNSTFYSKRTPIPLPPNPSLDVTTFI--SSQAHRGRIAFIDASTGQNLTFTELW  64

Query  317  SQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTVPELSK  496
              V  VA  L  ++G+RK  VVL+ SPNSI FP+  L  ++ GAI TT NP+ T  E++K
Sbjct  65   RAVESVADCLS-EIGIRKGHVVLLLSPNSILFPVVCLSVMSLGAIITTTNPLNTSNEIAK  123

Query  497  QIKDCSPKLIVTVPQLLDKV  556
            QIKD +P L  T  QLL K+
Sbjct  124  QIKDSNPVLAFTTSQLLPKI  143



>pdb|3TSY|A Chain A, 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Protein
Length=979

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 52/146 (36%), Positives = 86/146 (59%), Gaps = 3/146 (2%)
 Frame = +2

Query  122  RILAMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLT  301
            +++  + +    D I+RS  P I +P   +LS+  ++F+NIS++  +P + +  TG   T
Sbjct  33   QVMEKQSNNNNSDVIFRSKLPDIYIPN--HLSLHDYIFQNISEFATKPCLINGPTGHVYT  90

Query  302  FSQLKSQVSRVAHGLKHQLGVRKNDVVLIFSPNSIDFPLCFLgaiaagaiattVNPMYTV  481
            +S +     ++A    H+LGV +NDVV++  PN  +F L FL A   GA AT  NP +T 
Sbjct  91   YSDVHVISRQIAANF-HKLGVNQNDVVMLLLPNCPEFVLSFLAASFRGATATAANPFFTP  149

Query  482  PELSKQIKDCSPKLIVTVPQLLDKVK  559
             E++KQ K  + KLI+T  + +DK+K
Sbjct  150  AEIAKQAKASNTKLIITEARYVDKIK  175



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 655681405646