BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7181

Length=977
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011094637.1|  PREDICTED: probable receptor-like protein ki...    376   1e-124   Sesamum indicum [beniseed]
ref|XP_011094636.1|  PREDICTED: probable receptor-like protein ki...    376   2e-124   
ref|XP_006354346.1|  PREDICTED: probable receptor-like protein ki...    374   5e-124   Solanum tuberosum [potatoes]
ref|XP_006354344.1|  PREDICTED: probable receptor-like protein ki...    374   7e-124   Solanum tuberosum [potatoes]
ref|XP_009764511.1|  PREDICTED: probable receptor-like protein ki...    373   2e-123   Nicotiana sylvestris
ref|XP_009764510.1|  PREDICTED: probable receptor-like protein ki...    373   2e-123   Nicotiana sylvestris
ref|XP_010325981.1|  PREDICTED: probable receptor-like protein ki...    372   6e-123   Solanum lycopersicum
ref|XP_004246645.1|  PREDICTED: probable receptor-like protein ki...    371   1e-122   Solanum lycopersicum
ref|XP_009605411.1|  PREDICTED: probable receptor-like protein ki...    370   2e-122   
ref|XP_009605410.1|  PREDICTED: probable receptor-like protein ki...    370   2e-122   Nicotiana tomentosiformis
emb|CDP06758.1|  unnamed protein product                                355   4e-118   Coffea canephora [robusta coffee]
ref|XP_006381430.1|  kinase family protein                              345   9e-113   
ref|XP_011018722.1|  PREDICTED: probable receptor-like protein ki...    343   9e-112   Populus euphratica
ref|XP_011018721.1|  PREDICTED: probable receptor-like protein ki...    343   1e-111   Populus euphratica
ref|XP_010653601.1|  PREDICTED: probable receptor-like protein ki...    339   4e-110   Vitis vinifera
ref|XP_006354348.1|  PREDICTED: probable receptor-like protein ki...    338   8e-110   Solanum tuberosum [potatoes]
ref|XP_002519512.1|  Protein kinase APK1A, chloroplast precursor,...    337   2e-109   
gb|EYU34470.1|  hypothetical protein MIMGU_mgv1a006457mg                336   7e-109   Erythranthe guttata [common monkey flower]
gb|EYU34469.1|  hypothetical protein MIMGU_mgv1a006457mg                336   7e-109   Erythranthe guttata [common monkey flower]
ref|XP_007205192.1|  hypothetical protein PRUPE_ppa005670mg             336   1e-108   Prunus persica
ref|XP_007027372.1|  Kinase superfamily protein                         335   1e-108   Theobroma cacao [chocolate]
ref|XP_010241858.1|  PREDICTED: probable receptor-like protein ki...    334   3e-108   Nelumbo nucifera [Indian lotus]
ref|XP_007162763.1|  hypothetical protein PHAVU_001G178400g             333   1e-107   Phaseolus vulgaris [French bean]
emb|CBI32759.3|  unnamed protein product                                334   1e-107   Vitis vinifera
ref|XP_008243964.1|  PREDICTED: probable receptor-like protein ki...    333   3e-107   Prunus mume [ume]
ref|XP_012082392.1|  PREDICTED: probable receptor-like protein ki...    330   7e-107   Jatropha curcas
ref|XP_010107509.1|  putative receptor-like protein kinase              330   1e-106   Morus notabilis
gb|KHG19471.1|  hypothetical protein F383_26407                         326   2e-105   Gossypium arboreum [tree cotton]
ref|XP_010253943.1|  PREDICTED: probable receptor-like protein ki...    327   3e-105   Nelumbo nucifera [Indian lotus]
gb|KJB62395.1|  hypothetical protein B456_009G415600                    327   4e-105   Gossypium raimondii
gb|KJB62396.1|  hypothetical protein B456_009G415600                    327   4e-105   Gossypium raimondii
gb|KJB62397.1|  hypothetical protein B456_009G415600                    327   6e-105   Gossypium raimondii
ref|XP_003554386.1|  PREDICTED: probable receptor-like protein ki...    325   1e-104   Glycine max [soybeans]
ref|XP_006604577.1|  PREDICTED: probable receptor-like protein ki...    324   3e-104   Glycine max [soybeans]
ref|XP_010035962.1|  PREDICTED: probable receptor-like protein ki...    323   4e-104   Eucalyptus grandis [rose gum]
gb|KJB36567.1|  hypothetical protein B456_006G165500                    319   4e-104   Gossypium raimondii
gb|KDO48065.1|  hypothetical protein CISIN_1g014245mg                   323   5e-104   Citrus sinensis [apfelsine]
gb|KDO48066.1|  hypothetical protein CISIN_1g014245mg                   323   7e-104   Citrus sinensis [apfelsine]
gb|KHN09513.1|  Putative receptor-like protein kinase                   321   1e-103   Glycine soja [wild soybean]
ref|XP_009350770.1|  PREDICTED: probable receptor-like protein ki...    323   2e-103   Pyrus x bretschneideri [bai li]
ref|XP_003521400.1|  PREDICTED: probable receptor-like protein ki...    322   3e-103   Glycine max [soybeans]
gb|KJB36568.1|  hypothetical protein B456_006G165500                    320   8e-103   Gossypium raimondii
gb|KHG23255.1|  hypothetical protein F383_07036                         318   2e-102   Gossypium arboreum [tree cotton]
ref|XP_012092533.1|  PREDICTED: receptor-like serine/threonine-pr...    314   4e-102   
ref|XP_004304448.1|  PREDICTED: probable receptor-like protein ki...    318   2e-101   Fragaria vesca subsp. vesca
ref|XP_010658387.1|  PREDICTED: probable receptor-like protein ki...    316   5e-101   Vitis vinifera
ref|XP_006428740.1|  hypothetical protein CICLE_v10011770mg             315   9e-101   
ref|XP_007009900.1|  Receptor-like protein kinase                       314   2e-100   
gb|KEH24024.1|  kinase 1B                                               314   2e-100   Medicago truncatula
ref|XP_006340033.1|  PREDICTED: probable receptor-like protein ki...    314   2e-100   Solanum tuberosum [potatoes]
ref|XP_003625670.1|  Protein kinase                                     314   3e-100   Medicago truncatula
ref|XP_006481482.1|  PREDICTED: probable receptor-like protein ki...    313   3e-100   Citrus sinensis [apfelsine]
gb|KEH24025.1|  kinase 1B                                               314   4e-100   Medicago truncatula
gb|AFK42308.1|  unknown                                                 306   1e-99    Lotus japonicus
ref|XP_003590458.1|  Protein kinase 2A                                  312   2e-99    Medicago truncatula
emb|CDO99768.1|  unnamed protein product                                312   2e-99    Coffea canephora [robusta coffee]
gb|KEH42211.1|  kinase 1B                                               311   3e-99    Medicago truncatula
ref|XP_010684093.1|  PREDICTED: probable receptor-like protein ki...    311   3e-99    Beta vulgaris subsp. vulgaris [field beet]
gb|KHG18706.1|  hypothetical protein F383_01912                         311   3e-99    Gossypium arboreum [tree cotton]
ref|XP_009594135.1|  PREDICTED: probable receptor-like protein ki...    310   6e-99    Nicotiana tomentosiformis
ref|XP_007144362.1|  hypothetical protein PHAVU_007G149900g             310   1e-98    Phaseolus vulgaris [French bean]
ref|XP_008233294.1|  PREDICTED: probable receptor-like protein ki...    309   2e-98    Prunus mume [ume]
ref|XP_009376804.1|  PREDICTED: probable receptor-like protein ki...    310   2e-98    Pyrus x bretschneideri [bai li]
ref|XP_004493982.1|  PREDICTED: probable receptor-like protein ki...    309   2e-98    Cicer arietinum [garbanzo]
ref|XP_002530935.1|  Protein kinase APK1B, chloroplast precursor,...    310   2e-98    
ref|XP_007218041.1|  hypothetical protein PRUPE_ppa006060mg             309   3e-98    Prunus persica
ref|XP_004493981.1|  PREDICTED: probable receptor-like protein ki...    309   3e-98    Cicer arietinum [garbanzo]
gb|KJB73529.1|  hypothetical protein B456_011G238100                    308   3e-98    Gossypium raimondii
gb|KHN39036.1|  Putative receptor-like protein kinase                   306   6e-98    Glycine soja [wild soybean]
ref|XP_009788489.1|  PREDICTED: probable receptor-like protein ki...    308   6e-98    Nicotiana sylvestris
ref|XP_004497524.1|  PREDICTED: probable receptor-like protein ki...    307   7e-98    Cicer arietinum [garbanzo]
ref|XP_004497523.1|  PREDICTED: probable receptor-like protein ki...    308   8e-98    
ref|XP_010112214.1|  putative receptor-like protein kinase              308   9e-98    
ref|XP_002315317.2|  hypothetical protein POPTR_0010s23220g             307   1e-97    
ref|XP_004247375.1|  PREDICTED: probable receptor-like protein ki...    306   2e-97    Solanum lycopersicum
ref|XP_011077249.1|  PREDICTED: probable receptor-like protein ki...    306   4e-97    
gb|KHG26991.1|  hypothetical protein F383_05198                         305   6e-97    Gossypium arboreum [tree cotton]
ref|XP_010032169.1|  PREDICTED: probable receptor-like protein ki...    305   1e-96    Eucalyptus grandis [rose gum]
ref|XP_010464638.1|  PREDICTED: probable receptor-like protein ki...    304   1e-96    Camelina sativa [gold-of-pleasure]
dbj|BAH19927.1|  AT3G09830                                              304   2e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011041041.1|  PREDICTED: probable receptor-like protein ki...    304   2e-96    Populus euphratica
ref|XP_004307370.1|  PREDICTED: probable receptor-like protein ki...    304   2e-96    Fragaria vesca subsp. vesca
ref|XP_008457617.1|  PREDICTED: probable receptor-like protein ki...    302   4e-96    Cucumis melo [Oriental melon]
ref|XP_010477459.1|  PREDICTED: probable receptor-like protein ki...    303   4e-96    Camelina sativa [gold-of-pleasure]
ref|XP_006287832.1|  hypothetical protein CARUB_v10001049mg             303   4e-96    Capsella rubella
ref|XP_006297732.1|  hypothetical protein CARUB_v10013766mg             303   5e-96    Capsella rubella
gb|ACJ85098.1|  unknown                                                 301   9e-96    Medicago truncatula
ref|XP_006436456.1|  hypothetical protein CICLE_v10031608mg             301   1e-95    Citrus clementina [clementine]
ref|XP_009146895.1|  PREDICTED: probable receptor-like protein ki...    301   1e-95    
ref|XP_008778999.1|  PREDICTED: probable receptor-like protein ki...    301   2e-95    Phoenix dactylifera
ref|XP_006436457.1|  hypothetical protein CICLE_v10031608mg             300   2e-95    
ref|XP_006485632.1|  PREDICTED: probable receptor-like protein ki...    301   3e-95    Citrus sinensis [apfelsine]
ref|NP_187594.1|  protein kinase family protein                         300   3e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010935734.1|  PREDICTED: probable receptor-like protein ki...    301   3e-95    
ref|XP_010452206.1|  PREDICTED: probable receptor-like protein ki...    300   3e-95    Camelina sativa [gold-of-pleasure]
emb|CDY54619.1|  BnaA05g28720D                                          300   4e-95    Brassica napus [oilseed rape]
ref|XP_010423734.1|  PREDICTED: probable receptor-like protein ki...    300   4e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010543404.1|  PREDICTED: probable receptor-like protein ki...    300   5e-95    Tarenaya hassleriana [spider flower]
gb|KHN48255.1|  Putative receptor-like protein kinase                   300   5e-95    Glycine soja [wild soybean]
gb|KDO46223.1|  hypothetical protein CISIN_1g013504mg                   300   7e-95    Citrus sinensis [apfelsine]
ref|XP_010935733.1|  PREDICTED: probable receptor-like protein ki...    301   8e-95    Elaeis guineensis
ref|XP_008776800.1|  PREDICTED: probable receptor-like protein ki...    299   1e-94    Phoenix dactylifera
emb|CDY41582.1|  BnaC05g43190D                                          295   1e-94    Brassica napus [oilseed rape]
ref|XP_006593326.1|  PREDICTED: protein kinase isoform X1               301   2e-94    Glycine max [soybeans]
ref|XP_006398776.1|  hypothetical protein EUTSA_v10013665mg             298   2e-94    Eutrema salsugineum [saltwater cress]
ref|XP_010490808.1|  PREDICTED: probable receptor-like protein ki...    298   2e-94    Camelina sativa [gold-of-pleasure]
ref|NP_001235402.1|  protein kinase                                     301   2e-94    Glycine max [soybeans]
ref|XP_002882639.1|  hypothetical protein ARALYDRAFT_478307             298   2e-94    
ref|XP_004143264.1|  PREDICTED: probable receptor-like protein ki...    297   3e-94    Cucumis sativus [cucumbers]
ref|XP_002871026.1|  hypothetical protein ARALYDRAFT_908199             298   4e-94    Arabidopsis lyrata subsp. lyrata
ref|NP_195952.1|  protein kinase family protein                         298   4e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004149901.1|  PREDICTED: probable receptor-like protein ki...    297   7e-94    Cucumis sativus [cucumbers]
emb|CDY22206.1|  BnaC01g38950D                                          297   1e-93    Brassica napus [oilseed rape]
gb|KJB60555.1|  hypothetical protein B456_009G312200                    296   1e-93    Gossypium raimondii
ref|XP_008456511.1|  PREDICTED: probable receptor-like protein ki...    296   2e-93    Cucumis melo [Oriental melon]
ref|XP_002312001.1|  kinase family protein                              295   2e-93    
gb|EYU39624.1|  hypothetical protein MIMGU_mgv1a007133mg                295   3e-93    Erythranthe guttata [common monkey flower]
ref|XP_006407633.1|  hypothetical protein EUTSA_v10020792mg             295   3e-93    Eutrema salsugineum [saltwater cress]
gb|KGN47838.1|  hypothetical protein Csa_6G406010                       295   6e-93    Cucumis sativus [cucumbers]
emb|CDX70313.1|  BnaA10g26620D                                          295   7e-93    
gb|KGN48176.1|  hypothetical protein Csa_6G446370                       296   8e-93    Cucumis sativus [cucumbers]
ref|XP_008365181.1|  PREDICTED: probable receptor-like protein ki...    294   1e-92    
emb|CDY10387.1|  BnaCnng02880D                                          294   1e-92    Brassica napus [oilseed rape]
ref|XP_009368900.1|  PREDICTED: probable receptor-like protein ki...    293   2e-92    Pyrus x bretschneideri [bai li]
gb|AAF43496.1|AF131222_1  protein serine/threonine kinase               293   2e-92    Thinopyrum elongatum [tall wheatgrass]
emb|CDY41315.1|  BnaA01g32040D                                          293   3e-92    Brassica napus [oilseed rape]
ref|XP_009123163.1|  PREDICTED: probable receptor-like protein ki...    291   1e-91    Brassica rapa
ref|XP_011031711.1|  PREDICTED: probable receptor-like protein ki...    291   1e-91    Populus euphratica
emb|CDY44629.1|  BnaC04g06330D                                          291   1e-91    Brassica napus [oilseed rape]
ref|XP_009386350.1|  PREDICTED: probable receptor-like protein ki...    290   3e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386349.1|  PREDICTED: probable receptor-like protein ki...    290   3e-91    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB60556.1|  hypothetical protein B456_009G312200                    290   4e-91    Gossypium raimondii
ref|XP_009122715.1|  PREDICTED: probable receptor-like protein ki...    290   5e-91    Brassica rapa
dbj|BAK01480.1|  predicted protein                                      290   5e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ91599.1|  predicted protein                                      290   5e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU38549.1|  hypothetical protein MIMGU_mgv1a022350mg                287   7e-91    Erythranthe guttata [common monkey flower]
ref|XP_010918688.1|  PREDICTED: probable receptor-like protein ki...    289   8e-91    Elaeis guineensis
ref|XP_002879784.1|  hypothetical protein ARALYDRAFT_482930             288   1e-90    
ref|XP_006648129.1|  PREDICTED: probable receptor-like protein ki...    289   1e-90    Oryza brachyantha
ref|XP_002862908.1|  hypothetical protein ARALYDRAFT_921086             289   1e-90    Arabidopsis lyrata subsp. lyrata
ref|XP_010557951.1|  PREDICTED: probable receptor-like protein ki...    290   1e-90    Tarenaya hassleriana [spider flower]
gb|AAO42877.1|  At2g39110                                               289   2e-90    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001048536.1|  Os02g0819600                                       288   3e-90    
ref|XP_009125492.1|  PREDICTED: probable receptor-like protein ki...    287   4e-90    Brassica rapa
ref|XP_010509071.1|  PREDICTED: probable receptor-like protein ki...    288   5e-90    Camelina sativa [gold-of-pleasure]
ref|XP_003573979.2|  PREDICTED: probable receptor-like protein ki...    288   5e-90    Brachypodium distachyon [annual false brome]
gb|EEC74260.1|  hypothetical protein OsI_09473                          287   6e-90    Oryza sativa Indica Group [Indian rice]
ref|XP_006411135.1|  hypothetical protein EUTSA_v10016674mg             287   6e-90    Eutrema salsugineum [saltwater cress]
ref|NP_850311.1|  protein kinase superfamily protein                    287   7e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010235978.1|  PREDICTED: probable receptor-like protein ki...    286   1e-89    
ref|NP_001146659.1|  uncharacterized LOC100280259                       287   1e-89    Zea mays [maize]
emb|CDY44356.1|  BnaC02g03210D                                          286   1e-89    Brassica napus [oilseed rape]
emb|CDY69874.1|  BnaAnng31840D                                          286   1e-89    Brassica napus [oilseed rape]
ref|XP_008343482.1|  PREDICTED: probable receptor-like protein ki...    286   1e-89    
gb|EMT16531.1|  Protein kinase APK1B, chloroplastic                     285   1e-89    
gb|ACG27469.1|  protein kinase APK1A                                    286   1e-89    Zea mays [maize]
ref|XP_010505573.1|  PREDICTED: probable receptor-like protein ki...    286   1e-89    
ref|XP_009143340.1|  PREDICTED: probable receptor-like protein ki...    286   2e-89    
ref|XP_004954409.1|  PREDICTED: probable receptor-like protein ki...    285   2e-89    Setaria italica
ref|XP_010517246.1|  PREDICTED: probable receptor-like protein ki...    285   3e-89    Camelina sativa [gold-of-pleasure]
ref|XP_006295687.1|  hypothetical protein CARUB_v10024803mg             285   3e-89    Capsella rubella
ref|XP_010517248.1|  PREDICTED: probable receptor-like protein ki...    285   4e-89    Camelina sativa [gold-of-pleasure]
ref|XP_009384041.1|  PREDICTED: probable receptor-like protein ki...    285   4e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002454791.1|  hypothetical protein SORBIDRAFT_04g037460          284   7e-89    Sorghum bicolor [broomcorn]
ref|XP_008784814.1|  PREDICTED: probable receptor-like protein ki...    283   1e-88    Phoenix dactylifera
emb|CDX74866.1|  BnaA05g06120D                                          284   1e-88    
gb|EPS66606.1|  hypothetical protein M569_08171                         282   2e-88    Genlisea aurea
ref|XP_004983005.1|  PREDICTED: probable receptor-like protein ki...    283   3e-88    
ref|XP_006662393.1|  PREDICTED: probable receptor-like protein ki...    281   6e-88    
ref|XP_009141782.1|  PREDICTED: probable serine/threonine-protein...    281   1e-87    
emb|CDY18353.1|  BnaA04g22340D                                          281   1e-87    Brassica napus [oilseed rape]
ref|XP_009386591.1|  PREDICTED: probable receptor-like protein ki...    281   2e-87    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAC79621.1|  putative protein kinase                                 280   2e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006827432.1|  PREDICTED: probable receptor-like protein ki...    278   3e-86    Amborella trichopoda
ref|XP_008677078.1|  PREDICTED: uncharacterized LOC100279292 isof...    276   7e-86    
emb|CDX93286.1|  BnaC04g46100D                                          276   1e-85    
ref|XP_003560283.1|  PREDICTED: probable receptor-like protein ki...    275   2e-85    Brachypodium distachyon [annual false brome]
gb|KJB55869.1|  hypothetical protein B456_009G098900                    275   9e-85    Gossypium raimondii
gb|KCW85563.1|  hypothetical protein EUGRSUZ_B02362                     273   2e-84    Eucalyptus grandis [rose gum]
ref|XP_006424838.1|  hypothetical protein CICLE_v10028420mg             270   2e-84    Citrus clementina [clementine]
ref|XP_010043546.1|  PREDICTED: probable receptor-like protein ki...    273   4e-84    Eucalyptus grandis [rose gum]
ref|XP_010494957.1|  PREDICTED: probable disease resistance prote...    286   6e-84    
ref|XP_010494959.1|  PREDICTED: probable disease resistance prote...    286   7e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010106486.1|  putative receptor-like protein kinase              271   1e-83    
ref|XP_009397532.1|  PREDICTED: probable receptor-like protein ki...    270   1e-83    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABG66097.1|  Protein kinase domain containing protein, expressed     271   1e-83    Oryza sativa Japonica Group [Japonica rice]
ref|NP_850128.1|  protein kinase family protein                         268   2e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007016401.1|  Kinase APK1B, chloroplast, putative                271   2e-83    
ref|XP_010256920.1|  PREDICTED: probable receptor-like protein ki...    271   2e-83    Nelumbo nucifera [Indian lotus]
ref|XP_010264441.1|  PREDICTED: probable receptor-like protein ki...    268   2e-83    Nelumbo nucifera [Indian lotus]
gb|AAP53976.2|  Protein kinase domain containing protein, expressed     271   3e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008664921.1|  PREDICTED: probable serine/threonine-protein...    271   3e-83    Zea mays [maize]
ref|XP_008664922.1|  PREDICTED: probable serine/threonine-protein...    270   3e-83    Zea mays [maize]
ref|XP_008664920.1|  PREDICTED: probable serine/threonine-protein...    270   4e-83    Zea mays [maize]
ref|XP_006424839.1|  hypothetical protein CICLE_v10028420mg             270   5e-83    Citrus clementina [clementine]
gb|KDO72842.1|  hypothetical protein CISIN_1g043568mg                   270   5e-83    Citrus sinensis [apfelsine]
ref|XP_006294171.1|  hypothetical protein CARUB_v10023166mg             270   6e-83    Capsella rubella
gb|EEC67045.1|  hypothetical protein OsI_33788                          270   8e-83    Oryza sativa Indica Group [Indian rice]
ref|XP_012092541.1|  PREDICTED: probable receptor-like protein ki...    270   8e-83    Jatropha curcas
ref|XP_009792201.1|  PREDICTED: probable receptor-like protein ki...    270   1e-82    Nicotiana sylvestris
ref|XP_011042708.1|  PREDICTED: probable receptor-like protein ki...    269   2e-82    Populus euphratica
emb|CBI16123.3|  unnamed protein product                                266   2e-82    Vitis vinifera
ref|XP_011089472.1|  PREDICTED: probable receptor-like protein ki...    268   2e-82    Sesamum indicum [beniseed]
emb|CDY47884.1|  BnaA07g14290D                                          268   2e-82    Brassica napus [oilseed rape]
gb|KJB83776.1|  hypothetical protein B456_013G263500                    265   2e-82    Gossypium raimondii
ref|XP_009124370.1|  PREDICTED: probable receptor-like protein ki...    268   3e-82    Brassica rapa
ref|XP_002283598.1|  PREDICTED: probable receptor-like protein ki...    267   4e-82    Vitis vinifera
ref|XP_010264439.1|  PREDICTED: probable receptor-like protein ki...    267   5e-82    Nelumbo nucifera [Indian lotus]
ref|XP_010264440.1|  PREDICTED: probable receptor-like protein ki...    267   5e-82    Nelumbo nucifera [Indian lotus]
ref|NP_973556.1|  protein kinase family protein                         268   6e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002298354.2|  hypothetical protein POPTR_0001s24730g             267   6e-82    Populus trichocarpa [western balsam poplar]
ref|XP_011035308.1|  PREDICTED: probable receptor-like protein ki...    267   6e-82    Populus euphratica
ref|XP_002313435.2|  hypothetical protein POPTR_0009s03680g             267   7e-82    
emb|CDY39520.1|  BnaC04g15190D                                          267   7e-82    Brassica napus [oilseed rape]
ref|XP_002464564.1|  hypothetical protein SORBIDRAFT_01g020900          266   1e-81    Sorghum bicolor [broomcorn]
gb|KHN21951.1|  Putative receptor-like protein kinase                   262   1e-81    Glycine soja [wild soybean]
ref|XP_002531439.1|  Protein kinase APK1B, chloroplast precursor,...    268   1e-81    
ref|XP_004505859.1|  PREDICTED: probable receptor-like protein ki...    266   1e-81    Cicer arietinum [garbanzo]
gb|KJB83775.1|  hypothetical protein B456_013G263500                    266   2e-81    Gossypium raimondii
ref|XP_004294512.2|  PREDICTED: probable receptor-like protein ki...    266   2e-81    Fragaria vesca subsp. vesca
ref|XP_010321720.1|  PREDICTED: probable receptor-like protein ki...    261   3e-81    
ref|XP_010510559.1|  PREDICTED: probable receptor-like protein ki...    265   4e-81    Camelina sativa [gold-of-pleasure]
ref|XP_009590399.1|  PREDICTED: probable receptor-like protein ki...    265   5e-81    Nicotiana tomentosiformis
ref|XP_008464123.1|  PREDICTED: probable receptor-like protein ki...    265   6e-81    Cucumis melo [Oriental melon]
ref|XP_010470024.1|  PREDICTED: probable receptor-like protein ki...    265   7e-81    Camelina sativa [gold-of-pleasure]
ref|XP_004143119.1|  PREDICTED: probable receptor-like protein ki...    264   8e-81    Cucumis sativus [cucumbers]
ref|XP_010521845.1|  PREDICTED: probable receptor-like protein ki...    265   8e-81    Tarenaya hassleriana [spider flower]
ref|XP_009590397.1|  PREDICTED: probable receptor-like protein ki...    265   9e-81    Nicotiana tomentosiformis
ref|XP_010414462.1|  PREDICTED: probable receptor-like protein ki...    265   1e-80    Camelina sativa [gold-of-pleasure]
ref|XP_006409927.1|  hypothetical protein EUTSA_v10017635mg             263   1e-80    Eutrema salsugineum [saltwater cress]
ref|XP_002881023.1|  kinase family protein                              264   2e-80    
ref|XP_008223696.1|  PREDICTED: probable receptor-like protein ki...    263   2e-80    Prunus mume [ume]
dbj|BAJ90857.1|  predicted protein                                      263   3e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007132064.1|  hypothetical protein PHAVU_011G063900g             262   4e-80    Phaseolus vulgaris [French bean]
ref|XP_004240362.1|  PREDICTED: probable receptor-like protein ki...    262   6e-80    Solanum lycopersicum
ref|NP_001235210.1|  protein kinase                                     262   6e-80    Glycine max [soybeans]
dbj|BAK00090.1|  predicted protein                                      262   6e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH30166.1|  receptor-like kinase                                    262   6e-80    Medicago truncatula
gb|KHN32127.1|  Putative receptor-like protein kinase                   256   8e-80    Glycine soja [wild soybean]
ref|XP_007208565.1|  hypothetical protein PRUPE_ppa023937mg             261   1e-79    Prunus persica
ref|XP_008779202.1|  PREDICTED: probable receptor-like protein ki...    261   2e-79    Phoenix dactylifera
gb|KFK32248.1|  hypothetical protein AALP_AA6G217300                    260   2e-79    Arabis alpina [alpine rockcress]
ref|XP_010685749.1|  PREDICTED: probable receptor-like protein ki...    260   4e-79    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010931273.1|  PREDICTED: probable receptor-like protein ki...    258   2e-78    Elaeis guineensis
ref|XP_010441480.1|  PREDICTED: LOW QUALITY PROTEIN: probable dis...    271   2e-78    
gb|EYU18978.1|  hypothetical protein MIMGU_mgv1a006424mg                258   2e-78    Erythranthe guttata [common monkey flower]
ref|XP_009364394.1|  PREDICTED: probable receptor-like protein ki...    257   4e-78    Pyrus x bretschneideri [bai li]
emb|CDP09061.1|  unnamed protein product                                257   7e-78    Coffea canephora [robusta coffee]
ref|XP_003539672.1|  PREDICTED: probable receptor-like protein ki...    256   1e-77    Glycine max [soybeans]
ref|XP_008357170.1|  PREDICTED: probable receptor-like protein ki...    256   1e-77    Malus domestica [apple tree]
ref|XP_009353658.1|  PREDICTED: probable receptor-like protein ki...    253   1e-76    
gb|EPS66576.1|  hypothetical protein M569_08202                         249   1e-76    Genlisea aurea
ref|XP_011624107.1|  PREDICTED: probable receptor-like protein ki...    249   2e-76    
ref|XP_009388614.1|  PREDICTED: probable receptor-like protein ki...    250   2e-75    Musa acuminata subsp. malaccensis [pisang utan]
gb|ERN07884.1|  hypothetical protein AMTR_s00012p00223410               249   5e-75    Amborella trichopoda
ref|XP_008387581.1|  PREDICTED: probable receptor-like protein ki...    233   2e-71    
ref|XP_008223689.1|  PREDICTED: probable receptor-like protein ki...    238   2e-70    Prunus mume [ume]
ref|XP_002973981.1|  hypothetical protein SELMODRAFT_173964             232   8e-69    
ref|XP_002969082.1|  hypothetical protein SELMODRAFT_170305             230   6e-68    Selaginella moellendorffii
ref|XP_004307263.1|  PREDICTED: probable receptor-like protein ki...    229   1e-67    Fragaria vesca subsp. vesca
ref|XP_010052762.1|  PREDICTED: probable receptor-like protein ki...    228   5e-67    Eucalyptus grandis [rose gum]
ref|XP_011093490.1|  PREDICTED: probable receptor-like protein ki...    227   7e-67    Sesamum indicum [beniseed]
ref|XP_007052402.1|  Kinase superfamily protein isoform 1               228   8e-67    
ref|XP_011085500.1|  PREDICTED: probable receptor-like protein ki...    227   1e-66    Sesamum indicum [beniseed]
ref|XP_002282904.1|  PREDICTED: probable receptor-like protein ki...    225   3e-66    Vitis vinifera
gb|KJB40950.1|  hypothetical protein B456_007G084600                    226   5e-66    Gossypium raimondii
ref|XP_009398481.1|  PREDICTED: probable receptor-like protein ki...    224   1e-65    
ref|XP_012083746.1|  PREDICTED: probable receptor-like protein ki...    224   2e-65    Jatropha curcas
ref|XP_009384110.1|  PREDICTED: probable receptor-like protein ki...    224   2e-65    
ref|XP_003626764.1|  Protein kinase 2B                                  224   2e-65    Medicago truncatula
ref|XP_003578499.1|  PREDICTED: probable receptor-like protein ki...    223   2e-65    Brachypodium distachyon [annual false brome]
ref|XP_010089771.1|  putative receptor-like protein kinase              223   2e-65    Morus notabilis
ref|XP_001757199.1|  predicted protein                                  221   4e-65    
ref|XP_010269867.1|  PREDICTED: probable receptor-like protein ki...    222   6e-65    Nelumbo nucifera [Indian lotus]
ref|XP_010269866.1|  PREDICTED: probable receptor-like protein ki...    222   6e-65    Nelumbo nucifera [Indian lotus]
ref|XP_008678888.1|  PREDICTED: probable receptor-like protein ki...    223   7e-65    Zea mays [maize]
gb|KHN01616.1|  Putative receptor-like protein kinase                   222   7e-65    Glycine soja [wild soybean]
ref|XP_003530124.1|  PREDICTED: probable receptor-like protein ki...    222   7e-65    Glycine max [soybeans]
ref|XP_010269864.1|  PREDICTED: probable receptor-like protein ki...    222   9e-65    Nelumbo nucifera [Indian lotus]
dbj|BAJ93880.1|  predicted protein                                      221   9e-65    
ref|XP_009386442.1|  PREDICTED: probable receptor-like protein ki...    220   1e-64    
gb|KHG28445.1|  hypothetical protein F383_15126                         217   2e-64    
ref|XP_002452831.1|  hypothetical protein SORBIDRAFT_04g033310          222   2e-64    
ref|XP_006464387.1|  PREDICTED: probable receptor-like protein ki...    221   3e-64    
gb|EMT14693.1|  Protein kinase APK1B, chloroplastic                     218   4e-64    
gb|KJB22262.1|  hypothetical protein B456_004G038000                    218   4e-64    
gb|KDO85426.1|  hypothetical protein CISIN_1g013790mg                   220   7e-64    
gb|KDO85425.1|  hypothetical protein CISIN_1g013790mg                   219   8e-64    
ref|XP_006445469.1|  hypothetical protein CICLE_v10020196mg             219   9e-64    
gb|KJB22258.1|  hypothetical protein B456_004G038000                    218   1e-63    
ref|XP_003521049.1|  PREDICTED: probable receptor-like protein ki...    219   1e-63    
gb|KJB22260.1|  hypothetical protein B456_004G038000                    218   1e-63    
gb|EMT32030.1|  Putative serine/threonine-protein kinase NAK            218   1e-63    
ref|XP_008794867.1|  PREDICTED: probable receptor-like protein ki...    219   2e-63    
ref|XP_011032714.1|  PREDICTED: probable receptor-like protein ki...    219   2e-63    
ref|XP_001776671.1|  predicted protein                                  217   2e-63    
ref|XP_011014611.1|  PREDICTED: probable receptor-like protein ki...    219   2e-63    
gb|KJB40949.1|  hypothetical protein B456_007G084600                    219   2e-63    
gb|EPS73632.1|  hypothetical protein M569_01122                         216   2e-63    
ref|XP_010941254.1|  PREDICTED: probable receptor-like protein ki...    217   2e-63    
ref|XP_004953296.1|  PREDICTED: probable receptor-like protein ki...    219   3e-63    
gb|KHN19718.1|  Putative receptor-like protein kinase                   218   3e-63    
ref|XP_010935034.1|  PREDICTED: probable receptor-like protein ki...    217   3e-63    
gb|KJB22259.1|  hypothetical protein B456_004G038000                    218   3e-63    
ref|XP_006375193.1|  hypothetical protein POPTR_0014s05160g             218   4e-63    
ref|XP_010941253.1|  PREDICTED: probable receptor-like protein ki...    216   5e-63    
ref|XP_011045606.1|  PREDICTED: probable receptor-like protein ki...    217   6e-63    
ref|XP_004148371.1|  PREDICTED: probable receptor-like protein ki...    215   6e-63    
ref|XP_008465911.1|  PREDICTED: probable receptor-like protein ki...    215   1e-62    
ref|NP_001147668.1|  serine/threonine-protein kinase NAK                216   1e-62    
ref|XP_004957463.1|  PREDICTED: probable receptor-like protein ki...    216   1e-62    
ref|XP_010919810.1|  PREDICTED: probable receptor-like protein ki...    216   1e-62    
ref|XP_009759488.1|  PREDICTED: probable receptor-like protein ki...    216   1e-62    
ref|XP_004516992.1|  PREDICTED: probable receptor-like protein ki...    216   2e-62    
dbj|BAK04572.1|  predicted protein                                      216   2e-62    
ref|XP_006661476.1|  PREDICTED: probable receptor-like protein ki...    216   2e-62    
ref|XP_008799403.1|  PREDICTED: probable receptor-like protein ki...    214   3e-62    
dbj|BAJ92981.1|  predicted protein                                      216   3e-62    
ref|XP_002462727.1|  hypothetical protein SORBIDRAFT_02g030970          215   4e-62    
emb|CDP09392.1|  unnamed protein product                                215   4e-62    
ref|XP_010110539.1|  hypothetical protein L484_023373                   214   5e-62    
ref|XP_009376146.1|  PREDICTED: probable receptor-like protein ki...    215   5e-62    
ref|XP_002963331.1|  hypothetical protein SELMODRAFT_80744              213   5e-62    
ref|XP_009370938.1|  PREDICTED: probable receptor-like protein ki...    214   5e-62    
ref|XP_008651383.1|  PREDICTED: LOC100280671 isoform X1                 214   6e-62    
ref|XP_002268330.1|  PREDICTED: probable receptor-like protein ki...    214   8e-62    
ref|XP_008232338.1|  PREDICTED: probable receptor-like protein ki...    214   9e-62    
ref|XP_008788652.1|  PREDICTED: probable receptor-like protein ki...    213   1e-61    
ref|XP_007134382.1|  hypothetical protein PHAVU_010G043100g             214   1e-61    
ref|XP_002526490.1|  ATP binding protein, putative                      214   1e-61    
ref|XP_004976412.1|  PREDICTED: probable receptor-like protein ki...    215   1e-61    
ref|XP_004133967.1|  PREDICTED: probable receptor-like protein ki...    213   1e-61    
ref|XP_006358625.1|  PREDICTED: probable receptor-like protein ki...    213   1e-61    
ref|XP_009376148.1|  PREDICTED: probable receptor-like protein ki...    213   2e-61    
ref|XP_009370940.1|  PREDICTED: probable receptor-like protein ki...    213   2e-61    
gb|KHG28699.1|  hypothetical protein F383_14963                         212   2e-61    
ref|XP_002974621.1|  hypothetical protein SELMODRAFT_102294             211   2e-61    
ref|XP_010692004.1|  PREDICTED: probable receptor-like protein ki...    213   2e-61    
ref|XP_009594763.1|  PREDICTED: probable receptor-like protein ki...    213   2e-61    
ref|XP_004229716.1|  PREDICTED: probable receptor-like protein ki...    213   3e-61    
gb|ABU49132.1|  ser/thr protein kinase                                  213   3e-61    
ref|XP_008438279.1|  PREDICTED: probable receptor-like protein ki...    212   4e-61    
ref|XP_010683262.1|  PREDICTED: probable receptor-like protein ki...    214   4e-61    
ref|XP_008382233.1|  PREDICTED: probable receptor-like protein ki...    212   5e-61    
ref|XP_010683263.1|  PREDICTED: probable receptor-like protein ki...    213   5e-61    
gb|EAY86908.1|  hypothetical protein OsI_08291                          213   5e-61    
ref|XP_004508979.1|  PREDICTED: probable receptor-like protein ki...    211   6e-61    
ref|XP_008343868.1|  PREDICTED: probable receptor-like protein ki...    212   6e-61    
ref|NP_001238681.1|  NAK-type protein kinase                            210   7e-61    
ref|XP_007218043.1|  hypothetical protein PRUPE_ppa006098mg             212   7e-61    
ref|NP_001047588.1|  Os02g0650500                                       213   9e-61    
ref|XP_007209229.1|  hypothetical protein PRUPE_ppa006942mg             210   9e-61    
gb|KEH31591.1|  receptor-like kinase plant                              210   1e-60    
ref|XP_006354647.1|  PREDICTED: probable receptor-like protein ki...    211   1e-60    
gb|EPS61410.1|  hypothetical protein M569_13387                         211   1e-60    
ref|NP_001058579.1|  Os06g0714900                                       209   1e-60    
gb|EAZ38277.1|  hypothetical protein OsJ_22655                          209   1e-60    
gb|KHG22470.1|  hypothetical protein F383_00842                         210   2e-60    
ref|XP_011071028.1|  PREDICTED: probable receptor-like protein ki...    212   2e-60    
ref|XP_006354645.1|  PREDICTED: probable receptor-like protein ki...    211   2e-60    
ref|XP_002439025.1|  hypothetical protein SORBIDRAFT_10g030110          209   2e-60    
ref|XP_012075363.1|  PREDICTED: probable receptor-like protein ki...    209   2e-60    
gb|KJB51744.1|  hypothetical protein B456_008G230200                    209   2e-60    
ref|XP_009795376.1|  PREDICTED: probable receptor-like protein ki...    210   2e-60    
ref|XP_011086394.1|  PREDICTED: probable receptor-like protein ki...    211   3e-60    
ref|XP_004245841.1|  PREDICTED: probable receptor-like protein ki...    209   3e-60    
ref|XP_010656462.1|  PREDICTED: receptor-like serine/threonine-pr...    210   3e-60    
ref|XP_002285390.2|  PREDICTED: receptor-like serine/threonine-pr...    210   3e-60    
ref|NP_001063770.1|  Os09g0533600                                       209   4e-60    
ref|NP_001147062.1|  LOC100280671                                       209   4e-60    
ref|XP_003611407.1|  NAK-type protein kinase                            203   4e-60    
ref|XP_011070252.1|  PREDICTED: probable receptor-like protein ki...    209   4e-60    
ref|XP_006647611.1|  PREDICTED: probable receptor-like protein ki...    211   4e-60    
gb|EYU17859.1|  hypothetical protein MIMGU_mgv1a008283mg                208   4e-60    
ref|XP_006440140.1|  hypothetical protein CICLE_v10020507mg             208   5e-60    
ref|XP_004966446.1|  PREDICTED: probable receptor-like protein ki...    208   5e-60    
ref|XP_006477061.1|  PREDICTED: probable receptor-like protein ki...    208   6e-60    
gb|ACN28244.1|  unknown                                                 206   6e-60    
ref|XP_002517468.1|  Protein kinase APK1B, chloroplast precursor,...    211   6e-60    
gb|EAY95025.1|  hypothetical protein OsI_16835                          209   6e-60    
ref|XP_010528316.1|  PREDICTED: probable receptor-like protein ki...    210   7e-60    
ref|XP_010528314.1|  PREDICTED: probable receptor-like protein ki...    210   7e-60    
ref|XP_010528317.1|  PREDICTED: probable receptor-like protein ki...    210   7e-60    
ref|XP_004300300.1|  PREDICTED: probable receptor-like protein ki...    208   7e-60    
ref|XP_010274546.1|  PREDICTED: probable receptor-like protein ki...    208   8e-60    
ref|XP_011070251.1|  PREDICTED: probable receptor-like protein ki...    209   9e-60    
gb|KDP45472.1|  hypothetical protein JCGZ_09721                         210   1e-59    
ref|XP_009412843.1|  PREDICTED: probable receptor-like protein ki...    208   1e-59    
ref|XP_008229495.1|  PREDICTED: probable receptor-like protein ki...    207   1e-59    
ref|XP_002448253.1|  hypothetical protein SORBIDRAFT_06g024060          210   1e-59    
ref|XP_008669068.1|  PREDICTED: probable receptor-like protein ki...    208   1e-59    
gb|KJB39784.1|  hypothetical protein B456_007G030500                    207   1e-59    
ref|NP_001053452.1|  Os04g0543000                                       209   2e-59    
gb|KGN55809.1|  hypothetical protein Csa_3G017030                       205   2e-59    
ref|XP_007156604.1|  hypothetical protein PHAVU_002G002600g             206   2e-59    
gb|KCW71854.1|  hypothetical protein EUGRSUZ_E00331                     203   2e-59    
ref|NP_001132095.1|  LOC100193511                                       207   3e-59    
ref|XP_007039635.1|  Receptor protein kinase isoform 1                  206   3e-59    
gb|KDO82763.1|  hypothetical protein CISIN_1g010432mg                   204   3e-59    
ref|XP_009619124.1|  PREDICTED: probable receptor-like protein ki...    207   3e-59    
ref|XP_008669067.1|  PREDICTED: probable receptor-like protein ki...    208   3e-59    
ref|XP_010531801.1|  PREDICTED: probable receptor-like protein ki...    208   4e-59    
ref|XP_010531802.1|  PREDICTED: probable receptor-like protein ki...    208   4e-59    
ref|XP_008448760.1|  PREDICTED: probable receptor-like protein ki...    206   4e-59    
ref|XP_006431068.1|  hypothetical protein CICLE_v10011575mg             209   4e-59    
ref|XP_010531804.1|  PREDICTED: probable receptor-like protein ki...    208   4e-59    
ref|XP_006431066.1|  hypothetical protein CICLE_v10011575mg             209   4e-59    
ref|XP_006482531.1|  PREDICTED: probable receptor-like protein ki...    208   4e-59    
ref|XP_006431067.1|  hypothetical protein CICLE_v10011575mg             208   4e-59    
ref|XP_002323831.2|  hypothetical protein POPTR_0017s11370g             208   5e-59    
ref|XP_002323829.2|  hypothetical protein POPTR_0017s11370g             208   5e-59    
gb|KDO82764.1|  hypothetical protein CISIN_1g010432mg                   203   5e-59    
ref|XP_009797575.1|  PREDICTED: probable receptor-like protein ki...    208   5e-59    
gb|EYU28252.1|  hypothetical protein MIMGU_mgv1a018333mg                205   6e-59    
emb|CDY47249.1|  BnaA02g29350D                                          207   6e-59    
ref|XP_009129365.1|  PREDICTED: probable receptor-like protein ki...    207   6e-59    
ref|XP_009129364.1|  PREDICTED: probable receptor-like protein ki...    207   6e-59    
ref|XP_010915105.1|  PREDICTED: probable receptor-like protein ki...    208   6e-59    
ref|XP_010915102.1|  PREDICTED: probable receptor-like protein ki...    208   6e-59    
ref|XP_009587494.1|  PREDICTED: probable receptor-like protein ki...    208   6e-59    
ref|XP_010695453.1|  PREDICTED: probable receptor-like protein ki...    206   6e-59    
ref|XP_007155730.1|  hypothetical protein PHAVU_003G226700g             205   6e-59    
ref|XP_010485514.1|  PREDICTED: receptor-like serine/threonine-pr...    208   7e-59    
gb|KJB25423.1|  hypothetical protein B456_004G190600                    205   8e-59    
ref|XP_010463545.1|  PREDICTED: receptor-like serine/threonine-pr...    208   8e-59    
gb|EAZ31504.1|  hypothetical protein OsJ_15641                          209   9e-59    
ref|XP_006600867.1|  PREDICTED: probable receptor-like protein ki...    204   1e-58    
ref|XP_004147246.1|  PREDICTED: probable receptor-like protein ki...    205   1e-58    
ref|XP_010510371.1|  PREDICTED: receptor-like serine/threonine-pr...    207   1e-58    
dbj|BAJ97793.1|  predicted protein                                      206   1e-58    
emb|CDP00286.1|  unnamed protein product                                207   1e-58    
ref|XP_010931968.1|  PREDICTED: probable receptor-like protein ki...    206   1e-58    
gb|KHN42646.1|  Putative receptor-like protein kinase                   204   1e-58    
gb|EMT32976.1|  Protein kinase APK1B, chloroplastic                     206   1e-58    
ref|NP_189510.2|  putative protein kinase                               204   2e-58    
ref|XP_006652597.1|  PREDICTED: probable receptor-like protein ki...    207   2e-58    
ref|XP_010320662.1|  PREDICTED: probable receptor-like protein ki...    207   2e-58    
dbj|BAC57958.1|  serine/threonine protein kinase                        206   2e-58    
ref|XP_011003188.1|  PREDICTED: probable receptor-like protein ki...    207   2e-58    
ref|XP_006842103.1|  PREDICTED: probable receptor-like protein ki...    206   2e-58    
ref|XP_008793500.1|  PREDICTED: probable receptor-like protein ki...    207   2e-58    
gb|KJB40825.1|  hypothetical protein B456_007G078700                    206   2e-58    
ref|XP_011003187.1|  PREDICTED: probable receptor-like protein ki...    207   2e-58    
ref|XP_009418710.1|  PREDICTED: probable receptor-like protein ki...    204   2e-58    
gb|KJB40826.1|  hypothetical protein B456_007G078700                    206   2e-58    
ref|XP_004238768.1|  PREDICTED: probable receptor-like protein ki...    206   2e-58    
ref|XP_006357263.1|  PREDICTED: probable receptor-like protein ki...    206   2e-58    
gb|ABE01834.1|  NAK-type protein kinase                                 205   2e-58    
ref|XP_002305368.1|  kinase family protein                              206   2e-58    
ref|NP_001154651.1|  putative protein kinase                            205   2e-58    
ref|XP_007157381.1|  hypothetical protein PHAVU_002G065500g             206   2e-58    
ref|NP_001235470.1|  serine/threonine protein kinase-like protein       206   2e-58    
gb|KEH19837.1|  receptor-like kinase plant                              206   3e-58    
ref|XP_004511751.1|  PREDICTED: probable receptor-like protein ki...    203   3e-58    
ref|XP_010456541.1|  PREDICTED: probable receptor-like protein ki...    205   3e-58    
ref|XP_006385587.1|  hypothetical protein POPTR_0003s08340g             204   3e-58    
gb|EYU28703.1|  hypothetical protein MIMGU_mgv1a005501mg                206   3e-58    
ref|XP_010055393.1|  PREDICTED: probable receptor-like protein ki...    204   3e-58    
ref|XP_010931806.1|  PREDICTED: probable receptor-like protein ki...    206   3e-58    
ref|XP_010931889.1|  PREDICTED: probable receptor-like protein ki...    206   3e-58    
ref|XP_010096340.1|  putative receptor-like protein kinase              206   4e-58    
ref|XP_003611406.1|  NAK-type protein kinase                            202   4e-58    
gb|KDO82762.1|  hypothetical protein CISIN_1g010432mg                   204   4e-58    
ref|XP_006646050.1|  PREDICTED: probable receptor-like protein ki...    205   4e-58    
ref|XP_003560551.1|  PREDICTED: probable receptor-like protein ki...    203   4e-58    
emb|CDP13432.1|  unnamed protein product                                204   4e-58    
ref|NP_001030790.2|  putative protein kinase                            205   4e-58    
ref|XP_006385387.1|  kinase family protein                              203   5e-58    
ref|XP_002440373.1|  hypothetical protein SORBIDRAFT_09g030520          203   5e-58    
ref|XP_009627248.1|  PREDICTED: probable receptor-like protein ki...    205   5e-58    
gb|KFK33749.1|  hypothetical protein AALP_AA5G055100                    205   5e-58    
ref|NP_001238477.1|  NAK-type protein kinase                            202   5e-58    
ref|XP_011018668.1|  PREDICTED: probable receptor-like protein ki...    203   6e-58    
gb|ERN17929.1|  hypothetical protein AMTR_s00046p00017580               198   6e-58    
ref|XP_009131434.1|  PREDICTED: probable receptor-like protein ki...    206   6e-58    
ref|NP_197012.1|  probable receptor-like protein kinase                 206   6e-58    
ref|XP_004509947.1|  PREDICTED: probable receptor-like protein ki...    205   6e-58    
ref|XP_008344763.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    202   6e-58    
gb|ACU19870.1|  unknown                                                 200   6e-58    
gb|EMT24219.1|  Protein kinase APK1A, chloroplastic                     204   7e-58    
ref|XP_010420160.1|  PREDICTED: probable receptor-like protein ki...    206   7e-58    
ref|NP_001167795.1|  uncharacterized LOC100381489                       199   7e-58    
emb|CDX70589.1|  BnaC03g06730D                                          206   7e-58    
gb|KFK25744.1|  hypothetical protein AALP_AA8G154000                    206   7e-58    
ref|XP_006395351.1|  hypothetical protein EUTSA_v10004125mg             205   8e-58    
ref|XP_010492331.1|  PREDICTED: probable receptor-like protein ki...    206   8e-58    
ref|XP_003551987.1|  PREDICTED: probable receptor-like protein ki...    205   9e-58    
ref|XP_009371856.1|  PREDICTED: probable receptor-like protein ki...    202   9e-58    
ref|XP_007157391.1|  hypothetical protein PHAVU_002G066400g             205   1e-57    
ref|XP_009772201.1|  PREDICTED: probable receptor-like protein ki...    204   1e-57    
ref|XP_011009452.1|  PREDICTED: probable receptor-like protein ki...    205   1e-57    
ref|XP_002871647.1|  hypothetical protein ARALYDRAFT_909477             205   1e-57    
ref|XP_002520138.1|  Protein kinase APK1B, chloroplast precursor,...    205   1e-57    
ref|XP_010524324.1|  PREDICTED: probable receptor-like protein ki...    204   1e-57    
ref|XP_011009453.1|  PREDICTED: probable receptor-like protein ki...    204   1e-57    
ref|XP_008808482.1|  PREDICTED: probable receptor-like protein ki...    204   1e-57    
ref|XP_009594394.1|  PREDICTED: probable receptor-like protein ki...    204   1e-57    
ref|XP_006378157.1|  hypothetical protein POPTR_0010s04270g             204   1e-57    
ref|XP_011031999.1|  PREDICTED: probable receptor-like protein ki...    202   1e-57    
ref|XP_008808474.1|  PREDICTED: probable receptor-like protein ki...    204   1e-57    



>ref|XP_011094637.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Sesamum indicum]
 ref|XP_011094638.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Sesamum indicum]
 ref|XP_011094639.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Sesamum indicum]
Length=425

 Score =   376 bits (965),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 204/232 (88%), Gaps = 1/232 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA DAA GLAY HE MDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EGLTH+ST
Sbjct  194  RIALDAARGLAYLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPPEGLTHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK+DVWSYGVFLYELITGR PLDRNRPRSEQKLLEWVKP+
Sbjct  254  AVVGTMGYAAPEYIQTGRLTSKSDVWSYGVFLYELITGRRPLDRNRPRSEQKLLEWVKPY  313

Query  617  LSDSKKFRQIIDPRLEG-NILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKF+QI+DPRLEG  ILKSAHKLSLVANRCL R  K+RPKMSEVL+M+N+V+E + 
Sbjct  314  LSDAKKFQQILDPRLEGKQILKSAHKLSLVANRCLARLQKTRPKMSEVLEMINQVVEGTN  373

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            G G+P+P ++  +     +E + KGKRRI DMK+GDG WLVR+WS K +KTC
Sbjct  374  GTGNPQPPLMSKEQKKKFEEPEAKGKRRIADMKIGDGGWLVRVWSSKLVKTC  425



>ref|XP_011094636.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Sesamum indicum]
Length=436

 Score =   376 bits (965),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 204/232 (88%), Gaps = 1/232 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA DAA GLAY HE MDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EGLTH+ST
Sbjct  205  RIALDAARGLAYLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPPEGLTHVST  264

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK+DVWSYGVFLYELITGR PLDRNRPRSEQKLLEWVKP+
Sbjct  265  AVVGTMGYAAPEYIQTGRLTSKSDVWSYGVFLYELITGRRPLDRNRPRSEQKLLEWVKPY  324

Query  617  LSDSKKFRQIIDPRLEG-NILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKF+QI+DPRLEG  ILKSAHKLSLVANRCL R  K+RPKMSEVL+M+N+V+E + 
Sbjct  325  LSDAKKFQQILDPRLEGKQILKSAHKLSLVANRCLARLQKTRPKMSEVLEMINQVVEGTN  384

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            G G+P+P ++  +     +E + KGKRRI DMK+GDG WLVR+WS K +KTC
Sbjct  385  GTGNPQPPLMSKEQKKKFEEPEAKGKRRIADMKIGDGGWLVRVWSSKLVKTC  436



>ref|XP_006354346.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X3 [Solanum tuberosum]
 ref|XP_006354347.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X4 [Solanum tuberosum]
Length=423

 Score =   374 bits (961),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 205/231 (89%), Gaps = 2/231 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MD QIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EGLTH+ST
Sbjct  195  KIAQDAARGLAYLHEEMDVQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPPEGLTHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK+DVWSYGVFLYELITGR PLDRNRPRSEQKLLEWVKP+
Sbjct  255  AVVGTMGYAAPEYIQTGRLTSKSDVWSYGVFLYELITGRRPLDRNRPRSEQKLLEWVKPY  314

Query  617  LSDSKKFRQIIDPRLEGNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEASTG  438
            +SDSKKF+QI+DPRL+G I +SA KLS+VANRCLVRH K+RPKMSEVL+M+NK++E STG
Sbjct  315  ISDSKKFQQILDPRLDGKISRSAQKLSIVANRCLVRHAKTRPKMSEVLEMVNKIVETSTG  374

Query  437  IGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            IG+P P +  ++P  T  E  RKGKR+ITD+K+GDG+ LVR+WS K   TC
Sbjct  375  IGNPGPPVRIAEP--TSPESARKGKRKITDIKLGDGNRLVRMWSTKLTSTC  423



>ref|XP_006354344.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006354345.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X2 [Solanum tuberosum]
Length=434

 Score =   374 bits (961),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 205/231 (89%), Gaps = 2/231 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MD QIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EGLTH+ST
Sbjct  206  KIAQDAARGLAYLHEEMDVQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPPEGLTHVST  265

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK+DVWSYGVFLYELITGR PLDRNRPRSEQKLLEWVKP+
Sbjct  266  AVVGTMGYAAPEYIQTGRLTSKSDVWSYGVFLYELITGRRPLDRNRPRSEQKLLEWVKPY  325

Query  617  LSDSKKFRQIIDPRLEGNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEASTG  438
            +SDSKKF+QI+DPRL+G I +SA KLS+VANRCLVRH K+RPKMSEVL+M+NK++E STG
Sbjct  326  ISDSKKFQQILDPRLDGKISRSAQKLSIVANRCLVRHAKTRPKMSEVLEMVNKIVETSTG  385

Query  437  IGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            IG+P P +  ++P  T  E  RKGKR+ITD+K+GDG+ LVR+WS K   TC
Sbjct  386  IGNPGPPVRIAEP--TSPESARKGKRKITDIKLGDGNRLVRMWSTKLTSTC  434



>ref|XP_009764511.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Nicotiana sylvestris]
Length=423

 Score =   373 bits (958),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 203/231 (88%), Gaps = 2/231 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GL Y HE MD QIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EGLTH+ST
Sbjct  195  KIAQDAARGLTYLHEEMDVQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPPEGLTHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSK+DVWSYGVFLYELITGR PLDRNRPR EQKLLEWVKP+
Sbjct  255  AVVGTMGYAAPEYVQTGRLTSKSDVWSYGVFLYELITGRRPLDRNRPRIEQKLLEWVKPY  314

Query  617  LSDSKKFRQIIDPRLEGNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEASTG  438
            +SDSKKF+ I+DPRLEG I +SA KLS+VANRCLVRHPKSRPKMSEV++M+NKV+E+S G
Sbjct  315  ISDSKKFQHILDPRLEGKISRSAQKLSIVANRCLVRHPKSRPKMSEVVEMVNKVVESSIG  374

Query  437  IGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            +G+P P +   +P  T  E +RKGKRRI+D K+GDGS LVR+WS K + TC
Sbjct  375  VGNPEPPVKIVEP--TSPESERKGKRRISDTKLGDGSRLVRMWSTKLINTC  423



>ref|XP_009764510.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Nicotiana sylvestris]
Length=434

 Score =   373 bits (958),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 203/231 (88%), Gaps = 2/231 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GL Y HE MD QIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EGLTH+ST
Sbjct  206  KIAQDAARGLTYLHEEMDVQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPPEGLTHVST  265

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSK+DVWSYGVFLYELITGR PLDRNRPR EQKLLEWVKP+
Sbjct  266  AVVGTMGYAAPEYVQTGRLTSKSDVWSYGVFLYELITGRRPLDRNRPRIEQKLLEWVKPY  325

Query  617  LSDSKKFRQIIDPRLEGNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEASTG  438
            +SDSKKF+ I+DPRLEG I +SA KLS+VANRCLVRHPKSRPKMSEV++M+NKV+E+S G
Sbjct  326  ISDSKKFQHILDPRLEGKISRSAQKLSIVANRCLVRHPKSRPKMSEVVEMVNKVVESSIG  385

Query  437  IGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            +G+P P +   +P  T  E +RKGKRRI+D K+GDGS LVR+WS K + TC
Sbjct  386  VGNPEPPVKIVEP--TSPESERKGKRRISDTKLGDGSRLVRMWSTKLINTC  434



>ref|XP_010325981.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Solanum lycopersicum]
Length=422

 Score =   372 bits (954),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 203/231 (88%), Gaps = 3/231 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MD QIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EGLTH+ST
Sbjct  195  KIAQDAARGLAYLHEEMDVQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPPEGLTHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSK+DVWSYGVFLYELITGR PLDRNRPRSEQKLLEWVKP+
Sbjct  255  AVVGTMGYAAPEYVQTGRLTSKSDVWSYGVFLYELITGRRPLDRNRPRSEQKLLEWVKPY  314

Query  617  LSDSKKFRQIIDPRLEGNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEASTG  438
            +SDSKKF+QIIDPRL+G I +SA KLS+VANRCLVRH K+RPKMSEVL+M+NKV+E STG
Sbjct  315  ISDSKKFQQIIDPRLDGKISRSAQKLSIVANRCLVRHAKTRPKMSEVLEMVNKVVETSTG  374

Query  437  IGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            IG+P P +  ++P  T  E  RKGKR++ D K+GDGS LVRIWS K   TC
Sbjct  375  IGNPGPPVRIAEP--TSPESTRKGKRKV-DTKLGDGSRLVRIWSTKLTNTC  422



>ref|XP_004246645.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010325980.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Solanum lycopersicum]
Length=433

 Score =   371 bits (952),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 203/231 (88%), Gaps = 3/231 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MD QIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EGLTH+ST
Sbjct  206  KIAQDAARGLAYLHEEMDVQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPPEGLTHVST  265

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSK+DVWSYGVFLYELITGR PLDRNRPRSEQKLLEWVKP+
Sbjct  266  AVVGTMGYAAPEYVQTGRLTSKSDVWSYGVFLYELITGRRPLDRNRPRSEQKLLEWVKPY  325

Query  617  LSDSKKFRQIIDPRLEGNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEASTG  438
            +SDSKKF+QIIDPRL+G I +SA KLS+VANRCLVRH K+RPKMSEVL+M+NKV+E STG
Sbjct  326  ISDSKKFQQIIDPRLDGKISRSAQKLSIVANRCLVRHAKTRPKMSEVLEMVNKVVETSTG  385

Query  437  IGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            IG+P P +  ++P  T  E  RKGKR++ D K+GDGS LVRIWS K   TC
Sbjct  386  IGNPGPPVRIAEP--TSPESTRKGKRKV-DTKLGDGSRLVRIWSTKLTNTC  433



>ref|XP_009605411.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Nicotiana tomentosiformis]
Length=423

 Score =   370 bits (951),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 202/231 (87%), Gaps = 2/231 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GL Y HE MD QIIFRDFKSSNILLDE+WNAKLSDFGLARLGP EGLTH+ST
Sbjct  195  KIAQDAARGLTYLHEEMDVQIIFRDFKSSNILLDERWNAKLSDFGLARLGPPEGLTHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSK+DVWSYGVFLYELITGR PLDRNRPRSEQKLLEWVKP+
Sbjct  255  AVVGTMGYAAPEYVQTGRLTSKSDVWSYGVFLYELITGRRPLDRNRPRSEQKLLEWVKPY  314

Query  617  LSDSKKFRQIIDPRLEGNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEASTG  438
            +SDSKKF+ I+DPRLEG I +SA KLS+VANRCLVRH KSRPKMSEVL+M+NKV+EAS G
Sbjct  315  ISDSKKFQHILDPRLEGKISRSAQKLSIVANRCLVRHSKSRPKMSEVLEMVNKVIEASIG  374

Query  437  IGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            +G+P P +   +P  T  E +RKGKRRI+D K+G+G  LVR+WS K + TC
Sbjct  375  VGNPEPPVKIVEP--TSPESERKGKRRISDTKLGEGGRLVRMWSTKLINTC  423



>ref|XP_009605410.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Nicotiana tomentosiformis]
Length=434

 Score =   370 bits (951),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 202/231 (87%), Gaps = 2/231 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GL Y HE MD QIIFRDFKSSNILLDE+WNAKLSDFGLARLGP EGLTH+ST
Sbjct  206  KIAQDAARGLTYLHEEMDVQIIFRDFKSSNILLDERWNAKLSDFGLARLGPPEGLTHVST  265

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSK+DVWSYGVFLYELITGR PLDRNRPRSEQKLLEWVKP+
Sbjct  266  AVVGTMGYAAPEYVQTGRLTSKSDVWSYGVFLYELITGRRPLDRNRPRSEQKLLEWVKPY  325

Query  617  LSDSKKFRQIIDPRLEGNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEASTG  438
            +SDSKKF+ I+DPRLEG I +SA KLS+VANRCLVRH KSRPKMSEVL+M+NKV+EAS G
Sbjct  326  ISDSKKFQHILDPRLEGKISRSAQKLSIVANRCLVRHSKSRPKMSEVLEMVNKVIEASIG  385

Query  437  IGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            +G+P P +   +P  T  E +RKGKRRI+D K+G+G  LVR+WS K + TC
Sbjct  386  VGNPEPPVKIVEP--TSPESERKGKRRISDTKLGEGGRLVRMWSTKLINTC  434



>emb|CDP06758.1| unnamed protein product [Coffea canephora]
Length=305

 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 198/231 (86%), Gaps = 1/231 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE M+FQIIFRDFK+SNILLDE WNAKLSDFGLARLGP EGLTH+ST
Sbjct  74   KIAQDAARGLAYLHEEMEFQIIFRDFKASNILLDEDWNAKLSDFGLARLGPSEGLTHVST  133

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK+DVWSYGVFLYELITGR PLDRNRPR+EQKLLEWVKP+
Sbjct  134  AVVGTMGYAAPEYIQTGRLTSKSDVWSYGVFLYELITGRRPLDRNRPRNEQKLLEWVKPY  193

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKF+QI+DPRLE  +++KSAHKLSLVANRCL RH K+RPKMSEV+ M+N+V+ AS 
Sbjct  194  LSDAKKFQQILDPRLERKHLIKSAHKLSLVANRCLARHAKTRPKMSEVVAMVNQVVAASV  253

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKT  288
             IG PRP +       T++   +K KRRI D +V +G WLVRIWS K +KT
Sbjct  254  EIGSPRPPLKAVGQKETEEGAGKKNKRRIMDARVVEGGWLVRIWSSKHVKT  304



>ref|XP_006381430.1| kinase family protein [Populus trichocarpa]
 gb|ERP59227.1| kinase family protein [Populus trichocarpa]
Length=424

 Score =   345 bits (886),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 165/232 (71%), Positives = 195/232 (84%), Gaps = 1/232 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE MDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EGLTH+ST
Sbjct  193  RIAQDAARGLKYLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSEGLTHVST  252

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSK+DVWSYGVFLYELITGR PLDRNRP+SEQKLLEW++P+
Sbjct  253  AVVGTMGYAAPEYVQTGRLTSKSDVWSYGVFLYELITGRRPLDRNRPKSEQKLLEWIRPY  312

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKF+QI+DPRLE  +ILKSAHKL+ +ANRCLVR+PK RPKMSEVL+ +N++++AST
Sbjct  313  LSDAKKFKQIVDPRLEQKDILKSAHKLANIANRCLVRNPKLRPKMSEVLEKMNQIVDAST  372

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            G    + S  +S PI T      K KRR  D+K G+  W   +W+ K ++TC
Sbjct  373  GTESAQQSSKNSAPIKTSHGTTAKNKRRNVDLKTGESGWFGWMWNPKHVRTC  424



>ref|XP_011018722.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Populus euphratica]
 ref|XP_011018723.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Populus euphratica]
 ref|XP_011018724.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Populus euphratica]
Length=426

 Score =   343 bits (880),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 194/232 (84%), Gaps = 1/232 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE MDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EGLTH+ST
Sbjct  195  RIAQDAARGLKYLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSEGLTHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSK+DVWSYGVFLYELITGR PLDRNRP+SEQKLLEW++P+
Sbjct  255  AVVGTMGYAAPEYVQTGRLTSKSDVWSYGVFLYELITGRRPLDRNRPKSEQKLLEWIRPY  314

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKF+QI+DPRLE  + LKSAHKL+ +ANRCLVR+PK RPKMSEVL+ +N++++AST
Sbjct  315  LSDAKKFKQIVDPRLEQKDTLKSAHKLANIANRCLVRNPKLRPKMSEVLEKINQIVDAST  374

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            G    + S  +S PI T      K KRR  D+K G+  W   +W+ K ++TC
Sbjct  375  GTESAQQSYKNSAPIKTSHGTTAKNKRRNVDIKTGESGWFGWMWNPKHVRTC  426



>ref|XP_011018721.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Populus euphratica]
Length=457

 Score =   343 bits (881),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 194/232 (84%), Gaps = 1/232 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE MDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EGLTH+ST
Sbjct  226  RIAQDAARGLKYLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSEGLTHVST  285

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSK+DVWSYGVFLYELITGR PLDRNRP+SEQKLLEW++P+
Sbjct  286  AVVGTMGYAAPEYVQTGRLTSKSDVWSYGVFLYELITGRRPLDRNRPKSEQKLLEWIRPY  345

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKF+QI+DPRLE  + LKSAHKL+ +ANRCLVR+PK RPKMSEVL+ +N++++AST
Sbjct  346  LSDAKKFKQIVDPRLEQKDTLKSAHKLANIANRCLVRNPKLRPKMSEVLEKINQIVDAST  405

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            G    + S  +S PI T      K KRR  D+K G+  W   +W+ K ++TC
Sbjct  406  GTESAQQSYKNSAPIKTSHGTTAKNKRRNVDIKTGESGWFGWMWNPKHVRTC  457



>ref|XP_010653601.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Vitis 
vinifera]
Length=426

 Score =   339 bits (869),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/232 (70%), Positives = 191/232 (82%), Gaps = 1/232 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQIIFRDFKSSNILLDE+WNAKLSDFGLARLGP EGLTH+ST
Sbjct  195  KIAQDAAQGLAYLHEEMDFQIIFRDFKSSNILLDEEWNAKLSDFGLARLGPSEGLTHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSK+DVWSYGVF+YELITGR P DRNRP+SEQKLL WVKP 
Sbjct  255  AVVGTMGYAAPEYVQTGRLTSKSDVWSYGVFIYELITGRRPFDRNRPKSEQKLLSWVKPF  314

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF  I+DPRLEGN  LKS  +L++VANRCLVR+PKSRPKMSEVL+M+N++++A  
Sbjct  315  LSDIKKFNLILDPRLEGNYHLKSVQRLAIVANRCLVRNPKSRPKMSEVLEMVNRIVDAPR  374

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
              G P+P +     I T    + K KR I D+++G+G WL   W+ + ++TC
Sbjct  375  ETGSPQPPVKRLLSIETSQITELKKKRNIKDLRIGEGGWLPWKWTSRVVRTC  426



>ref|XP_006354348.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X5 [Solanum tuberosum]
Length=412

 Score =   338 bits (866),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MD QIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EGLTH+ST
Sbjct  206  KIAQDAARGLAYLHEEMDVQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPPEGLTHVST  265

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK+DVWSYGVFLYELITGR PLDRNRPRSEQKLLEWVKP+
Sbjct  266  AVVGTMGYAAPEYIQTGRLTSKSDVWSYGVFLYELITGRRPLDRNRPRSEQKLLEWVKPY  325

Query  617  LSDSKKFRQIIDPRLEGNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEASTG  438
            +SDSKKF+QI+DPRL+G I +SA KLS+VANRCLVRH K+RPKMSEVL+M+NK++E STG
Sbjct  326  ISDSKKFQQILDPRLDGKISRSAQKLSIVANRCLVRHAKTRPKMSEVLEMVNKIVETSTG  385

Query  437  IGDPRPSIVHSDPIS  393
            IG+P P +  ++P S
Sbjct  386  IGNPGPPVRIAEPTS  400



>ref|XP_002519512.1| Protein kinase APK1A, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF42926.1| Protein kinase APK1A, chloroplast precursor, putative [Ricinus 
communis]
Length=422

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/232 (70%), Positives = 192/232 (83%), Gaps = 1/232 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE M FQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EGLTH+ST
Sbjct  191  RIAQDAARGLTYLHEEMGFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSEGLTHVST  250

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSK+DVWSYGVFLYELITGR PLDRNRPRSEQKLLEWVKP+
Sbjct  251  AVVGTMGYAAPEYVQTGRLTSKSDVWSYGVFLYELITGRRPLDRNRPRSEQKLLEWVKPY  310

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            L+D+KKF QI+DPRLEG   L+SA KL+ +ANRCLVR+PK+RPKMSEVL+M+N++++AS+
Sbjct  311  LADAKKFPQILDPRLEGKYPLRSAQKLATIANRCLVRNPKARPKMSEVLEMVNRIVDASS  370

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
                P+ S   S  + T  +   K KRR  D+K  +  W  R+W+ K ++TC
Sbjct  371  EASSPQLSFKSSITMETSRDHKTKNKRRKVDLKGRESGWFSRMWAPKLIRTC  422



>gb|EYU34470.1| hypothetical protein MIMGU_mgv1a006457mg [Erythranthe guttata]
Length=443

 Score =   336 bits (862),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 173/232 (75%), Positives = 192/232 (83%), Gaps = 13/232 (6%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA DAA GLAY HE MDFQIIFRDFKSSNILLDE+WNAKLSDFGLARLGP EGLTH+ST
Sbjct  224  RIALDAARGLAYLHEEMDFQIIFRDFKSSNILLDEEWNAKLSDFGLARLGPPEGLTHVST  283

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK+DVWSYGVFLYELITGR PLDRNRPRSEQKLLEWVKP+
Sbjct  284  AVVGTMGYAAPEYIQTGRLTSKSDVWSYGVFLYELITGRRPLDRNRPRSEQKLLEWVKPY  343

Query  617  LSDSKKFRQIIDPRLEG-NILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+QI+DPRLEG  ILKSAHKLSLVANRCL R  K+RPKMSEV++M+N+V+EAS 
Sbjct  344  LSDGKKFQQILDPRLEGKQILKSAHKLSLVANRCLARLSKTRPKMSEVVEMVNQVVEASI  403

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            G      +I  + P ST  E D K KRRI      D  W +R WS K +KTC
Sbjct  404  G------NIPQAQPPSTNAEED-KSKRRIF-----DSGWSLRGWSSKVVKTC  443



>gb|EYU34469.1| hypothetical protein MIMGU_mgv1a006457mg [Erythranthe guttata]
Length=440

 Score =   336 bits (862),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 173/232 (75%), Positives = 192/232 (83%), Gaps = 13/232 (6%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA DAA GLAY HE MDFQIIFRDFKSSNILLDE+WNAKLSDFGLARLGP EGLTH+ST
Sbjct  221  RIALDAARGLAYLHEEMDFQIIFRDFKSSNILLDEEWNAKLSDFGLARLGPPEGLTHVST  280

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK+DVWSYGVFLYELITGR PLDRNRPRSEQKLLEWVKP+
Sbjct  281  AVVGTMGYAAPEYIQTGRLTSKSDVWSYGVFLYELITGRRPLDRNRPRSEQKLLEWVKPY  340

Query  617  LSDSKKFRQIIDPRLEG-NILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+QI+DPRLEG  ILKSAHKLSLVANRCL R  K+RPKMSEV++M+N+V+EAS 
Sbjct  341  LSDGKKFQQILDPRLEGKQILKSAHKLSLVANRCLARLSKTRPKMSEVVEMVNQVVEASI  400

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            G      +I  + P ST  E D K KRRI      D  W +R WS K +KTC
Sbjct  401  G------NIPQAQPPSTNAEED-KSKRRIF-----DSGWSLRGWSSKVVKTC  440



>ref|XP_007205192.1| hypothetical protein PRUPE_ppa005670mg [Prunus persica]
 gb|EMJ06391.1| hypothetical protein PRUPE_ppa005670mg [Prunus persica]
Length=448

 Score =   336 bits (862),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 168/263 (64%), Positives = 195/263 (74%), Gaps = 32/263 (12%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQIIFRDFKSSNILLDEQWNAKLSDFG+ARLGP EGLTH+ST
Sbjct  186  KIAQDAARGLAYLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGMARLGPSEGLTHVST  245

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLT+KNDVWSYGVFLYELITGR PLDRNRP+SEQKLLEWVKP+
Sbjct  246  AVVGTMGYAAPEYIQTGRLTAKNDVWSYGVFLYELITGRRPLDRNRPKSEQKLLEWVKPY  305

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKV-----  456
            LSD KKFR IIDPRLE    LKS  KL++VANRCLVR PK+RPKMSEVL+M+N++     
Sbjct  306  LSDLKKFRLIIDPRLEAKYPLKSVQKLAIVANRCLVRLPKNRPKMSEVLEMVNQIIEAPP  365

Query  455  --------------------------LEASTGIGDPRPSIVHSDPISTKDEVDRKGKRRI  354
                                      +EA TG   P+  + +  PI T  +V+   KRR 
Sbjct  366  SGQNKIRDVSSGQKKIREAPSSQRKNMEAPTGTASPQLPLKNLAPIQTSRDVETVNKRRN  425

Query  353  TDMKVGDGSWLVRIWSLKQLKTC  285
             D++ G+  WL R+W+ K L+TC
Sbjct  426  ADLRRGETGWLSRVWTPKLLRTC  448



>ref|XP_007027372.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY07874.1| Kinase superfamily protein [Theobroma cacao]
Length=424

 Score =   335 bits (859),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 192/232 (83%), Gaps = 3/232 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQIIFRD KSSNILLDEQWNAKLSDFGLARLGP EGLTH+ST
Sbjct  195  KIAQDAARGLAYLHEGMDFQIIFRDLKSSNILLDEQWNAKLSDFGLARLGPSEGLTHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK DVWSYGVFLYELITGR PLD+NRP++EQKLL+WVKP+
Sbjct  255  AVVGTMGYAAPEYIQTGRLTSKIDVWSYGVFLYELITGRRPLDKNRPKNEQKLLDWVKPY  314

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKF+ I+DPRL+G   LKSA +L+ VANRCLVR+PKSRPKMSEVL+M+N+V+EAS 
Sbjct  315  LSDAKKFQFILDPRLKGKCQLKSAQRLATVANRCLVRNPKSRPKMSEVLEMVNRVVEASA  374

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            G G P P +     + T  E  RK +RRI D + G+    V  W+ K ++ C
Sbjct  375  GSGSPEPLLKTLPSVETSGETGRKHRRRIIDFRSGEK--FVWPWTPKLVRAC  424



>ref|XP_010241858.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nelumbo 
nucifera]
Length=427

 Score =   334 bits (857),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 164/236 (69%), Positives = 193/236 (82%), Gaps = 6/236 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE MDFQIIFRDFKSSNILLDEQWNAKLSDFGLAR GP EGL+H+ST
Sbjct  193  RIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARQGPSEGLSHVST  252

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT+K+DVWS+GVFLYELITGR P+DRNRP+SEQKLLEWV+PH
Sbjct  253  AVVGTIGYAAPEYIQTGRLTAKSDVWSFGVFLYELITGRKPVDRNRPKSEQKLLEWVRPH  312

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKFR I+DPRLEG   LKSA KL+ VANRCLVRHPK+RPKMSEVL+M+ KV+E ST
Sbjct  313  LSDMKKFRHILDPRLEGKYSLKSAQKLAAVANRCLVRHPKTRPKMSEVLEMVKKVVE-ST  371

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG---KRRITDMKVGDGSWLV-RIWSLKQLKTC  285
             +G P P++    P  T  E   KG   KR++ D +VG+  W   R+W  K ++TC
Sbjct  372  EMGSPEPAMKSLAPTDTSAEPKIKGSNLKRQVVDSRVGESGWSAWRMWRPKLIRTC  427



>ref|XP_007162763.1| hypothetical protein PHAVU_001G178400g [Phaseolus vulgaris]
 ref|XP_007162764.1| hypothetical protein PHAVU_001G178400g [Phaseolus vulgaris]
 gb|ESW34757.1| hypothetical protein PHAVU_001G178400g [Phaseolus vulgaris]
 gb|ESW34758.1| hypothetical protein PHAVU_001G178400g [Phaseolus vulgaris]
Length=425

 Score =   333 bits (853),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 189/232 (81%), Gaps = 1/232 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIARDAA GL Y HE MDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GLTH+ST
Sbjct  194  KIARDAARGLTYLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLTHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYASPEY+QTGRLTSKNDVWSYGVFLYELITGR PLDRNRPR EQKLLEW++P+
Sbjct  254  AVVGTMGYASPEYIQTGRLTSKNDVWSYGVFLYELITGRRPLDRNRPRGEQKLLEWIRPY  313

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ I+DPRL+   I KSAH+LS++ANRCLV++PK+RPKMSEVL+M+N ++E S+
Sbjct  314  LSDGKKFQLILDPRLDKKQIFKSAHRLSMIANRCLVKNPKNRPKMSEVLEMVNGMVEYSS  373

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
                P   +     + T  E +   K+R  D K G+ +W VR+W  K L+TC
Sbjct  374  SRSSPPLPLRSVARVETSQETETNNKKRTMDQKPGESNWFVRMWRPKLLRTC  425



>emb|CBI32759.3| unnamed protein product [Vitis vinifera]
Length=460

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 186/225 (83%), Gaps = 1/225 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQIIFRDFKSSNILLDE+WNAKLSDFGLARLGP EGLTH+ST
Sbjct  195  KIAQDAAQGLAYLHEEMDFQIIFRDFKSSNILLDEEWNAKLSDFGLARLGPSEGLTHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSK+DVWSYGVF+YELITGR P DRNRP+SEQKLL WVKP 
Sbjct  255  AVVGTMGYAAPEYVQTGRLTSKSDVWSYGVFIYELITGRRPFDRNRPKSEQKLLSWVKPF  314

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF  I+DPRLEGN  LKS  +L++VANRCLVR+PKSRPKMSEVL+M+N++++A  
Sbjct  315  LSDIKKFNLILDPRLEGNYHLKSVQRLAIVANRCLVRNPKSRPKMSEVLEMVNRIVDAPR  374

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWS  306
              G P+P +     I T    + K KR I D+++G+G WL   W+
Sbjct  375  ETGSPQPPVKRLLSIETSQITELKKKRNIKDLRIGEGGWLPWKWT  419



>ref|XP_008243964.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Prunus mume]
 ref|XP_008243965.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Prunus mume]
 ref|XP_008243967.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Prunus mume]
 ref|XP_008243968.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Prunus mume]
Length=458

 Score =   333 bits (853),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/273 (62%), Positives = 195/273 (71%), Gaps = 42/273 (15%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQIIFRDFKSSNILLDEQWNAKLSDFG+ARLGP EGLTH+ST
Sbjct  186  KIAQDAARGLAYLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGMARLGPSEGLTHVST  245

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLT+KNDVWSYGVFLYELITGR PLDRNRP+SEQKLLEWVKP+
Sbjct  246  AVVGTMGYAAPEYIQTGRLTAKNDVWSYGVFLYELITGRRPLDRNRPKSEQKLLEWVKPY  305

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKV-----  456
            LSD KKFR IIDPRLE    LKS  KL++VANRCLVR PK+RPKMSEVL+M+N++     
Sbjct  306  LSDLKKFRLIIDPRLEAKYPLKSVQKLAIVANRCLVRLPKNRPKMSEVLEMVNQIIEAPP  365

Query  455  ------------------------------------LEASTGIGDPRPSIVHSDPISTKD  384
                                                +EA TG   P+  + +  PI T  
Sbjct  366  SGQNKIRDISSGQKKIREVPSSQKKIREAPSSQRKNMEAPTGTASPQLPLRNLAPIQTSR  425

Query  383  EVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            +V+   KRR  D++ G+  WL R+W+ K L+TC
Sbjct  426  DVETVNKRRNADLRRGETGWLSRVWTPKLLRTC  458



>ref|XP_012082392.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Jatropha 
curcas]
 gb|KDP29140.1| hypothetical protein JCGZ_16529 [Jatropha curcas]
Length=427

 Score =   330 bits (847),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 191/233 (82%), Gaps = 2/233 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE M FQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EG TH+ST
Sbjct  195  RIAQDAARGLTYLHEEMGFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPAEGSTHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLT K+DVWSYGVFLYELITGR PLDRN+PR+EQKLLEWV+P+
Sbjct  255  AVVGTMGYAAPEYVQTGRLTFKSDVWSYGVFLYELITGRRPLDRNKPRNEQKLLEWVRPY  314

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF QI+DPRL+G   +KSA KL+ +ANRCLVR+PKSRPKMSEVL+M+N++ +AS+
Sbjct  315  LSDGKKFSQILDPRLQGKYPIKSAQKLATIANRCLVRNPKSRPKMSEVLEMVNRLADASS  374

Query  440  GIGDPRPSIVHSDPISTKDEVDR-KGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
              G P+     S   +   +V++ K KRR  D++ G+  W  R+W+ K ++TC
Sbjct  375  ETGSPQVLSFRSTMSTENSQVNKTKNKRRSIDLRGGESGWFTRMWTPKLIRTC  427



>ref|XP_010107509.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXC16191.1| putative receptor-like protein kinase [Morus notabilis]
Length=426

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/232 (69%), Positives = 187/232 (81%), Gaps = 1/232 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+ AA GLA+ HE MD QIIFRDFK+SNILLDE+WNAKLSDFG+ARLGP EGLTH+ST
Sbjct  195  KIAQHAARGLAHLHEEMDIQIIFRDFKASNILLDEEWNAKLSDFGMARLGPAEGLTHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLT K+DVWSYGVFLYELITGR PLDRNRP+ EQKLLEWVKPH
Sbjct  255  AVVGTMGYAAPEYVQTGRLTYKSDVWSYGVFLYELITGRRPLDRNRPKGEQKLLEWVKPH  314

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKFR I+DPRLEG   LKS  KL+LVANRCL+R  K+RPKMSEVL+M+NK+ E +T
Sbjct  315  LSDVKKFRLIVDPRLEGKYSLKSVQKLALVANRCLIRFTKNRPKMSEVLEMVNKIAEDTT  374

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
              G P   + +   + +  + + K KRRI D K G+ +W  R+W  K L+TC
Sbjct  375  ETGSPPLPLKNLASMDSSRDSEAKNKRRIMDTKSGENAWSFRMWRPKLLRTC  426



>gb|KHG19471.1| hypothetical protein F383_26407 [Gossypium arboreum]
Length=409

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 182/216 (84%), Gaps = 1/216 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQIIFRDFKSSNILLD+QW AKLSDFGLARLGP EGLTH+ST
Sbjct  185  KIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLDDQWRAKLSDFGLARLGPSEGLTHVST  244

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK DVWSYGVFLYELITGR PLD+NRP+ EQKLLEWVKP+
Sbjct  245  AVVGTMGYAAPEYIQTGRLTSKIDVWSYGVFLYELITGRLPLDKNRPKCEQKLLEWVKPY  304

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LS +KKF  I+DPRL+    LKSA KL++VANRC+VR+PKSRPKMSEVL+M+N+++EAST
Sbjct  305  LSKAKKFELIVDPRLKRQYQLKSAQKLAVVANRCVVRNPKSRPKMSEVLEMVNQIVEAST  364

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGD  333
            G G+P P +     + T    +RK  RRI D +  D
Sbjct  365  GAGNPEPPLKTKPFVDTSRGTERKHNRRIIDSRSSD  400



>ref|XP_010253943.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nelumbo 
nucifera]
Length=426

 Score =   327 bits (837),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 164/236 (69%), Positives = 195/236 (83%), Gaps = 7/236 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GLAY HE MDFQIIFRDFKSSNILLDEQWNAKLSDFGLAR GP EGLTHIST
Sbjct  193  RIAQDAARGLAYLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARQGPSEGLTHIST  252

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT+K+DVWSYGVFLYELITGR PLDRNRP+SEQKLLEWV+PH
Sbjct  253  AVVGTIGYAAPEYIQTGRLTAKSDVWSYGVFLYELITGRKPLDRNRPKSEQKLLEWVRPH  312

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ I+DPRLEGN  LKSA +L+ VANRCLVR PK+RPKMSEVL+++ K++E ST
Sbjct  313  LSDMKKFKLILDPRLEGNYSLKSAQRLAAVANRCLVRQPKARPKMSEVLEIVKKLVE-ST  371

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG---KRRITDMKVGDGSWLV-RIWSLKQLKTC  285
             +G P  S+    P  T +E   +G   KRR+ D +VG+  W   ++W+ K ++TC
Sbjct  372  EMG-PESSMKMLAPGDTSEEQKMEGSNLKRRVVDSRVGERGWSAWQMWTPKLIRTC  426



>gb|KJB62395.1| hypothetical protein B456_009G415600 [Gossypium raimondii]
Length=455

 Score =   327 bits (838),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 182/216 (84%), Gaps = 1/216 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQIIFRDFKSSNILLD+QW AKLSDFGLARLGP EGLTH+ST
Sbjct  231  KIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLDDQWRAKLSDFGLARLGPSEGLTHVST  290

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK DVWSYGVFLYELITGR PLD+NRP+SEQKLLEWVKP+
Sbjct  291  AVVGTMGYAAPEYIQTGRLTSKIDVWSYGVFLYELITGRLPLDKNRPKSEQKLLEWVKPY  350

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LS +KKF  I+DPRL+    LKSA KL+ VANRC+VR+PKSRPKMSEVL+M+N+++EA T
Sbjct  351  LSKAKKFELIVDPRLKRQYQLKSAQKLAAVANRCVVRNPKSRPKMSEVLEMVNQIVEAPT  410

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGD  333
            G G+P P +     + T    +RK  RRI D + GD
Sbjct  411  GAGNPEPPLKTKPFVDTSRGTERKHNRRIIDSRSGD  446



>gb|KJB62396.1| hypothetical protein B456_009G415600 [Gossypium raimondii]
Length=450

 Score =   327 bits (838),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 182/216 (84%), Gaps = 1/216 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQIIFRDFKSSNILLD+QW AKLSDFGLARLGP EGLTH+ST
Sbjct  226  KIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLDDQWRAKLSDFGLARLGPSEGLTHVST  285

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK DVWSYGVFLYELITGR PLD+NRP+SEQKLLEWVKP+
Sbjct  286  AVVGTMGYAAPEYIQTGRLTSKIDVWSYGVFLYELITGRLPLDKNRPKSEQKLLEWVKPY  345

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LS +KKF  I+DPRL+    LKSA KL+ VANRC+VR+PKSRPKMSEVL+M+N+++EA T
Sbjct  346  LSKAKKFELIVDPRLKRQYQLKSAQKLAAVANRCVVRNPKSRPKMSEVLEMVNQIVEAPT  405

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGD  333
            G G+P P +     + T    +RK  RRI D + GD
Sbjct  406  GAGNPEPPLKTKPFVDTSRGTERKHNRRIIDSRSGD  441



>gb|KJB62397.1| hypothetical protein B456_009G415600, partial [Gossypium raimondii]
Length=458

 Score =   327 bits (837),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 182/216 (84%), Gaps = 1/216 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQIIFRDFKSSNILLD+QW AKLSDFGLARLGP EGLTH+ST
Sbjct  234  KIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLDDQWRAKLSDFGLARLGPSEGLTHVST  293

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK DVWSYGVFLYELITGR PLD+NRP+SEQKLLEWVKP+
Sbjct  294  AVVGTMGYAAPEYIQTGRLTSKIDVWSYGVFLYELITGRLPLDKNRPKSEQKLLEWVKPY  353

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LS +KKF  I+DPRL+    LKSA KL+ VANRC+VR+PKSRPKMSEVL+M+N+++EA T
Sbjct  354  LSKAKKFELIVDPRLKRQYQLKSAQKLAAVANRCVVRNPKSRPKMSEVLEMVNQIVEAPT  413

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGD  333
            G G+P P +     + T    +RK  RRI D + GD
Sbjct  414  GAGNPEPPLKTKPFVDTSRGTERKHNRRIIDSRSGD  449



>ref|XP_003554386.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X1 [Glycine max]
 gb|KHN02327.1| Putative receptor-like protein kinase [Glycine soja]
Length=428

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/232 (67%), Positives = 186/232 (80%), Gaps = 2/232 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIARDAA GL Y HE MDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GLTH+ST
Sbjct  198  KIARDAASGLTYLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLTHVST  257

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSKNDVWSYGVFLYELITGR PLDRNRPR EQKLLEW++P+
Sbjct  258  AVVGTMGYAAPEYVQTGRLTSKNDVWSYGVFLYELITGRRPLDRNRPRGEQKLLEWIRPY  317

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ I+DPRL+   + KSA +L+ +ANRCLV++PK+RPKMSEVL+M+N ++E S 
Sbjct  318  LSDGKKFQLILDPRLDKKQVFKSAQRLATIANRCLVKNPKNRPKMSEVLEMVNGMVE-SI  376

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
                P+  +     +    + +   K+R  D K G+ +W VR+W  K ++TC
Sbjct  377  SSSSPQLPLRSVATLEASQDTETNNKKRTMDHKPGESNWFVRMWRPKLVRTC  428



>ref|XP_006604577.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X2 [Glycine max]
Length=440

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/232 (67%), Positives = 186/232 (80%), Gaps = 2/232 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIARDAA GL Y HE MDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GLTH+ST
Sbjct  210  KIARDAASGLTYLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLTHVST  269

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSKNDVWSYGVFLYELITGR PLDRNRPR EQKLLEW++P+
Sbjct  270  AVVGTMGYAAPEYVQTGRLTSKNDVWSYGVFLYELITGRRPLDRNRPRGEQKLLEWIRPY  329

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ I+DPRL+   + KSA +L+ +ANRCLV++PK+RPKMSEVL+M+N ++E S 
Sbjct  330  LSDGKKFQLILDPRLDKKQVFKSAQRLATIANRCLVKNPKNRPKMSEVLEMVNGMVE-SI  388

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
                P+  +     +    + +   K+R  D K G+ +W VR+W  K ++TC
Sbjct  389  SSSSPQLPLRSVATLEASQDTETNNKKRTMDHKPGESNWFVRMWRPKLVRTC  440



>ref|XP_010035962.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Eucalyptus 
grandis]
 gb|KCW47479.1| hypothetical protein EUGRSUZ_K01253 [Eucalyptus grandis]
Length=422

 Score =   323 bits (829),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 158/232 (68%), Positives = 188/232 (81%), Gaps = 5/232 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+D A GL Y HE MDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTH+ST
Sbjct  195  RIAQDTARGLTYLHEQMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSKNDVWSYGVFLYELITGR PLDRN P+SEQKLLEWVKP+
Sbjct  255  AVVGTMGYAAPEYLQTGRLTSKNDVWSYGVFLYELITGRRPLDRNLPKSEQKLLEWVKPY  314

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSDSKKF+ I+DPRL G   +KS HKL+ +AN+CL ++PK+RPKMSEVL ++++++  ST
Sbjct  315  LSDSKKFKLIVDPRLVGTYHIKSVHKLATIANKCLHKNPKTRPKMSEVLGLVDEIVREST  374

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            G+ D   S V    + T+++     KRRI D K  +  WL RIW+ K  + C
Sbjct  375  GM-DSLNSFV---SVETQEDTGTNNKRRIFDFKAWESWWLGRIWTWKFARAC  422



>gb|KJB36567.1| hypothetical protein B456_006G165500 [Gossypium raimondii]
Length=304

 Score =   319 bits (818),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 164/233 (70%), Positives = 195/233 (84%), Gaps = 10/233 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EGLTHIST
Sbjct  80   KIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSEGLTHIST  139

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK DVWSYGVFLYELITGR PLD+NRP++EQ+LLEWVKP+
Sbjct  140  AVVGTMGYAAPEYIQTGRLTSKIDVWSYGVFLYELITGRRPLDKNRPKNEQRLLEWVKPY  199

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD +KF+ I+DPRL+G   LKSA +L++VANRCLVR+PKSRPKMSEVL+M+N+++EAS+
Sbjct  200  LSD-RKFQLILDPRLKGKYQLKSAQRLAVVANRCLVRNPKSRPKMSEVLEMVNRIVEASS  258

Query  440  -GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
             G   P P +   + +S   E  R+ KRRI D + G+    V  W+ K ++TC
Sbjct  259  AGPRTPEPPL---NDVSL--ETARERKRRIIDFRSGEK--FVWSWTPKLIRTC  304



>gb|KDO48065.1| hypothetical protein CISIN_1g014245mg [Citrus sinensis]
Length=428

 Score =   323 bits (829),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 158/232 (68%), Positives = 185/232 (80%), Gaps = 1/232 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQII RDFKSSNILLDEQWNAKLSDFGLARLGP EG TH+ST
Sbjct  197  KIAQDAARGLAYLHEGMDFQIIVRDFKSSNILLDEQWNAKLSDFGLARLGPSEGFTHVST  256

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRL +++DVWSYGVFLYELITGR P+DRNRPRSEQKLL+WVKP+
Sbjct  257  AVVGTMGYAAPEYVQTGRLAARSDVWSYGVFLYELITGRRPIDRNRPRSEQKLLQWVKPY  316

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+K+FRQI+DPRLEG   L+   KLS VAN CLV++ ++RPKMSEVL+M+NK+++AS 
Sbjct  317  LSDAKQFRQIVDPRLEGKYSLRLVSKLSHVANLCLVKNARTRPKMSEVLEMVNKIVDASA  376

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
              G PR  +  S    T D    K KRRI + K  +   L   W  K ++TC
Sbjct  377  EAGSPRRPLRSSTSRETPDHTKTKHKRRIIESKTRESGTLFWKWRQKLIRTC  428



>gb|KDO48066.1| hypothetical protein CISIN_1g014245mg [Citrus sinensis]
Length=426

 Score =   323 bits (828),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 158/232 (68%), Positives = 185/232 (80%), Gaps = 1/232 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQII RDFKSSNILLDEQWNAKLSDFGLARLGP EG TH+ST
Sbjct  195  KIAQDAARGLAYLHEGMDFQIIVRDFKSSNILLDEQWNAKLSDFGLARLGPSEGFTHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRL +++DVWSYGVFLYELITGR P+DRNRPRSEQKLL+WVKP+
Sbjct  255  AVVGTMGYAAPEYVQTGRLAARSDVWSYGVFLYELITGRRPIDRNRPRSEQKLLQWVKPY  314

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+K+FRQI+DPRLEG   L+   KLS VAN CLV++ ++RPKMSEVL+M+NK+++AS 
Sbjct  315  LSDAKQFRQIVDPRLEGKYSLRLVSKLSHVANLCLVKNARTRPKMSEVLEMVNKIVDASA  374

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
              G PR  +  S    T D    K KRRI + K  +   L   W  K ++TC
Sbjct  375  EAGSPRRPLRSSTSRETPDHTKTKHKRRIIESKTRESGTLFWKWRQKLIRTC  426



>gb|KHN09513.1| Putative receptor-like protein kinase [Glycine soja]
Length=398

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 190/234 (81%), Gaps = 6/234 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIARDAA GL Y HE MDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GLTH+ST
Sbjct  168  KIARDAARGLTYLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLTHVST  227

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSKNDVWSYGVFLYELITGR PLDRNRPR EQKLLEW++P+
Sbjct  228  AVVGTMGYAAPEYVQTGRLTSKNDVWSYGVFLYELITGRRPLDRNRPRREQKLLEWIRPY  287

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ I+DPRL+   + KSA +L+++AN+CL ++PK+RPKMSEVL+M+N ++E+S+
Sbjct  288  LSDGKKFQLILDPRLDKKQVFKSAQRLAMIANQCLAKNPKNRPKMSEVLEMVNGMVESSS  347

Query  440  GIGDPRP--SIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
                  P  S+V    +    + +   K+R  D K+G+ +W VR+W  K ++TC
Sbjct  348  SSSPQLPLRSVV---TLEASQDTETNNKKRTMDQKLGESNWFVRMWRPKLVRTC  398



>ref|XP_009350770.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Pyrus 
x bretschneideri]
 ref|XP_009350771.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Pyrus 
x bretschneideri]
Length=447

 Score =   323 bits (827),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/261 (63%), Positives = 197/261 (75%), Gaps = 31/261 (12%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GLAY HE MDFQIIFRDFKSSNILLD+QWNAKLSDFG+ARLGP EGLTH+ST
Sbjct  186  RIAQDAARGLAYLHEEMDFQIIFRDFKSSNILLDDQWNAKLSDFGMARLGPSEGLTHVST  245

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSKNDVWSYGVFLYELITGR PLDRNRP+SEQKLLEWVKP+
Sbjct  246  AVVGTMGYAAPEYIQTGRLTSKNDVWSYGVFLYELITGRRPLDRNRPKSEQKLLEWVKPY  305

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKFR IIDP+LEG   LKSA +L++VAN+CLVR PK+RPKMS+VL+M+N+++EA +
Sbjct  306  LSDVKKFRLIIDPKLEGKYPLKSAQRLAIVANKCLVRLPKNRPKMSKVLEMVNQIIEAPS  365

Query  440  GIGDPR--PSI--------------------VHSD--------PISTKDEVDRKGKRRIT  351
                PR  PSI                      S+        PI T  +V+   KR+  
Sbjct  366  AQKKPREVPSIEKKIREVPSSQNKFMKTPIGTESEQLPPKNLAPIETCRDVETMNKRKNV  425

Query  350  DMKVGDGSWLVRIWSLKQLKT  288
            D++  +  WL R+W+ K L+T
Sbjct  426  DLRRRETGWLSRLWTPKFLRT  446



>ref|XP_003521400.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X1 [Glycine max]
 ref|XP_006577026.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X2 [Glycine max]
Length=428

 Score =   322 bits (824),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 190/234 (81%), Gaps = 6/234 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIARDAA GL Y HE MDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GLTH+ST
Sbjct  198  KIARDAARGLTYLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLTHVST  257

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSKNDVWSYGVFLYELITGR PLDRNRPR EQKLLEW++P+
Sbjct  258  AVVGTMGYAAPEYVQTGRLTSKNDVWSYGVFLYELITGRRPLDRNRPRREQKLLEWIRPY  317

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ I+DPRL+   + KSA +L+++AN+CL ++PK+RPKMSEVL+M+N ++E+S+
Sbjct  318  LSDGKKFQLILDPRLDKKQVFKSAQRLAMIANQCLAKNPKNRPKMSEVLEMVNGMVESSS  377

Query  440  GIGDPRP--SIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
                  P  S+V    +    + +   K+R  D K+G+ +W VR+W  K ++TC
Sbjct  378  SSSPQLPLRSVV---TLEASQDTETNNKKRTMDQKLGESNWFVRMWRPKLVRTC  428



>gb|KJB36568.1| hypothetical protein B456_006G165500 [Gossypium raimondii]
 gb|KJB36569.1| hypothetical protein B456_006G165500 [Gossypium raimondii]
Length=419

 Score =   320 bits (820),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 164/233 (70%), Positives = 195/233 (84%), Gaps = 10/233 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EGLTHIST
Sbjct  195  KIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSEGLTHIST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK DVWSYGVFLYELITGR PLD+NRP++EQ+LLEWVKP+
Sbjct  255  AVVGTMGYAAPEYIQTGRLTSKIDVWSYGVFLYELITGRRPLDKNRPKNEQRLLEWVKPY  314

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD +KF+ I+DPRL+G   LKSA +L++VANRCLVR+PKSRPKMSEVL+M+N+++EAS+
Sbjct  315  LSD-RKFQLILDPRLKGKYQLKSAQRLAVVANRCLVRNPKSRPKMSEVLEMVNRIVEASS  373

Query  440  -GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
             G   P P +   + +S   E  R+ KRRI D + G+    V  W+ K ++TC
Sbjct  374  AGPRTPEPPL---NDVSL--ETARERKRRIIDFRSGEK--FVWSWTPKLIRTC  419



>gb|KHG23255.1| hypothetical protein F383_07036 [Gossypium arboreum]
Length=381

 Score =   318 bits (814),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/233 (69%), Positives = 194/233 (83%), Gaps = 10/233 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGM+FQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EGLTHIST
Sbjct  157  KIAQDAARGLAYLHEGMEFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSEGLTHIST  216

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK DVWSYGVFLYELITGR P D+NRP++EQ+LLEWVKP+
Sbjct  217  AVVGTMGYAAPEYIQTGRLTSKIDVWSYGVFLYELITGRRPFDKNRPKNEQRLLEWVKPY  276

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD +KF+ I+DPRL+G   LKSA +L +VANRCLVR+PKSRPKMSEVL+M+N+++EAS+
Sbjct  277  LSD-RKFQLILDPRLKGKYQLKSAQRLVVVANRCLVRNPKSRPKMSEVLEMVNRIVEASS  335

Query  440  -GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
             G   P P +   + +S   E  R+ KRRI D++ G+    +  W+ K ++TC
Sbjct  336  AGPRTPEPPL---NDVSL--ETARESKRRIVDLRSGEK--FIWSWTPKLIRTC  381



>ref|XP_012092533.1| PREDICTED: receptor-like serine/threonine-protein kinase At3g01300 
[Jatropha curcas]
 gb|KDP20484.1| hypothetical protein JCGZ_05337 [Jatropha curcas]
Length=309

 Score =   314 bits (805),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 160/235 (68%), Positives = 190/235 (81%), Gaps = 5/235 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQIIFRDFKSSNILLD++WNAKLSDFGLARLGP +GL+HIST
Sbjct  76   KIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLDDKWNAKLSDFGLARLGPSDGLSHIST  135

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLTSK+DVW YGVFLYELITGR PLDRNRP+ EQKLLEWV+PH
Sbjct  136  AVVGTIGYAAPEYIQTGRLTSKSDVWGYGVFLYELITGRRPLDRNRPKDEQKLLEWVRPH  195

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKFR I+DPRL+G   LKSA KL+ VANRCLVR  KSRPKMSEVL+M+NK+++A T
Sbjct  196  LSDVKKFRLILDPRLDGKYHLKSAQKLAAVANRCLVRQAKSRPKMSEVLEMVNKIVDA-T  254

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG--KRRITDMKVGDGSWLV-RIWSLKQLKTC  285
             +G P   +    P    +E+ R+   KR++ +  +G+   L  R W LK +K C
Sbjct  255  DMGSPLLPMKSLAPKDGYEEITRRERLKRKLLNPIIGEKGCLAWRRWRLKAVKAC  309



>ref|XP_004304448.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Fragaria 
vesca subsp. vesca]
 ref|XP_011468117.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Fragaria 
vesca subsp. vesca]
 ref|XP_011468118.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Fragaria 
vesca subsp. vesca]
 ref|XP_011468119.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Fragaria 
vesca subsp. vesca]
Length=466

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/273 (60%), Positives = 194/273 (71%), Gaps = 43/273 (16%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GL Y HE MDFQIIFRDFKSSNILLD++WNAKLSDFG+ARLGP EG++H+ST
Sbjct  195  KIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDKEWNAKLSDFGMARLGPAEGVSHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSKNDVWSYGVFLYELITGR PLDRNRP+SEQKLLEWVKP+
Sbjct  255  AVVGTMGYAAPEYIQTGRLTSKNDVWSYGVFLYELITGRRPLDRNRPKSEQKLLEWVKPY  314

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKFR IIDPRLEG   LKS  KL++VANRCLVR PK+RPKMSEVL+M+N+++EA +
Sbjct  315  LSDLKKFRLIIDPRLEGKYPLKSVQKLAIVANRCLVRLPKNRPKMSEVLEMVNQIIEAPS  374

Query  440  G-----------------------------------------IGDPRPSIVHSDPISTKD  384
            G                                         +  P P  V++ PI T  
Sbjct  375  GQKKNTEAPSGQNRFKEAPPSQNKIKEAPSGHNKVTATPTGKVSLPLPP-VNTAPIETSR  433

Query  383  EVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            E +   K+R  + + G+   L R+W+ K L+TC
Sbjct  434  EYETVSKKRNVETRRGETGLLSRVWTPKLLRTC  466



>ref|XP_010658387.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Vitis 
vinifera]
 ref|XP_010658388.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Vitis 
vinifera]
Length=429

 Score =   316 bits (809),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 190/234 (81%), Gaps = 4/234 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GLAY HEGM+FQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GL+H+ST
Sbjct  197  RIAQDAARGLAYLHEGMEFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLSHVST  256

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT+K+DVWSYGVFLYELITGR PLDRNRP++EQKLLEW++PH
Sbjct  257  AVVGTIGYAAPEYIQTGRLTAKSDVWSYGVFLYELITGRRPLDRNRPKNEQKLLEWIRPH  316

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ I+DPRLEG   LKSA KL+ VAN+CLVR  K+RPKMSE+LDM+N+++EA+ 
Sbjct  317  LSDVKKFQLILDPRLEGKYTLKSAQKLAAVANKCLVRQIKTRPKMSEILDMVNRIVEAAE  376

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG-KRRITDMKVGDGSWLV-RIWSLKQLKTC  285
              G P+P I  S P    +E  RK  K    D  +G+   LV + W  K ++T 
Sbjct  377  -TGSPQPPIKSSTPRDAPEESKRKRLKTMFVDPIIGENRRLVWQKWRPKLVRTS  429



>ref|XP_006428740.1| hypothetical protein CICLE_v10011770mg [Citrus clementina]
 ref|XP_006428741.1| hypothetical protein CICLE_v10011770mg [Citrus clementina]
 gb|ESR41980.1| hypothetical protein CICLE_v10011770mg [Citrus clementina]
 gb|ESR41981.1| hypothetical protein CICLE_v10011770mg [Citrus clementina]
Length=432

 Score =   315 bits (807),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 185/231 (80%), Gaps = 3/231 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQII RDFKSSNILLDEQWNAKLSDFGLARLGP EG TH+ST
Sbjct  197  KIAQDAARGLAYLHEGMDFQIIVRDFKSSNILLDEQWNAKLSDFGLARLGPSEGFTHVST  256

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRL +++DVWSYGVFLYELITGR P+DRNRP+SEQKLL+WVKP+
Sbjct  257  AVVGTMGYAAPEYVQTGRLAARSDVWSYGVFLYELITGRRPIDRNRPKSEQKLLQWVKPY  316

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+K+FRQI+DPRLEG   L+   KLS VAN CLV++ ++RPKMS+VL+M+NK+++AS 
Sbjct  317  LSDAKQFRQIVDPRLEGKYSLRLVSKLSHVANLCLVKNARTRPKMSDVLEMVNKIVDASA  376

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKT  288
              G PR  +  S    T D    K KRRI + K  +   L   W  +Q+++
Sbjct  377  EAGSPRRPLRSSTSRETPDHTKTKHKRRIIESKTRESGTL--FWKWRQMQS  425



>ref|XP_007009900.1| Receptor-like protein kinase [Theobroma cacao]
 gb|EOY18710.1| Receptor-like protein kinase [Theobroma cacao]
Length=430

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/235 (66%), Positives = 189/235 (80%), Gaps = 5/235 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQIIFRDFKSSNILLDE WNAKLSDFGLARLGP +GL+H+ST
Sbjct  197  KIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLDEHWNAKLSDFGLARLGPSDGLSHVST  256

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT+K+DVWSYGVFLYELITGR PLDR+RP+ EQKLLEWV+PH
Sbjct  257  AVVGTIGYAAPEYIQTGRLTAKSDVWSYGVFLYELITGRRPLDRSRPKREQKLLEWVRPH  316

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD KKF+ I+DPRLEG   LKSAHKL+ VAN+CL R  K RPKMSEVL+M+N+++EA+ 
Sbjct  317  ISDIKKFKLILDPRLEGKYSLKSAHKLAAVANKCLARQAKLRPKMSEVLEMVNRIVEAAD  376

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG--KRRITDMKVGDGSWLV-RIWSLKQLKTC  285
             +  P+  +  S P +  + +  +   KRR  D+  GD   L+ R W  K ++TC
Sbjct  377  MVS-PQLPMKSSTPKNVSEVLSSRKHLKRRFVDLITGDKGCLIWRTWRPKIVRTC  430



>gb|KEH24024.1| kinase 1B [Medicago truncatula]
Length=426

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/232 (66%), Positives = 188/232 (81%), Gaps = 3/232 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA DAA GL Y HE MDFQIIFRDFKSSNILLD+QWNAKLSDFGLARLGP +GLTH+ST
Sbjct  196  KIAHDAARGLTYLHEEMDFQIIFRDFKSSNILLDDQWNAKLSDFGLARLGPSDGLTHVST  255

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSKNDVWSYGVFLYELITGR PLDRNRP+ EQKLLEW+KP+
Sbjct  256  AVVGTMGYAAPEYLQTGRLTSKNDVWSYGVFLYELITGRRPLDRNRPKGEQKLLEWIKPY  315

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKF+ I+DPRL+   +++SA +L+ +ANRCLV++PK+RPKMSEVL+M+N ++E+S+
Sbjct  316  LSDTKKFQLILDPRLDKKQVIRSAQRLATIANRCLVKNPKNRPKMSEVLEMVNGIVESSS  375

Query  440  GIGDPRPSIVHSDPISTKDEVD-RKGKRRITDMKVGDGSWLVRIWSLKQLKT  288
                  P + +   I    E + R  K+R  D K  + +W VR+W  K ++T
Sbjct  376  DTNSQLP-LKNVSRIEVSHETEMRNTKKRTMDQKPRESNWFVRLWRPKLIRT  426



>ref|XP_006340033.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006340034.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006340035.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X3 [Solanum tuberosum]
 ref|XP_006340036.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X4 [Solanum tuberosum]
Length=425

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 177/200 (89%), Gaps = 1/200 (1%)
 Frame = -1

Query  974  IARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHISTA  795
            IARDAA GLAY HEGM+FQIIFRDFKSSNILLDE+WNAKLSDFGLARLGP +GL+H+STA
Sbjct  190  IARDAARGLAYLHEGMEFQIIFRDFKSSNILLDEKWNAKLSDFGLARLGPSDGLSHVSTA  249

Query  794  VVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPHL  615
            VVGT+GYA+PEY+QTGRLTSK+DVWSYGVFLYELITGR PLDRN+P++EQKLLEWV+PHL
Sbjct  250  VVGTVGYAAPEYIQTGRLTSKSDVWSYGVFLYELITGRRPLDRNKPKNEQKLLEWVRPHL  309

Query  614  SDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEASTG  438
            SD KKF QI+DPRL+GN  +KSA KL+ +ANRCLV+HP++RPKMSEVL+M+N+V+EA+ G
Sbjct  310  SDLKKFEQILDPRLDGNYSIKSAQKLAAIANRCLVKHPRNRPKMSEVLEMVNQVVEATEG  369

Query  437  IGDPRPSIVHSDPISTKDEV  378
               PR  +  S   +  D++
Sbjct  370  AKCPRTPVDESSTPNVDDDM  389



>ref|XP_003625670.1| Protein kinase [Medicago truncatula]
 gb|AES81888.1| kinase 1B [Medicago truncatula]
Length=434

 Score =   314 bits (804),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/232 (66%), Positives = 188/232 (81%), Gaps = 3/232 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA DAA GL Y HE MDFQIIFRDFKSSNILLD+QWNAKLSDFGLARLGP +GLTH+ST
Sbjct  204  KIAHDAARGLTYLHEEMDFQIIFRDFKSSNILLDDQWNAKLSDFGLARLGPSDGLTHVST  263

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSKNDVWSYGVFLYELITGR PLDRNRP+ EQKLLEW+KP+
Sbjct  264  AVVGTMGYAAPEYLQTGRLTSKNDVWSYGVFLYELITGRRPLDRNRPKGEQKLLEWIKPY  323

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKF+ I+DPRL+   +++SA +L+ +ANRCLV++PK+RPKMSEVL+M+N ++E+S+
Sbjct  324  LSDTKKFQLILDPRLDKKQVIRSAQRLATIANRCLVKNPKNRPKMSEVLEMVNGIVESSS  383

Query  440  GIGDPRPSIVHSDPISTKDEVD-RKGKRRITDMKVGDGSWLVRIWSLKQLKT  288
                  P + +   I    E + R  K+R  D K  + +W VR+W  K ++T
Sbjct  384  DTNSQLP-LKNVSRIEVSHETEMRNTKKRTMDQKPRESNWFVRLWRPKLIRT  434



>ref|XP_006481482.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
[Citrus sinensis]
Length=432

 Score =   313 bits (803),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/227 (68%), Positives = 181/227 (80%), Gaps = 1/227 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQII RDFKSSNILLDEQWNAKLSDFGLARLGP EG TH+ST
Sbjct  197  KIAQDAARGLAYLHEGMDFQIIVRDFKSSNILLDEQWNAKLSDFGLARLGPSEGFTHVST  256

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRL +++DVWSYGVFLYELITGR P+DRNRP+SEQKLL+WVKP+
Sbjct  257  AVVGTMGYAAPEYVQTGRLAARSDVWSYGVFLYELITGRRPIDRNRPKSEQKLLQWVKPY  316

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+K+FRQI+DPRLEG   L+   KLS VAN CLV++ ++RPKMS+VL+M+NK+++AS 
Sbjct  317  LSDAKQFRQIVDPRLEGKYSLRLVSKLSHVANLCLVKNARTRPKMSDVLEMVNKIVDASA  376

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLK  300
              G PR  +  S    T D    K KRRI + K  +   L   W  K
Sbjct  377  EAGSPRRPLRSSTSRETPDHTKTKHKRRIIESKTRESGTLFWKWRQK  423



>gb|KEH24025.1| kinase 1B [Medicago truncatula]
Length=446

 Score =   314 bits (804),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 152/232 (66%), Positives = 188/232 (81%), Gaps = 3/232 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA DAA GL Y HE MDFQIIFRDFKSSNILLD+QWNAKLSDFGLARLGP +GLTH+ST
Sbjct  216  KIAHDAARGLTYLHEEMDFQIIFRDFKSSNILLDDQWNAKLSDFGLARLGPSDGLTHVST  275

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSKNDVWSYGVFLYELITGR PLDRNRP+ EQKLLEW+KP+
Sbjct  276  AVVGTMGYAAPEYLQTGRLTSKNDVWSYGVFLYELITGRRPLDRNRPKGEQKLLEWIKPY  335

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKF+ I+DPRL+   +++SA +L+ +ANRCLV++PK+RPKMSEVL+M+N ++E+S+
Sbjct  336  LSDTKKFQLILDPRLDKKQVIRSAQRLATIANRCLVKNPKNRPKMSEVLEMVNGIVESSS  395

Query  440  GIGDPRPSIVHSDPISTKDEVD-RKGKRRITDMKVGDGSWLVRIWSLKQLKT  288
                  P + +   I    E + R  K+R  D K  + +W VR+W  K ++T
Sbjct  396  DTNSQLP-LKNVSRIEVSHETEMRNTKKRTMDQKPRESNWFVRLWRPKLIRT  446



>gb|AFK42308.1| unknown [Lotus japonicus]
Length=253

 Score =   306 bits (783),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 186/231 (81%), Gaps = 4/231 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GL Y HE MDFQIIFRDFKSSNILLDE WNAKLSDFGLARLGP EGLTH+S 
Sbjct  25   KIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDEHWNAKLSDFGLARLGPAEGLTHVSI  84

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK+DVWSYGVFLYELITGR PLDRNRP+ EQKLL+W++P+
Sbjct  85   AVVGTMGYAAPEYIQTGRLTSKSDVWSYGVFLYELITGRRPLDRNRPKGEQKLLDWIRPY  144

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ I+DPRLE  +I KSA +L+++ANRCLVR+PK+RPKMSEVL+M+++V+++S 
Sbjct  145  LSDGKKFQIILDPRLERKHIFKSAQRLAVIANRCLVRNPKNRPKMSEVLEMMDQVVKSSV  204

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKT  288
               + +P +          + D K K+R  D K  D +W  RIW  K L+T
Sbjct  205  S-ANQQPPLRSVASAEASPDTDIKNKKRTIDSK-PDCNWF-RIWRPKLLRT  252



>ref|XP_003590458.1| Protein kinase 2A [Medicago truncatula]
 gb|AES60709.1| kinase 1B [Medicago truncatula]
 gb|AFK42573.1| unknown [Medicago truncatula]
Length=427

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/233 (68%), Positives = 191/233 (82%), Gaps = 6/233 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GL Y HE MDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GLTH+ST
Sbjct  199  KIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLTHVST  258

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK DVWSYGVFLYELITGR PLDRNRP+ EQ+LLEW++P+
Sbjct  259  AVVGTMGYAAPEYIQTGRLTSKIDVWSYGVFLYELITGRRPLDRNRPKGEQQLLEWIRPY  318

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ I+DPRLE  ++LKSA KL++VANRCLVR+PK+RPKMSEVL+M+++++E+S 
Sbjct  319  LSDVKKFQIILDPRLERKHLLKSAQKLAIVANRCLVRNPKNRPKMSEVLEMVDRIVESSV  378

Query  440  GIGDPRP-SIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
                  P + V S   S   E++   K+RI D K  D +W  R+W  K L+TC
Sbjct  379  STNQQPPLNSVASADDSQDTEIN--NKKRIMDPK-PDCNWF-RLWRPKLLRTC  427



>emb|CDO99768.1| unnamed protein product [Coffea canephora]
Length=426

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/233 (66%), Positives = 186/233 (80%), Gaps = 3/233 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GLAY HEGM+FQIIFRDFKSSNILLD++WNAKLSDFGLARLGP +G +H+ST
Sbjct  195  RIAQDAARGLAYLHEGMEFQIIFRDFKSSNILLDDRWNAKLSDFGLARLGPSDGFSHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLTSK+DVW+YGVFLYELITGR PLDRNRP++EQKLLEWV+PH
Sbjct  255  AVVGTVGYAAPEYIQTGRLTSKSDVWAYGVFLYELITGRRPLDRNRPKNEQKLLEWVRPH  314

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            L+D KKF QI+DPRL+G   LKSA KL+  AN+CLVRHPK RP+MSEVL+++NKV+E S 
Sbjct  315  LADIKKFEQILDPRLDGKYSLKSAQKLAATANKCLVRHPKHRPRMSEVLEIVNKVVEESV  374

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLV-RIWSLKQLKTC  285
             IG P+  I  S     +    +  KRR  D   G+  WL+ R W  K +K  
Sbjct  375  -IGSPQGPISSSVKHFEEKSKAQGPKRRFVDNVTGENKWLLWRTWKPKLVKAT  426



>gb|KEH42211.1| kinase 1B [Medicago truncatula]
Length=436

 Score =   311 bits (798),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 159/233 (68%), Positives = 191/233 (82%), Gaps = 6/233 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GL Y HE MDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GLTH+ST
Sbjct  208  KIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLTHVST  267

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK DVWSYGVFLYELITGR PLDRNRP+ EQ+LLEW++P+
Sbjct  268  AVVGTMGYAAPEYIQTGRLTSKIDVWSYGVFLYELITGRRPLDRNRPKGEQQLLEWIRPY  327

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ I+DPRLE  ++LKSA KL++VANRCLVR+PK+RPKMSEVL+M+++++E+S 
Sbjct  328  LSDVKKFQIILDPRLERKHLLKSAQKLAIVANRCLVRNPKNRPKMSEVLEMVDRIVESSV  387

Query  440  GIGDPRP-SIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
                  P + V S   S   E++   K+RI D K  D +W  R+W  K L+TC
Sbjct  388  STNQQPPLNSVASADDSQDTEIN--NKKRIMDPK-PDCNWF-RLWRPKLLRTC  436



>ref|XP_010684093.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Beta 
vulgaris subsp. vulgaris]
Length=423

 Score =   311 bits (796),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/231 (65%), Positives = 183/231 (79%), Gaps = 5/231 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IARDAA GL Y HE MDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EGLTH+ST
Sbjct  196  RIARDAARGLTYLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPPEGLTHVST  255

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            A+VGT+GYA+PEY++TGRLTSKNDVWSYGVFLYELITGR P+D+NRP+SEQ+L++WV+P+
Sbjct  256  AIVGTLGYAAPEYIRTGRLTSKNDVWSYGVFLYELITGRRPIDKNRPKSEQRLIDWVRPY  315

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF  I+DPRL  N  LKS HKLS+VANRCLVR PKSRPKMS+VLDM+N ++ AS 
Sbjct  316  LSDLKKFELIVDPRLGKNYPLKSIHKLSVVANRCLVRQPKSRPKMSDVLDMVNHIVGASA  375

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKT  288
             +  P P ++     ++KD       +R    +  + +W+ R+W     KT
Sbjct  376  ELAVPIPVVISDTEEASKDS----HAKRSMGTRFKEDNWVARLWRHNLWKT  422



>gb|KHG18706.1| hypothetical protein F383_01912 [Gossypium arboreum]
Length=429

 Score =   311 bits (796),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 157/233 (67%), Positives = 185/233 (79%), Gaps = 4/233 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GL Y HEGMDFQIIFRDFKSSNILLDE WNAKLSDFGLARLGP +GL+H+ST
Sbjct  197  KIAQDAARGLTYLHEGMDFQIIFRDFKSSNILLDEHWNAKLSDFGLARLGPSDGLSHVST  256

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT+K+DVWSYGVFLYELITGR PLDRNRP+SEQKLLEWV+PH
Sbjct  257  AVVGTIGYAAPEYIQTGRLTAKSDVWSYGVFLYELITGRRPLDRNRPKSEQKLLEWVRPH  316

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKFR+I+DPRLEG   LKSA KL+ VAN+CLVR  K RPKMSEVL ML++++E + 
Sbjct  317  LSDMKKFRRILDPRLEGKYSLKSARKLAAVANKCLVRQAKQRPKMSEVLQMLDEIVETAD  376

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG-KRRITDMKVGDGSWLV-RIWSLKQLKT  288
             +  P+P+   S P    +   R+  KRR  D+   D    V R W  K ++T
Sbjct  377  MLS-PQPATKSSIPKHVSELSKRERLKRRFIDLINSDKRCFVWRTWRPKIVRT  428



>ref|XP_009594135.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nicotiana 
tomentosiformis]
 ref|XP_009594136.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nicotiana 
tomentosiformis]
 ref|XP_009594137.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nicotiana 
tomentosiformis]
Length=430

 Score =   310 bits (795),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 155/235 (66%), Positives = 186/235 (79%), Gaps = 7/235 (3%)
 Frame = -1

Query  974  IARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHISTA  795
            IARDAA GLAY HEGM+FQIIFRDFKSSNILLDE+WNAKLSDFGLARLGP  GL+H+STA
Sbjct  196  IARDAATGLAYLHEGMEFQIIFRDFKSSNILLDEKWNAKLSDFGLARLGPSHGLSHVSTA  255

Query  794  VVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPHL  615
            VVGT+GYA+PEY+QTGRLTSK+DVWSYGVFLYELITGR PLDRN+P++EQKLLEWV+PHL
Sbjct  256  VVGTVGYAAPEYIQTGRLTSKSDVWSYGVFLYELITGRRPLDRNKPKNEQKLLEWVRPHL  315

Query  614  SDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEASTG  438
            SD KKF QI+DPRL+GN  LKSA KL+ +ANRCL +HP++RPKMSEVL+M+N+++EA T 
Sbjct  316  SDLKKFEQILDPRLDGNYSLKSAQKLAAIANRCLTKHPRNRPKMSEVLEMVNRLVEA-TE  374

Query  437  IGDPRPSIVHSDPISTKDEVDR----KGKRRITDMKVGDGSWLV-RIWSLKQLKT  288
               P   I  S     +DE  R       RR+ +    +   LV ++W  K + T
Sbjct  375  AKSPEIPIEESTTTRVEDEKFRVRCLSASRRLVEHIPKENKLLVWKLWRPKLVST  429



>ref|XP_007144362.1| hypothetical protein PHAVU_007G149900g [Phaseolus vulgaris]
 gb|ESW16356.1| hypothetical protein PHAVU_007G149900g [Phaseolus vulgaris]
Length=425

 Score =   310 bits (793),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/235 (66%), Positives = 191/235 (81%), Gaps = 9/235 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GL Y HE MDFQIIFRDFKSSNILLDEQW AKLSDFGLARLGP +GLTH+ST
Sbjct  195  KIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDEQWKAKLSDFGLARLGPSDGLTHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSK+DVWSYGVFLYELITGR P+DRNRP+ EQK+LEW++P+
Sbjct  255  AVVGTMGYAAPEYVQTGRLTSKSDVWSYGVFLYELITGRRPIDRNRPKGEQKMLEWIRPY  314

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD +KF+ I+DPRLE  ++ KSA KL+++AN+CLVR+PK+RPKMSEVL M+ +V+E+S 
Sbjct  315  LSDGRKFQIILDPRLERKHLFKSAQKLAVIANKCLVRNPKNRPKMSEVLQMVTQVVESSV  374

Query  440  GIGDPRP---SIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
               +P+P   S+V S+  S   E   K   +IT  +  D +WL R+W  K L+TC
Sbjct  375  ST-NPQPPLKSVVASEEASQDTETVNK---KITMDQKPDCNWL-RMWRPKLLRTC  424



>ref|XP_008233294.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Prunus 
mume]
Length=429

 Score =   309 bits (792),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/239 (66%), Positives = 192/239 (80%), Gaps = 12/239 (5%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGM+FQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GL+H+ST
Sbjct  195  KIAQDAARGLAYLHEGMEFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLSHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LTSK+DVWSYGVFLYELITGR P+DRNRP++EQKLLEWV+PH
Sbjct  255  AVVGTVGYAAPEYIQTGHLTSKSDVWSYGVFLYELITGRRPVDRNRPKNEQKLLEWVRPH  314

Query  617  L-SDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAS  444
            L SD KKF+ I+DPRLEGN  LK+A KL+ VA+RCLVR P+SRPKMSEV++MLN+++E +
Sbjct  315  LSSDPKKFQLILDPRLEGNYSLKAAQKLAAVASRCLVRQPRSRPKMSEVVEMLNRIME-T  373

Query  443  TGIGDPRPSIVHSDPISTKDEVDRKGKRRI-----TDMKVGDGSWLV-RIWSLKQLKTC  285
            T +G P   +   D   +KDE  R+ KR +      D  +G+   L  + W  K + TC
Sbjct  374  TDMGSPELPLKGVD---SKDEYYRESKREVLRRMFVDPLIGENGCLNWQTWRPKLVNTC  429



>ref|XP_009376804.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Pyrus 
x bretschneideri]
Length=456

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/272 (59%), Positives = 191/272 (70%), Gaps = 42/272 (15%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE M+FQIIFRDFKSSNILLD+QWNAKLSDFG+ARLGP EGLTH+ST
Sbjct  186  RIAQDAARGLTYLHEEMEFQIIFRDFKSSNILLDDQWNAKLSDFGMARLGPSEGLTHVST  245

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSKNDVWSYGVFLYELITGR PLDRNRP+SEQ LL+WVKP+
Sbjct  246  AVVGTMGYAAPEYIQTGRLTSKNDVWSYGVFLYELITGRRPLDRNRPKSEQNLLDWVKPY  305

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKFR IIDP+LEG   LKSA KL++VANRCLV+ PK+RPKMSEVL+M+N+++EAS+
Sbjct  306  LSDVKKFRLIIDPKLEGKYPLKSAQKLAIVANRCLVKLPKNRPKMSEVLEMVNQIIEASS  365

Query  440  G-------------------IGDPRPSIVHSD---------------------PISTKDE  381
            G                   +G  +     S                      PI T  +
Sbjct  366  GQKKNTNIQSGQKKTMEVPLVGKKKREAPSSKNKVTEARRGTESLQLPPKNLAPIETSRD  425

Query  380  VDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            V+    +R  D++   G W  R W+ K L+ C
Sbjct  426  VETVNNKRNVDLRRETG-WFSRSWTPKLLRKC  456



>ref|XP_004493982.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X2 [Cicer arietinum]
Length=427

 Score =   309 bits (792),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/231 (66%), Positives = 181/231 (78%), Gaps = 1/231 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GL Y HE MDFQIIFRDFKSSNILLD+QWNAKLSDFGLARLGP +GLTH+ST
Sbjct  196  KIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDDQWNAKLSDFGLARLGPSDGLTHVST  255

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYASPEYV TGRLTSKNDVWSYG+FLYELITGR PLDRNRP+ EQK+LEW+KP+
Sbjct  256  AVVGTMGYASPEYVHTGRLTSKNDVWSYGIFLYELITGRRPLDRNRPKGEQKMLEWIKPY  315

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKF+ I+DPRL+   ++KSA +L+ +ANRCLV++PKSRPKMSEVL M+  V+  S+
Sbjct  316  LSDAKKFQLILDPRLDKKQVIKSAQRLAAIANRCLVKNPKSRPKMSEVLKMVEGVVGLSS  375

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKT  288
                  P    S    + D      K+R  D K  + +W VR+W  K +KT
Sbjct  376  SANSQIPLENVSRVEVSHDTETNNNKKRTMDQKHRESNWFVRMWRPKIVKT  426



>ref|XP_002530935.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF31450.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=457

 Score =   310 bits (793),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 193/237 (81%), Gaps = 10/237 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            K+A+DAA GLAY HE MDFQIIFRDFKSSNILLD+QWNAKLSDFGLARLGP +GL+H+ST
Sbjct  225  KVAQDAAQGLAYLHEEMDFQIIFRDFKSSNILLDDQWNAKLSDFGLARLGPSDGLSHVST  284

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLTSK+DVW YGVFLYELITGR PLDRNRP+ EQKLLEWV+PH
Sbjct  285  AVVGTIGYAAPEYIQTGRLTSKSDVWGYGVFLYELITGRRPLDRNRPKEEQKLLEWVRPH  344

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ I+DPRLEG   LKSA KL+ VANRCL+R  KSRPKMSEVL M++K+++ +T
Sbjct  345  LSDLKKFKLILDPRLEGKYNLKSAQKLAAVANRCLIRQAKSRPKMSEVLAMVSKIVD-TT  403

Query  440  GIGDPRPSIVHSDPISTKD--EVDRKG--KRRITDMKVGDGSWLV-RIWSLKQLKTC  285
             +G P   ++    ++ KD  E+ R+   KR++ + ++G+  WL  R W+ K ++ C
Sbjct  404  DLGSP---LLPMKSLAPKDASEMSRRERLKRKLLNQEIGEKVWLAWRRWTPKLVRAC  457



>ref|XP_007218041.1| hypothetical protein PRUPE_ppa006060mg [Prunus persica]
 gb|EMJ19240.1| hypothetical protein PRUPE_ppa006060mg [Prunus persica]
Length=429

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 157/239 (66%), Positives = 192/239 (80%), Gaps = 12/239 (5%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGM+FQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GL+H+ST
Sbjct  195  KIAQDAARGLAYLHEGMEFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLSHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LTSK+DVWSYG+FLYELITGR P+DRNRP++EQKLLEWV+PH
Sbjct  255  AVVGTVGYAAPEYIQTGHLTSKSDVWSYGIFLYELITGRRPVDRNRPKNEQKLLEWVRPH  314

Query  617  L-SDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAS  444
            L SD KKF+ I+DPRLEGN  LK+A KL+ VA+RCLVR P+SRPKMSEV++MLN+++E +
Sbjct  315  LSSDPKKFQLILDPRLEGNYSLKAAQKLAAVASRCLVRQPRSRPKMSEVVEMLNRIME-T  373

Query  443  TGIGDPRPSIVHSDPISTKDEVDRKGKRRI-----TDMKVGDGSWLV-RIWSLKQLKTC  285
            T +G P   +   D   +KDE  R+ KR +      D  +G+   L  + W  K + TC
Sbjct  374  TDMGSPEFPLKGVD---SKDEYYRESKREVLRRMFVDPLIGENGCLNWQTWRPKLVNTC  429



>ref|XP_004493981.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X1 [Cicer arietinum]
Length=439

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/231 (66%), Positives = 181/231 (78%), Gaps = 1/231 (0%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GL Y HE MDFQIIFRDFKSSNILLD+QWNAKLSDFGLARLGP +GLTH+ST
Sbjct  208  KIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDDQWNAKLSDFGLARLGPSDGLTHVST  267

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYASPEYV TGRLTSKNDVWSYG+FLYELITGR PLDRNRP+ EQK+LEW+KP+
Sbjct  268  AVVGTMGYASPEYVHTGRLTSKNDVWSYGIFLYELITGRRPLDRNRPKGEQKMLEWIKPY  327

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKF+ I+DPRL+   ++KSA +L+ +ANRCLV++PKSRPKMSEVL M+  V+  S+
Sbjct  328  LSDAKKFQLILDPRLDKKQVIKSAQRLAAIANRCLVKNPKSRPKMSEVLKMVEGVVGLSS  387

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKT  288
                  P    S    + D      K+R  D K  + +W VR+W  K +KT
Sbjct  388  SANSQIPLENVSRVEVSHDTETNNNKKRTMDQKHRESNWFVRMWRPKIVKT  438



>gb|KJB73529.1| hypothetical protein B456_011G238100 [Gossypium raimondii]
Length=429

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/233 (67%), Positives = 184/233 (79%), Gaps = 4/233 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GL Y HEGMDFQIIFRDFKSSNILLDE WNAKLSDFGLARLGP +GL+H+ST
Sbjct  197  KIAQDAARGLTYLHEGMDFQIIFRDFKSSNILLDEHWNAKLSDFGLARLGPSDGLSHVST  256

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT+K+DVWSYGVFLYELITGR PLDRNRP++EQKLLEWV+PH
Sbjct  257  AVVGTIGYAAPEYIQTGRLTAKSDVWSYGVFLYELITGRRPLDRNRPKAEQKLLEWVRPH  316

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKFR I+DPRLEG   LKSA KL+ VAN+CL R  K RPKMSEVL ML++++E + 
Sbjct  317  LSDMKKFRLILDPRLEGKYSLKSARKLAAVANKCLARQAKQRPKMSEVLQMLDEIVETAD  376

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG-KRRITDMKVGDGSWLV-RIWSLKQLKT  288
             +  P+P+   S P    +   R+  KRR  D+   D   LV R W  K ++T
Sbjct  377  MLS-PQPATKSSIPKHVSELSKRERLKRRFIDLINSDKRCLVWRTWRPKIVRT  428



>gb|KHN39036.1| Putative receptor-like protein kinase [Glycine soja]
Length=377

 Score =   306 bits (784),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/222 (70%), Positives = 183/222 (82%), Gaps = 6/222 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GLTH+ST
Sbjct  141  KIAQDAARGLAYLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLTHVST  200

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSK DVWSYGVFLYELITGR P+DRNRP+ EQKLLEWV+P+
Sbjct  201  AVVGTMGYAAPEYVQTGRLTSKIDVWSYGVFLYELITGRHPIDRNRPKGEQKLLEWVRPY  260

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEA--  447
            LSD +KF+ I+DPRLE  +ILKSA KL+++ANRCLV++PK+RPKMSEVLDM+ +V+E+  
Sbjct  261  LSDRRKFQLILDPRLERKHILKSAQKLAIIANRCLVKNPKNRPKMSEVLDMVTQVVESTV  320

Query  446  STGIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWL  321
            ST    P  S+  S   S   +V  K   ++T  +  D +WL
Sbjct  321  STNQQPPLKSVAASAEASQGTKVKNK---KVTMDQNPDCNWL  359



>ref|XP_009788489.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nicotiana 
sylvestris]
 ref|XP_009788490.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nicotiana 
sylvestris]
Length=432

 Score =   308 bits (788),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 167/178 (94%), Gaps = 1/178 (1%)
 Frame = -1

Query  974  IARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHISTA  795
            IARDAA GLAY HEGM+FQIIFRDFKSSNILLDE+WNAKLSDFGLARLGP +GL+H+STA
Sbjct  197  IARDAATGLAYLHEGMEFQIIFRDFKSSNILLDEKWNAKLSDFGLARLGPSDGLSHVSTA  256

Query  794  VVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPHL  615
            VVGT+GYA+PEY+QTGRLTSK+DVWSYGVFLYELITGR PLDRN+P++EQKLLEWV+PHL
Sbjct  257  VVGTVGYAAPEYIQTGRLTSKSDVWSYGVFLYELITGRRPLDRNKPKNEQKLLEWVRPHL  316

Query  614  SDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAS  444
            SD KKF QI+DPRL+GN  LKSA KL+ +ANRCL +HP++RPKMSEVL+M+N+++EA+
Sbjct  317  SDLKKFEQILDPRLDGNYSLKSAQKLAAIANRCLTKHPRNRPKMSEVLEMVNRLVEAT  374



>ref|XP_004497524.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X2 [Cicer arietinum]
Length=427

 Score =   307 bits (787),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 189/234 (81%), Gaps = 8/234 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GL Y HE MDFQIIFRDFKSSNILLDE WNAKLSDFGLARLGP +GLTH+ST
Sbjct  197  KIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDEHWNAKLSDFGLARLGPSDGLTHVST  256

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK+DVW YGVFLYELITGR PLDRNRP+ EQKLLEW++P+
Sbjct  257  AVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFLYELITGRRPLDRNRPKGEQKLLEWIRPY  316

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ I+DPRLE  ++LKSA KL+++ANRCLVR+PK+RPKMSEVL+M+++++E+S 
Sbjct  317  LSDGKKFQIILDPRLERKHLLKSAQKLAMIANRCLVRNPKNRPKMSEVLEMVDRIVESSV  376

Query  440  GIGDPRP--SIVHSDPISTKDEVDRKGKRRITDMK-VGDGSWLVRIWSLKQLKT  288
                  P  S+  +D      + + K K+RI D K   D +W  R+W  K L+T
Sbjct  377  SANQQPPLNSVASAD---DSQDAEIKNKKRIMDPKPESDWNWF-RMWRPKLLRT  426



>ref|XP_004497523.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X1 [Cicer arietinum]
Length=436

 Score =   308 bits (788),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 189/234 (81%), Gaps = 8/234 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GL Y HE MDFQIIFRDFKSSNILLDE WNAKLSDFGLARLGP +GLTH+ST
Sbjct  206  KIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDEHWNAKLSDFGLARLGPSDGLTHVST  265

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK+DVW YGVFLYELITGR PLDRNRP+ EQKLLEW++P+
Sbjct  266  AVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFLYELITGRRPLDRNRPKGEQKLLEWIRPY  325

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ I+DPRLE  ++LKSA KL+++ANRCLVR+PK+RPKMSEVL+M+++++E+S 
Sbjct  326  LSDGKKFQIILDPRLERKHLLKSAQKLAMIANRCLVRNPKNRPKMSEVLEMVDRIVESSV  385

Query  440  GIGDPRP--SIVHSDPISTKDEVDRKGKRRITDMK-VGDGSWLVRIWSLKQLKT  288
                  P  S+  +D      + + K K+RI D K   D +W  R+W  K L+T
Sbjct  386  SANQQPPLNSVASAD---DSQDAEIKNKKRIMDPKPESDWNWF-RMWRPKLLRT  435



>ref|XP_010112214.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXC32923.1| putative receptor-like protein kinase [Morus notabilis]
Length=470

 Score =   308 bits (790),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 179/209 (86%), Gaps = 6/209 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIARDAA GLAY HE M+FQIIFRDFKSSNILLDE WNAKLSDFGLARLGP +GL+HIST
Sbjct  184  KIARDAARGLAYLHEEMEFQIIFRDFKSSNILLDEHWNAKLSDFGLARLGPSDGLSHIST  243

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT+K+DVWSYGVFLYELITGR PLDRNRPRSEQKLLEWV+ H
Sbjct  244  AVVGTIGYAAPEYIQTGRLTAKSDVWSYGVFLYELITGRRPLDRNRPRSEQKLLEWVRQH  303

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSDSKKF++I+DPRLEG   LKSA KL+ VANRCLVR  KSRPKMSEVLD++++++E S 
Sbjct  304  LSDSKKFQKILDPRLEGKYSLKSARKLASVANRCLVRQSKSRPKMSEVLDVVSRIVE-SA  362

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRI  354
             IG P+  +     +S +DE  R+ KR I
Sbjct  363  DIGSPQTPL---KSLSLQDET-RRSKREI  387



>ref|XP_002315317.2| hypothetical protein POPTR_0010s23220g [Populus trichocarpa]
 gb|EEF01488.2| hypothetical protein POPTR_0010s23220g [Populus trichocarpa]
Length=438

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/235 (66%), Positives = 186/235 (79%), Gaps = 6/235 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQIIFRDFKSSNILLD+QWNAKLSDFGLARLGP +GL+H+ST
Sbjct  204  KIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLDDQWNAKLSDFGLARLGPSDGLSHVST  263

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLTSK+DVWS+GVFLYELITGR PLDRNRP++EQ LLEWV+ H
Sbjct  264  AVVGTIGYAAPEYIQTGRLTSKSDVWSFGVFLYELITGRRPLDRNRPKNEQNLLEWVRSH  323

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD +KFR I+DP+LEG   +K+A KL+ VANRCLVR  KSRPKMS++LDM+NK+++ +T
Sbjct  324  LSDVRKFRLIMDPKLEGKYNIKAAQKLASVANRCLVRQAKSRPKMSDILDMINKIVD-TT  382

Query  440  GIGDPRPSIVHSDPISTKDEVDR-KGKRRITDMKVGD--GSWLV-RIWSLKQLKT  288
              G P P      P    +   R + KRR  D  +GD  G W   R W  K ++T
Sbjct  383  DNGSPLPCTKSLAPKDAPEGPGRERMKRRFLDSIIGDQKGCWSAWRTWRTKLVRT  437



>ref|XP_004247375.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Solanum 
lycopersicum]
 ref|XP_010326559.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Solanum 
lycopersicum]
Length=415

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 167/178 (94%), Gaps = 1/178 (1%)
 Frame = -1

Query  974  IARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHISTA  795
            IARDAA GLAY HEGM+FQIIFRDFKSSNILLDE+WNAKLSDFGLARLGP +GL+H+STA
Sbjct  181  IARDAARGLAYLHEGMEFQIIFRDFKSSNILLDEKWNAKLSDFGLARLGPSDGLSHVSTA  240

Query  794  VVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPHL  615
            VVGT+GYA+PEY+QTGRLTSK+DVWSYGVFLYELITGR PLDRN+P++EQKLLEWV+PHL
Sbjct  241  VVGTVGYAAPEYIQTGRLTSKSDVWSYGVFLYELITGRRPLDRNKPKNEQKLLEWVRPHL  300

Query  614  SDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAS  444
            SD KKF QI+DPRL+G   +KSA KL+ +ANRCLV+HP++RPKMSEVL+M+N+V++A+
Sbjct  301  SDLKKFEQILDPRLDGKYSIKSAQKLAAIANRCLVKHPRNRPKMSEVLEMVNQVVKAT  358



>ref|XP_011077249.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
 ref|XP_011077250.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
 ref|XP_011077251.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
 ref|XP_011077253.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
Length=423

 Score =   306 bits (783),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 184/222 (83%), Gaps = 5/222 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            K+A+DAA GL Y HEGM+FQIIFRDFKSSNILLD++WNAKLSDFGLARLGP +GL+H+ST
Sbjct  195  KVAQDAARGLTYLHEGMEFQIIFRDFKSSNILLDDRWNAKLSDFGLARLGPADGLSHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLTSK+DVWSYG+FLYELITGR PLDRNRP++E+KLL+WV+PH
Sbjct  255  AVVGTIGYAAPEYIQTGRLTSKSDVWSYGIFLYELITGRRPLDRNRPKNEEKLLDWVRPH  314

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            L+D +KF QI+DPRL G   LKSA KL+ +ANRCL+RHPK+RP+MS+VL+M+N V+EA T
Sbjct  315  LADMRKFEQILDPRLNGKYELKSAQKLAAIANRCLLRHPKNRPRMSQVLEMVNHVVEA-T  373

Query  440  GIGDPRPSIVHSDPISTKDE--VDRKGKRRITDMKVGDGSWL  321
             I  P  ++ HS P++  DE   +   KRR     +GD   L
Sbjct  374  SIESPDGTVEHS-PLTDDDEKSAEESLKRRFLHHIIGDNKCL  414



>gb|KHG26991.1| hypothetical protein F383_05198 [Gossypium arboreum]
Length=426

 Score =   305 bits (781),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 154/234 (66%), Positives = 190/234 (81%), Gaps = 8/234 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIARDAA GLA+ HEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GL+H+ST
Sbjct  198  KIARDAARGLAFLHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLSHVST  257

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT K+DVWSYGVFLYELITGR PLDRNRP+ E+KLLEWV+PH
Sbjct  258  AVVGTIGYAAPEYIQTGRLTIKSDVWSYGVFLYELITGRRPLDRNRPKGEEKLLEWVRPH  317

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +S+ KKFR IIDPRL+G   LKSAHKL+ VAN+CL R  K RPKMSEVL+M++ ++E++ 
Sbjct  318  ISNIKKFRLIIDPRLDGKYSLKSAHKLAAVANKCLTRQAKLRPKMSEVLEMVDGIVESAE  377

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG--KRRITDMKVGDGSWLVRIWSLKQLKTC  285
             +  P+P +  S+ ++T  E+ +    +RR+ D+  GD   L  +W  K + TC
Sbjct  378  MVS-PQPDLKSSN-LNTNFELSKTESLRRRLLDLIPGDKGCL--MWP-KIVTTC  426



>ref|XP_010032169.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Eucalyptus 
grandis]
 ref|XP_010032170.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Eucalyptus 
grandis]
 gb|KCW51572.1| hypothetical protein EUGRSUZ_J01074 [Eucalyptus grandis]
Length=430

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/237 (65%), Positives = 186/237 (78%), Gaps = 10/237 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D+A GL Y HEGMD QIIFRDFKSSNILLD+QWNAKLSDFGLARLGP  G +H+ST
Sbjct  198  KIAQDSARGLTYLHEGMDLQIIFRDFKSSNILLDDQWNAKLSDFGLARLGPSSGESHVST  257

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGT+GYA+PEY+QTG LT+K+DVWSYG+FLYELITGR PL+RNRP++EQKLLEWVKP+
Sbjct  258  LVVGTIGYAAPEYIQTGHLTTKSDVWSYGIFLYELITGRRPLERNRPKNEQKLLEWVKPN  317

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ I+DPRLEG   LKSA +L+ VANRCLVRHPK RPKMSEVL M+N+++EA  
Sbjct  318  LSDIKKFQTILDPRLEGKYSLKSAQRLASVANRCLVRHPKGRPKMSEVLAMVNRIVEA-M  376

Query  440  GIGDPRPSIVHSDPISTKDEVDR----KGKRRITDMKVGDGSWLV-RIWSLKQLKTC  285
              G P+  +     ++  DE+++    + KRR  D   G+  WLV   W  K +KTC
Sbjct  377  ETGSPKAPL---RSVAKNDELEKSRKERFKRRFVDPITGETGWLVCWTWRPKLVKTC  430



>ref|XP_010464638.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Camelina 
sativa]
Length=426

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/235 (64%), Positives = 188/235 (80%), Gaps = 6/235 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE MDFQIIFRDFKSSNILLDE W AKLSDFGLARLGP EGLTH+ST
Sbjct  194  RIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDEDWKAKLSDFGLARLGPSEGLTHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+QTGRLTSK+DVW YGVFLYELITGR P+DRN+P+ EQKLLEWV+P+
Sbjct  254  DVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFLYELITGRRPVDRNKPKGEQKLLEWVRPY  313

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD++KFR I+DPRLEG   +KS  KL++VANRCLVR+PK+RPKMSEVL+M+ K++EAS+
Sbjct  314  LSDTRKFRLILDPRLEGKYPIKSVQKLAVVANRCLVRNPKTRPKMSEVLEMVTKIVEASS  373

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRI---TDMKVGDGSWLVRIWSLKQLKTC  285
            G G P+  +V    ++   +   K KR +    +   G+G W  ++W+ K ++ C
Sbjct  374  GNGSPQ--LVPLKSVNASRDTGGKNKRGLETKNNGGGGEGGWFGKLWNPKTIRAC  426



>dbj|BAH19927.1| AT3G09830 [Arabidopsis thaliana]
Length=418

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/232 (64%), Positives = 185/232 (80%), Gaps = 8/232 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE M+FQIIFRDFKSSNILLDE W AKLSDFGLARLGP EGLTH+ST
Sbjct  194  RIAQDAARGLTYLHEEMEFQIIFRDFKSSNILLDEDWKAKLSDFGLARLGPSEGLTHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+QTGRLTSK+DVW YGVFLYELITGR P+DRNRP+ EQKLLEWV+P+
Sbjct  254  DVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFLYELITGRRPVDRNRPKGEQKLLEWVRPY  313

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD++KF+ I+DPRLEG   +KS  KL++VANRCLVR+ K+RPKMSEVL+M+NK++EAS+
Sbjct  314  LSDTRKFKLILDPRLEGKYPIKSVQKLAVVANRCLVRNSKARPKMSEVLEMVNKIVEASS  373

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            G G P+   ++S   S       +  R   +   G+G W  ++W+ K ++ C
Sbjct  374  GNGSPQLVPLNSVKAS-------RDARGENNGGGGEGGWFGKLWNPKTIRAC  418



>ref|XP_011041041.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Populus 
euphratica]
 ref|XP_011041042.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Populus 
euphratica]
 ref|XP_011041043.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Populus 
euphratica]
Length=434

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/240 (64%), Positives = 190/240 (79%), Gaps = 16/240 (7%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQIIFRDFKSSNILLD+QWNAKLSDFGLARLGP +GL+H+ST
Sbjct  200  KIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLDDQWNAKLSDFGLARLGPSDGLSHVST  259

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLTSK+DVWS+GVFLYELITGR PLDRNRP++EQKLLEWV+ H
Sbjct  260  AVVGTIGYAAPEYIQTGRLTSKSDVWSFGVFLYELITGRRPLDRNRPKNEQKLLEWVRSH  319

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD +KFR I+DPRLEG   +K+A KL+ VANRCLVR  K+RPKMS++LDM+NK+++ +T
Sbjct  320  LSDVRKFRLIMDPRLEGKYNIKAAQKLASVANRCLVRQAKTRPKMSDILDMINKIVD-TT  378

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG----KRRITDMKVGD-----GSWLVRIWSLKQLKT  288
              G P   ++ +  ++ KD  +  G    K+R  D   GD      +W  R W  K ++T
Sbjct  379  DNGSP---LLRTKSLAPKDAPEGPGRERMKKRFLDSIFGDQKRCWSAW--RTWRTKLMRT  433



>ref|XP_004307370.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Fragaria 
vesca subsp. vesca]
Length=430

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/239 (65%), Positives = 187/239 (78%), Gaps = 9/239 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE M+FQIIFRDFKSSNILLDE WNAKLSDFGLARLGP +G++H+ST
Sbjct  193  KIAQDAARGLAYLHEEMEFQIIFRDFKSSNILLDEHWNAKLSDFGLARLGPSDGVSHVST  252

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LTSK+DVWSYG+FLYELITGR P+DRNRP++EQKLLEWV+ H
Sbjct  253  AVVGTVGYAAPEYIQTGHLTSKSDVWSYGIFLYELITGRRPVDRNRPKNEQKLLEWVRAH  312

Query  617  LS-DSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAS  444
            +S D KKF+ I+DPRLEG   LK+A KL+ VANRCLVR PKSRPKMSEVL+M+N+++E +
Sbjct  313  MSADLKKFQLIMDPRLEGKYSLKAAQKLAAVANRCLVRQPKSRPKMSEVLEMINRIVETT  372

Query  443  TGIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGD------GSWLVRIWSLKQLKTC  285
            T +G P+     S   S K+E     KR I   K  D      G   ++IW  K +KTC
Sbjct  373  TDMGSPQQLPSESVDYS-KNEFLTGSKREILRRKFVDPLIGEKGCLNLQIWRPKIVKTC  430



>ref|XP_008457617.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Cucumis 
melo]
Length=398

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 175/207 (85%), Gaps = 4/207 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IARDAA GL Y HE +D QIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EG TH+ST
Sbjct  194  RIARDAARGLTYLHEELDVQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPPEGFTHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            A+VGTMGYA+PEYVQTGRLTSK DVWSYGVFLYELITGR P+DRNRP+SEQKLLEWVKP+
Sbjct  254  AIVGTMGYAAPEYVQTGRLTSKTDVWSYGVFLYELITGRIPIDRNRPKSEQKLLEWVKPY  313

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKF+ I+DPRL+G   +KSA+KLS VANRCLVR+PK+RPKMSE+L+M++++ EA T
Sbjct  314  LSDTKKFQLILDPRLKGKSHIKSAYKLSNVANRCLVRNPKNRPKMSEILEMVSRIAEAWT  373

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKR  360
              G+ +  +    P + K+   R  K+
Sbjct  374  ETGNSQTPLA---PYTIKNSQGRPIKK  397



>ref|XP_010477459.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Camelina 
sativa]
 ref|XP_010477529.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Camelina 
sativa]
 ref|XP_010486557.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Camelina 
sativa]
Length=426

 Score =   303 bits (776),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 150/235 (64%), Positives = 188/235 (80%), Gaps = 6/235 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE MDFQIIFRDFKSSNILLDE W AKLSDFGLARLGP EGLTH+ST
Sbjct  194  RIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDEDWKAKLSDFGLARLGPSEGLTHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+QTGRLTSK+DVW YGVFLYELITGR P+DRN+P+ EQKLLEWV+P+
Sbjct  254  DVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFLYELITGRRPVDRNKPKGEQKLLEWVRPY  313

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD++KF+ I+DPRLEG   +KS  KL++VANRCLVR+PK+RPKMSEVL+M+ K++EAS+
Sbjct  314  LSDTRKFKLILDPRLEGKYPIKSVQKLAVVANRCLVRNPKTRPKMSEVLEMVTKIVEASS  373

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRI---TDMKVGDGSWLVRIWSLKQLKTC  285
            G G P+  +V    ++   +   K KR +    +   G+G W  ++W+ K ++ C
Sbjct  374  GNGSPQ--LVPLKSVNASRDTGGKNKRGLETKNNGGGGEGGWFGKLWNPKTIRAC  426



>ref|XP_006287832.1| hypothetical protein CARUB_v10001049mg [Capsella rubella]
 gb|EOA20730.1| hypothetical protein CARUB_v10001049mg [Capsella rubella]
Length=420

 Score =   303 bits (775),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 187/233 (80%), Gaps = 5/233 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE MDFQIIFRDFKSSNILLDE W AKLSDFGLARLGP  G +H+ST
Sbjct  191  RIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDENWKAKLSDFGLARLGPAPGSSHVST  250

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+QTGRLTSK+DVW YGVF+YELITGR PLDRN+P+ EQKLLEWV+P+
Sbjct  251  DVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDRNKPKGEQKLLEWVRPY  310

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+++FR I+DPRLEG  ++K   +L++VAN CL R+PK+RPKMSEVLDM+ K++E+S+
Sbjct  311  LSDTRRFRLIVDPRLEGKYMIKPVQRLAVVANLCLARNPKARPKMSEVLDMVTKIVESSS  370

Query  440  -GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
             G G  +P +V   P+ +++    + ++   D+  G+G WL ++W+ K ++ C
Sbjct  371  PGNGGKKPQLV---PLKSQEASRDEEEKNKKDLDGGEGGWLEKLWNPKNVRAC  420



>ref|XP_006297732.1| hypothetical protein CARUB_v10013766mg [Capsella rubella]
 gb|EOA30630.1| hypothetical protein CARUB_v10013766mg [Capsella rubella]
Length=426

 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 149/233 (64%), Positives = 188/233 (81%), Gaps = 2/233 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GLAY HE M+FQIIFRDFKSSNILLDE W AKLSDFGLARLGP EGLTH+ST
Sbjct  194  RIAQDAARGLAYLHEEMEFQIIFRDFKSSNILLDEDWKAKLSDFGLARLGPSEGLTHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+QTGRLTSK+DVW YGVFLYELITGR P+DRN+P+ EQKLLEWV+P+
Sbjct  254  DVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFLYELITGRRPVDRNKPKGEQKLLEWVRPY  313

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD++KF+ I+DPRLEG   +KS  KL++VANRCLVR+PK+RPKMSEVL+M+ K++EAS+
Sbjct  314  LSDTRKFKLILDPRLEGKYPIKSVQKLAVVANRCLVRNPKTRPKMSEVLEMVTKIVEASS  373

Query  440  GIGDPRPSIVHSDPIST-KDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            G G P+   + S   S+     +++G     +   G+G W  ++W+ K ++ C
Sbjct  374  GNGSPQLVPLKSKNASSDAGGKNKRGLETKNNGGGGEGGWFGKLWNPKTIRAC  426



>gb|ACJ85098.1| unknown [Medicago truncatula]
Length=385

 Score =   301 bits (770),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 167/187 (89%), Gaps = 1/187 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GL Y HE MDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GLTH+ST
Sbjct  199  KIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLTHVST  258

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLTSK DVWSYGVFLYELITGR PLDRNRP+ EQ+LLEW++P+
Sbjct  259  AVVGTMGYAAPEYIQTGRLTSKIDVWSYGVFLYELITGRRPLDRNRPKGEQQLLEWIRPY  318

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ I+DPRLE  ++LKSA KL++VANRCLVR+PK+RPKMSEVL+M+++++E+S 
Sbjct  319  LSDVKKFQIILDPRLERKHLLKSAQKLAIVANRCLVRNPKNRPKMSEVLEMVDRIVESSV  378

Query  440  GIGDPRP  420
                  P
Sbjct  379  STNQQPP  385



>ref|XP_006436456.1| hypothetical protein CICLE_v10031608mg [Citrus clementina]
 ref|XP_006485633.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X2 [Citrus sinensis]
 ref|XP_006485634.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X3 [Citrus sinensis]
 ref|XP_006485635.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X4 [Citrus sinensis]
 ref|XP_006485636.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X5 [Citrus sinensis]
 gb|ESR49696.1| hypothetical protein CICLE_v10031608mg [Citrus clementina]
Length=430

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/236 (65%), Positives = 185/236 (78%), Gaps = 10/236 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GL+H+ST
Sbjct  198  KIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLSHVST  257

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT K+D+WS+GVFLYELITGR PLDRNRP+SEQKLLEWV+PH
Sbjct  258  AVVGTIGYAAPEYIQTGRLTYKSDIWSFGVFLYELITGRRPLDRNRPKSEQKLLEWVRPH  317

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE-AS  444
            L+D+KKF  I+DP+LEG   +K A KL+ VAN+CL R  KSRPKMSEV++MLNK+++ A 
Sbjct  318  LTDAKKFTMILDPKLEGKYSIKLAQKLAAVANKCLARQAKSRPKMSEVVEMLNKIVDVAE  377

Query  443  TGI-GDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDG---SWLVRIWSLKQLKT  288
            TG    P  ++   D   T  +   + KRR  D   G+    +WL   W  K +KT
Sbjct  378  TGTPQTPLKNLSLKDAFETSKK--ERLKRRFVDPIRGEKGCLAWLT--WRPKLVKT  429



>ref|XP_009146895.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Brassica 
rapa]
Length=424

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 185/232 (80%), Gaps = 2/232 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE M+FQIIFRDFKSSNILLDE W AKLSDFGLARLGP EGLTH+ST
Sbjct  194  RIAQDAARGLTYLHEQMEFQIIFRDFKSSNILLDENWKAKLSDFGLARLGPSEGLTHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+QTGRLTSK+DVW YGVF+YELITGR P+DRN+P+ EQKLLEWV+P+
Sbjct  254  DVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRKPVDRNKPKGEQKLLEWVRPY  313

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD++KF+ I+DPRLEG   LKS  KL++VANRCLVR+PK+RPKMSEVL+M+NK++EA +
Sbjct  314  LSDTRKFKLILDPRLEGKYPLKSVQKLAVVANRCLVRNPKARPKMSEVLEMVNKIVEAPS  373

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
              G   P +V    + T  +     K+R  +   G+G W  ++W+ K ++ C
Sbjct  374  CSGTS-PQLVPLQSLETSRDAGGGKKKRGLENGGGEGGWFGKLWNPKTIRAC  424



>ref|XP_008778999.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Phoenix 
dactylifera]
 ref|XP_008779000.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Phoenix 
dactylifera]
Length=430

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 187/237 (79%), Gaps = 9/237 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            K+A DAA GL Y HE MDFQIIFRDFK+SNILLDE WNAKLSDFGLAR GP EGL+H+ST
Sbjct  195  KVAIDAARGLKYLHEDMDFQIIFRDFKTSNILLDEHWNAKLSDFGLARHGPAEGLSHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT GYA+PEY++TG LT+K+D+WSYGV LYELITGR PLDRNRP+SEQKLLEWVKP+
Sbjct  255  AVVGTAGYAAPEYMRTGHLTAKSDIWSYGVVLYELITGRRPLDRNRPKSEQKLLEWVKPY  314

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD KKFR I+DPRLEG   LKSA KL+ VANRCLVR+PKSRPKMSEVL+M+ +  EA  
Sbjct  315  ISDVKKFRLILDPRLEGQYSLKSATKLASVANRCLVRNPKSRPKMSEVLEMVQRTYEAME  374

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG-----KRRITDMKVGDGSWLV-RIWSLKQLKT  288
              G P+P +  S P   K+   RK      KRRI D+K+G+G  LV + W+ K ++T
Sbjct  375  -TGAPQPPLKSSAP-EEKNSGTRKKRGLNLKRRIGDLKMGEGMRLVWQGWTPKLVRT  429



>ref|XP_006436457.1| hypothetical protein CICLE_v10031608mg [Citrus clementina]
 gb|ESR49697.1| hypothetical protein CICLE_v10031608mg [Citrus clementina]
Length=399

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/236 (65%), Positives = 185/236 (78%), Gaps = 10/236 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GL+H+ST
Sbjct  167  KIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLSHVST  226

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT K+D+WS+GVFLYELITGR PLDRNRP+SEQKLLEWV+PH
Sbjct  227  AVVGTIGYAAPEYIQTGRLTYKSDIWSFGVFLYELITGRRPLDRNRPKSEQKLLEWVRPH  286

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE-AS  444
            L+D+KKF  I+DP+LEG   +K A KL+ VAN+CL R  KSRPKMSEV++MLNK+++ A 
Sbjct  287  LTDAKKFTMILDPKLEGKYSIKLAQKLAAVANKCLARQAKSRPKMSEVVEMLNKIVDVAE  346

Query  443  TGI-GDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDG---SWLVRIWSLKQLKT  288
            TG    P  ++   D   T  +   + KRR  D   G+    +WL   W  K +KT
Sbjct  347  TGTPQTPLKNLSLKDAFETSKK--ERLKRRFVDPIRGEKGCLAWLT--WRPKLVKT  398



>ref|XP_006485632.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X1 [Citrus sinensis]
Length=441

 Score =   301 bits (772),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 154/236 (65%), Positives = 185/236 (78%), Gaps = 10/236 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GL+H+ST
Sbjct  209  KIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLSHVST  268

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT K+D+WS+GVFLYELITGR PLDRNRP+SEQKLLEWV+PH
Sbjct  269  AVVGTIGYAAPEYIQTGRLTYKSDIWSFGVFLYELITGRRPLDRNRPKSEQKLLEWVRPH  328

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE-AS  444
            L+D+KKF  I+DP+LEG   +K A KL+ VAN+CL R  KSRPKMSEV++MLNK+++ A 
Sbjct  329  LTDAKKFTMILDPKLEGKYSIKLAQKLAAVANKCLARQAKSRPKMSEVVEMLNKIVDVAE  388

Query  443  TGI-GDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDG---SWLVRIWSLKQLKT  288
            TG    P  ++   D   T  +   + KRR  D   G+    +WL   W  K +KT
Sbjct  389  TGTPQTPLKNLSLKDAFETSKK--ERLKRRFVDPIRGEKGCLAWLT--WRPKLVKT  440



>ref|NP_187594.1| protein kinase family protein [Arabidopsis thaliana]
 ref|NP_974270.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AAF23252.1|AC015985_10 putative protein kinase [Arabidopsis thaliana]
 gb|AAM14067.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM67514.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEE74818.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AEE74819.1| protein kinase family protein [Arabidopsis thaliana]
Length=418

 Score =   300 bits (769),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 166/186 (89%), Gaps = 1/186 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE M+FQIIFRDFKSSNILLDE W AKLSDFGLARLGP EGLTH+ST
Sbjct  194  RIAQDAARGLTYLHEEMEFQIIFRDFKSSNILLDEDWKAKLSDFGLARLGPSEGLTHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+QTGRLTSK+DVW YGVFLYELITGR P+DRNRP+ EQKLLEWV+P+
Sbjct  254  DVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFLYELITGRRPVDRNRPKGEQKLLEWVRPY  313

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD++KF+ I+DPRLEG   +KS  KL++VANRCLVR+ K+RPKMSEVL+M+NK++EAS+
Sbjct  314  LSDTRKFKLILDPRLEGKYPIKSVQKLAVVANRCLVRNSKARPKMSEVLEMVNKIVEASS  373

Query  440  GIGDPR  423
            G G P+
Sbjct  374  GNGSPQ  379



>ref|XP_010935734.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Elaeis guineensis]
 ref|XP_010935735.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Elaeis guineensis]
Length=430

 Score =   301 bits (770),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 157/236 (67%), Positives = 186/236 (79%), Gaps = 7/236 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            K+A DAA GL Y HE MDFQIIFRDFK+SNILLDE WNAKLSDFGLAR GP EGL+H+ST
Sbjct  195  KVAIDAARGLKYLHEDMDFQIIFRDFKTSNILLDEHWNAKLSDFGLARHGPSEGLSHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT GYA+PEY++TG LT+K+DVWSYGV LYELITGR PLDRNRP+SEQKLLEWVKP+
Sbjct  255  AVVGTAGYAAPEYMRTGHLTAKSDVWSYGVVLYELITGRRPLDRNRPKSEQKLLEWVKPY  314

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD KKFR I+DPRLEG   LKSA KL  VANRCLVR+PKSRPKMSEVL+M+ +++E S 
Sbjct  315  ISDVKKFRLILDPRLEGQYSLKSATKLGSVANRCLVRNPKSRPKMSEVLEMVQRIVE-SM  373

Query  440  GIGDPRP----SIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLV-RIWSLKQLKT  288
              G P+P    SI   +   T+ +     KRRI D K+G+G  LV + W+ K ++T
Sbjct  374  ETGAPQPPLKSSISEEETSGTRKKRGLNLKRRIVDWKMGEGMRLVWQGWTPKLVRT  429



>ref|XP_010452206.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Camelina 
sativa]
Length=421

 Score =   300 bits (769),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 185/233 (79%), Gaps = 5/233 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE MDFQIIFRDFKSSNILLDE W AKLSDFGLARLGP  G +H+ST
Sbjct  192  RIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDENWKAKLSDFGLARLGPSPGSSHVST  251

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+QTGRLTSK+DVW YGVF+YELITGR PLDRN+P+ EQKLLEWV+P+
Sbjct  252  DVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDRNKPKGEQKLLEWVRPY  311

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+++FR I+DPRLEG  ++K   KL++VAN CL R+ K+RPKMSEVLDM+ K++EAS+
Sbjct  312  LSDTRRFRLIVDPRLEGKYMIKPVQKLAVVANLCLARNAKARPKMSEVLDMVTKIVEASS  371

Query  440  -GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
             G+G  +P +V   P+ ++     + ++    +  G+G WL ++W+ K ++ C
Sbjct  372  PGVGSKKPQLV---PLKSQGASRDEEEKNKKVLDGGEGGWLEKLWNPKNVRAC  421



>emb|CDY54619.1| BnaA05g28720D [Brassica napus]
Length=427

 Score =   300 bits (769),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 185/232 (80%), Gaps = 2/232 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE M+FQIIFRDFKSSNILLDE W AKLSDFGLARLGP EGLTH+ST
Sbjct  197  RIAQDAARGLTYLHEQMEFQIIFRDFKSSNILLDENWKAKLSDFGLARLGPSEGLTHVST  256

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+QTGRLTSK+DVW YGVF+YELITGR P+DRN+P+ EQKLLEWV+P+
Sbjct  257  DVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRKPVDRNKPKGEQKLLEWVRPY  316

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD++KF+ I+DPRLEG   LKS  KL++VANRCLVR+PK+RPKMSEVL+M+NK++EA +
Sbjct  317  LSDTRKFKLILDPRLEGKYPLKSVQKLAVVANRCLVRNPKARPKMSEVLEMVNKIVEAPS  376

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
              G   P +V    +    +V    K+R  +   G+G W  ++W+ K ++ C
Sbjct  377  CSGTS-PQLVPLKSLEASRDVGGGKKKRGLENGGGEGGWFGKLWNPKTIRAC  427



>ref|XP_010423734.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Camelina 
sativa]
Length=422

 Score =   300 bits (769),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 185/233 (79%), Gaps = 5/233 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE MDFQIIFRDFKSSNILLDE W AKLSDFGLARLGP  G +H+ST
Sbjct  193  RIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDENWKAKLSDFGLARLGPSPGSSHVST  252

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+QTGRLTSK+DVW YGVF+YELITGR PLDRN+P+ EQKLLEWV+P+
Sbjct  253  DVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDRNKPKGEQKLLEWVRPY  312

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+++FR I+DPRLEG  ++K   KL++VAN CL R+ K+RPKMSEVLDM+ K++EAS+
Sbjct  313  LSDTRRFRLIVDPRLEGKYMIKPVQKLAVVANLCLARNAKARPKMSEVLDMVTKIVEASS  372

Query  440  -GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
             G+G  +P +V   P+ ++     + ++    +  G+G WL ++W+ K ++ C
Sbjct  373  PGVGGKKPQLV---PLKSQGASRDEEEKNKKVLDGGEGGWLEKLWNPKNVRAC  422



>ref|XP_010543404.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Tarenaya 
hassleriana]
Length=426

 Score =   300 bits (768),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 151/234 (65%), Positives = 185/234 (79%), Gaps = 4/234 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE MDFQIIFRDFKSSNILLDE W AKLSDFGLARLGP  GLTH+ T
Sbjct  194  RIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDEDWKAKLSDFGLARLGPAGGLTHVFT  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEYVQTGRLTSK+DVW YGVF+YELITGR P+DRN+P+ EQKLLEWV+P+
Sbjct  254  DVVGTMGYAAPEYVQTGRLTSKSDVWGYGVFIYELITGRRPVDRNKPKGEQKLLEWVRPY  313

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKFR I+DPRLEG   +KS  +L++VANRCLVR+PK+RPKMSEVL+M+ K++EAS+
Sbjct  314  LSDTKKFRLILDPRLEGKYPIKSVQRLAVVANRCLVRNPKARPKMSEVLEMVTKIVEASS  373

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDM--KVGDGSWLVRIWSLKQLKTC  285
            G G   P +V    +        K K+R+ +M    G+G W  +IW+ K ++ C
Sbjct  374  GNGGS-PQLVPMKSLEGSRGAGGKKKKRVLEMGNNGGEGGWFGKIWNPKMVRAC  426



>gb|KHN48255.1| Putative receptor-like protein kinase [Glycine soja]
Length=431

 Score =   300 bits (769),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 189/233 (81%), Gaps = 8/233 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GL Y HE MDFQIIFRDFKSSNILLDE WNAKLSDFGLARLGP +GLTH+ST
Sbjct  196  KIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDELWNAKLSDFGLARLGPSDGLTHVST  255

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSK+DVWSYGVFLYELITGR P+DRNRP+ EQKLLEWV+P+
Sbjct  256  AVVGTMGYAAPEYVQTGRLTSKSDVWSYGVFLYELITGRRPIDRNRPKGEQKLLEWVRPY  315

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEA--  447
            LSD ++F+ I+DPRLE  +ILKSA KL+++ANRCLVR+PK+RPKMSEVL+M+ +V+E+  
Sbjct  316  LSDGRRFQLILDPRLERRHILKSAQKLAIIANRCLVRNPKNRPKMSEVLEMVTRVVESSV  375

Query  446  STGIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKT  288
            ST +  P  S+  ++     +  ++K    +T  +  D +WL R+W  K L+ 
Sbjct  376  STNLQPPLKSVASAEASQAAEIKNKK----VTMDQNPDCNWL-RMWRPKLLRA  423



>gb|KDO46223.1| hypothetical protein CISIN_1g013504mg [Citrus sinensis]
Length=441

 Score =   300 bits (769),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 152/238 (64%), Positives = 188/238 (79%), Gaps = 14/238 (6%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GL+H+ST
Sbjct  209  KIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLSHVST  268

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT K+D+WS+GVFLYELITGR PLDRNRP+SEQKLLEWV+PH
Sbjct  269  AVVGTIGYAAPEYIQTGRLTYKSDIWSFGVFLYELITGRRPLDRNRPKSEQKLLEWVRPH  328

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            L+D+KKF  I+DP+LEG   +K A KL+ VAN+CL R  K RPKMSEV+++LNK+++A+ 
Sbjct  329  LTDAKKFTMILDPKLEGKYSIKLAQKLAAVANKCLARQAKGRPKMSEVVEVLNKIVDAAE  388

Query  440  GIGDPRPSIVHSDPISTKDEVD----RKGKRRITDMKVGDG---SWLVRIWSLKQLKT  288
              G P+  + +   +S KD+ +     + KRR  D   G+    +WL   W  K +KT
Sbjct  389  -TGTPQTPLKN---LSLKDDFETSKKERLKRRFVDPIRGEKGCLAWLT--WRPKLVKT  440



>ref|XP_010935733.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Elaeis guineensis]
Length=475

 Score =   301 bits (771),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 157/236 (67%), Positives = 186/236 (79%), Gaps = 7/236 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            K+A DAA GL Y HE MDFQIIFRDFK+SNILLDE WNAKLSDFGLAR GP EGL+H+ST
Sbjct  240  KVAIDAARGLKYLHEDMDFQIIFRDFKTSNILLDEHWNAKLSDFGLARHGPSEGLSHVST  299

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT GYA+PEY++TG LT+K+DVWSYGV LYELITGR PLDRNRP+SEQKLLEWVKP+
Sbjct  300  AVVGTAGYAAPEYMRTGHLTAKSDVWSYGVVLYELITGRRPLDRNRPKSEQKLLEWVKPY  359

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD KKFR I+DPRLEG   LKSA KL  VANRCLVR+PKSRPKMSEVL+M+ +++E S 
Sbjct  360  ISDVKKFRLILDPRLEGQYSLKSATKLGSVANRCLVRNPKSRPKMSEVLEMVQRIVE-SM  418

Query  440  GIGDPRP----SIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLV-RIWSLKQLKT  288
              G P+P    SI   +   T+ +     KRRI D K+G+G  LV + W+ K ++T
Sbjct  419  ETGAPQPPLKSSISEEETSGTRKKRGLNLKRRIVDWKMGEGMRLVWQGWTPKLVRT  474



>ref|XP_008776800.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Phoenix 
dactylifera]
Length=428

 Score =   299 bits (766),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 186/236 (79%), Gaps = 8/236 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA DAA GL Y HE MDFQIIFRD K+SNILLDE WNAKLSDFGLAR GP EG TH+ST
Sbjct  194  RIALDAARGLTYLHEEMDFQIIFRDMKTSNILLDELWNAKLSDFGLARQGPAEGQTHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT+K+D+WSYGV LYELITGR P+DRNRP++EQKLL+WVKP+
Sbjct  254  AVVGTIGYAAPEYIQTGRLTAKSDIWSYGVVLYELITGRRPMDRNRPKAEQKLLDWVKPY  313

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE-AS  444
            +SD +KF  IIDPRLEG+  LKSA  L+ VAN+CL+R PKSRPKMSEVL M+  ++E   
Sbjct  314  ISDIRKFHMIIDPRLEGSYTLKSATNLAAVANKCLIRRPKSRPKMSEVLGMVQSIIENME  373

Query  443  TGIGDPRPSIVHSDPISTKDEVDRKG---KRRITDMKVGDGSWLV-RIWSLKQLKT  288
            TGI  P P     +  S  +E  ++G   KRRI D+KVG+G WLV + W+ K ++T
Sbjct  374  TGIPHPPPRSYLEETAS--EESKKRGLDWKRRIGDLKVGEGRWLVWQGWTQKLVRT  427



>emb|CDY41582.1| BnaC05g43190D [Brassica napus]
Length=308

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 184/232 (79%), Gaps = 3/232 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE M+FQIIFRDFKSSNILLDE W AKLSDFGLARLGP EGLTH+ST
Sbjct  79   RIAQDAARGLTYLHEQMEFQIIFRDFKSSNILLDENWKAKLSDFGLARLGPSEGLTHVST  138

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+QTGRLT K+DVW YGVF+YELITGR P+DRN+P+ EQKLLEWV+P+
Sbjct  139  DVVGTMGYAAPEYIQTGRLTYKSDVWGYGVFVYELITGRKPVDRNKPKGEQKLLEWVRPY  198

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD++KF  I+DPRLEG   LKS  KL++VANRCLVR+PK+RPKMSEVL+M+NK++EA +
Sbjct  199  LSDTRKFNLILDPRLEGKYPLKSVQKLAVVANRCLVRNPKARPKMSEVLEMVNKIVEAPS  258

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
              G   P +V    + T  +   K K+R  +   G+G W  ++W+ K ++ C
Sbjct  259  CSGT-SPQLVPLKSLETSRDAGGK-KKRGLENGGGEGGWFGKLWNPKTIRAC  308



>ref|XP_006593326.1| PREDICTED: protein kinase isoform X1 [Glycine max]
Length=483

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 189/233 (81%), Gaps = 8/233 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GL Y HE MDFQIIFRDFKSSNILLDE WNAKLSDFGLARLGP +GLTH+ST
Sbjct  248  KIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDELWNAKLSDFGLARLGPSDGLTHVST  307

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSK+DVWSYGVFLYELITGR P+DRNRP+ EQKLLEWV+P+
Sbjct  308  AVVGTMGYAAPEYVQTGRLTSKSDVWSYGVFLYELITGRRPIDRNRPKGEQKLLEWVRPY  367

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEA--  447
            LSD ++F+ I+DPRLE  +ILKSA KL+++ANRCLVR+PK+RPKMSEVL+M+ +V+E+  
Sbjct  368  LSDGRRFQLILDPRLERRHILKSAQKLAIIANRCLVRNPKNRPKMSEVLEMVTRVVESSV  427

Query  446  STGIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKT  288
            ST +  P  S+  ++     +  ++K    +T  +  D +WL R+W  K L+ 
Sbjct  428  STNLQPPLKSVASAEASQAAEIKNKK----VTKDQNPDCNWL-RMWRPKLLRA  475



>ref|XP_006398776.1| hypothetical protein EUTSA_v10013665mg [Eutrema salsugineum]
 gb|ESQ40229.1| hypothetical protein EUTSA_v10013665mg [Eutrema salsugineum]
Length=418

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/235 (62%), Positives = 185/235 (79%), Gaps = 8/235 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE MDFQIIFRDFKSSNILLDE W AKLSDFGLARLGP  G TH+ST
Sbjct  188  RIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDEDWKAKLSDFGLARLGPSPGSTHVST  247

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+QTGRLTSK+DVW YGVF+YELITGR PLDRNRP+ EQKLLEWV+P+
Sbjct  248  GVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDRNRPKGEQKLLEWVRPY  307

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            L+DSK+FR I+DPRLEG  ++K   +L++VAN CL R+PK+RPKMSEVLDM+ K++E+S+
Sbjct  308  LTDSKRFRLIVDPRLEGKYLIKPVQRLAVVANLCLARNPKTRPKMSEVLDMVTKIVESSS  367

Query  440  -GIGDPRPSIVHSDPISTKDEVDR--KGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
             G G  +  ++   P+ + +   R  +GK +   +   DG WL ++W+ K ++ C
Sbjct  368  PGNGSKKQQLI---PLKSLEAASRDVEGKNKKV-LDGDDGGWLEKLWNPKNVRAC  418



>ref|XP_010490808.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Camelina 
sativa]
Length=421

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 185/233 (79%), Gaps = 5/233 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE M+FQIIFRDFKSSNILLDE W AKLSDFGLARLGP  G +H+ST
Sbjct  192  RIAQDAARGLTYLHEEMNFQIIFRDFKSSNILLDENWKAKLSDFGLARLGPSPGSSHVST  251

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+QTGRLTSK+DVW YGVF+YELITGR PLDRN+P+ EQKLLEWV+P+
Sbjct  252  DVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDRNKPKGEQKLLEWVRPY  311

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+++FR I+DPRLEG  ++K   KL++VAN CL R+ K+RPKMSEVLDM+ K++EAS+
Sbjct  312  LSDTRRFRLIVDPRLEGKYMIKPVQKLAVVANLCLARNAKARPKMSEVLDMVTKIVEASS  371

Query  440  -GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
             G+G  +P +V   P+ ++     + ++    +  G+G WL ++W+ K ++ C
Sbjct  372  PGVGGKKPQLV---PLKSQGASRDEEEKNKKVLDGGEGGWLEKLWNPKNVRAC  421



>ref|NP_001235402.1| protein kinase [Glycine max]
 gb|ACM89571.1| protein kinase [Glycine max]
Length=491

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 189/233 (81%), Gaps = 8/233 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GL Y HE MDFQIIFRDFKSSNILLDE WNAKLSDFGLARLGP +GLTH+ST
Sbjct  256  KIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDELWNAKLSDFGLARLGPSDGLTHVST  315

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEYVQTGRLTSK+DVWSYGVFLYELITGR P+DRNRP+ EQKLLEWV+P+
Sbjct  316  AVVGTMGYAAPEYVQTGRLTSKSDVWSYGVFLYELITGRRPIDRNRPKGEQKLLEWVRPY  375

Query  617  LSDSKKFRQIIDPRLE-GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEA--  447
            LSD ++F+ I+DPRLE  +ILKSA KL+++ANRCLVR+PK+RPKMSEVL+M+ +V+E+  
Sbjct  376  LSDGRRFQLILDPRLERRHILKSAQKLAIIANRCLVRNPKNRPKMSEVLEMVTRVVESSV  435

Query  446  STGIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKT  288
            ST +  P  S+  ++     +  ++K    +T  +  D +WL R+W  K L+ 
Sbjct  436  STNLQPPLKSVASAEASQAAEIKNKK----VTKDQNPDCNWL-RMWRPKLLRA  483



>ref|XP_002882639.1| hypothetical protein ARALYDRAFT_478307 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58898.1| hypothetical protein ARALYDRAFT_478307 [Arabidopsis lyrata subsp. 
lyrata]
Length=418

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 165/186 (89%), Gaps = 1/186 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE M+FQIIFRDFKSSNILLDE W AKLSDFGLARLGP EGLTH+ST
Sbjct  194  RIAQDAARGLTYLHEEMEFQIIFRDFKSSNILLDEDWKAKLSDFGLARLGPSEGLTHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+QTGRLTSK+DVW YGVFLYELITGR P+DRNRP+ EQKLLEWV+P+
Sbjct  254  DVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFLYELITGRRPVDRNRPKGEQKLLEWVRPY  313

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD++KF+ I+DPRLEG   +KS  KL++VANRCLVR+ K+RPKMSEVL+M+ K++EAS+
Sbjct  314  LSDTRKFKLILDPRLEGKYPIKSVQKLAVVANRCLVRNSKARPKMSEVLEMVTKIVEASS  373

Query  440  GIGDPR  423
            G G P+
Sbjct  374  GNGSPQ  379



>ref|XP_004143264.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Cucumis 
sativus]
Length=398

 Score =   297 bits (761),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 173/203 (85%), Gaps = 4/203 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE +D QIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EG TH+ST
Sbjct  194  RIAQDAARGLTYLHEELDVQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPPEGFTHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            A+VGTMGYA+PEYVQTGRLTSK DVWSYGVFLYELITGR P+DRNRP+SEQKLLEWVKP+
Sbjct  254  AIVGTMGYAAPEYVQTGRLTSKTDVWSYGVFLYELITGRIPIDRNRPKSEQKLLEWVKPY  313

Query  617  LSDSKKFRQIIDPRLEG-NILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKF+ I+DPRL+G + +KSA+KLS VANRCLVR+PK+RPKMS++L+M++++ E  T
Sbjct  314  LSDTKKFQLILDPRLKGKSHIKSAYKLSNVANRCLVRNPKNRPKMSDILEMVSRIAETWT  373

Query  440  GIGDPRPSIVHSDPISTKDEVDR  372
              G+ +  +    P + K+   R
Sbjct  374  ETGNSQTPLA---PYTMKNSQGR  393



>ref|XP_002871026.1| hypothetical protein ARALYDRAFT_908199 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47285.1| hypothetical protein ARALYDRAFT_908199 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score =   298 bits (762),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 187/235 (80%), Gaps = 9/235 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE MDFQIIFRDFKSSNILLDE W AKLSDFGLARLGP  G +H+ST
Sbjct  191  RIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDENWKAKLSDFGLARLGPSPGSSHVST  250

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+QTGRLTSK+DVW YGVF+YELITGR PLDRN+P+ EQKLLEWV+P+
Sbjct  251  DVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDRNKPKGEQKLLEWVRPY  310

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+++FR I+DPRLEG  ++K   KL++VAN CL R+ K+RPKMSEVL+M+ K++EAS+
Sbjct  311  LSDTRRFRLIVDPRLEGKYMIKPVQKLAVVANLCLTRNAKARPKMSEVLEMVTKIVEASS  370

Query  440  -GIGDPRPSIVHSDPISTKD--EVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
             G G  +P +V   P+ +++   V+    +++ D   G+G WL ++W+ K ++ C
Sbjct  371  PGNGGKKPQLV---PLKSQEASRVEEGKNKKVLDG--GEGGWLEKLWNPKNVRAC  420



>ref|NP_195952.1| protein kinase family protein [Arabidopsis thaliana]
 emb|CAB83288.1| protein kinase-like [Arabidopsis thaliana]
 dbj|BAB08392.1| protein serine/threonine kinase [Arabidopsis thaliana]
 gb|ABI49463.1| At5g03320 [Arabidopsis thaliana]
 gb|AED90584.1| protein kinase family protein [Arabidopsis thaliana]
Length=420

 Score =   298 bits (762),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 187/235 (80%), Gaps = 9/235 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE MDFQIIFRDFKSSNILLDE W AKLSDFGLARLGP  G +H+ST
Sbjct  191  RIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDENWTAKLSDFGLARLGPSPGSSHVST  250

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+QTGRLTSK+DVW YGVF+YELITGR PLDRN+P+ EQKLLEWV+P+
Sbjct  251  DVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDRNKPKGEQKLLEWVRPY  310

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+++FR I+DPRLEG  ++KS  KL++VAN CL R+ K+RPKMSEVL+M+ K++EAS+
Sbjct  311  LSDTRRFRLIVDPRLEGKYMIKSVQKLAVVANLCLTRNAKARPKMSEVLEMVTKIVEASS  370

Query  440  -GIGDPRPSIVHSDPISTKD--EVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
             G G  +P +V   P+ +++   V+    +++ D    +G WL ++W+ K ++ C
Sbjct  371  PGNGGKKPQLV---PLKSQETSRVEEGKNKKVLDG--AEGGWLEKLWNPKNVRAC  420



>ref|XP_004149901.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Cucumis 
sativus]
Length=430

 Score =   297 bits (761),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 149/236 (63%), Positives = 186/236 (79%), Gaps = 8/236 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY HEGMDFQIIFRDFKSSNILLD+QWNAKLSDFGLARLGP +GL+H+ST
Sbjct  198  KIAQDTARGLAYLHEGMDFQIIFRDFKSSNILLDDQWNAKLSDFGLARLGPSDGLSHVST  257

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            A+VGT+GYA+PEY+QTGRLT+K DVWSYGVFLYELITGR PLDRNRP+ EQKLLEWV+PH
Sbjct  258  AIVGTIGYAAPEYLQTGRLTAKIDVWSYGVFLYELITGRRPLDRNRPKGEQKLLEWVRPH  317

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEA--  447
            LSD KKF  I+DPRL G   +K+A+KL+ VA+RCLVR   +RPKMSEVL+M+N++++   
Sbjct  318  LSDLKKFELILDPRLGGKYSIKAAYKLAAVASRCLVRKAAARPKMSEVLEMVNRIMDGFN  377

Query  446  -STGIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRI-WSLKQLKTC  285
              + +   + S  +SD   +K E  RK   RI +  +G+   L+ + W  K ++TC
Sbjct  378  LESPLIPEKSSTSNSDSEGSKSESLRK---RILNPFIGENGCLICLSWRPKVVRTC  430



>emb|CDY22206.1| BnaC01g38950D [Brassica napus]
Length=452

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 177/213 (83%), Gaps = 4/213 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE M+FQIIFRDFKSSNILLDE W AKLSDFGLARLGP EGLTH++T
Sbjct  219  RIAQDAARGLTYLHEQMEFQIIFRDFKSSNILLDEDWKAKLSDFGLARLGPSEGLTHVTT  278

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY++TGRLTSK+DVW YGVF+YELITGR P+DRN+P  EQKLLEWV+P+
Sbjct  279  DVVGTMGYAAPEYIKTGRLTSKSDVWGYGVFIYELITGRRPVDRNKPNGEQKLLEWVRPY  338

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKF+ I+DPRLEG   LK+  KLS+VANRCLVR+PK+RPKMSEVL+M+ K++EA +
Sbjct  339  LSDTKKFKLILDPRLEGKYNLKAVQKLSVVANRCLVRNPKARPKMSEVLEMVTKIVEAPS  398

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMK  342
            G G   P +V S  + T  +V   GK+++ + +
Sbjct  399  GSGTS-PQLVPSKSLETSRDVG--GKKKVLETR  428



>gb|KJB60555.1| hypothetical protein B456_009G312200 [Gossypium raimondii]
Length=427

 Score =   296 bits (759),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 186/235 (79%), Gaps = 10/235 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIARDAA GLA+ HE MDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GL+H+ST
Sbjct  199  KIARDAARGLAFLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLSHVST  258

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT K+DVWSYGVFLYELITGR PLDRNRP+ E+KLLEWV+PH
Sbjct  259  AVVGTIGYAAPEYIQTGRLTIKSDVWSYGVFLYELITGRRPLDRNRPKGEEKLLEWVRPH  318

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +S+ KKFR IIDPRL+G   LKSAHKL+ VAN+CL R  K RPKMSEVL+M++ ++E++ 
Sbjct  319  ISNIKKFRLIIDPRLDGKYSLKSAHKLAAVANKCLTRQAKLRPKMSEVLEMVDGIVESAE  378

Query  440  GI---GDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
             +    D + S ++++   +K E  R   RR+ D+  G    L  +W  K + TC
Sbjct  379  MVMPQSDLKCSNLNTNFKLSKTESLR---RRLLDLIPGGKGCL--MWP-KIVTTC  427



>ref|XP_008456511.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Cucumis 
melo]
Length=430

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/236 (63%), Positives = 184/236 (78%), Gaps = 8/236 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY HEGMDFQIIFRDFKSSNILLD+QWNAKLSDFGLARLGP +GL+H+ST
Sbjct  198  KIAQDTARGLAYLHEGMDFQIIFRDFKSSNILLDDQWNAKLSDFGLARLGPSDGLSHVST  257

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            A+VGT+GYA+PEY+QTGRLT+K DVWSYGVFLYELITGR PLDRNRP+ EQKLLEWV+PH
Sbjct  258  AIVGTIGYAAPEYLQTGRLTAKIDVWSYGVFLYELITGRRPLDRNRPKGEQKLLEWVRPH  317

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF  I+DPRL G    K+A+KL+ VA+RCLVR   +RPKMSEVL+M+N++++   
Sbjct  318  LSDLKKFELILDPRLGGKYSTKAAYKLAAVASRCLVRKAAARPKMSEVLEMVNRIVD---  374

Query  440  GIGDPRPSIVHSDPISTKD-EVDRKG--KRRITDMKVGDGSWLVRI-WSLKQLKTC  285
            G+    P I      S  D E  + G  ++RI +  +G+   L+ + W  K ++TC
Sbjct  375  GVNLESPLIPEKSSTSNNDFEGSKSGSLRKRIMNPFIGENGCLICLSWRPKVVRTC  430



>ref|XP_002312001.1| kinase family protein [Populus trichocarpa]
 gb|EEE89368.1| kinase family protein [Populus trichocarpa]
Length=403

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/233 (64%), Positives = 186/233 (80%), Gaps = 12/233 (5%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQIIFRD KSSNILLD+QWNAKLSDFGLARLGP +GL+H+ST
Sbjct  177  KIAQDAARGLAYLHEGMDFQIIFRDVKSSNILLDDQWNAKLSDFGLARLGPSDGLSHVST  236

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY++TGRLTSK+DVWS+GVFLYELITGR PLDRNRP++EQKLLEWV+PH
Sbjct  237  AVVGTIGYAAPEYIRTGRLTSKSDVWSFGVFLYELITGRRPLDRNRPKNEQKLLEWVRPH  296

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LS ++KFR I+DPRLEG   +K+A KL+ VAN CLVR  K+RPKMSE+L+M+NK+++ +T
Sbjct  297  LSGARKFRLILDPRLEGKYNIKTAQKLAAVANCCLVRQAKTRPKMSEILEMINKIVD-TT  355

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRI----TDMKVGD-GSWLVRIWSLKQ  297
              G P   ++    ++ KD  +R  + RI     D  +G+ G W    W  +Q
Sbjct  356  DNGSP---LLPMKSLAPKDAPERSKRERIKMRFVDPIIGESGCW--SAWRTRQ  403



>gb|EYU39624.1| hypothetical protein MIMGU_mgv1a007133mg [Erythranthe guttata]
Length=418

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 147/222 (66%), Positives = 177/222 (80%), Gaps = 5/222 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            K+A+DAA GL Y HEGM+FQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GL+H+ST
Sbjct  196  KVAQDAARGLTYLHEGMEFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPADGLSHVST  255

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLTSK+DVWSYG+FLYELITGR P DRNRP+ EQKLL+WV+ H
Sbjct  256  AVVGTVGYAAPEYIQTGRLTSKSDVWSYGIFLYELITGRRPFDRNRPKDEQKLLDWVRNH  315

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKF +I+DPRL G   LKSA KL+ +A+RCLVRHPK+RPKMSEVL M+N V++++ 
Sbjct  316  LSDAKKFERILDPRLNGKYELKSAQKLAAIASRCLVRHPKNRPKMSEVLKMVNIVVDSAE  375

Query  440  GIGDP--RPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWL  321
               D   R  I+  D   T +E     KRR  +  + D   L
Sbjct  376  NADDAVDRSPILDIDEKKTGEE--ESWKRRFLEHLMRDNKCL  415



>ref|XP_006407633.1| hypothetical protein EUTSA_v10020792mg [Eutrema salsugineum]
 gb|ESQ49086.1| hypothetical protein EUTSA_v10020792mg [Eutrema salsugineum]
Length=426

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 148/234 (63%), Positives = 185/234 (79%), Gaps = 4/234 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE M+FQIIFRDFKSSNILLDE W AKLSDFGLARLGP EGLTH+ST
Sbjct  194  RIAQDAARGLTYLHEQMEFQIIFRDFKSSNILLDEDWKAKLSDFGLARLGPSEGLTHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+ TGRLTSK+DVW YGVF+YELITGR P+DRN+P+ EQKLLEWV+P+
Sbjct  254  DVVGTMGYAAPEYIHTGRLTSKSDVWGYGVFIYELITGRRPVDRNKPKGEQKLLEWVRPY  313

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD++KF+ I+DPRLEG   LKS  KL++VANRCLVR+PK+RPKMSEVL+M+ K++EA +
Sbjct  314  LSDTRKFKLILDPRLEGKYPLKSVQKLAVVANRCLVRNPKARPKMSEVLEMVTKIVEAPS  373

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRIT--DMKVGDGSWLVRIWSLKQLKTC  285
            G G   P +V    + T  +   K KR +   +   G+G W  ++W+ K ++ C
Sbjct  374  GSG-INPQLVPLKSLETSRDAGGKKKRVLETRNNGGGEGGWFGKLWNPKTIRAC  426



>gb|KGN47838.1| hypothetical protein Csa_6G406010 [Cucumis sativus]
Length=437

 Score =   295 bits (755),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 149/236 (63%), Positives = 186/236 (79%), Gaps = 8/236 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY HEGMDFQIIFRDFKSSNILLD+QWNAKLSDFGLARLGP +GL+H+ST
Sbjct  205  KIAQDTARGLAYLHEGMDFQIIFRDFKSSNILLDDQWNAKLSDFGLARLGPSDGLSHVST  264

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            A+VGT+GYA+PEY+QTGRLT+K DVWSYGVFLYELITGR PLDRNRP+ EQKLLEWV+PH
Sbjct  265  AIVGTIGYAAPEYLQTGRLTAKIDVWSYGVFLYELITGRRPLDRNRPKGEQKLLEWVRPH  324

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEA--  447
            LSD KKF  I+DPRL G   +K+A+KL+ VA+RCLVR   +RPKMSEVL+M+N++++   
Sbjct  325  LSDLKKFELILDPRLGGKYSIKAAYKLAAVASRCLVRKAAARPKMSEVLEMVNRIMDGFN  384

Query  446  -STGIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRI-WSLKQLKTC  285
              + +   + S  +SD   +K E  RK   RI +  +G+   L+ + W  K ++TC
Sbjct  385  LESPLIPEKSSTSNSDSEGSKSESLRK---RILNPFIGENGCLICLSWRPKVVRTC  437



>emb|CDX70313.1| BnaA10g26620D [Brassica napus]
Length=429

 Score =   295 bits (754),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 184/232 (79%), Gaps = 6/232 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE MDFQIIFRDFKSSNILLDE W AKLSDFGLARLGP+ G TH+ST
Sbjct  203  RIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDEDWKAKLSDFGLARLGPEPGSTHVST  262

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+QTGRLTSK+DVW YGVF+YELITGR PLD+NRP+ EQKLLEWV+P+
Sbjct  263  GVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDKNRPKGEQKLLEWVRPY  322

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            L+D+KKFR IIDPRLEG  ++K   +L++VAN CL R+PK+RPKMSEVL+M+ K++E S+
Sbjct  323  LTDTKKFRLIIDPRLEGKYLIKPVQRLAVVANLCLARNPKARPKMSEVLEMVTKIVETSS  382

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
                 +  ++    +S +DE ++  K  + D   G+G WL ++W+ K ++ C
Sbjct  383  PRSGGKKQLLPLRSLS-RDEEEKSNK--VVDG--GEGGWLDKLWNPKNVRAC  429



>gb|KGN48176.1| hypothetical protein Csa_6G446370 [Cucumis sativus]
Length=475

 Score =   296 bits (758),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 173/203 (85%), Gaps = 4/203 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE +D QIIFRDFKSSNILLDEQWNAKLSDFGLARLGP EG TH+ST
Sbjct  271  RIAQDAARGLTYLHEELDVQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPPEGFTHVST  330

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            A+VGTMGYA+PEYVQTGRLTSK DVWSYGVFLYELITGR P+DRNRP+SEQKLLEWVKP+
Sbjct  331  AIVGTMGYAAPEYVQTGRLTSKTDVWSYGVFLYELITGRIPIDRNRPKSEQKLLEWVKPY  390

Query  617  LSDSKKFRQIIDPRLEG-NILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKF+ I+DPRL+G + +KSA+KLS VANRCLVR+PK+RPKMS++L+M++++ E  T
Sbjct  391  LSDTKKFQLILDPRLKGKSHIKSAYKLSNVANRCLVRNPKNRPKMSDILEMVSRIAETWT  450

Query  440  GIGDPRPSIVHSDPISTKDEVDR  372
              G+ +  +    P + K+   R
Sbjct  451  ETGNSQTPLA---PYTMKNSQGR  470



>ref|XP_008365181.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Malus 
domestica]
Length=432

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 182/225 (81%), Gaps = 9/225 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY HEGM+FQIIFRDFKSSNILLDEQWNAKLSDFG+ARLGP +GL+H+ST
Sbjct  198  KIAQDTARGLAYLHEGMEFQIIFRDFKSSNILLDEQWNAKLSDFGMARLGPSDGLSHVST  257

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LTSK+DVWSYGVFL ELITGR P+DRNRP++EQKL+EWV+PH
Sbjct  258  AVVGTVGYAAPEYIQTGHLTSKSDVWSYGVFLLELITGRRPVDRNRPKNEQKLMEWVRPH  317

Query  617  L-SDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAS  444
            L SD KKFR I+DPRLEG   +K+A KL+ VA+RCLVR PKSRPKMSEVL+M+N+++E +
Sbjct  318  LSSDPKKFRVILDPRLEGKYSIKAAQKLATVASRCLVRAPKSRPKMSEVLEMVNRIME-T  376

Query  443  TGIGDPRPSIVHSDPISTKDEVDRKGK----RRITDMKVGDGSWL  321
            T +G P   + + D  S +D      +    RR+ D  +G+   L
Sbjct  377  TDMGSPELPLHNVD--SKEDYFGESKRESLMRRLVDPFIGENCCL  419



>emb|CDY10387.1| BnaCnng02880D [Brassica napus]
Length=435

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 184/232 (79%), Gaps = 6/232 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE MDFQIIFRDFKSSNILLDE W AKLSDFGLARLGP+ G TH+ST
Sbjct  209  RIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDEDWKAKLSDFGLARLGPEPGSTHVST  268

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+QTGRLTSK+DVW YGVF+YELITGR PLD+NRP+ EQKLLEWV+P+
Sbjct  269  GVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDKNRPKGEQKLLEWVRPY  328

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKFR IIDPRLEG  ++K   +L+++AN CL R+PK+RPKMSEVL+M+ K++E S+
Sbjct  329  LSDTKKFRLIIDPRLEGKYLIKPIQRLAVLANLCLARNPKARPKMSEVLEMVTKIVETSS  388

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
                 +  ++    +S +DE ++  K  + D   G+G WL ++W+ K ++ C
Sbjct  389  PRSGGKKQLLPLRSLS-RDEEEKSNK--VVDG--GEGGWLDKLWNPKNVRAC  435



>ref|XP_009368900.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Pyrus 
x bretschneideri]
Length=432

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/230 (64%), Positives = 187/230 (81%), Gaps = 14/230 (6%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY HEGM+FQIIFRDFKSSNILLDEQWNAKLSDFG+ARLGP +GL+H+ST
Sbjct  198  KIAQDTARGLAYLHEGMEFQIIFRDFKSSNILLDEQWNAKLSDFGMARLGPSDGLSHVST  257

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLTSK+DVWSYG+FL ELITGR P+DRNRP++EQKL+EWV+PH
Sbjct  258  AVVGTVGYAAPEYIQTGRLTSKSDVWSYGIFLLELITGRRPVDRNRPKNEQKLMEWVRPH  317

Query  617  L-SDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAS  444
            L SD KKF+ I+DPRLEG   LK+A KL+ VA+RCLVR PKSRPKMSEVL+ +N+++E +
Sbjct  318  LSSDLKKFQLILDPRLEGKYSLKAAQKLATVASRCLVRAPKSRPKMSEVLETVNRIME-T  376

Query  443  TGIGDPRPSIVHSDPISTKDEVDRKGK-----RRITDMKVGDG---SWLV  318
            T +G P   + + D   +K++   + K     RR+ D  +G+    +WL+
Sbjct  377  TDMGSPELPLHNVD---SKEDYFAESKRESLMRRLVDPFIGENCCFNWLI  423



>gb|AAF43496.1|AF131222_1 protein serine/threonine kinase [Lophopyrum elongatum]
 gb|AAK11674.1|AF339747_1 protein kinase [Lophopyrum elongatum]
Length=433

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/236 (64%), Positives = 186/236 (79%), Gaps = 9/236 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            ++A D A GL Y HE  +F+IIFRD K SNILLDE WNAKLSDFGLARLGPQEG +H+ST
Sbjct  200  RVALDTARGLKYLHEDSEFKIIFRDLKPSNILLDENWNAKLSDFGLARLGPQEG-SHVST  258

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+ TGRL+SKND+WSYGV LYEL+TGR PLDRNRPR EQ L+EWVKP+
Sbjct  259  AVVGTIGYAAPEYIHTGRLSSKNDIWSYGVVLYELLTGRRPLDRNRPRGEQNLVEWVKPY  318

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
             SD+KKF  I+DPRLEGN  LKSA +++ +AN+CLVRH + RPKMSEVL+M+ K+++ S+
Sbjct  319  SSDTKKFETIMDPRLEGNYNLKSAARIASLANKCLVRHARYRPKMSEVLEMVQKIVD-SS  377

Query  440  GIGDP-RPSIVHSDPISTKDEVDRKG---KRRITDMKVGDGSWLV-RIWSLKQLKT  288
             +G P RP I HS  +++ DE  RKG   KRRI D+K GDG W     W+ K ++T
Sbjct  378  DLGTPERPLISHSKKLAS-DEKKRKGLNLKRRIADIKAGDGRWFRWHKWTPKLVRT  432



>emb|CDY41315.1| BnaA01g32040D [Brassica napus]
Length=434

 Score =   293 bits (750),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 162/183 (89%), Gaps = 1/183 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE M+FQIIFRDFKSSNILLDE W AKLSDFGLARLGP EGLTH++T
Sbjct  210  RIAQDAARGLTYLHEQMEFQIIFRDFKSSNILLDEDWKAKLSDFGLARLGPSEGLTHVTT  269

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY++TGRLTSK+DVW YGVF+YELITGR P+DRN+P  EQKLLEWV+P+
Sbjct  270  DVVGTMGYAAPEYIKTGRLTSKSDVWGYGVFIYELITGRRPVDRNKPNGEQKLLEWVRPY  329

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKF+ I+DPRLEG   LK+  KLS+VANRCLVR+PK+RPKMSEVL+M+ K++EA +
Sbjct  330  LSDTKKFKLILDPRLEGKYNLKAVQKLSVVANRCLVRNPKARPKMSEVLEMVTKIVEAPS  389

Query  440  GIG  432
            G G
Sbjct  390  GSG  392



>ref|XP_009123163.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Brassica 
rapa]
 ref|XP_009123166.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Brassica 
rapa]
Length=428

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 184/235 (78%), Gaps = 5/235 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE M+FQIIFRDFKSSNILLDE W AKLSDFGLARLGP EGLTH++T
Sbjct  195  RIAQDAARGLTYLHEQMEFQIIFRDFKSSNILLDEDWKAKLSDFGLARLGPSEGLTHVTT  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY++TGRLTSK+DVW YGVF+YELITGR P+DRN+P  EQKLLEWV+ +
Sbjct  255  DVVGTMGYAAPEYIKTGRLTSKSDVWGYGVFIYELITGRRPVDRNKPNGEQKLLEWVRHY  314

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD+KKF+ I+DPRLEG   LK+  KLS+VANRCLVR+PK+RPKMSEVL+M+ K++EA +
Sbjct  315  LSDTKKFKLILDPRLEGKYNLKAVQKLSVVANRCLVRNPKARPKMSEVLEMVTKIVEAPS  374

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRI---TDMKVGDGSWLVRIWSLKQLKTC  285
            G G   P +V    + T  +V  K K+ +    +   G+G W  ++W+ K +  C
Sbjct  375  GSGTS-PQLVPLKSLETSRDVGGKKKKVLETRNNGGGGEGGWFGKLWNPKAVGAC  428



>ref|XP_011031711.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Populus euphratica]
 ref|XP_011031712.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Populus euphratica]
Length=426

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 186/233 (80%), Gaps = 12/233 (5%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HEGMDFQIIFRD KSSNILLD+QWNAKLSDFGLARLGP +GL+H+ST
Sbjct  200  KIAQDAARGLAYLHEGMDFQIIFRDVKSSNILLDDQWNAKLSDFGLARLGPSDGLSHVST  259

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY++TGRLTSK+DVWS+GVFLYELITGR PLDRNRP++EQKLLEWV+PH
Sbjct  260  AVVGTIGYAAPEYIRTGRLTSKSDVWSFGVFLYELITGRRPLDRNRPKNEQKLLEWVRPH  319

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            L+ ++KFR I+DPRL+G   +K+A KL+ VAN CLVR  K+RPKMSE+L+M+NK+++ +T
Sbjct  320  LTGARKFRLILDPRLDGKYNIKTAQKLAAVANCCLVRQAKTRPKMSEILEMINKIVD-TT  378

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRI----TDMKVGD-GSWLVRIWSLKQ  297
              G P   ++    ++ KD  +R   +RI     D  +G+ G W    W  +Q
Sbjct  379  DNGSP---LLPMKILAPKDAPERSKSKRIKMRFVDPIIGESGCW--SAWRTRQ  426



>emb|CDY44629.1| BnaC04g06330D [Brassica napus]
Length=424

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/232 (62%), Positives = 181/232 (78%), Gaps = 9/232 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY H+GM+FQIIFRDFKSSNILLDE WNAKLSDFGLAR+GP +G+TH+ST
Sbjct  191  KIAQDTARGLAYLHQGMEFQIIFRDFKSSNILLDENWNAKLSDFGLARMGPSKGVTHVST  250

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LT+K+DVWSYG+FLYELITGR P DRNRPR+EQ +LEW++PH
Sbjct  251  AVVGTIGYAAPEYIQTGHLTAKSDVWSYGIFLYELITGRRPFDRNRPRNEQNILEWIRPH  310

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            L+D KKF+ IIDPRLEGN  LKSA KL+ VANRCL+   K+RP MSEV +ML +++E+S 
Sbjct  311  LTDIKKFKMIIDPRLEGNYYLKSALKLAAVANRCLMVKAKARPTMSEVSEMLERIVESSE  370

Query  440  GIGDPRPSIVHSDPISTKDEVD----RKGKRRITDMKVG-DGSWLVRIWSLK  300
             +    P+++    ++ KD  +     K KRR  ++  G +G   +  WS K
Sbjct  371  EVS---PALLLVKSLTPKDAFEASRREKVKRRFVELVTGVNGCPNLPTWSPK  419



>ref|XP_009386350.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=424

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/234 (62%), Positives = 180/234 (77%), Gaps = 4/234 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            ++A DAA GL + HE MDFQIIFRDFK+SNILLDE WNAKLSDFGLAR GP EGL+H+ST
Sbjct  192  RVALDAARGLTHLHEEMDFQIIFRDFKASNILLDEDWNAKLSDFGLARQGPAEGLSHVST  251

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT GYA+PEY+QTGRLT+K+D+WSYGVFLY LITGR P+D+NRP+ EQKLLEWV+P+
Sbjct  252  AVVGTFGYAAPEYMQTGRLTAKSDIWSYGVFLYVLITGRQPIDKNRPKGEQKLLEWVRPY  311

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            ++D KK R I+DP+LEG+  LKSA KL  VANRCLVR PKSRPKMS+VL+M+ +++E ST
Sbjct  312  ITDVKKIRIIMDPKLEGDYSLKSASKLVTVANRCLVRQPKSRPKMSDVLEMVQRIIE-ST  370

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG-KRRITDMKVGDGSWLV-RIWSLKQLKTC  285
              G P   +          E  +KG KR I D K+G+   L  + W  K ++TC
Sbjct  371  ETGAPEAPLRSCSEKGKPGETKKKGVKRIIGDWKMGENMRLAWQGWKAKLVRTC  424



>ref|XP_009386349.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=427

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/234 (62%), Positives = 180/234 (77%), Gaps = 4/234 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            ++A DAA GL + HE MDFQIIFRDFK+SNILLDE WNAKLSDFGLAR GP EGL+H+ST
Sbjct  195  RVALDAARGLTHLHEEMDFQIIFRDFKASNILLDEDWNAKLSDFGLARQGPAEGLSHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT GYA+PEY+QTGRLT+K+D+WSYGVFLY LITGR P+D+NRP+ EQKLLEWV+P+
Sbjct  255  AVVGTFGYAAPEYMQTGRLTAKSDIWSYGVFLYVLITGRQPIDKNRPKGEQKLLEWVRPY  314

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            ++D KK R I+DP+LEG+  LKSA KL  VANRCLVR PKSRPKMS+VL+M+ +++E ST
Sbjct  315  ITDVKKIRIIMDPKLEGDYSLKSASKLVTVANRCLVRQPKSRPKMSDVLEMVQRIIE-ST  373

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG-KRRITDMKVGDGSWLV-RIWSLKQLKTC  285
              G P   +          E  +KG KR I D K+G+   L  + W  K ++TC
Sbjct  374  ETGAPEAPLRSCSEKGKPGETKKKGVKRIIGDWKMGENMRLAWQGWKAKLVRTC  427



>gb|KJB60556.1| hypothetical protein B456_009G312200 [Gossypium raimondii]
Length=426

 Score =   290 bits (742),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 151/235 (64%), Positives = 185/235 (79%), Gaps = 11/235 (5%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIARDAA GLA+ HE MDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GL+H+ST
Sbjct  199  KIARDAARGLAFLHEEMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLSHVST  258

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AV GT+GYA+PEY+QTGRLT K+DVWSYGVFLYELITGR PLDRNRP+ E+KLLEWV+PH
Sbjct  259  AV-GTIGYAAPEYIQTGRLTIKSDVWSYGVFLYELITGRRPLDRNRPKGEEKLLEWVRPH  317

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +S+ KKFR IIDPRL+G   LKSAHKL+ VAN+CL R  K RPKMSEVL+M++ ++E++ 
Sbjct  318  ISNIKKFRLIIDPRLDGKYSLKSAHKLAAVANKCLTRQAKLRPKMSEVLEMVDGIVESAE  377

Query  440  GI---GDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
             +    D + S ++++   +K E  R   RR+ D+  G    L  +W  K + TC
Sbjct  378  MVMPQSDLKCSNLNTNFKLSKTESLR---RRLLDLIPGGKGCL--MWP-KIVTTC  426



>ref|XP_009122715.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Brassica 
rapa]
Length=429

 Score =   290 bits (742),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 142/232 (61%), Positives = 183/232 (79%), Gaps = 6/232 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE MDFQIIFRDFKSSNILLDE W AKLSDFGLARLGP+ G TH+ST
Sbjct  203  RIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDEDWKAKLSDFGLARLGPEPGSTHVST  262

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+QTGRLTSK+DVW YGVF+YELITGR PLD+NRP+ EQKLLEWV+P+
Sbjct  263  GVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDKNRPKGEQKLLEWVRPY  322

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            L+D+K+FR IID RLEG  ++K   +L++VAN CL R+PK+RPKMSEVL+M+ K++E S+
Sbjct  323  LTDTKRFRIIIDTRLEGKYLIKPVQRLAVVANLCLARNPKARPKMSEVLEMVTKIVETSS  382

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
                 +  ++    +S +DE ++  K  + D   G+G WL ++W+ K ++ C
Sbjct  383  PRSGGKKQLLPLRSLS-RDEEEKSNK--VVDG--GEGGWLDKLWNPKNVRAC  429



>dbj|BAK01480.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   290 bits (742),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 148/236 (63%), Positives = 185/236 (78%), Gaps = 9/236 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            ++A D A GL Y HE  +F+IIFRD K SNILLDE WNAKLSDFGLARLGPQEG +H+ST
Sbjct  201  RVALDTARGLKYLHEDSEFKIIFRDLKPSNILLDENWNAKLSDFGLARLGPQEG-SHVST  259

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+ TGRL+SKND+WSYGV LYEL+TGR PLDRNRPR EQ L+EWVKP+
Sbjct  260  AVVGTIGYAAPEYIHTGRLSSKNDIWSYGVVLYELLTGRRPLDRNRPRGEQNLVEWVKPY  319

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
             SD+KKF  I+DPRLEGN  LKSA K++ +AN+CLVR+ + RPKMSEVL+M+ K+++ S+
Sbjct  320  SSDTKKFETIMDPRLEGNYSLKSAAKIASLANKCLVRNARYRPKMSEVLEMVQKIVD-SS  378

Query  440  GIGDPR-PSIVHSDPISTKDEVDRKG---KRRITDMKVGDGSWLV-RIWSLKQLKT  288
             +G P  P I HS  +++ DE  +KG   KRRI D+K GDG W     W+ K ++T
Sbjct  379  DLGTPEHPLISHSKELAS-DEKKKKGLDLKRRIADIKAGDGRWFTWHKWTPKLVRT  433



>dbj|BAJ91599.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96520.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   290 bits (743),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 183/235 (78%), Gaps = 5/235 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            K+A DAA GL Y HE MDFQ+IFRD K+SNILLDE WNAKLSDFGLAR GPQEGL+H+ST
Sbjct  205  KVALDAARGLKYLHEEMDFQVIFRDLKTSNILLDENWNAKLSDFGLARHGPQEGLSHVST  264

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT+K+D+W YGV LYELITGR P+DRNRP+SEQKLL+WVKP+
Sbjct  265  AVVGTLGYAAPEYMQTGRLTAKSDIWGYGVLLYELITGRRPIDRNRPKSEQKLLDWVKPY  324

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD K+F  I+DPRLEG+  LKS  KL+ VANRCL+R PKSRPKMSEV +M+ K+++ S 
Sbjct  325  ISDVKRFPIIVDPRLEGHYNLKSMTKLAGVANRCLLRMPKSRPKMSEVYEMVQKIVD-SV  383

Query  440  GIGDPRPSIVHSDPISTKD-EVDRKG--KRRITDMKVGDGSWLVRIWSLKQLKTC  285
             IG P P + +   +S    +  +KG  KRR+ + K G    + R W  + +KTC
Sbjct  384  EIGPPEPPLHYHGSVSGPGAKRTKKGSLKRRLQEFKFGCRQIVWRGWKPEIIKTC  438



>gb|EYU38549.1| hypothetical protein MIMGU_mgv1a022350mg, partial [Erythranthe 
guttata]
Length=344

 Score =   287 bits (734),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 160/183 (87%), Gaps = 4/183 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA D A GLAY HE MDFQIIFRDFKSSNILLDE WNAKLSDFGLARLGP EGLTH+ST
Sbjct  162  RIALDTARGLAYLHEEMDFQIIFRDFKSSNILLDENWNAKLSDFGLARLGPTEGLTHVST  221

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY++TG LTSK+DVWSYGVFLYELITGR PL+RNRP++EQKLLEW++P+
Sbjct  222  AVVGTMGYAAPEYIRTGHLTSKSDVWSYGVFLYELITGRRPLERNRPKNEQKLLEWIQPY  281

Query  617  LSDSKKFRQIIDPRLE--GNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNK--VLE  450
            +SD KKF+QI+DPR+E    +LKSA KLSLVAN CL R PK RPKMSE+ +M+ +  V+E
Sbjct  282  ISDGKKFQQILDPRIERGTQVLKSAQKLSLVANCCLTRLPKKRPKMSEITEMVREVAVVE  341

Query  449  AST  441
            AST
Sbjct  342  AST  344



>ref|XP_010918688.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Elaeis guineensis]
 ref|XP_010918689.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Elaeis guineensis]
Length=427

 Score =   289 bits (740),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 182/235 (77%), Gaps = 7/235 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            + A DAA GL Y HE  DFQIIFRD K+SNILLDE WNAKLSDFGLAR GP EG +H+ST
Sbjct  194  RTALDAARGLTYLHEETDFQIIFRDMKTSNILLDEHWNAKLSDFGLARQGPAEGQSHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AV+GT+GYA+PEY+QTGRLT+K+D+WSYGV LYELITGR P+DRNRPR+EQKLL WVKP+
Sbjct  254  AVMGTIGYAAPEYIQTGRLTAKSDIWSYGVVLYELITGRRPMDRNRPRAEQKLLNWVKPY  313

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE-AS  444
            +SD +KF  I+DPRLEGN  LKSA KL+ VANRCL+R+PKSRP+MSEVL+M+  ++E   
Sbjct  314  ISDIRKFHMIVDPRLEGNYTLKSATKLAAVANRCLIRYPKSRPRMSEVLEMVQSIIENME  373

Query  443  TGIGDPRPSIVHSDPISTKDEVDRKG---KRRITDMKVGDGSWLVRIWSLKQLKT  288
            TG  +P P     +  +T +E  ++G   KRRI D+KV     + + W+ K ++T
Sbjct  374  TGTPNPPPRGYLEE--TTSEESTKRGLDLKRRIRDLKVEGRRLVWQGWTPKLVRT  426



>ref|XP_002879784.1| hypothetical protein ARALYDRAFT_482930 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56043.1| hypothetical protein ARALYDRAFT_482930 [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 172/218 (79%), Gaps = 2/218 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY HEGM+FQIIFRDFKSSNILLDE WNAKLSDFGLAR+GP +G+TH+ST
Sbjct  176  KIAQDTARGLAYLHEGMEFQIIFRDFKSSNILLDENWNAKLSDFGLARMGPSDGITHVST  235

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LT+K+DVWSYG+FLYELITGR P DRNRPR+EQ +LEW++PH
Sbjct  236  AVVGTIGYAAPEYIQTGHLTAKSDVWSYGIFLYELITGRRPFDRNRPRNEQNILEWIRPH  295

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ IIDPRLEGN  LKSA KL+ VANRCL+   K+RP MS+V +ML +++E S 
Sbjct  296  LSDIKKFKMIIDPRLEGNYYLKSALKLAAVANRCLMVKAKARPTMSQVSEMLERIVETSD  355

Query  440  GIGDPRPSIVHSDPISTKDEVDR-KGKRRITDMKVGDG  330
                  P +    P +  +   R + KRR  ++ +G+ 
Sbjct  356  DAPSGLPLMKSLTPKAAFEASRRERVKRRFVELLIGEN  393



>ref|XP_006648129.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
[Oryza brachyantha]
Length=427

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/235 (63%), Positives = 180/235 (77%), Gaps = 5/235 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            K+A DAA GL Y HE M+FQ+IFRD K+SNILLDE WNAKLSDFGLAR GP EGLTH+ST
Sbjct  194  KVALDAARGLKYLHEEMEFQVIFRDLKTSNILLDENWNAKLSDFGLARHGPSEGLTHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGTMGYA+PEY+QTGRLT+K+D+W YGV LYELITGR P+DRNRP+ EQKLL+WVKP+
Sbjct  254  AVVGTMGYAAPEYMQTGRLTAKSDIWGYGVLLYELITGRRPIDRNRPKGEQKLLDWVKPY  313

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD K+F  IIDPRLEG+  LKS  KL+ VANRCLVR PKSRPKMSEV +M+ K++E S 
Sbjct  314  ISDIKRFPIIIDPRLEGHYNLKSMTKLASVANRCLVRLPKSRPKMSEVYEMVQKIVE-SI  372

Query  440  GIGDPRPSIVHSDPISTKD-EVDRKG--KRRITDMKVGDGSWLVRIWSLKQLKTC  285
              G P+P + +   +S    +  +KG  KRR  + K G    + R W  + +KTC
Sbjct  373  ETGTPQPPLHYHGSVSEPGAKRTKKGSLKRRFQEFKFGCRQIVWRGWKPEIIKTC  427



>ref|XP_002862908.1| hypothetical protein ARALYDRAFT_921086 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39167.1| hypothetical protein ARALYDRAFT_921086 [Arabidopsis lyrata subsp. 
lyrata]
Length=434

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 172/218 (79%), Gaps = 2/218 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY HEGM+FQIIFRDFKSSNILLDE WNAKLSDFGLAR+GP +G+TH+ST
Sbjct  201  KIAQDTARGLAYLHEGMEFQIIFRDFKSSNILLDENWNAKLSDFGLARMGPSDGITHVST  260

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LT+K+DVWSYG+FLYELITGR P DRNRPR+EQ +LEW++PH
Sbjct  261  AVVGTIGYAAPEYIQTGHLTAKSDVWSYGIFLYELITGRRPFDRNRPRNEQNILEWIRPH  320

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ IIDPRLEGN  LKSA KL+ VANRCL+   K+RP MS+V +ML +++E S 
Sbjct  321  LSDIKKFKMIIDPRLEGNYYLKSALKLAAVANRCLMVKAKARPTMSQVSEMLERIVETSD  380

Query  440  GIGDPRPSIVHSDPISTKDEVDR-KGKRRITDMKVGDG  330
                  P +    P +  +   R + KRR  ++ +G+ 
Sbjct  381  DAPSGLPLMKSLTPKAAFEASRRERVKRRFVELLIGEN  418



>ref|XP_010557951.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Tarenaya 
hassleriana]
Length=449

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/220 (65%), Positives = 175/220 (80%), Gaps = 6/220 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA D A GLAY HEGM+FQIIFRDFKSSNILLDE WNAKLSDFGLAR+GP EG+TH+ST
Sbjct  215  KIALDTARGLAYLHEGMEFQIIFRDFKSSNILLDENWNAKLSDFGLARMGPSEGITHVST  274

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LT+K+DVWSYG+FLYELITGR P DRNRPR+EQ +LEW++PH
Sbjct  275  AVVGTIGYAAPEYLQTGHLTAKSDVWSYGIFLYELITGRRPFDRNRPRNEQNVLEWIRPH  334

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ I+DPRL GN  LKSA KL+ VANRCL+   KSRP+MS+VL+M++++ E S+
Sbjct  335  LSDIKKFKMIVDPRLGGNYCLKSALKLAAVANRCLMTKAKSRPRMSQVLEMIDRIAETSS  394

Query  440  ---GIGDPRPSIVHSDPISTKDEVDRKG-KRRITDMKVGD  333
               G+ +  P +    P    +   R+G KRR  +  VG+
Sbjct  395  SHDGV-EALPLMKSLTPKDAFEASRREGAKRRFVEFIVGE  433



>gb|AAO42877.1| At2g39110 [Arabidopsis thaliana]
Length=435

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 176/222 (79%), Gaps = 9/222 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIARD A GLAY H+GM+FQIIFRDFKSSNILLDE WNAKLSDFGLAR+GP +G+TH+ST
Sbjct  201  KIARDTARGLAYLHQGMEFQIIFRDFKSSNILLDENWNAKLSDFGLARMGPSDGITHVST  260

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LT+K+DVWSYG+FLYELITGR P DRNRPR+EQ +LEW++PH
Sbjct  261  AVVGTIGYAAPEYIQTGHLTAKSDVWSYGIFLYELITGRRPFDRNRPRNEQNILEWIRPH  320

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ IIDPRLEGN  LKSA KL+ VANRCL+   K+RP MS+V +ML +++E S+
Sbjct  321  LSDIKKFKMIIDPRLEGNYYLKSALKLAAVANRCLMVKAKARPTMSQVSEMLERIVETSS  380

Query  440  GIGDPRPS-IVHSDPISTKDEVD----RKGKRRITDMKVGDG  330
               D  PS +     ++ KD  +     + KRR  ++ +G+ 
Sbjct  381  ---DGAPSGLPLMKSLTPKDAFEASRRERVKRRFVELLIGEN  419



>ref|NP_001048536.1| Os02g0819600 [Oryza sativa Japonica Group]
 dbj|BAD22970.1| putative protein serine/threonine kinase [Oryza sativa Japonica 
Group]
 dbj|BAD23099.1| putative protein serine/threonine kinase [Oryza sativa Japonica 
Group]
 dbj|BAF10450.1| Os02g0819600 [Oryza sativa Japonica Group]
 gb|EEE58058.1| hypothetical protein OsJ_08896 [Oryza sativa Japonica Group]
Length=427

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 180/235 (77%), Gaps = 5/235 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            K+A DAA GL Y HE M+FQ+IFRD K+SNILLDE WNAKLSDFGLAR GP EGLTH+ST
Sbjct  194  KVALDAARGLKYLHEEMEFQVIFRDLKTSNILLDENWNAKLSDFGLARHGPSEGLTHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT+K+D+W YGV LYELITGR P+DRNRP+ EQKLL+WVKP+
Sbjct  254  AVVGTLGYAAPEYMQTGRLTAKSDIWGYGVLLYELITGRRPIDRNRPKGEQKLLDWVKPY  313

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD K+F  IIDPRLEG+  LKS  KL+ VANRCLVR PKSRPKMSEV +M+ K++ AS 
Sbjct  314  ISDIKRFPIIIDPRLEGHYNLKSMTKLASVANRCLVRLPKSRPKMSEVYEMVQKIV-ASI  372

Query  440  GIGDPRPSIVHSDPISTK-DEVDRKG--KRRITDMKVGDGSWLVRIWSLKQLKTC  285
              G P+P + +   +S    +  +KG  KRR  + K G    + R W  + +KTC
Sbjct  373  ETGTPQPPLHYHGSVSEPGSKRPKKGSLKRRFQEFKFGCRQIVWRSWKPEIIKTC  427



>ref|XP_009125492.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Brassica 
rapa]
Length=412

 Score =   287 bits (735),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 141/233 (61%), Positives = 179/233 (77%), Gaps = 4/233 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE MDFQIIFRDFKSSNILLDE W AKLSDFGLARLGP  G TH+ST
Sbjct  182  RIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDEDWRAKLSDFGLARLGPAPGSTHVST  241

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGT+GYA+PEY+QTGRLTSK+DVW YGVF+YELITGR PLD+N P+ EQKLLEWV+P+
Sbjct  242  GVVGTLGYAAPEYIQTGRLTSKSDVWGYGVFMYELITGRRPLDKNMPKGEQKLLEWVRPY  301

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE-AS  444
            L+D+K+FR IIDPRLEG   +K   KL++VAN CL R+ K+RPKMSEVL+M+ K++E +S
Sbjct  302  LTDTKRFRLIIDPRLEGKYSIKYVQKLAVVANLCLTRNSKARPKMSEVLEMVTKIVEDSS  361

Query  443  TGIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            +  G  +  +V    +      + K K+ + D   G+G WL ++W+ K ++ C
Sbjct  362  SRNGGKKRQMVPLRSLGASRAEEEKQKKVVLDG--GEGGWLDKLWNPKNVRAC  412



>ref|XP_010509071.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Camelina 
sativa]
Length=435

 Score =   288 bits (736),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 181/233 (78%), Gaps = 10/233 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY HEGM+FQIIFRDFKSSNILLDE WNAKLSDFGLAR+GP +G+TH+ST
Sbjct  201  KIAQDTARGLAYLHEGMEFQIIFRDFKSSNILLDENWNAKLSDFGLARMGPSDGITHVST  260

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LT+K+DVWSYG+FLYELITGR P DRNRPR+EQ +LEWV+PH
Sbjct  261  AVVGTIGYAAPEYIQTGHLTAKSDVWSYGIFLYELITGRRPFDRNRPRNEQNILEWVRPH  320

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ IIDPRLEGN  LKSA KL+ +ANRCL+   KSRP MS+V +ML +++E ++
Sbjct  321  LSDIKKFKMIIDPRLEGNYYLKSALKLAAIANRCLMVKAKSRPTMSQVSEMLERIVETTS  380

Query  440  GIGDPRPS-IVHSDPISTKDEVD----RKGKRRITDMKVG-DGSWLVRIWSLK  300
               D  PS +     ++ KD  +     + KRR  ++ +G +G   +  WS K
Sbjct  381  ---DETPSGLPLMKSLTPKDAFEASRRERVKRRFVELWIGVNGCPNLPTWSPK  430



>ref|XP_003573979.2| PREDICTED: probable receptor-like protein kinase At3g55450 [Brachypodium 
distachyon]
Length=443

 Score =   288 bits (736),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 147/236 (62%), Positives = 185/236 (78%), Gaps = 9/236 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            ++A D A GL Y HE  +F+IIFRD K SNILLDE WNAKLSDFGLARLGPQEG +H+ST
Sbjct  210  RVALDTARGLKYLHEDSEFKIIFRDLKPSNILLDENWNAKLSDFGLARLGPQEG-SHVST  268

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+ TGRL+SKND+WS+GV LYEL+TGR PLDRNRPR EQ L+EWVKP+
Sbjct  269  AVVGTIGYAAPEYIHTGRLSSKNDIWSFGVVLYELLTGRRPLDRNRPRGEQNLVEWVKPY  328

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
             SD+KKF  I+DPRLEG   LKSA +L+ +AN+CLVRH + RPKMSEVL+M+ K++++S 
Sbjct  329  SSDAKKFETIMDPRLEGKYSLKSAARLASLANKCLVRHARHRPKMSEVLEMVQKIVDSSD  388

Query  440  GIGDPR-PSIVHSDPISTKDEVDRKG---KRRITDMKVGDGSWLV-RIWSLKQLKT  288
             +G P  P I HS  +++ DE  RKG   KRRI D+K G+G W   + W+ K ++T
Sbjct  389  -LGTPEHPLINHSKELAS-DEKKRKGLNLKRRIADIKAGEGRWFTWQKWTPKLVRT  442



>gb|EEC74260.1| hypothetical protein OsI_09473 [Oryza sativa Indica Group]
Length=427

 Score =   287 bits (734),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 180/235 (77%), Gaps = 5/235 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            K+A DAA GL Y HE M+FQ+IFRD K+SNILLDE WNAKLSDFGLAR GP EGLTH+ST
Sbjct  194  KVALDAARGLKYLHEEMEFQVIFRDLKTSNILLDENWNAKLSDFGLARHGPSEGLTHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT+K+D+W YGV LYELITGR P+DRNRP+ EQKLL+WVKP+
Sbjct  254  AVVGTLGYAAPEYMQTGRLTAKSDIWGYGVLLYELITGRRPIDRNRPKGEQKLLDWVKPY  313

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD K+F  IIDPRLEG+  LKS  KL+ VANRCLVR PKSRPKMSEV +M+ K++ AS 
Sbjct  314  ISDIKRFPIIIDPRLEGHYNLKSMTKLASVANRCLVRLPKSRPKMSEVYEMVQKIV-ASI  372

Query  440  GIGDPRPSIVHSDPISTK-DEVDRKG--KRRITDMKVGDGSWLVRIWSLKQLKTC  285
              G P+P + +   +S    +  +KG  KRR  + K G    + R W  + +KTC
Sbjct  373  ETGTPQPPLHYHGSVSEPGSKRPKKGSLKRRFQEFKFGCRQIVWRGWKPEIIKTC  427



>ref|XP_006411135.1| hypothetical protein EUTSA_v10016674mg [Eutrema salsugineum]
 gb|ESQ52588.1| hypothetical protein EUTSA_v10016674mg [Eutrema salsugineum]
Length=438

 Score =   287 bits (735),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 176/229 (77%), Gaps = 3/229 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY H+GM+FQIIFRDFKSSNILLDE WNAKLSDFGLAR+GP +G+TH+ST
Sbjct  205  KIAQDTARGLAYLHQGMEFQIIFRDFKSSNILLDENWNAKLSDFGLARMGPSDGITHVST  264

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGT+GYA+PEY+QTG LT+K+DVWSYG+FLYELITGR P DRNRPR+EQ +LEW++PH
Sbjct  265  TVVGTIGYAAPEYIQTGHLTAKSDVWSYGIFLYELITGRRPFDRNRPRNEQNILEWIRPH  324

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ IIDPRLEGN  LKS  KL+ VANRCL+   KSRP MS+V +ML++++E S 
Sbjct  325  LSDIKKFKMIIDPRLEGNYYLKSVLKLAAVANRCLMVKAKSRPTMSQVSEMLDRIVETSD  384

Query  440  GIGDPRPSIVHSDPISTKDEVDR-KGKRRITDMKVG-DGSWLVRIWSLK  300
             +    P +    P    +   R + KRR  ++ +G +G   +  WS K
Sbjct  385  EVSPALPLMKSLTPKDAFEASRRERVKRRFVELLIGVNGCPNLPTWSPK  433



>ref|NP_850311.1| protein kinase superfamily protein [Arabidopsis thaliana]
 dbj|BAE99942.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC09636.1| protein kinase superfamily protein [Arabidopsis thaliana]
Length=435

 Score =   287 bits (735),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 176/222 (79%), Gaps = 9/222 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY H+GM+FQIIFRDFKSSNILLDE WNAKLSDFGLAR+GP +G+TH+ST
Sbjct  201  KIAQDTARGLAYLHQGMEFQIIFRDFKSSNILLDENWNAKLSDFGLARMGPSDGITHVST  260

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LT+K+DVWSYG+FLYELITGR P DRNRPR+EQ +LEW++PH
Sbjct  261  AVVGTIGYAAPEYIQTGHLTAKSDVWSYGIFLYELITGRRPFDRNRPRNEQNILEWIRPH  320

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ IIDPRLEGN  LKSA KL+ VANRCL+   K+RP MS+V +ML +++E S+
Sbjct  321  LSDIKKFKMIIDPRLEGNYYLKSALKLAAVANRCLMVKAKARPTMSQVSEMLERIVETSS  380

Query  440  GIGDPRPS-IVHSDPISTKDEVD----RKGKRRITDMKVGDG  330
               D  PS +     ++ KD  +     + KRR  ++ +G+ 
Sbjct  381  ---DGAPSGLPLMKSLTPKDAFEASRRERVKRRFVELLIGEN  419



>ref|XP_010235978.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Brachypodium 
distachyon]
Length=427

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 182/235 (77%), Gaps = 5/235 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            K+A DAA GL Y HE MDFQ+IFRD K+SNILLDE W+AKLSDFGLAR GPQEGL+H+ST
Sbjct  194  KVALDAARGLKYLHEEMDFQVIFRDLKTSNILLDENWDAKLSDFGLARHGPQEGLSHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT+K+D+WSYGV LYELITGR P+D+NRP+ EQKLL+WVKP+
Sbjct  254  AVVGTLGYAAPEYMQTGRLTAKSDMWSYGVLLYELITGRRPIDKNRPKGEQKLLDWVKPY  313

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD K+F  I+DPRLEG+  LKS  KL+ VANRCLVR PKSRPKMSEV +M+ K+++ S 
Sbjct  314  ISDVKRFPIIVDPRLEGHYNLKSVTKLAAVANRCLVRLPKSRPKMSEVYEMVQKIVD-SI  372

Query  440  GIGDPRPSIVHSDPISTKD-EVDRKG--KRRITDMKVGDGSWLVRIWSLKQLKTC  285
              G P+P + +   +S    +  +KG  KRR  + K G    + R W  + +KTC
Sbjct  373  ETGPPQPPLHYHGSVSEPGAKRTKKGSLKRRFQEFKFGCRQIVWRGWKPEIIKTC  427



>ref|NP_001146659.1| uncharacterized LOC100280259 [Zea mays]
 ref|XP_008643525.1| PREDICTED: uncharacterized LOC100280259 isoform X1 [Zea mays]
 ref|XP_008643526.1| PREDICTED: uncharacterized LOC100280259 isoform X1 [Zea mays]
 ref|XP_008643527.1| PREDICTED: uncharacterized LOC100280259 isoform X1 [Zea mays]
 gb|ACL54482.1| unknown [Zea mays]
 gb|ACL54571.1| unknown [Zea mays]
 gb|AFW74065.1| putative protein kinase superfamily protein isoform 1 [Zea mays]
 gb|AFW74066.1| putative protein kinase superfamily protein isoform 2 [Zea mays]
Length=431

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/232 (63%), Positives = 182/232 (78%), Gaps = 11/232 (5%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            K+A D+A GL Y HE M+FQ+IFRD K+SNILLDE WNAKLSDFGLAR GP EGLTH+ST
Sbjct  194  KVALDSARGLKYLHEEMEFQVIFRDLKTSNILLDENWNAKLSDFGLARHGPAEGLTHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT+K+D+WSYGV LYELITGR P+DRNRP+SEQKLL+WVKP+
Sbjct  254  AVVGTLGYAAPEYMQTGRLTAKSDIWSYGVLLYELITGRRPIDRNRPKSEQKLLDWVKPY  313

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD K+F  I+DPRLEG+  LKS  KLS VANRCLVR PKSRPKMSEV DM+ K+++   
Sbjct  314  ISDVKRFPIIVDPRLEGHYNLKSMTKLSSVANRCLVRMPKSRPKMSEVYDMVQKIVDC-V  372

Query  440  GIGDPRPSIVH-----SDPISTKDEVDRKG---KRRITDMKVGDGSWLVRIW  309
            G G P+P ++H     S+P    D+  RKG   +RR+ +++ G    + R W
Sbjct  373  GTGPPQPPLLHYHGSASEP-GPGDKRARKGSVKRRRLWELRFGCRHIVWRGW  423



>emb|CDY44356.1| BnaC02g03210D [Brassica napus]
Length=409

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 177/234 (76%), Gaps = 6/234 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE MDFQIIFRDFKSSNILLDE W AKLSDFGLARLGP  G TH+ST
Sbjct  179  RIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDEDWKAKLSDFGLARLGPAPGSTHVST  238

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGTMGYA+PEY+QTGRLTSK+DVW YGVF+YELITGR PLD+N P+ EQKLLEWV+P+
Sbjct  239  GVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFMYELITGRRPLDKNMPKGEQKLLEWVRPY  298

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE--A  447
            L+D+K+FR IIDPRLEG   +K   KL++VAN CL R+ K+RPKMSEVL+M+ K++E  +
Sbjct  299  LTDTKRFRLIIDPRLEGKYSIKYVQKLAVVANLCLTRNSKARPKMSEVLEMVTKIVEDSS  358

Query  446  STGIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            S   G  R  +V    +      + K K  + D   G+G WL ++W+ K ++ C
Sbjct  359  SRNCGKKR-QLVPLRSLGASRAEEEKQKNVVLDG--GEGGWLDKLWNPKNVRAC  409



>emb|CDY69874.1| BnaAnng31840D [Brassica napus]
Length=412

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 140/233 (60%), Positives = 179/233 (77%), Gaps = 4/233 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GL Y HE MDFQIIFRDFKSSNILLDE W AKLSDFGLARLGP  G TH+ST
Sbjct  182  RIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDEDWRAKLSDFGLARLGPAPGSTHVST  241

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGT+GYA+PEY+QTGRLTSK+DVW YGVF+YELITGR PLD+N P+ EQKLLEWV+P+
Sbjct  242  GVVGTLGYAAPEYIQTGRLTSKSDVWGYGVFMYELITGRRPLDKNMPKGEQKLLEWVRPY  301

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE-AS  444
            L+++K+FR IIDPRLEG   +K   KL++VAN CL R+ K+RPKMSEVL+M+ K++E +S
Sbjct  302  LTNTKRFRLIIDPRLEGKYSIKYVQKLAVVANLCLTRNSKARPKMSEVLEMVTKIVEDSS  361

Query  443  TGIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQLKTC  285
            +  G  +  +V    +      + K K+ + D   G+G WL ++W+ K ++ C
Sbjct  362  SRNGGKKRQMVPLRSLGASRAEEEKQKKVVLDG--GEGGWLDKLWNPKNVRAC  412



>ref|XP_008343482.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Malus 
domestica]
Length=432

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 180/226 (80%), Gaps = 11/226 (5%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY HEGM+FQIIFRDFKSSNILLDEQWNAKLSDFGLARLGP +GL+H+ST
Sbjct  198  KIAQDXARGLAYLHEGMEFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLSHVST  257

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LT+K+DVWSYG+FL ELITGR PLDRNRP++EQKLLEWV+P 
Sbjct  258  AVVGTVGYAAPEYIQTGHLTTKSDVWSYGIFLLELITGRRPLDRNRPKNEQKLLEWVRPX  317

Query  617  L-SDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAS  444
            L SD KKF+ I+D RLEG   LK+A KL+ VA+RCLVR  +SRPKMSEVL+MLN+++E +
Sbjct  318  LSSDLKKFQVILDARLEGKYSLKAAQKLAAVASRCLVRQSRSRPKMSEVLEMLNRIME-T  376

Query  443  TGIGDPRPSIVHSDPISTKDEVDRKGK-----RRITDMKVGDGSWL  321
            T +G P   + + D   +K++   + K     RR  D  +G+   L
Sbjct  377  TDMGSPELPLRNVD---SKEDYFAESKREYLMRRFVDPFIGENGCL  419



>gb|EMT16531.1| Protein kinase APK1B, chloroplastic [Aegilops tauschii]
Length=398

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 182/235 (77%), Gaps = 5/235 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            K+A DAA GL Y HE MDFQ+IFRD K+SNILLDE WNAKLSDFGLAR GPQEGL+H+ST
Sbjct  165  KVALDAARGLKYLHEEMDFQVIFRDLKTSNILLDENWNAKLSDFGLARHGPQEGLSHVST  224

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT+K+D+W YGV LYELITGR P+DRNRP+ EQKLL+WVKP+
Sbjct  225  AVVGTLGYAAPEYMQTGRLTAKSDIWGYGVLLYELITGRRPIDRNRPKGEQKLLDWVKPY  284

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD K+F  I+DPRLEG+  LKS  +L+ VANRCL+R PK+RPKMSEV +M+ K+++ S 
Sbjct  285  ISDVKRFPIIVDPRLEGHYNLKSMTRLAGVANRCLLRLPKTRPKMSEVYEMVQKIVD-SV  343

Query  440  GIGDPRPSIVHSDPISTKD-EVDRKG--KRRITDMKVGDGSWLVRIWSLKQLKTC  285
             IG P P + +   +S    +  +KG  KRR+ + K G    + R W  + +KTC
Sbjct  344  EIGPPEPPLHYHGSVSGPGAKRTKKGSLKRRLQEFKFGCRQIVWRGWKPEIIKTC  398



>gb|ACG27469.1| protein kinase APK1A [Zea mays]
Length=431

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/232 (63%), Positives = 182/232 (78%), Gaps = 11/232 (5%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            K+A D+A GL Y HE M+FQ+IFRD K+SNILLDE WNAKLSDFGLAR GP EGLTH+ST
Sbjct  194  KVALDSARGLKYLHEEMEFQVIFRDLKTSNILLDENWNAKLSDFGLARHGPAEGLTHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT+K+D+WSYGV LYELITGR P+DRNRP+SEQKLL+WVKP+
Sbjct  254  AVVGTLGYAAPEYMQTGRLTAKSDIWSYGVLLYELITGRRPIDRNRPKSEQKLLDWVKPY  313

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD K+F  I+DPRLEG+  LKS  KLS VANRCLVR PKSRPKMSEV DM+ K+++   
Sbjct  314  ISDVKRFPIIVDPRLEGHYNLKSMTKLSSVANRCLVRMPKSRPKMSEVYDMVQKIVDC-V  372

Query  440  GIGDPRPSIVH-----SDPISTKDEVDRKG---KRRITDMKVGDGSWLVRIW  309
            G G P+P ++H     S+P    D+  RKG   +RR+ +++ G    + R W
Sbjct  373  GTGPPQPPLLHYHGSASEP-GPGDKRARKGSVKRRRLWELRFGCRHIVWRGW  423



>ref|XP_010505573.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Camelina 
sativa]
 ref|XP_010505574.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Camelina 
sativa]
 ref|XP_010505575.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Camelina 
sativa]
 ref|XP_010505576.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Camelina 
sativa]
Length=435

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 181/233 (78%), Gaps = 10/233 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY HEGM+FQIIFRDFKSSNILLDE WNAKLSDFGLAR+GP +G+TH+ST
Sbjct  201  KIAQDTARGLAYLHEGMEFQIIFRDFKSSNILLDENWNAKLSDFGLARMGPSDGITHVST  260

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LT+K+DVWSYG+FLYELITGR P DRNRPR+EQ +LEWV+PH
Sbjct  261  AVVGTIGYAAPEYIQTGHLTAKSDVWSYGIFLYELITGRRPFDRNRPRNEQNILEWVRPH  320

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ IIDPRLEGN  LKSA K++ +ANRCL+   KSRP MS+V +ML +++E ++
Sbjct  321  LSDIKKFKMIIDPRLEGNYYLKSALKVAAIANRCLMVKAKSRPTMSQVSEMLERIVETTS  380

Query  440  GIGDPRPS-IVHSDPISTKDEVD----RKGKRRITDMKVG-DGSWLVRIWSLK  300
               D  PS +     ++ KD  +     + KRR  ++ +G +G   +  WS K
Sbjct  381  ---DETPSGLPLMKSLTPKDAFEASRRERVKRRFVELWIGVNGCPNLPTWSPK  430



>ref|XP_009143340.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Brassica 
rapa]
Length=430

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 175/229 (76%), Gaps = 3/229 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY H+GM+FQIIFRDFKSSNILLDE WNAKLSDFGLAR+GP +G+TH+ST
Sbjct  197  KIAQDTARGLAYLHQGMEFQIIFRDFKSSNILLDENWNAKLSDFGLARMGPSKGVTHVST  256

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LT+K+DVWSYG+FLYELITGR P DRNRPR+EQ +LEW++PH
Sbjct  257  AVVGTIGYAAPEYIQTGHLTAKSDVWSYGIFLYELITGRRPFDRNRPRNEQNILEWIRPH  316

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            L+D KKF+ IIDPRLEGN  LKSA KL+ VANRCL+   KSRP M EV +ML +++E S 
Sbjct  317  LTDIKKFKMIIDPRLEGNYYLKSALKLAAVANRCLMVKAKSRPTMGEVSEMLERIVETSD  376

Query  440  GIGDPRPSIVHSDPISTKDEVDR-KGKRRITDMKVG-DGSWLVRIWSLK  300
             +    P +    P    +   R + K+R  ++  G +G   +  WS K
Sbjct  377  EVSPALPLVKSLTPKDAFEASRRERVKKRFVELVTGVNGCPNLPTWSPK  425



>ref|XP_004954409.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
[Setaria italica]
Length=427

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/234 (63%), Positives = 182/234 (78%), Gaps = 5/234 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            K+A D+A GL Y HE M+FQ+IFRD K+SNILLDE WNAKLSDFGLAR GP EGLTH+ST
Sbjct  194  KVALDSARGLKYLHEEMEFQVIFRDLKTSNILLDENWNAKLSDFGLARHGPTEGLTHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT+K+D+WSYGV LYELITGR P+DRNRP+SEQKLLEWVKP+
Sbjct  254  AVVGTLGYAAPEYMQTGRLTAKSDIWSYGVLLYELITGRRPIDRNRPKSEQKLLEWVKPY  313

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            + D K+F  IIDPRLEG+  LKS  KLS VANRCLVR PKSRPKMSEV +M+ K+++ S 
Sbjct  314  VGDKKRFPIIIDPRLEGHYNLKSMLKLSSVANRCLVRMPKSRPKMSEVYEMVQKIVD-SV  372

Query  440  GIGDPRPSIVHSDPISTKD-EVDRKG--KRRITDMKVGDGSWLVRIWSLKQLKT  288
              G P+P + +   +S    +  +KG  KRR+ + K G  + + R W  + +KT
Sbjct  373  ETGPPQPPLHYHGSVSEPGAKRTKKGSLKRRLQEFKFGCRNIVWRGWKPEIVKT  426



>ref|XP_010517246.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Camelina sativa]
Length=435

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 180/233 (77%), Gaps = 10/233 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY HE M+FQIIFRDFKSSNILLDE WNAKLSDFGLAR+GP +G+TH+ST
Sbjct  201  KIAQDTARGLAYLHEDMEFQIIFRDFKSSNILLDENWNAKLSDFGLARMGPSDGITHVST  260

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LT+K+DVWSYG+FLYELITGR P DRNRPR+EQ +LEWV+PH
Sbjct  261  AVVGTIGYAAPEYIQTGHLTAKSDVWSYGIFLYELITGRRPFDRNRPRNEQNILEWVRPH  320

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ IIDPRLEGN  LKSA KL+ +ANRCL+   KSRP MS+V +ML +++E ++
Sbjct  321  LSDIKKFKMIIDPRLEGNYYLKSALKLAAIANRCLMVKAKSRPTMSQVSEMLERIVETTS  380

Query  440  GIGDPRPS-IVHSDPISTKDEVD----RKGKRRITDMKVG-DGSWLVRIWSLK  300
               D  PS +     ++ KD  +     + KRR  ++ +G +G   +  WS K
Sbjct  381  ---DETPSGLPLMKSLTPKDAFEASRRERVKRRFVELLIGVNGCPNLPTWSPK  430



>ref|XP_006295687.1| hypothetical protein CARUB_v10024803mg [Capsella rubella]
 gb|EOA28585.1| hypothetical protein CARUB_v10024803mg [Capsella rubella]
Length=435

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 171/219 (78%), Gaps = 3/219 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY H+GM+FQIIFRDFKSSNILLDE W AKLSDFGLAR+GP +G+TH+ST
Sbjct  201  KIAQDTARGLAYLHQGMEFQIIFRDFKSSNILLDENWKAKLSDFGLARMGPSDGITHVST  260

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LT+K+D+WSYG+FLYELITGR P DRNRPR+EQ +LEWV+PH
Sbjct  261  AVVGTIGYAAPEYIQTGHLTAKSDIWSYGIFLYELITGRRPFDRNRPRNEQNILEWVRPH  320

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ IIDPRLEGN  LKS  KL+ VANRCL+   KSRP MS+V +ML +++E ++
Sbjct  321  LSDLKKFKMIIDPRLEGNYYLKSVLKLAAVANRCLMVKAKSRPTMSQVSEMLERIVETTS  380

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG--KRRITDMKVGDG  330
                  P ++ S       E  R+   KRR  ++ +G+ 
Sbjct  381  DEAPSGPPLMKSLTPKDAFEASRRERVKRRFVELLIGEN  419



>ref|XP_010517248.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Camelina sativa]
Length=420

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 180/233 (77%), Gaps = 10/233 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY HE M+FQIIFRDFKSSNILLDE WNAKLSDFGLAR+GP +G+TH+ST
Sbjct  186  KIAQDTARGLAYLHEDMEFQIIFRDFKSSNILLDENWNAKLSDFGLARMGPSDGITHVST  245

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LT+K+DVWSYG+FLYELITGR P DRNRPR+EQ +LEWV+PH
Sbjct  246  AVVGTIGYAAPEYIQTGHLTAKSDVWSYGIFLYELITGRRPFDRNRPRNEQNILEWVRPH  305

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ IIDPRLEGN  LKSA KL+ +ANRCL+   KSRP MS+V +ML +++E ++
Sbjct  306  LSDIKKFKMIIDPRLEGNYYLKSALKLAAIANRCLMVKAKSRPTMSQVSEMLERIVETTS  365

Query  440  GIGDPRPS-IVHSDPISTKDEVD----RKGKRRITDMKVG-DGSWLVRIWSLK  300
               D  PS +     ++ KD  +     + KRR  ++ +G +G   +  WS K
Sbjct  366  ---DETPSGLPLMKSLTPKDAFEASRRERVKRRFVELLIGVNGCPNLPTWSPK  415



>ref|XP_009384041.1| PREDICTED: probable receptor-like protein kinase At3g55450 [Musa 
acuminata subsp. malaccensis]
Length=428

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 182/235 (77%), Gaps = 5/235 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            ++A DAA GL Y HE MDFQIIFRDFKSSNILLD+ WNAKLSDFGLAR GP EG++H+ST
Sbjct  195  RVALDAARGLTYLHEQMDFQIIFRDFKSSNILLDKDWNAKLSDFGLARQGPTEGISHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT+K+D+WSYGVFLYEL+TGR P+D +RP+ EQKLLEWVKP+
Sbjct  255  AVVGTLGYAAPEYMQTGRLTAKSDIWSYGVFLYELLTGRQPIDIDRPKGEQKLLEWVKPY  314

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD +KFR I+D RL G    KSA KL+ VANRCL + PKSRPKMSEVL+M+ +++  ST
Sbjct  315  ISDVRKFRIIMDTRLAGEYSFKSATKLASVANRCLRQQPKSRPKMSEVLEMVQQIV-GST  373

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG--KRRITDMKVGDGSWLV-RIWSLKQLKTC  285
            G G P+  + +SD       V++K   +R I + K G G  LV +   LK +K+C
Sbjct  374  GAGVPQAPLRNSDLEQGHPRVEKKKVLRRTIGEQKKGQGMQLVWQGCGLKLVKSC  428



>ref|XP_002454791.1| hypothetical protein SORBIDRAFT_04g037460 [Sorghum bicolor]
 gb|EES07767.1| hypothetical protein SORBIDRAFT_04g037460 [Sorghum bicolor]
Length=422

 Score =   284 bits (727),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 180/229 (79%), Gaps = 8/229 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            K+A D+A GL Y HE M+FQ+IFRD K+SNILLDE W+AKLSDFGLAR GP EGLTH+ST
Sbjct  194  KVALDSARGLKYLHEEMEFQVIFRDLKTSNILLDENWDAKLSDFGLARHGPAEGLTHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT+K+D+WSYGV LYELITGR P+D+NRP+SEQKLL+WVKP+
Sbjct  254  AVVGTLGYAAPEYMQTGRLTAKSDIWSYGVLLYELITGRRPIDKNRPKSEQKLLDWVKPY  313

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD K+F  I+DPRLEG+  LKS  KLS VANRCLVR PKSRPKMSEV DM+ K+++ S 
Sbjct  314  ISDVKRFPIIVDPRLEGHYNLKSMTKLSSVANRCLVRMPKSRPKMSEVYDMVQKIVD-SI  372

Query  440  GIGDPRPSIVH-----SDPISTKDEVDRKGKRRITDMKVGDGSWLVRIW  309
            G G P+P ++H     SDP +TK       + R+ +  +G  + + R W
Sbjct  373  GTGPPQPPLLHYRGSASDP-ATKRAKKGSLRTRLREFGLGCRNIVQRGW  420



>ref|XP_008784814.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Phoenix 
dactylifera]
Length=427

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 171/223 (77%), Gaps = 4/223 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA DAA GL Y HE  DFQIIFRD K+SNILLDE WNAKLSDFG AR GP +G +H+ST
Sbjct  194  RIALDAARGLTYLHEEADFQIIFRDLKASNILLDEHWNAKLSDFGFARQGPAKGFSHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT K+D+WSYGV LYELITGR P+DRNRP++EQ+LL+WVKP+
Sbjct  254  AVVGTIGYAAPEYIQTGRLTVKSDIWSYGVLLYELITGRRPMDRNRPKAEQRLLDWVKPY  313

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
             SD++KF  IIDPRL+ N  LKSA KL+ VANRCL RHPKSRPKMSEV  M+  ++E   
Sbjct  314  KSDTRKFHMIIDPRLQRNYSLKSATKLAAVANRCLTRHPKSRPKMSEVSKMVQSIVE-KL  372

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG--KRRITDMKVGDGSWLV  318
             IG  +P +  S   +T  E  ++G   +R  D+KVG G  LV
Sbjct  373  EIGTLQPHLRSSSEEATSKESIKRGMNSKRSGDLKVGKGMQLV  415



>emb|CDX74866.1| BnaA05g06120D [Brassica napus]
Length=430

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 175/229 (76%), Gaps = 3/229 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY H+GM+FQIIFRDFKSSNILLDE WNAKLSDFGLAR+GP +G+TH+ST
Sbjct  197  KIAQDTARGLAYLHQGMEFQIIFRDFKSSNILLDENWNAKLSDFGLARMGPSKGVTHVST  256

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LT+K+DVWSYG+FLYELITGR P DRNRPR+EQ +LEW++PH
Sbjct  257  AVVGTIGYAAPEYIQTGHLTAKSDVWSYGIFLYELITGRRPFDRNRPRNEQNILEWIRPH  316

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            L+D KKF+ IIDPRLEG+  LKSA KL+ VANRCL+   KSRP M EV +ML +++E S 
Sbjct  317  LTDIKKFKMIIDPRLEGSYYLKSALKLAAVANRCLMVKAKSRPTMGEVSEMLERIVETSD  376

Query  440  GIGDPRPSIVHSDPISTKDEVDR-KGKRRITDMKVG-DGSWLVRIWSLK  300
             +    P +    P    +   R + K+R  ++  G +G   +  WS K
Sbjct  377  EVSPALPLVKSLTPKDAFEASRRERVKKRFVELVTGVNGCPNLPTWSPK  425



>gb|EPS66606.1| hypothetical protein M569_08171, partial [Genlisea aurea]
Length=377

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 161/187 (86%), Gaps = 3/187 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQ-IIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIS  801
            KIA DAACGLAY HE M FQ IIFRDFKSSNILLD+QWNAKLSDFGLARLGP +G THIS
Sbjct  183  KIALDAACGLAYLHEEMSFQQIIFRDFKSSNILLDDQWNAKLSDFGLARLGPSDGRTHIS  242

Query  800  TAVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKP  621
            T +VGT+GYA+PEYVQTGRL +K+D+WSYGVFLYELITGR PLD +RPR+EQKLLEW+KP
Sbjct  243  TQIVGTLGYAAPEYVQTGRLRAKSDIWSYGVFLYELITGRRPLDHSRPRNEQKLLEWIKP  302

Query  620  HLSDSKKFRQIIDPRL--EGNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEA  447
            +LSD KKF+ ++D RL  +  +LKSAH+LSL+ANRCL R PK+RP MSEV +++ +++E 
Sbjct  303  YLSDPKKFQLVVDHRLPKQRQVLKSAHRLSLLANRCLSRRPKARPSMSEVREVVREIIET  362

Query  446  STGIGDP  426
            STGI  P
Sbjct  363  STGIRVP  369



>ref|XP_004983005.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X1 [Setaria italica]
 ref|XP_004983006.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X2 [Setaria italica]
 ref|XP_004983007.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X3 [Setaria italica]
 ref|XP_004983008.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X4 [Setaria italica]
 ref|XP_004983009.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X5 [Setaria italica]
Length=446

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 180/235 (77%), Gaps = 7/235 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            ++A D A GL Y HE  +F+IIFRD K SNILLDE WNAKLSDFGLARLGPQEG +H+ST
Sbjct  213  RVALDTARGLKYLHEESEFKIIFRDLKPSNILLDENWNAKLSDFGLARLGPQEG-SHVST  271

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+ TGRL++KND+WS+GV LYEL+TGR PLDRNRPR EQ L++WVKP+
Sbjct  272  AVVGTIGYAAPEYIHTGRLSTKNDIWSFGVVLYELLTGRRPLDRNRPRGEQNLVDWVKPY  331

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
             SD+KK   +IDPRL+GN  +KSA +L+ VAN+CLVRH + RPKMSEVLDM+ K++E+S 
Sbjct  332  SSDAKKLETVIDPRLQGNYSIKSAAQLASVANKCLVRHARYRPKMSEVLDMVQKIVESSE  391

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG---KRRITDMKVGDGSWLV-RIWSLKQLKT  288
             +G P   ++ +      DE  RK    KRRI D+K G+G W   + W+ K ++T
Sbjct  392  -LGTPEHPLISNSKELVSDEKKRKVLDLKRRIADIKAGEGRWFAWQRWTPKLVRT  445



>ref|XP_006662393.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
[Oryza brachyantha]
Length=417

 Score =   281 bits (720),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 142/235 (60%), Positives = 176/235 (75%), Gaps = 7/235 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            ++A D A GL Y HE  + +IIFRD K SNIL+DE WNAKLSDFGLARLGPQEG +H+ST
Sbjct  184  RVALDTARGLKYLHEESEIKIIFRDLKPSNILIDENWNAKLSDFGLARLGPQEG-SHVST  242

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+ TGRL+SKND+WSYGV LYEL+TGR PLDRNRPR EQ L+EWVKP+
Sbjct  243  AVVGTIGYAAPEYIHTGRLSSKNDIWSYGVVLYELLTGRRPLDRNRPRGEQNLIEWVKPY  302

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
             SD+KK   I+DPRLEG   LKSA KL+ VAN+CLVRH + RPKMSEVL+M+ K+++ S+
Sbjct  303  SSDAKKLEIIMDPRLEGKYSLKSAAKLASVANKCLVRHARHRPKMSEVLEMVQKIID-SS  361

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG---KRRITDMKVGDGSWLV-RIWSLKQLKT  288
             +G P   ++       +DE  RKG   KRR  D+K GD  W   + W  K ++T
Sbjct  362  DLGTPEHPLISKSKELVRDEKKRKGIDLKRRFADIKAGDQRWFTWQRWRPKLVRT  416



>ref|XP_009141782.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
 ref|XP_009141783.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
 ref|XP_009141784.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
 ref|XP_009141785.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
 ref|XP_009141786.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
Length=437

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY H G++FQIIFRDFKSSNILLDE WNAKLSDFGLAR+GP +G++H+ST
Sbjct  203  KIAQDTARGLAYLHHGLEFQIIFRDFKSSNILLDENWNAKLSDFGLARMGPSDGISHVST  262

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LT+K+DVWSYG+FLYELITGR P DRNRPR+EQ +L+W++PH
Sbjct  263  AVVGTIGYAAPEYIQTGHLTAKSDVWSYGIFLYELITGRRPFDRNRPRNEQNILDWIRPH  322

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            L+D KKF+ I+DPRLEGN  LKSA KL+ VANRCL+   KSRP MSEV DML +++E S 
Sbjct  323  LADIKKFKMIVDPRLEGNYYLKSALKLAAVANRCLMVKAKSRPTMSEVSDMLERIVETSA  382



>emb|CDY18353.1| BnaA04g22340D [Brassica napus]
Length=422

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY H G++FQIIFRDFKSSNILLDE WNAKLSDFGLAR+GP +G++H+ST
Sbjct  188  KIAQDTARGLAYLHHGLEFQIIFRDFKSSNILLDENWNAKLSDFGLARMGPSDGISHVST  247

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LT+K+DVWSYG+FLYELITGR P DRNRPR+EQ +L+W++PH
Sbjct  248  AVVGTIGYAAPEYIQTGHLTAKSDVWSYGIFLYELITGRRPFDRNRPRNEQNILDWIRPH  307

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            L+D KKF+ I+DPRLEGN  LKSA KL+ VANRCL+   KSRP MSEV DML +++E S 
Sbjct  308  LADIKKFKMIVDPRLEGNYYLKSALKLAAVANRCLMVKAKSRPTMSEVSDMLERIVETSA  367



>ref|XP_009386591.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009386592.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009386593.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Musa 
acuminata subsp. malaccensis]
Length=424

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/232 (61%), Positives = 180/232 (78%), Gaps = 10/232 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            ++A D+A GLAY HE MDFQIIFRDFK+SNILLD+ WNAKLSDFG AR GP EG++H+ST
Sbjct  194  RVALDSARGLAYLHEEMDFQIIFRDFKTSNILLDKDWNAKLSDFGFARQGPTEGISHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+P+Y+QTGRLT+K+DVWSYGVFLY LITGR P+DR RP+ EQKLLEWVKP 
Sbjct  254  AVVGTVGYAAPDYMQTGRLTAKSDVWSYGVFLYVLITGRRPIDRKRPKGEQKLLEWVKPR  313

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD+KKF  I+DPRL G   LKSA KL+ VAN+CL+R P SRPKMSEVL+M++K+++ ST
Sbjct  314  ISDAKKFHIIMDPRLAGEYSLKSAIKLASVANKCLLRQPNSRPKMSEVLEMVHKIVK-ST  372

Query  440  GIGDPRPSIVHSDPISTKDE-VDRKGKRR-------ITDMKVGDGSWLVRIW  309
              G+P+P + + D      E  ++KG R+       +  +  G GS LV I+
Sbjct  373  ETGEPQPPLRNCDSEQGNPEAAEKKGPRKTLKILGGMQSVWQGCGSKLVNIF  424



>gb|AAC79621.1| putative protein kinase [Arabidopsis thaliana]
Length=419

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/222 (63%), Positives = 175/222 (79%), Gaps = 10/222 (5%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+D A GLAY H+GM+FQIIFRDFKSSNILLDE WNAKLSDFGLAR+GP +G+TH+ST
Sbjct  186  KIAQDTARGLAYLHQGMEFQIIFRDFKSSNILLDENWNAKLSDFGLARMGPSDGITHVST  245

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGT+GYA+PEY+QTG LT+K+DVWSYG+FLYELITGR P DRNRPR+EQ +LEW++PH
Sbjct  246  -VVGTIGYAAPEYIQTGHLTAKSDVWSYGIFLYELITGRRPFDRNRPRNEQNILEWIRPH  304

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            LSD KKF+ IIDPRLEGN  LKSA KL+ VANRCL+   K+RP MS+V +ML +++E S+
Sbjct  305  LSDIKKFKMIIDPRLEGNYYLKSALKLAAVANRCLMVKAKARPTMSQVSEMLERIVETSS  364

Query  440  GIGDPRPS-IVHSDPISTKDEVD----RKGKRRITDMKVGDG  330
               D  PS +     ++ KD  +     + KRR  ++ +G+ 
Sbjct  365  ---DGAPSGLPLMKSLTPKDAFEASRRERVKRRFVELLIGEN  403



>ref|XP_006827432.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Amborella 
trichopoda]
 gb|ERM94848.1| hypothetical protein AMTR_s00009p00089890 [Amborella trichopoda]
Length=428

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 163/186 (88%), Gaps = 1/186 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA DAA GL Y HE MDFQIIFRDFK SNILLD+ +NAKLSDFGLAR GP EG+TH+ST
Sbjct  196  RIALDAARGLTYLHEEMDFQIIFRDFKPSNILLDKNFNAKLSDFGLARQGPSEGVTHVST  255

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT+K+DVWSYGV LYELITGR PLDRNRP+SEQKLLEWVKP+
Sbjct  256  AVVGTVGYAAPEYIQTGRLTAKSDVWSYGVVLYELITGRRPLDRNRPKSEQKLLEWVKPY  315

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD +KFR I+DPRL   + ++SA++L++VA++CLV++ +SRPKMSEV +M+ +++E+S 
Sbjct  316  MSDIRKFRMILDPRLSAEVPVRSAYRLAVVASKCLVKNVRSRPKMSEVGEMVRQIIESSE  375

Query  440  GIGDPR  423
             +G P+
Sbjct  376  MVGSPQ  381



>ref|XP_008677078.1| PREDICTED: uncharacterized LOC100279292 isoform X1 [Zea mays]
 ref|XP_008677079.1| PREDICTED: uncharacterized LOC100279292 isoform X1 [Zea mays]
 gb|AFW63975.1| putative protein kinase superfamily protein [Zea mays]
Length=426

 Score =   276 bits (707),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 175/223 (78%), Gaps = 13/223 (6%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            K+A D+A GL Y HE M+FQ+IFRD K+SNILLDE WNAKLSDFGLAR GP EGLTH+ST
Sbjct  190  KVALDSARGLKYLHEEMEFQVIFRDLKTSNILLDENWNAKLSDFGLARHGPTEGLTHVST  249

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GY +PEY+QTG LT+K+D+WSYGV LYELITGR P+D+NRP+SEQKLL+WVKP+
Sbjct  250  AVVGTLGYTAPEYMQTGHLTAKSDIWSYGVVLYELITGRRPIDQNRPKSEQKLLDWVKPY  309

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD K+F  IIDPRLEG+  LKSA KL+ VANRC+VR PKSRPKMSEV  M+ ++++   
Sbjct  310  ISDVKRFPVIIDPRLEGHYNLKSATKLASVANRCMVRLPKSRPKMSEVYGMVQRIVDG-V  368

Query  440  GIGDPRPSIVH------SDPISTKDEVDRKG--KRRITDMKVG  336
            G G P+P ++H      S+P + + E   KG  +RR  + + G
Sbjct  369  GTGPPQPPLLHYHHGSASEPGAKRAE---KGSLRRRFREFRSG  408



>emb|CDX93286.1| BnaC04g46100D [Brassica napus]
Length=422

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 155/179 (87%), Gaps = 1/179 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA   A GLAY H G++FQIIFRDFKSSNILLDE+WNAKLSDFGLAR+GP +G++H+ST
Sbjct  188  KIALHTARGLAYLHHGLEFQIIFRDFKSSNILLDEKWNAKLSDFGLARMGPSDGISHVST  247

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTG LT+K+DVWSYG+FLYELITGR P DRNRPR+EQ +L+W++PH
Sbjct  248  AVVGTIGYAAPEYIQTGHLTAKSDVWSYGIFLYELITGRRPFDRNRPRNEQNILDWIRPH  307

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAS  444
            L+D KKF+ I+DPRLEGN  LKSA KL+ VANRCL+   KSRP MSEV +ML +++E S
Sbjct  308  LADIKKFKMIVDPRLEGNYYLKSALKLAAVANRCLMVKAKSRPTMSEVSEMLERIVETS  366



>ref|XP_003560283.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Brachypodium 
distachyon]
Length=422

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 168/210 (80%), Gaps = 4/210 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            K+A  AA GL+Y H  MDFQIIFRD K+SNILLD+ WNAKLSDFG+AR GP EGLTH+ST
Sbjct  196  KVALHAARGLSYLHHDMDFQIIFRDLKTSNILLDQHWNAKLSDFGMAREGPTEGLTHVST  255

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRLT+K+DVW+YGV LYELITGR PLDRNRPRSEQKLL+WV+P+
Sbjct  256  AVVGTLGYAAPEYIQTGRLTAKSDVWTYGVLLYELITGRRPLDRNRPRSEQKLLDWVRPY  315

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEA--  447
            +SD+ K + I+DP+LEGN  ++S  KL+ VANRCL R P++RP+MSEVLDM+ K ++   
Sbjct  316  ISDTTKLKLIVDPKLEGNYNIRSVAKLATVANRCLARLPRARPRMSEVLDMVQKAMDVDL  375

Query  446  STGIGDPRPSIVHSDPISTKDEV-DRKGKR  360
            +T   D   + +H      +++V  RKGK+
Sbjct  376  ATSTSDHDQAPLHCYGACGEEDVKQRKGKK  405



>gb|KJB55869.1| hypothetical protein B456_009G098900 [Gossypium raimondii]
Length=460

 Score =   275 bits (703),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK+SNILLDE +NAKLSDFGLAR GP EG  H+ST
Sbjct  212  KIAQDAARGLAYLHEEMDFQLIFRDFKTSNILLDEDFNAKLSDFGLARQGPLEGFGHVST  271

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTGRLT+K+DVWS+GV LYELITGR  L+RN PRSEQKLLEWVKP+
Sbjct  272  SVVGTVGYAAPEYVQTGRLTAKSDVWSFGVVLYELITGRRALERNLPRSEQKLLEWVKPY  331

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SDSKKF  IIDPRLEG   +KSA KL+ +AN+CL+++PKSRPKMSEV++ML  ++  ++
Sbjct  332  ISDSKKFHLIIDPRLEGQYCIKSAQKLASLANKCLMKNPKSRPKMSEVVEMLGNIISGTS  391



>gb|KCW85563.1| hypothetical protein EUGRSUZ_B02362 [Eucalyptus grandis]
Length=415

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 177/228 (78%), Gaps = 3/228 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK+SNILLDE +NAKLSDFGLAR GP EGL+H+ST
Sbjct  167  KIAQDAARGLAYLHEEMDFQLIFRDFKTSNILLDEDFNAKLSDFGLARQGPAEGLSHVST  226

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYV TGRLT+K+DVWS+GV LYELITGR  ++RN PRSEQKLL+WV+P+
Sbjct  227  SVVGTIGYAAPEYVHTGRLTAKSDVWSFGVVLYELITGRRAVERNLPRSEQKLLDWVRPY  286

Query  617  LSDSKKFRQIIDPRLEGNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEASTG  438
            +SDS+KF  I+DPRLEG  +KSA KL+ +AN+CL++ PKSRPKMS V++ML  ++   + 
Sbjct  287  VSDSRKFSLILDPRLEGQDIKSAQKLASLANKCLMKQPKSRPKMSNVVEMLGNIISELSP  346

Query  437  IGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQL  294
              D  P  V ++    K E    G+  +   K G+ S L +++ ++++
Sbjct  347  QDDVIPEPVETEAEEVKGEA--AGETEVDSGKQGN-SKLRKVFDIREI  391



>ref|XP_006424838.1| hypothetical protein CICLE_v10028420mg [Citrus clementina]
 gb|ESR38078.1| hypothetical protein CICLE_v10028420mg [Citrus clementina]
Length=343

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 166/213 (78%), Gaps = 17/213 (8%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK+SNILLDE + AKLSDFGLAR GP EGL H+ST
Sbjct  95   KIAQDAARGLAYLHEEMDFQLIFRDFKTSNILLDEDYKAKLSDFGLARQGPPEGLGHVST  154

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTGRLT+K+DVWS+GV LYELITGR  ++RN PR+EQKLLEWV+P+
Sbjct  155  SVVGTVGYAAPEYVQTGRLTAKSDVWSFGVVLYELITGRRAVERNLPRNEQKLLEWVRPY  214

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SDSKKF  IIDPRLEGN  +KSA KL+ +A++CL + PKSRPKMSEV+D+L  ++    
Sbjct  215  VSDSKKFHLIIDPRLEGNYCIKSAQKLAALASKCLTKQPKSRPKMSEVVDILGNII----  270

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMK  342
                          IS++DEV  +    I D+K
Sbjct  271  ------------SEISSQDEVTLQPVAEIEDVK  291



>ref|XP_010043546.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Eucalyptus 
grandis]
Length=453

 Score =   273 bits (697),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 177/228 (78%), Gaps = 3/228 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK+SNILLDE +NAKLSDFGLAR GP EGL+H+ST
Sbjct  205  KIAQDAARGLAYLHEEMDFQLIFRDFKTSNILLDEDFNAKLSDFGLARQGPAEGLSHVST  264

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYV TGRLT+K+DVWS+GV LYELITGR  ++RN PRSEQKLL+WV+P+
Sbjct  265  SVVGTIGYAAPEYVHTGRLTAKSDVWSFGVVLYELITGRRAVERNLPRSEQKLLDWVRPY  324

Query  617  LSDSKKFRQIIDPRLEGNILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEASTG  438
            +SDS+KF  I+DPRLEG  +KSA KL+ +AN+CL++ PKSRPKMS V++ML  ++   + 
Sbjct  325  VSDSRKFSLILDPRLEGQDIKSAQKLASLANKCLMKQPKSRPKMSNVVEMLGNIISELSP  384

Query  437  IGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQL  294
              D  P  V ++    K E    G+  +   K G+ S L +++ ++++
Sbjct  385  QDDVIPEPVETEAEEVKGEA--AGETEVDSGKQGN-SKLRKVFDIREI  429



>ref|XP_010494957.1| PREDICTED: probable disease resistance protein At5g47260 isoform 
X1 [Camelina sativa]
 ref|XP_010494958.1| PREDICTED: probable disease resistance protein At5g47260 isoform 
X1 [Camelina sativa]
Length=1339

 Score =   286 bits (733),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 174/214 (81%), Gaps = 7/214 (3%)
 Frame = -1

Query  977   KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
             +IA+DAA GLAY HE MDFQI F +FKSSNILLDE W AKL  FGLA LG  EGLTH+ST
Sbjct  1119  RIAQDAARGLAYLHEEMDFQITFCEFKSSNILLDEDWIAKLLKFGLASLGSSEGLTHVST  1178

Query  797   AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             +VVGTM YA+PEY+QTGRLTSK+DVW+YGVFLYELITGR P+DR++P+ EQKLLEWV+P+
Sbjct  1179  SVVGTMDYAAPEYIQTGRLTSKSDVWAYGVFLYELITGRRPIDRSKPKGEQKLLEWVRPY  1238

Query  617   LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
             LSD++KF+ I+DPRLEG   +KS  KL++VANRCLVR+PK+RPKMSEVL+M+ K++EAST
Sbjct  1239  LSDTRKFKLILDPRLEGKYPIKSVQKLAVVANRCLVRNPKARPKMSEVLEMVTKIVEAST  1298

Query  440   GIGDPRPSIVHSDPIST-KDEVDRKGKRRITDMK  342
             G G P+      DP++T K   D  G ++ T  K
Sbjct  1299  GNGSPQL-----DPLNTLKASRDGAGGQKQTQGK  1327



>ref|XP_010494959.1| PREDICTED: probable disease resistance protein At5g47260 isoform 
X2 [Camelina sativa]
Length=1333

 Score =   286 bits (732),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 174/214 (81%), Gaps = 7/214 (3%)
 Frame = -1

Query  977   KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
             +IA+DAA GLAY HE MDFQI F +FKSSNILLDE W AKL  FGLA LG  EGLTH+ST
Sbjct  1113  RIAQDAARGLAYLHEEMDFQITFCEFKSSNILLDEDWIAKLLKFGLASLGSSEGLTHVST  1172

Query  797   AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             +VVGTM YA+PEY+QTGRLTSK+DVW+YGVFLYELITGR P+DR++P+ EQKLLEWV+P+
Sbjct  1173  SVVGTMDYAAPEYIQTGRLTSKSDVWAYGVFLYELITGRRPIDRSKPKGEQKLLEWVRPY  1232

Query  617   LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
             LSD++KF+ I+DPRLEG   +KS  KL++VANRCLVR+PK+RPKMSEVL+M+ K++EAST
Sbjct  1233  LSDTRKFKLILDPRLEGKYPIKSVQKLAVVANRCLVRNPKARPKMSEVLEMVTKIVEAST  1292

Query  440   GIGDPRPSIVHSDPIST-KDEVDRKGKRRITDMK  342
             G G P+      DP++T K   D  G ++ T  K
Sbjct  1293  GNGSPQL-----DPLNTLKASRDGAGGQKQTQGK  1321



>ref|XP_010106486.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXC10662.1| putative receptor-like protein kinase [Morus notabilis]
Length=444

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 158/180 (88%), Gaps = 2/180 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GLAY HE MDFQ+IFRDFK+SNILLDE++NAKLSDFGLAR GP EG  H+ST
Sbjct  195  QIAQDAARGLAYLHEEMDFQLIFRDFKTSNILLDEEYNAKLSDFGLARQGPPEGTGHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEYVQTGRLT+K+DVWS+GV LYELITGR  ++RN PRSEQKLLEWVKP+
Sbjct  255  AVVGTVGYAAPEYVQTGRLTAKSDVWSFGVVLYELITGRRAVERNLPRSEQKLLEWVKPY  314

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDML-NKVLEAS  444
            +SD KKF  I+DPRLEG   ++SA KL+ +ANRCLV+HPKSRPKMSEV+++L N + EAS
Sbjct  315  VSDPKKFHIILDPRLEGQYCIRSAQKLASLANRCLVKHPKSRPKMSEVVEILGNIITEAS  374



>ref|XP_009397532.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009397533.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Musa 
acuminata subsp. malaccensis]
Length=408

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 167/217 (77%), Gaps = 6/217 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA DAA GL Y HEG +FQIIFRD K+SNILLD  WNAKLSDFGLAR GP +GL+H+ST
Sbjct  194  KIALDAANGLTYLHEGGEFQIIFRDLKTSNILLDAHWNAKLSDFGLARQGPTDGLSHVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            A+VGTMGYA+PEY+QTGRLT+K+D+WSYGV LYELITGR P+DRNRPR EQKLLEWVKP+
Sbjct  254  AIVGTMGYAAPEYIQTGRLTAKSDIWSYGVVLYELITGRQPMDRNRPRKEQKLLEWVKPY  313

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
             SD+KKF  I+DP+++ N  LK A +LS VAN+CL+R PK RPKMS+VL M+ +++   T
Sbjct  314  TSDAKKFHLIVDPKIDDNYCLKQAMELSAVANKCLMRSPKLRPKMSDVLGMVQRIV--CT  371

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG---KRRITDMKV  339
              G  R    H     +  E + +G   K RI+D+KV
Sbjct  372  ENGTLRHPSSHFPEERSCREREGRGMDLKTRISDLKV  408



>gb|ABG66097.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
Length=445

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/236 (60%), Positives = 176/236 (75%), Gaps = 8/236 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            ++A D A GL Y HE  + +IIFRD K SNIL+DE WNAKLSDFGLARL  Q+G +H+ST
Sbjct  211  RVALDTARGLKYLHEESEIKIIFRDLKPSNILIDENWNAKLSDFGLARLVSQDG-SHVST  269

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+ TGRL+SKND+WSYGV LYEL+TGR PLDRNRPR EQ L+EWVKP+
Sbjct  270  AVVGTIGYAAPEYIHTGRLSSKNDIWSYGVVLYELLTGRRPLDRNRPRGEQNLIEWVKPY  329

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
             +DSKK   I+DPRLEG+  LKSA KL+ VAN+CLVRH + RPKMSEVL+M+ K+++ ST
Sbjct  330  STDSKKLEIIMDPRLEGSYSLKSAAKLASVANKCLVRHARHRPKMSEVLEMVQKIVD-ST  388

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG---KRRITDMKV-GDGSWLV-RIWSLKQLKT  288
             +G P   ++      T+DE  RKG   KRR  D+K  GD  W   + W  K ++T
Sbjct  389  DLGTPEHPLISKSRELTRDEKKRKGLDLKRRFADIKAGGDQRWFTWQRWRPKLVRT  444



>ref|NP_850128.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AEC08192.1| protein kinase family protein [Arabidopsis thaliana]
Length=343

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 155/178 (87%), Gaps = 2/178 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFKSSNILLDE++ AKLSDFGLAR GP EGL H+ST
Sbjct  96   KIAQDAAQGLAYLHEEMDFQLIFRDFKSSNILLDERFGAKLSDFGLARQGPPEGLGHVST  155

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTG+LT+K+DVWS+GV LYELITGR  +DRNRPR EQKLLEWVKP+
Sbjct  156  SVVGTVGYAAPEYVQTGKLTAKSDVWSFGVVLYELITGRRAVDRNRPRGEQKLLEWVKPY  215

Query  617  LSDSKKFRQIIDPRLEGN--ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE  450
            +SDSKKF  I+DPRLEG    +KS  +++ +AN+CL++ PKSRPKMSEV+ +L ++++
Sbjct  216  VSDSKKFHLIVDPRLEGQYYCMKSVQRVAALANKCLMKQPKSRPKMSEVVSLLGRIID  273



>ref|XP_007016401.1| Kinase APK1B, chloroplast, putative [Theobroma cacao]
 gb|EOY34020.1| Kinase APK1B, chloroplast, putative [Theobroma cacao]
Length=456

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK+SNILLDE +NAKLSDFGLAR GP EGL H+ST
Sbjct  208  KIAQDAARGLAYLHEEMDFQLIFRDFKTSNILLDEDFNAKLSDFGLARQGPAEGLGHVST  267

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGT+GYA+PEYVQTGRLT+K+DVWS+GV LYEL+TGR  L+RN PRSEQKLLEWV+P+
Sbjct  268  TVVGTIGYAAPEYVQTGRLTAKSDVWSFGVVLYELVTGRRALERNLPRSEQKLLEWVRPY  327

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SDSKKF  I+DPRLEG+  +KS  KL+ +AN+CL+++PKSRPKMSEV++ML  ++  ++
Sbjct  328  VSDSKKFHLIVDPRLEGHYCIKSVQKLASLANKCLMKNPKSRPKMSEVVEMLGNIISETS  387



>ref|XP_010256920.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nelumbo 
nucifera]
Length=442

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 159/181 (88%), Gaps = 2/181 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GLAY HE MDFQ+IFRDFK+SNILLDE +NAKLSDFGLAR GP EGL+H+ T
Sbjct  196  RIAQDAARGLAYLHEEMDFQLIFRDFKTSNILLDEDFNAKLSDFGLARQGPTEGLSHVLT  255

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEY+QTGRLT+K+DVWS+GV LYEL+TGR  +DRN PR EQKLLEW+KP+
Sbjct  256  SVVGTVGYAAPEYIQTGRLTAKSDVWSFGVVLYELLTGRRSVDRNLPRGEQKLLEWIKPY  315

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVL-EAS  444
            +SDSKKF  IIDPRLEG   +KSA KLS +AN+CL++ PKSRP+MSEV++ML +++ EAS
Sbjct  316  ISDSKKFHLIIDPRLEGQYCIKSAQKLSSLANKCLLKQPKSRPRMSEVVEMLGQIITEAS  375

Query  443  T  441
            +
Sbjct  376  S  376



>ref|XP_010264441.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X3 [Nelumbo nucifera]
Length=352

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 181/232 (78%), Gaps = 10/232 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GLAY HE MDFQ+IFRDFK+SNILLDE +NAKLSDFGLAR GP EGL+++ST
Sbjct  104  RIAQDAARGLAYLHEEMDFQLIFRDFKTSNILLDEDFNAKLSDFGLARQGPTEGLSYVST  163

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEY+Q GRLT+K+DVWS+GV LYEL+TGR  +DRN P+ +QKLLEWVKP+
Sbjct  164  SVVGTVGYAAPEYIQMGRLTAKSDVWSFGVVLYELMTGRRSVDRNLPKGKQKLLEWVKPY  223

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SDSKKF  IIDPRLEG   ++SA KL+ +AN+CL++ PKSRPKMSEV++ML +++  ++
Sbjct  224  VSDSKKFHLIIDPRLEGQYCIESAQKLASLANKCLMKQPKSRPKMSEVVEMLGQIICETS  283

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKV---GDGSWLVRIWSLKQL  294
             +      +  S+P+    E +   +  ITD K    G+G +L R++  +++
Sbjct  284  SLSLSDCGV--SEPVK---ETEATSEYSITDTKSSKQGNG-YLKRVFDFREM  329



>gb|AAP53976.2| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAH00975.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51031.1| hypothetical protein OsJ_31679 [Oryza sativa Japonica Group]
Length=461

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/236 (60%), Positives = 176/236 (75%), Gaps = 8/236 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            ++A D A GL Y HE  + +IIFRD K SNIL+DE WNAKLSDFGLARL  Q+G +H+ST
Sbjct  227  RVALDTARGLKYLHEESEIKIIFRDLKPSNILIDENWNAKLSDFGLARLVSQDG-SHVST  285

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+ TGRL+SKND+WSYGV LYEL+TGR PLDRNRPR EQ L+EWVKP+
Sbjct  286  AVVGTIGYAAPEYIHTGRLSSKNDIWSYGVVLYELLTGRRPLDRNRPRGEQNLIEWVKPY  345

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
             +DSKK   I+DPRLEG+  LKSA KL+ VAN+CLVRH + RPKMSEVL+M+ K+++ ST
Sbjct  346  STDSKKLEIIMDPRLEGSYSLKSAAKLASVANKCLVRHARHRPKMSEVLEMVQKIVD-ST  404

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG---KRRITDMKV-GDGSWLV-RIWSLKQLKT  288
             +G P   ++      T+DE  RKG   KRR  D+K  GD  W   + W  K ++T
Sbjct  405  DLGTPEHPLISKSRELTRDEKKRKGLDLKRRFADIKAGGDQRWFTWQRWRPKLVRT  460



>ref|XP_008664921.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Zea mays]
Length=452

 Score =   271 bits (692),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 174/235 (74%), Gaps = 7/235 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            ++A D A GL Y HE  +F+IIFRD K SNILLD+ WNAKLSDFGLARLGPQEG +H+ST
Sbjct  219  RVALDTARGLKYLHEESEFKIIFRDLKPSNILLDDNWNAKLSDFGLARLGPQEG-SHVST  277

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGT+GYA+PEY+ TGRL++KND+WS+GV L EL+TGR PLDRNRPR EQ L++W+KP+
Sbjct  278  VVVGTIGYAAPEYIHTGRLSTKNDIWSFGVVLLELLTGRRPLDRNRPRGEQNLVDWMKPY  337

Query  617  LSDSKKFRQIIDPRLEGNILK-SAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
             SD+KK    IDPRL+GN  K SA +L+ VAN+CLVRH + RPKMSEVL+M+ K++E S 
Sbjct  338  SSDAKKLEAAIDPRLQGNYSKRSAAQLASVANKCLVRHARHRPKMSEVLEMVRKIVENSE  397

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG---KRRITDMKVGDGSWLV-RIWSLKQLKT  288
              G P   ++ +      DE  RK    KRRI D+K G+G W   + W+ K ++T
Sbjct  398  -TGTPEHPLISNSEELVSDERKRKRLGLKRRIADIKAGEGRWFAWQRWTPKLVRT  451



>ref|XP_008664922.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X3 [Zea mays]
 ref|XP_008664923.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X3 [Zea mays]
 tpg|DAA49844.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=438

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 174/235 (74%), Gaps = 7/235 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            ++A D A GL Y HE  +F+IIFRD K SNILLD+ WNAKLSDFGLARLGPQEG +H+ST
Sbjct  205  RVALDTARGLKYLHEESEFKIIFRDLKPSNILLDDNWNAKLSDFGLARLGPQEG-SHVST  263

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGT+GYA+PEY+ TGRL++KND+WS+GV L EL+TGR PLDRNRPR EQ L++W+KP+
Sbjct  264  VVVGTIGYAAPEYIHTGRLSTKNDIWSFGVVLLELLTGRRPLDRNRPRGEQNLVDWMKPY  323

Query  617  LSDSKKFRQIIDPRLEGNILK-SAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
             SD+KK    IDPRL+GN  K SA +L+ VAN+CLVRH + RPKMSEVL+M+ K++E S 
Sbjct  324  SSDAKKLEAAIDPRLQGNYSKRSAAQLASVANKCLVRHARHRPKMSEVLEMVRKIVENSE  383

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG---KRRITDMKVGDGSWLV-RIWSLKQLKT  288
              G P   ++ +      DE  RK    KRRI D+K G+G W   + W+ K ++T
Sbjct  384  -TGTPEHPLISNSEELVSDERKRKRLGLKRRIADIKAGEGRWFAWQRWTPKLVRT  437



>ref|XP_008664920.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Zea mays]
 tpg|DAA49843.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=452

 Score =   270 bits (691),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 174/235 (74%), Gaps = 7/235 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            ++A D A GL Y HE  +F+IIFRD K SNILLD+ WNAKLSDFGLARLGPQEG +H+ST
Sbjct  219  RVALDTARGLKYLHEESEFKIIFRDLKPSNILLDDNWNAKLSDFGLARLGPQEG-SHVST  277

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             VVGT+GYA+PEY+ TGRL++KND+WS+GV L EL+TGR PLDRNRPR EQ L++W+KP+
Sbjct  278  VVVGTIGYAAPEYIHTGRLSTKNDIWSFGVVLLELLTGRRPLDRNRPRGEQNLVDWMKPY  337

Query  617  LSDSKKFRQIIDPRLEGNILK-SAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
             SD+KK    IDPRL+GN  K SA +L+ VAN+CLVRH + RPKMSEVL+M+ K++E S 
Sbjct  338  SSDAKKLEAAIDPRLQGNYSKRSAAQLASVANKCLVRHARHRPKMSEVLEMVRKIVENSE  397

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG---KRRITDMKVGDGSWLV-RIWSLKQLKT  288
              G P   ++ +      DE  RK    KRRI D+K G+G W   + W+ K ++T
Sbjct  398  -TGTPEHPLISNSEELVSDERKRKRLGLKRRIADIKAGEGRWFAWQRWTPKLVRT  451



>ref|XP_006424839.1| hypothetical protein CICLE_v10028420mg [Citrus clementina]
 ref|XP_006488336.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
[Citrus sinensis]
 gb|ESR38079.1| hypothetical protein CICLE_v10028420mg [Citrus clementina]
Length=453

 Score =   270 bits (690),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 166/213 (78%), Gaps = 17/213 (8%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK+SNILLDE + AKLSDFGLAR GP EGL H+ST
Sbjct  205  KIAQDAARGLAYLHEEMDFQLIFRDFKTSNILLDEDYKAKLSDFGLARQGPPEGLGHVST  264

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTGRLT+K+DVWS+GV LYELITGR  ++RN PR+EQKLLEWV+P+
Sbjct  265  SVVGTVGYAAPEYVQTGRLTAKSDVWSFGVVLYELITGRRAVERNLPRNEQKLLEWVRPY  324

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SDSKKF  IIDPRLEGN  +KSA KL+ +A++CL + PKSRPKMSEV+D+L  ++    
Sbjct  325  VSDSKKFHLIIDPRLEGNYCIKSAQKLAALASKCLTKQPKSRPKMSEVVDILGNIIS---  381

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMK  342
                          IS++DEV  +    I D+K
Sbjct  382  -------------EISSQDEVTLQPVAEIEDVK  401



>gb|KDO72842.1| hypothetical protein CISIN_1g043568mg [Citrus sinensis]
Length=453

 Score =   270 bits (690),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 166/213 (78%), Gaps = 17/213 (8%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK+SNILLDE + AKLSDFGLAR GP EGL H+ST
Sbjct  205  KIAQDAARGLAYLHEEMDFQLIFRDFKTSNILLDEDYKAKLSDFGLARQGPPEGLGHVST  264

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTGRLT+K+DVWS+GV LYELITGR  ++RN PR+EQKLLEWV+P+
Sbjct  265  SVVGTVGYAAPEYVQTGRLTAKSDVWSFGVVLYELITGRRAVERNLPRNEQKLLEWVRPY  324

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SDSKKF  IIDPRLEGN  +KSA KL+ +A++CL + PKSRPKMSEV+D+L  ++    
Sbjct  325  VSDSKKFHLIIDPRLEGNYCIKSAQKLAALASKCLTKQPKSRPKMSEVVDILGNIIS---  381

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMK  342
                          IS++DEV  +    I D+K
Sbjct  382  -------------EISSQDEVTLQPVAEIEDVK  401



>ref|XP_006294171.1| hypothetical protein CARUB_v10023166mg [Capsella rubella]
 gb|EOA27069.1| hypothetical protein CARUB_v10023166mg [Capsella rubella]
Length=462

 Score =   270 bits (690),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 155/178 (87%), Gaps = 2/178 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFKSSNILLDE++ AKLSDFGLAR GP EGL H+ST
Sbjct  215  KIAQDAAQGLAYLHEEMDFQLIFRDFKSSNILLDERFGAKLSDFGLARQGPPEGLGHVST  274

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTG+LT+K+DVWSYGV LYELITGR  +DRNRPR EQKLLEWVKP+
Sbjct  275  SVVGTVGYAAPEYVQTGKLTAKSDVWSYGVVLYELITGRRAIDRNRPRGEQKLLEWVKPY  334

Query  617  LSDSKKFRQIIDPRLEGN--ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE  450
            +SDSKKF  I+DPRLEG    +KS  +++ +AN+CLV+ PKSRPKMSEV+ +L ++++
Sbjct  335  VSDSKKFHVIVDPRLEGQCYCMKSVQRVAALANKCLVKQPKSRPKMSEVVSLLGRIID  392



>gb|EEC67045.1| hypothetical protein OsI_33788 [Oryza sativa Indica Group]
Length=466

 Score =   270 bits (690),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 140/236 (59%), Positives = 175/236 (74%), Gaps = 8/236 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            ++A D A GL Y HE  + +IIFRD K SNIL+DE WNAKLSDFGLARL  Q+G +H+ST
Sbjct  232  RVALDTARGLKYLHEESEIKIIFRDLKPSNILIDENWNAKLSDFGLARLVSQDG-SHVST  290

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+ TGRL+SKND+WSYGV LYEL+TGR PLDRNRPR EQ L+EWVKP+
Sbjct  291  AVVGTIGYAAPEYIHTGRLSSKNDIWSYGVVLYELLTGRRPLDRNRPRGEQNLIEWVKPY  350

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
             +DSKK   I+DPRLEG+  LKSA  L+ VAN+CLVRH + RPKMSEVL+M+ K+++ ST
Sbjct  351  STDSKKLEIIMDPRLEGSYSLKSAANLASVANKCLVRHARHRPKMSEVLEMVQKIVD-ST  409

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG---KRRITDMKV-GDGSWLV-RIWSLKQLKT  288
             +G P   ++      T+DE  RKG   KRR  D+K  GD  W   + W  K ++T
Sbjct  410  DLGTPEHPLISKSRELTRDEKKRKGLDLKRRFADIKAGGDQRWFTWQRWRPKLVRT  465



>ref|XP_012092541.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Jatropha 
curcas]
 gb|KDP20447.1| hypothetical protein JCGZ_05292 [Jatropha curcas]
Length=457

 Score =   270 bits (689),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 163/201 (81%), Gaps = 6/201 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK+SN+LLDE +NAKLSDFGLAR GP EGL H+ST
Sbjct  207  KIAQDAARGLAYLHEEMDFQLIFRDFKTSNVLLDEDFNAKLSDFGLARQGPPEGLGHVST  266

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTGRLT+K+DVWS+GV LYELITGR  L+RN PR+EQKLLEWV+P+
Sbjct  267  SVVGTVGYAAPEYVQTGRLTAKSDVWSFGVVLYELITGRRALERNLPRAEQKLLEWVRPY  326

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SDSKKF  I+DPRLEG   +KSA KL+ +AN+CL + PKSRPKMSEV++ML  ++ + T
Sbjct  327  VSDSKKFYLILDPRLEGQYSIKSAQKLAALANKCLTKQPKSRPKMSEVVEMLGNII-SET  385

Query  440  GIGDPRPSIVHSDPISTKDEV  378
               D  P      P+   +EV
Sbjct  386  SPQDEVPCA----PVCETEEV  402



>ref|XP_009792201.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nicotiana 
sylvestris]
Length=462

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 165/205 (80%), Gaps = 2/205 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK SNILLDE +NAKLSDFGLAR GP  GL+H+ST
Sbjct  190  KIAQDAARGLAYLHEEMDFQLIFRDFKPSNILLDEDFNAKLSDFGLARQGPAAGLSHVST  249

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTGRLT+K+DVWS+GV LYELITGR  L+RN PR+EQKLLEWV+P+
Sbjct  250  SVVGTVGYAAPEYVQTGRLTAKSDVWSFGVVLYELITGRRVLERNLPRAEQKLLEWVRPY  309

Query  617  LSDSKKFRQIIDPRLEG-NILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SDSKKF  I+DPRLEG + +KSA +L+L+AN+CL ++P+SRPKMSEV+D L  ++  + 
Sbjct  310  VSDSKKFHFILDPRLEGHDCVKSAQRLALLANKCLAKNPRSRPKMSEVVDTLGNIITDAA  369

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG  366
               +  P     + +  K+E   +G
Sbjct  370  AQAEVVPETA-KEAVDEKEEDAEEG  393



>ref|XP_011042708.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Populus 
euphratica]
Length=450

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/231 (58%), Positives = 178/231 (77%), Gaps = 9/231 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK+SN+LLDE +NAKLSDFGLAR GP EGL H+ST
Sbjct  203  KIAQDAARGLAYLHEEMDFQLIFRDFKASNVLLDEDFNAKLSDFGLARQGPPEGLGHVST  262

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTGRLT+K+DVWS+GV +YELITGR  ++RN PR EQKLLEWVKP 
Sbjct  263  SVVGTVGYAAPEYVQTGRLTAKSDVWSFGVVMYELITGRRAVERNLPRGEQKLLEWVKPF  322

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SDSKKF  I+DPRLEG   +KSA +L+ +ANRCL + PKSRPKMSE +++L  ++  ++
Sbjct  323  VSDSKKFHLIVDPRLEGQCCIKSAQRLAALANRCLAKQPKSRPKMSEAVEILGNIISETS  382

Query  440  GIGDPRPSIVHSDPISTKDEVDRK--GKRRITDMKVGDGSWLVRIWSLKQL  294
               +  P     +P+S  +EV  +  G+      K G+ S+  ++++++++
Sbjct  383  SQDEGIP-----EPVSEIEEVKEEATGEMGAESTKSGN-SYRKKVFNIREM  427



>emb|CBI16123.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 176/229 (77%), Gaps = 7/229 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK+SN+LLDE +NAKLSDFGLAR GP +G++H+ST
Sbjct  112  KIAQDAARGLAYLHEEMDFQLIFRDFKTSNVLLDEDFNAKLSDFGLARQGPSQGVSHVST  171

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYV TGRLT+K+DVWS+GV LYELITGR  ++RN PRSEQKLLEWV+P+
Sbjct  172  SVVGTVGYAAPEYVHTGRLTAKSDVWSFGVVLYELITGRRAVERNLPRSEQKLLEWVRPY  231

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SDSKKF  I+DPRLEG   +KSA KL+ +AN+CL + PKSRPKMSEV+++L  ++    
Sbjct  232  VSDSKKFHLIVDPRLEGEYCIKSAQKLASLANKCLSKQPKSRPKMSEVVEILGNIISEIA  291

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQL  294
               +  P      PI+  D V  + +     +K G+ ++L +++ LK +
Sbjct  292  PQEEVAPQ-----PINETDNVKEEAEEETEPIKQGN-NYLRKVFDLKDM  334



>ref|XP_011089472.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
Length=446

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 166/204 (81%), Gaps = 6/204 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE M+FQ+IFRDFK+SNILLDE +NAKLSDFGLAR GP  GL+H+ST
Sbjct  203  KIAQDAARGLAYLHEEMEFQLIFRDFKTSNILLDEDFNAKLSDFGLARQGPSAGLSHVST  262

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYV TGRLT+K+DVWS+GV LYELITGR  L+RN PR EQKLLEWV+P+
Sbjct  263  SVVGTVGYAAPEYVHTGRLTAKSDVWSFGVVLYELITGRRVLERNLPRGEQKLLEWVRPY  322

Query  617  LSDSKKFRQIIDPRLEG-NILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD KKF  I+DPRLEG N +KSA +L+ +AN+CL++HP+SRPKMSEV++ML  ++  + 
Sbjct  323  VSDPKKFHLILDPRLEGQNCMKSAQRLASLANKCLMKHPRSRPKMSEVIEMLGSIISEAL  382

Query  440  GIGDPRPSIVHSDPISTKDEVDRK  369
              G+  P     +P++  + V+ +
Sbjct  383  PPGECVP-----EPVTQTENVNEE  401



>emb|CDY47884.1| BnaA07g14290D [Brassica napus]
Length=454

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 169/211 (80%), Gaps = 10/211 (5%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFKSSNILLDE+++AKLSDFGLAR GP EGL H+ST
Sbjct  210  KIAQDAAQGLAYLHEQMDFQLIFRDFKSSNILLDERFSAKLSDFGLARQGPPEGLGHVST  269

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTG+LT+K+DVWS+GV LYELITGR  +DRNRPR EQKLLEWVKP+
Sbjct  270  SVVGTVGYAAPEYVQTGKLTAKSDVWSFGVVLYELITGRRAVDRNRPRGEQKLLEWVKPY  329

Query  617  LSDSKKFRQIIDPRLEGN--ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAS  444
            +SDSKKF  I+DPRL+G    +KS  +++ +AN+CL++ PKSRP+MSEV+  L  +++  
Sbjct  330  VSDSKKFHVIVDPRLQGQYYCIKSVQRVAALANKCLMKQPKSRPRMSEVVSFLGSIIDEE  389

Query  443  TG-----IGDPRPSIVHSDPISTKDEVDRKG  366
            T      +GD    I+ +D   ++ EV ++G
Sbjct  390  TENAPAPLGDETEEIIEAD---SEPEVIKQG  417



>gb|KJB83776.1| hypothetical protein B456_013G263500 [Gossypium raimondii]
Length=344

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = -1

Query  974  IARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHISTA  795
            IA+DAA GLAY HE MDFQ+IFRDFK+SNILLD+ +NAKLSDFGLAR GP EG  H+STA
Sbjct  98   IAQDAARGLAYLHEEMDFQLIFRDFKTSNILLDDDFNAKLSDFGLARQGPPEGFGHVSTA  157

Query  794  VVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPHL  615
            VVGT+GY +PEYVQTGRLT+K+DVWS+GV LYEL+TGR  L+RN PRSEQKLLEWV+P++
Sbjct  158  VVGTVGYTAPEYVQTGRLTAKSDVWSFGVVLYELVTGRRALERNLPRSEQKLLEWVRPYI  217

Query  614  SDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            SDSKKF  I+DPRLEG   LKSA KL+ +AN+CL+++PK RPKMSEV++ML  ++  ++
Sbjct  218  SDSKKFHLIVDPRLEGQYCLKSARKLASLANKCLMKNPKPRPKMSEVVEMLGNIISETS  276



>ref|XP_009124370.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Brassica 
rapa]
Length=452

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 169/211 (80%), Gaps = 10/211 (5%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFKSSNILLDE+++AKLSDFGLAR GP EGL H+ST
Sbjct  208  KIAQDAAQGLAYLHEQMDFQLIFRDFKSSNILLDERFSAKLSDFGLARQGPPEGLGHVST  267

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTG+LT+K+DVWS+GV LYELITGR  +DRNRPR EQKLLEWVKP+
Sbjct  268  SVVGTVGYAAPEYVQTGKLTAKSDVWSFGVVLYELITGRRAVDRNRPRGEQKLLEWVKPY  327

Query  617  LSDSKKFRQIIDPRLEGN--ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAS  444
            +SDSKKF  I+DPRL+G    +KS  +++ +AN+CL++ PKSRP+MSEV+  L  +++  
Sbjct  328  VSDSKKFHVIVDPRLQGQYYCIKSVQRVAALANKCLMKQPKSRPRMSEVVSFLGSIIDEE  387

Query  443  TG-----IGDPRPSIVHSDPISTKDEVDRKG  366
            T      +GD    I+ +D   ++ EV ++G
Sbjct  388  TENAPAPLGDETEEIIEAD---SEPEVIKQG  415



>ref|XP_002283598.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Vitis 
vinifera]
Length=443

 Score =   267 bits (683),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 176/229 (77%), Gaps = 7/229 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK+SN+LLDE +NAKLSDFGLAR GP +G++H+ST
Sbjct  197  KIAQDAARGLAYLHEEMDFQLIFRDFKTSNVLLDEDFNAKLSDFGLARQGPSQGVSHVST  256

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYV TGRLT+K+DVWS+GV LYELITGR  ++RN PRSEQKLLEWV+P+
Sbjct  257  SVVGTVGYAAPEYVHTGRLTAKSDVWSFGVVLYELITGRRAVERNLPRSEQKLLEWVRPY  316

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SDSKKF  I+DPRLEG   +KSA KL+ +AN+CL + PKSRPKMSEV+++L  ++    
Sbjct  317  VSDSKKFHLIVDPRLEGEYCIKSAQKLASLANKCLSKQPKSRPKMSEVVEILGNIISEIA  376

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQL  294
               +  P      PI+  D V  + +     +K G+ ++L +++ LK +
Sbjct  377  PQEEVAPQ-----PINETDNVKEEAEEETEPIKQGN-NYLRKVFDLKDM  419



>ref|XP_010264439.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Nelumbo nucifera]
Length=448

 Score =   267 bits (683),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 181/232 (78%), Gaps = 10/232 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GLAY HE MDFQ+IFRDFK+SNILLDE +NAKLSDFGLAR GP EGL+++ST
Sbjct  200  RIAQDAARGLAYLHEEMDFQLIFRDFKTSNILLDEDFNAKLSDFGLARQGPTEGLSYVST  259

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEY+Q GRLT+K+DVWS+GV LYEL+TGR  +DRN P+ +QKLLEWVKP+
Sbjct  260  SVVGTVGYAAPEYIQMGRLTAKSDVWSFGVVLYELMTGRRSVDRNLPKGKQKLLEWVKPY  319

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SDSKKF  IIDPRLEG   ++SA KL+ +AN+CL++ PKSRPKMSEV++ML +++  ++
Sbjct  320  VSDSKKFHLIIDPRLEGQYCIESAQKLASLANKCLMKQPKSRPKMSEVVEMLGQIICETS  379

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKV---GDGSWLVRIWSLKQL  294
             +      +  S+P+    E +   +  ITD K    G+G +L R++  +++
Sbjct  380  SLSLSDCGV--SEPVK---ETEATSEYSITDTKSSKQGNG-YLKRVFDFREM  425



>ref|XP_010264440.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Nelumbo nucifera]
Length=444

 Score =   267 bits (683),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 181/232 (78%), Gaps = 10/232 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GLAY HE MDFQ+IFRDFK+SNILLDE +NAKLSDFGLAR GP EGL+++ST
Sbjct  196  RIAQDAARGLAYLHEEMDFQLIFRDFKTSNILLDEDFNAKLSDFGLARQGPTEGLSYVST  255

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEY+Q GRLT+K+DVWS+GV LYEL+TGR  +DRN P+ +QKLLEWVKP+
Sbjct  256  SVVGTVGYAAPEYIQMGRLTAKSDVWSFGVVLYELMTGRRSVDRNLPKGKQKLLEWVKPY  315

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SDSKKF  IIDPRLEG   ++SA KL+ +AN+CL++ PKSRPKMSEV++ML +++  ++
Sbjct  316  VSDSKKFHLIIDPRLEGQYCIESAQKLASLANKCLMKQPKSRPKMSEVVEMLGQIICETS  375

Query  440  GIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKV---GDGSWLVRIWSLKQL  294
             +      +  S+P+    E +   +  ITD K    G+G +L R++  +++
Sbjct  376  SLSLSDCGV--SEPVK---ETEATSEYSITDTKSSKQGNG-YLKRVFDFREM  421



>ref|NP_973556.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AAC33222.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM15076.1| putative protein kinase [Arabidopsis thaliana]
 gb|ABO45701.1| At2g28940 [Arabidopsis thaliana]
 gb|AEC08193.1| protein kinase family protein [Arabidopsis thaliana]
Length=462

 Score =   268 bits (684),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 155/178 (87%), Gaps = 2/178 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFKSSNILLDE++ AKLSDFGLAR GP EGL H+ST
Sbjct  215  KIAQDAAQGLAYLHEEMDFQLIFRDFKSSNILLDERFGAKLSDFGLARQGPPEGLGHVST  274

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTG+LT+K+DVWS+GV LYELITGR  +DRNRPR EQKLLEWVKP+
Sbjct  275  SVVGTVGYAAPEYVQTGKLTAKSDVWSFGVVLYELITGRRAVDRNRPRGEQKLLEWVKPY  334

Query  617  LSDSKKFRQIIDPRLEGN--ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE  450
            +SDSKKF  I+DPRLEG    +KS  +++ +AN+CL++ PKSRPKMSEV+ +L ++++
Sbjct  335  VSDSKKFHLIVDPRLEGQYYCMKSVQRVAALANKCLMKQPKSRPKMSEVVSLLGRIID  392



>ref|XP_002298354.2| hypothetical protein POPTR_0001s24730g [Populus trichocarpa]
 gb|EEE83159.2| hypothetical protein POPTR_0001s24730g [Populus trichocarpa]
Length=451

 Score =   267 bits (683),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 152/176 (86%), Gaps = 1/176 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK+SN+LLDE +NAKLSDFGLARLGP EGL H+ST
Sbjct  203  KIAQDAARGLAYLHEEMDFQLIFRDFKASNVLLDEDFNAKLSDFGLARLGPPEGLGHVST  262

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTGRLT+K+DVWS+GV +YELITGR  ++RN PR EQKLLEWVKP 
Sbjct  263  SVVGTVGYAAPEYVQTGRLTAKSDVWSFGVVMYELITGRRAVERNLPRGEQKLLEWVKPF  322

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVL  453
            +SDSKK   I+DPRLEG   +KSA KLS +AN+C+ + PKSRPKMSEV++ML  ++
Sbjct  323  VSDSKKLHLILDPRLEGQYCIKSAQKLSALANKCVAKQPKSRPKMSEVVEMLGNII  378



>ref|XP_011035308.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Populus 
euphratica]
Length=451

 Score =   267 bits (683),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 161/201 (80%), Gaps = 6/201 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK+SN+LLDE +NAKLSDFGLARLGP EGL H+ST
Sbjct  203  KIAQDAARGLAYLHEEMDFQLIFRDFKASNVLLDEDFNAKLSDFGLARLGPPEGLGHVST  262

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTGRLT+K+DVWS+GV +YELITGR  ++RN PR EQKLLEWVKP 
Sbjct  263  SVVGTVGYAAPEYVQTGRLTAKSDVWSFGVVMYELITGRRAVERNLPRGEQKLLEWVKPF  322

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SDSKK   I+DPRLEG   +KSA KLS +AN+C+ + PKSRPKMSEV++ML  ++   +
Sbjct  323  VSDSKKLHLILDPRLEGQYCIKSAQKLSALANKCVAKQPKSRPKMSEVVEMLGNIIGEIS  382

Query  440  GIGDPRPSIVHSDPISTKDEV  378
               +  P     +P S  +EV
Sbjct  383  SQDEDAP-----EPASEIEEV  398



>ref|XP_002313435.2| hypothetical protein POPTR_0009s03680g [Populus trichocarpa]
 gb|EEE87390.2| hypothetical protein POPTR_0009s03680g [Populus trichocarpa]
Length=450

 Score =   267 bits (682),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 161/201 (80%), Gaps = 6/201 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK+SN+LLD  +NAKLSDFGLAR GP EGL H+ST
Sbjct  203  KIAQDAARGLAYLHEEMDFQLIFRDFKASNVLLDSDFNAKLSDFGLARQGPPEGLGHVST  262

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTGRLT+K+DVWS+GV +YELITGR  ++RN PR EQKLLEWVKP 
Sbjct  263  SVVGTVGYAAPEYVQTGRLTAKSDVWSFGVVMYELITGRRAVERNLPRGEQKLLEWVKPF  322

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SDSKKF  I+DPRLEG   +KSA KL+ +ANRCL + PKSRPKMSE +++L  ++  ++
Sbjct  323  VSDSKKFHLIVDPRLEGQCCIKSAQKLAALANRCLAKQPKSRPKMSEAVEILGNIISETS  382

Query  440  GIGDPRPSIVHSDPISTKDEV  378
               +  P     +P+S  +EV
Sbjct  383  SQDEGIP-----EPVSEIEEV  398



>emb|CDY39520.1| BnaC04g15190D [Brassica napus]
Length=457

 Score =   267 bits (683),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 163/199 (82%), Gaps = 7/199 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFKSSNILLDE+++AKLSDFGLAR GP EGL H+ST
Sbjct  209  KIAQDAAQGLAYLHEQMDFQLIFRDFKSSNILLDERFSAKLSDFGLARQGPPEGLGHVST  268

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTG+LT+K+DVWS+GV LYELITGR  +DRNRPR EQKLLEWVKP+
Sbjct  269  SVVGTVGYAAPEYVQTGKLTAKSDVWSFGVVLYELITGRRAVDRNRPRGEQKLLEWVKPY  328

Query  617  LSDSKKFRQIIDPRLEGN--ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAS  444
            +SDSKKF  I+DPRL+G    +KS  +++ +AN+CL++ PKSRP+MSEV+ +L  +++  
Sbjct  329  VSDSKKFHVIVDPRLQGQYYCIKSVQRVAALANKCLMKQPKSRPRMSEVVSLLGSIIDEE  388

Query  443  TG-----IGDPRPSIVHSD  402
            T      +GD    I+ ++
Sbjct  389  TENAPAPLGDETEEIIEAE  407



>ref|XP_002464564.1| hypothetical protein SORBIDRAFT_01g020900 [Sorghum bicolor]
 gb|EER91562.1| hypothetical protein SORBIDRAFT_01g020900 [Sorghum bicolor]
Length=441

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 168/224 (75%), Gaps = 6/224 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            ++A D A GL Y HE  + +IIFRD K SNILLD+ WNAKLSDFGLARLGPQEG +H+ST
Sbjct  208  RVALDTARGLKYLHEESEVKIIFRDLKPSNILLDDNWNAKLSDFGLARLGPQEG-SHVST  266

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+ TGRL++KND+WS+GV L EL+TGR PLDRNRPR EQ L++W+KP+
Sbjct  267  AVVGTIGYAAPEYIHTGRLSTKNDIWSFGVVLLELLTGRRPLDRNRPRGEQNLVDWMKPY  326

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
             S +KK   +IDPRL+GN  +KSA +L+ VAN+CLVRH + RPKMSEVL+M+ K++E+S 
Sbjct  327  SSGAKKLETVIDPRLQGNYSIKSAAQLASVANKCLVRHARYRPKMSEVLEMVQKIVESSE  386

Query  440  GIGDPRPSIVHSDPISTKDEVDRKG---KRRITDMKVGDGSWLV  318
             IG P   ++ +       E  RKG   K RI D+K  +G W  
Sbjct  387  -IGTPEHPLISNSKELVSGEKKRKGLDLKTRIADIKAREGRWFA  429



>gb|KHN21951.1| Putative receptor-like protein kinase [Glycine soja]
Length=307

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 155/176 (88%), Gaps = 1/176 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GLAY HE MDFQ+IFRDFK+SNILLDE +NAKLSDFGLAR GP EG  ++ST
Sbjct  55   RIAQDAARGLAYLHEEMDFQLIFRDFKTSNILLDENFNAKLSDFGLARQGPSEGSGYVST  114

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEYVQTG+LT+K+DVWS+GV LYELITGR  ++RN P++EQKLLEWV+P+
Sbjct  115  AVVGTIGYAAPEYVQTGKLTAKSDVWSFGVVLYELITGRRAVERNLPKNEQKLLEWVRPY  174

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVL  453
            +SD +KF +I+DPRLEG   +KSAHKL+++AN+C+++ PKSRPKMSEV++ L  ++
Sbjct  175  VSDPRKFYRIVDPRLEGQYCIKSAHKLAILANKCIMKQPKSRPKMSEVVESLGSII  230



>ref|XP_002531439.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF30951.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=490

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 163/201 (81%), Gaps = 6/201 (3%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK+SN+LLDE +NAKLSDFGLAR GP EGL H+ST
Sbjct  219  KIAQDAARGLAYLHEEMDFQLIFRDFKASNVLLDEDFNAKLSDFGLARQGPPEGLGHVST  278

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTGRLT+K+DVWS+GV LYELITGR  L+RN PR+EQKLLEWV+P+
Sbjct  279  SVVGTVGYAAPEYVQTGRLTAKSDVWSFGVVLYELITGRRALERNLPRAEQKLLEWVRPY  338

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SDSKKF  I+DPRLEG   +KSA KL+ +AN+CL + PKSRPKMS+V++ L  ++  ++
Sbjct  339  VSDSKKFHLILDPRLEGEYCIKSAQKLAALANKCLAKQPKSRPKMSDVVETLGNIINETS  398

Query  440  GIGDPRPSIVHSDPISTKDEV  378
               +     V  +P+   +EV
Sbjct  399  SQDE-----VACEPVPETEEV  414



>ref|XP_004505859.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
[Cicer arietinum]
Length=443

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK+SNILLDE +NAKLSDFGLAR GP EG  ++ST
Sbjct  193  KIAQDAARGLAYLHEEMDFQLIFRDFKTSNILLDEDFNAKLSDFGLARQGPSEGFGYVST  252

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEYVQTG+LT+K+DVWS+GV LYELITGR  ++RN P++EQKLLEWV+P+
Sbjct  253  AVVGTIGYAAPEYVQTGKLTAKSDVWSFGVVLYELITGRRAVERNLPKNEQKLLEWVRPY  312

Query  617  LSDSKKFRQIIDPRLEG-NILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD KKF  I+DPRLEG +  KSAHKL+++AN+CL++ PKSRPKMSEV+++L  ++  + 
Sbjct  313  VSDPKKFHHIVDPRLEGQDCTKSAHKLAILANKCLMKQPKSRPKMSEVVEILGNIINETV  372



>gb|KJB83775.1| hypothetical protein B456_013G263500 [Gossypium raimondii]
Length=459

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 175/228 (77%), Gaps = 6/228 (3%)
 Frame = -1

Query  974  IARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHISTA  795
            IA+DAA GLAY HE MDFQ+IFRDFK+SNILLD+ +NAKLSDFGLAR GP EG  H+STA
Sbjct  213  IAQDAARGLAYLHEEMDFQLIFRDFKTSNILLDDDFNAKLSDFGLARQGPPEGFGHVSTA  272

Query  794  VVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPHL  615
            VVGT+GY +PEYVQTGRLT+K+DVWS+GV LYEL+TGR  L+RN PRSEQKLLEWV+P++
Sbjct  273  VVGTVGYTAPEYVQTGRLTAKSDVWSFGVVLYELVTGRRALERNLPRSEQKLLEWVRPYI  332

Query  614  SDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEASTG  438
            SDSKKF  I+DPRLEG   LKSA KL+ +AN+CL+++PK RPKMSEV++ML  ++  ++ 
Sbjct  333  SDSKKFHLIVDPRLEGQYCLKSARKLASLANKCLMKNPKPRPKMSEVVEMLGNIISETS-  391

Query  437  IGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQL  294
                  SI  S PI   ++V  + +    +      ++L +++ +K++
Sbjct  392  --SQYESI--SQPIGENEDVKEESEVETEESTKQGHNYLKKVFEIKEI  435



>ref|XP_004294512.2| PREDICTED: probable receptor-like protein kinase At5g47070 [Fragaria 
vesca subsp. vesca]
Length=471

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 159/191 (83%), Gaps = 3/191 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK SN+LLDE +NAKLSDFGLAR GP EG+TH+ST
Sbjct  222  KIAQDAARGLAYLHEEMDFQLIFRDFKPSNVLLDEDFNAKLSDFGLARQGPLEGMTHVST  281

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEYVQTG+LT+K+DVWS+GV LYELITGR  ++RN PRSEQKLLEWV+P+
Sbjct  282  AVVGTVGYAAPEYVQTGKLTAKSDVWSFGVVLYELITGRRAMERNLPRSEQKLLEWVRPY  341

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
             SDSKKF  I+DPRLEG   +KSA KL+ +AN+CL + PKSRPKMS+V+ +L  +++  T
Sbjct  342  ASDSKKFHLIVDPRLEGQYCIKSAQKLASLANKCLSKQPKSRPKMSDVVGILGTIIDEQT  401

Query  440  GIGD--PRPSI  414
               +  P+P I
Sbjct  402  PQDEVAPQPVI  412



>ref|XP_010321720.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Solanum lycopersicum]
Length=323

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 153/176 (87%), Gaps = 1/176 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK SNILLDE + AKLSDFGLAR GP  GLTH+ST
Sbjct  74   KIAQDAARGLAYLHEEMDFQLIFRDFKPSNILLDEDFIAKLSDFGLARQGPTAGLTHVST  133

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTGRLT+K+DVWS+GV LYELITGR  L+RN PR+EQKLLEWV+P+
Sbjct  134  SVVGTVGYAAPEYVQTGRLTAKSDVWSFGVVLYELITGRRVLERNLPRAEQKLLEWVRPY  193

Query  617  LSDSKKFRQIIDPRLEG-NILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVL  453
            +SD+KKF  I+DPRLEG + +KSA +L+ +AN+CL ++ +SRP+MSEV+DML  ++
Sbjct  194  VSDTKKFHFILDPRLEGHDCIKSAQRLASLANKCLAKNARSRPRMSEVVDMLENII  249



>ref|XP_010510559.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Camelina 
sativa]
Length=465

 Score =   265 bits (678),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 154/178 (87%), Gaps = 2/178 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFKSSNILLDE + AKLSDFGLAR GP EGL H+ST
Sbjct  218  KIAQDAAQGLAYLHEEMDFQLIFRDFKSSNILLDEGFGAKLSDFGLARQGPPEGLGHVST  277

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTG+LT+K+DVWS+GV LYELITGR  +DRNRPR EQKLLEWVKP+
Sbjct  278  SVVGTVGYAAPEYVQTGKLTAKSDVWSFGVVLYELITGRRAVDRNRPRGEQKLLEWVKPY  337

Query  617  LSDSKKFRQIIDPRLEGN--ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE  450
            +SDSKKF  I+DPRLEG    +KS  +++ +AN+CL++ PKSRP+MSEV+ +L ++++
Sbjct  338  VSDSKKFHVIVDPRLEGQYYCMKSVQRVAALANKCLMKQPKSRPRMSEVVSLLGRIID  395



>ref|XP_009590399.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Nicotiana tomentosiformis]
Length=463

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 154/176 (88%), Gaps = 1/176 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK SNILLDE +NAKLSDFGLAR GP  GL+HIST
Sbjct  191  KIAQDAARGLAYLHEEMDFQLIFRDFKPSNILLDEDFNAKLSDFGLARQGPAAGLSHIST  250

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTGRLT+K+DVWS+GV LYELITGR  L+RN PR+EQKLLEWV+P+
Sbjct  251  SVVGTVGYAAPEYVQTGRLTAKSDVWSFGVVLYELITGRRVLERNLPRAEQKLLEWVRPY  310

Query  617  LSDSKKFRQIIDPRLEG-NILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVL  453
            + DSKKF  I+DPRLEG + +KSA +L+ +AN+CL ++P+SRPKMSEV+D+L  ++
Sbjct  311  VLDSKKFHFILDPRLEGHDCVKSAQRLASLANKCLTKNPRSRPKMSEVVDILGNII  366



>ref|XP_008464123.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Cucumis 
melo]
Length=448

 Score =   265 bits (676),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRD K+SNILLDE++NAKLSDFGLAR GP EG++H+ST
Sbjct  198  KIAQDAARGLAYLHEEMDFQLIFRDLKASNILLDEEFNAKLSDFGLARQGPPEGISHVST  257

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTGRLT+K+DVWS+GV LYELITGR  ++RN PR+EQKLLEW+KP+
Sbjct  258  SVVGTIGYAAPEYVQTGRLTAKSDVWSFGVVLYELITGRRAVERNLPRNEQKLLEWIKPY  317

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD KKF  I+DPRLEG   +KSA KL+ +AN+CL++ PK+RPKMSEV+++L  ++  S 
Sbjct  318  ISDPKKFHLIVDPRLEGECNIKSAQKLASLANKCLMKQPKNRPKMSEVVEILGNIISESC  377



>ref|XP_010470024.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Camelina 
sativa]
Length=465

 Score =   265 bits (677),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 154/178 (87%), Gaps = 2/178 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFKSSNILLDE + AKLSDFGLAR GP EGL H+ST
Sbjct  218  KIAQDAAQGLAYLHEEMDFQLIFRDFKSSNILLDEGFGAKLSDFGLARQGPPEGLGHVST  277

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTG+LT+K+DVWS+GV LYELITGR  +DRNRPR EQKLLEWVKP+
Sbjct  278  SVVGTVGYAAPEYVQTGKLTAKSDVWSFGVVLYELITGRRAVDRNRPRGEQKLLEWVKPY  337

Query  617  LSDSKKFRQIIDPRLEGN--ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE  450
            +SDSKKF  I+DPRLEG    +KS  +++ +AN+CL++ PKSRP+MSEV+ +L ++++
Sbjct  338  VSDSKKFHVIVDPRLEGQYYCMKSVQRVAALANKCLMKQPKSRPRMSEVVSLLGRIID  395



>ref|XP_004143119.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Cucumis 
sativus]
 gb|KGN47145.1| hypothetical protein Csa_6G190360 [Cucumis sativus]
Length=448

 Score =   264 bits (675),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRD K+SNILLDE++NAKLSDFGLAR GP EG++H+ST
Sbjct  198  KIAQDAARGLAYLHEEMDFQLIFRDLKASNILLDEEFNAKLSDFGLARQGPPEGISHVST  257

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTGRLT+K+DVWS+GV LYELITGR  ++RN PR+EQKLLEW+KP+
Sbjct  258  SVVGTIGYAAPEYVQTGRLTAKSDVWSFGVVLYELITGRRAVERNLPRNEQKLLEWIKPY  317

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD KKF  I+DPRLEG   +KSA KL+ +AN+CL++ PK+RPKMSEV++ L  ++  S 
Sbjct  318  ISDPKKFHLIVDPRLEGECNIKSAQKLASLANKCLMKQPKNRPKMSEVVEFLGNIISESC  377



>ref|XP_010521845.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Tarenaya 
hassleriana]
Length=461

 Score =   265 bits (676),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFKSSNILLD+++NAKLSDFGLAR GP EGL H+ST
Sbjct  214  KIAQDAAQGLAYLHEEMDFQLIFRDFKSSNILLDKEFNAKLSDFGLARQGPPEGLGHVST  273

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTG+LT+K+DVWS+GV LYELITGR  +DRN PR EQKLLEW +P+
Sbjct  274  SVVGTVGYAAPEYVQTGKLTAKSDVWSFGVVLYELITGRRAVDRNLPRGEQKLLEWARPY  333

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAS  444
            +SDSKKF  I+DPRLE    LKSA KL+ +ANRCL++ PKSRP+MSEV+ +L  +++ +
Sbjct  334  VSDSKKFHIIVDPRLESQYCLKSAQKLAALANRCLMKQPKSRPRMSEVVTVLGNIIDEA  392



>ref|XP_009590397.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Nicotiana tomentosiformis]
Length=475

 Score =   265 bits (677),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 154/176 (88%), Gaps = 1/176 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK SNILLDE +NAKLSDFGLAR GP  GL+HIST
Sbjct  191  KIAQDAARGLAYLHEEMDFQLIFRDFKPSNILLDEDFNAKLSDFGLARQGPAAGLSHIST  250

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTGRLT+K+DVWS+GV LYELITGR  L+RN PR+EQKLLEWV+P+
Sbjct  251  SVVGTVGYAAPEYVQTGRLTAKSDVWSFGVVLYELITGRRVLERNLPRAEQKLLEWVRPY  310

Query  617  LSDSKKFRQIIDPRLEG-NILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVL  453
            + DSKKF  I+DPRLEG + +KSA +L+ +AN+CL ++P+SRPKMSEV+D+L  ++
Sbjct  311  VLDSKKFHFILDPRLEGHDCVKSAQRLASLANKCLTKNPRSRPKMSEVVDILGNII  366



>ref|XP_010414462.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Camelina 
sativa]
Length=464

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 154/178 (87%), Gaps = 2/178 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFKSSNILLDE + AKLSDFGLAR GP EGL H+ST
Sbjct  217  KIAQDAAQGLAYLHEEMDFQLIFRDFKSSNILLDEGFGAKLSDFGLARQGPPEGLGHVST  276

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTG+LT+K+DVWS+GV LYELITGR  +DRNRPR EQKLL+WVKP+
Sbjct  277  SVVGTVGYAAPEYVQTGKLTAKSDVWSFGVVLYELITGRRAVDRNRPRGEQKLLKWVKPY  336

Query  617  LSDSKKFRQIIDPRLEGN--ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE  450
            +SDSKKF  I+DPRLEG    +KS  +++ +AN+CL++ PKSRP+MSEV+ +L ++++
Sbjct  337  VSDSKKFHVIVDPRLEGQYYCMKSVQRVAALANKCLMKQPKSRPRMSEVVSLLGRIID  394



>ref|XP_006409927.1| hypothetical protein EUTSA_v10017635mg [Eutrema salsugineum]
 gb|ESQ51380.1| hypothetical protein EUTSA_v10017635mg [Eutrema salsugineum]
Length=450

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 171/219 (78%), Gaps = 9/219 (4%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFKSSNILLDE++ AKLSDFGLAR GP+EGL H+ST
Sbjct  209  KIAQDAAQGLAYLHEEMDFQLIFRDFKSSNILLDERFCAKLSDFGLARQGPREGLGHVST  268

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTG+LT+K+DVWS+GV LYELITGR  +DRN PR EQKLLEWVKP+
Sbjct  269  SVVGTVGYAAPEYVQTGKLTAKSDVWSFGVVLYELITGRRAVDRNLPRGEQKLLEWVKPY  328

Query  617  LSDSKKFRQIIDPRLEGN--ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE--  450
            +SDSKKF  I+DPRL+G    +KS  +++ +AN+CL++ PKSRP+MSEV+ +L  +++  
Sbjct  329  VSDSKKFHAIVDPRLQGRDYSMKSVQRVAALANKCLMKQPKSRPRMSEVVSVLGSIIDEE  388

Query  449  ---ASTGIGDPRPSIVHSDPISTKDEVDRKGKRRITDMK  342
               A   + D    IV ++P   K     K ++++ D++
Sbjct  389  RENAPPPLADETEEIVEAEPEVVKQ--GSKYRKKVLDIR  425



>ref|XP_002881023.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57282.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=461

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 154/178 (87%), Gaps = 2/178 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFKSSNILLDE++ AKLSDFGLAR GP EGL H+ST
Sbjct  214  KIAQDAAQGLAYLHEEMDFQLIFRDFKSSNILLDERFGAKLSDFGLARQGPPEGLGHVST  273

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTG+LT+K+DVWS+GV LYELITGR  +DRNRPR EQ LLEWVKP+
Sbjct  274  SVVGTVGYAAPEYVQTGKLTAKSDVWSFGVVLYELITGRRAVDRNRPRGEQNLLEWVKPY  333

Query  617  LSDSKKFRQIIDPRLEGN--ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE  450
            +SDSKKF  I+DPRLEG    +KS  +++ +AN+CL++ PKSRP+MSEV+ ++ ++++
Sbjct  334  VSDSKKFHAIVDPRLEGQYYCMKSVQRVAALANKCLMKQPKSRPRMSEVVALIGRIID  391



>ref|XP_008223696.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Prunus mume]
Length=444

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 160/201 (80%), Gaps = 17/201 (8%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK SNILLDE +NAKLSDFGLAR GP +G +H+ST
Sbjct  198  KIAQDAARGLAYLHEEMDFQLIFRDFKPSNILLDEDFNAKLSDFGLARQGPPQGTSHVST  257

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTGRLT+K+DVWS+GV L+ELITGR  ++RN PRSEQKLLEWV+P+
Sbjct  258  SVVGTIGYAAPEYVQTGRLTAKSDVWSFGVVLFELITGRRAVERNLPRSEQKLLEWVRPY  317

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SDSKKF  I+DPRLEG   +KSA KL+ +ANRCL + PKSRPKMSEV+ +L  ++    
Sbjct  318  VSDSKKFHLIVDPRLEGQYCIKSAQKLASLANRCLSKQPKSRPKMSEVVVVLGSII----  373

Query  440  GIGDPRPSIVHSDPISTKDEV  378
                        D +S++DEV
Sbjct  374  ------------DELSSQDEV  382



>dbj|BAJ90857.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=467

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 147/177 (83%), Gaps = 1/177 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            ++A DAA GL Y HE MDFQIIFRD K+SNILLDE WNAKLSDFG+AR GP EGLTH+ST
Sbjct  237  RVALDAARGLKYLHEDMDFQIIFRDLKTSNILLDENWNAKLSDFGMAREGPTEGLTHVST  296

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRL +K+D+WSYGV LYELITGR P+D  RPR EQKLLEWVKP+
Sbjct  297  AVVGTLGYAAPEYIQTGRLNAKSDIWSYGVLLYELITGRRPIDGERPRGEQKLLEWVKPY  356

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE  450
            +SD+ + R I+DP+LEG   +KS  KL  VANRCL R PK+RP+M +VLDM+ K ++
Sbjct  357  ISDTNRLRLIVDPKLEGRYSIKSVAKLVTVANRCLARLPKARPRMGDVLDMVQKAVD  413



>ref|XP_007132064.1| hypothetical protein PHAVU_011G063900g [Phaseolus vulgaris]
 gb|ESW04058.1| hypothetical protein PHAVU_011G063900g [Phaseolus vulgaris]
Length=439

 Score =   262 bits (670),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 164/204 (80%), Gaps = 5/204 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GLAY HE MDFQ+IFRDFK+SNILLDE +NAKLSDFGLAR GP EG  ++ST
Sbjct  189  RIAQDAARGLAYLHEEMDFQLIFRDFKASNILLDENFNAKLSDFGLARQGPSEGSGYVST  248

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEYVQTG+LT+K+DVWS+GV LYELITGR  ++RN P++EQKLLEWV+P+
Sbjct  249  AVVGTIGYAAPEYVQTGKLTAKSDVWSFGVVLYELITGRRAVERNLPKTEQKLLEWVRPY  308

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD +KF  I+DPRL+G   +KSAHK++++AN+CL++ PKSRPKMSEV+D L  ++  + 
Sbjct  309  VSDPRKFHHIVDPRLKGQYCIKSAHKIAILANKCLMKQPKSRPKMSEVVDSLGSIIIET-  367

Query  440  GIGDPRPSIVHSDPISTKDEVDRK  369
               D R        ++ ++E + K
Sbjct  368  ---DTRDECFPQAAVAAREEKEEK  388



>ref|XP_004240362.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Solanum lycopersicum]
Length=444

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 153/176 (87%), Gaps = 1/176 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK SNILLDE + AKLSDFGLAR GP  GLTH+ST
Sbjct  195  KIAQDAARGLAYLHEEMDFQLIFRDFKPSNILLDEDFIAKLSDFGLARQGPTAGLTHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTGRLT+K+DVWS+GV LYELITGR  L+RN PR+EQKLLEWV+P+
Sbjct  255  SVVGTVGYAAPEYVQTGRLTAKSDVWSFGVVLYELITGRRVLERNLPRAEQKLLEWVRPY  314

Query  617  LSDSKKFRQIIDPRLEG-NILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVL  453
            +SD+KKF  I+DPRLEG + +KSA +L+ +AN+CL ++ +SRP+MSEV+DML  ++
Sbjct  315  VSDTKKFHFILDPRLEGHDCIKSAQRLASLANKCLAKNARSRPRMSEVVDMLENII  370



>ref|NP_001235210.1| protein kinase [Glycine max]
 gb|ACM89550.1| protein kinase [Glycine max]
Length=446

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 155/176 (88%), Gaps = 1/176 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GLAY HE MDFQ+IFRDFK+SNILLDE +NAKLSDFGLAR GP EG  ++ST
Sbjct  194  RIAQDAARGLAYLHEEMDFQLIFRDFKTSNILLDENFNAKLSDFGLARQGPSEGSGYVST  253

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEYVQTG+LT+K+DVWS+GV LYELITGR  ++RN P++EQKLLEWV+P+
Sbjct  254  AVVGTIGYAAPEYVQTGKLTAKSDVWSFGVVLYELITGRRAVERNLPKNEQKLLEWVRPY  313

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVL  453
            +SD +KF +I+DPRLEG   +KSAHKL+++AN+C+++ PKSRPKMSEV++ L  ++
Sbjct  314  VSDPRKFYRIVDPRLEGQYCIKSAHKLAILANKCIMKQPKSRPKMSEVVESLGSII  369



>dbj|BAK00090.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 147/177 (83%), Gaps = 1/177 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            ++A DAA GL Y HE MDFQIIFRD K+SNILLDE WNA+LSDFG+AR GP EGLTH+ST
Sbjct  214  RVALDAARGLKYLHEDMDFQIIFRDLKTSNILLDENWNAELSDFGMAREGPTEGLTHVST  273

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEY+QTGRL +K+D+WSYGV LYELITGR P+D  RPR EQKLLEWVKP+
Sbjct  274  AVVGTLGYAAPEYIQTGRLNAKSDIWSYGVLLYELITGRRPIDGERPRGEQKLLEWVKPY  333

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE  450
            +SD+ + R I+DP+LEG   +KS  KL  VANRCL R PK+RP+M +VLDM+ K ++
Sbjct  334  ISDTNRLRLIVDPKLEGRYSIKSVAKLVTVANRCLARLPKARPRMGDVLDMVQKAVD  390



>gb|KEH30166.1| receptor-like kinase [Medicago truncatula]
Length=448

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GLAY HE MDFQ+IFRDFK+SNILLDE +NAKLSDFGLAR GP EG  ++ST
Sbjct  198  RIAQDAARGLAYLHEEMDFQLIFRDFKTSNILLDEDFNAKLSDFGLARQGPAEGFGYVST  257

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GYA+PEYV TG+LT+K+DVWS+GV LYELITGR  ++RN P++EQKLL+WV+P+
Sbjct  258  AVVGTIGYAAPEYVHTGKLTAKSDVWSFGVVLYELITGRRAVERNLPKNEQKLLDWVRPY  317

Query  617  LSDSKKFRQIIDPRLEG-NILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SD KKF  I+DPRLE  + +KSAHKL+++AN+CL++ PKSRPKMSEV+++L  +++ S 
Sbjct  318  VSDPKKFHHIVDPRLEAQDCIKSAHKLAVLANKCLMKQPKSRPKMSEVVEILGNIIDESV  377



>gb|KHN32127.1| Putative receptor-like protein kinase [Glycine soja]
Length=278

 Score =   256 bits (654),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 152/176 (86%), Gaps = 1/176 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IARDAA GLAY HE MDFQ+IFRDFK+SNILLDE +NAKLSDFGLAR GP EG  ++ST
Sbjct  26   RIARDAARGLAYLHEEMDFQLIFRDFKTSNILLDENFNAKLSDFGLARQGPSEGSGYVST  85

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GY +PEYV TG+LT+K+DVWS+GV LYELITGR  ++RN PR+EQKLL+WV+P+
Sbjct  86   AVVGTIGYVAPEYVLTGKLTAKSDVWSFGVVLYELITGRRVVERNLPRNEQKLLDWVRPY  145

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVL  453
            +SD +KF  I+DPRL+G   +KSAHKL+++AN+CL++ PKSRPKMSEV++ L  ++
Sbjct  146  VSDPRKFHHILDPRLKGQYCIKSAHKLAILANKCLMKQPKSRPKMSEVVESLGSII  201



>ref|XP_007208565.1| hypothetical protein PRUPE_ppa023937mg [Prunus persica]
 gb|EMJ09764.1| hypothetical protein PRUPE_ppa023937mg [Prunus persica]
Length=444

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 159/201 (79%), Gaps = 17/201 (8%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK SNILLDE +NAKLSDFGLAR GP EG +H+ST
Sbjct  198  KIAQDAARGLAYLHEEMDFQLIFRDFKPSNILLDEDFNAKLSDFGLARQGPPEGTSHVST  257

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYVQTGRLT+K+DVWS+GV L+ELITGR  ++RN PRSEQKLLEWV+P+
Sbjct  258  SVVGTIGYAAPEYVQTGRLTAKSDVWSFGVVLFELITGRRAVERNLPRSEQKLLEWVRPY  317

Query  617  LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SDSKKF  I+D RLEG   +KSA KL+ +ANRCL + PKSRPKMSEV+ +L  ++    
Sbjct  318  VSDSKKFHLIVDHRLEGQFCIKSAQKLASLANRCLSKQPKSRPKMSEVVVVLRSII----  373

Query  440  GIGDPRPSIVHSDPISTKDEV  378
                        D +S++DEV
Sbjct  374  ------------DELSSQDEV  382



>ref|XP_008779202.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Phoenix 
dactylifera]
Length=442

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK+SNILLDE +NAKLSDFG AR GP EG+ H+ST
Sbjct  195  KIAQDAARGLAYLHEEMDFQLIFRDFKTSNILLDEDFNAKLSDFGFARHGPAEGVGHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYV TGRLT+K+DVWS+GV LYELITGR  +DRN PR+EQKLL+WV+P+
Sbjct  255  SVVGTVGYAAPEYVHTGRLTAKSDVWSFGVVLYELITGRRSVDRNLPRNEQKLLDWVRPY  314

Query  617  LSDSKKFRQIIDPRLEG-NILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
             +D KKF  I+DPRLEG N ++S  KL  +ANRCL++ PKSRP+MSEV+++L++++E   
Sbjct  315  ATDPKKFHIIVDPRLEGQNCVQSVRKLIALANRCLMKQPKSRPRMSEVVEVLDQIIEILN  374

Query  440  G  438
            G
Sbjct  375  G  375



>gb|KFK32248.1| hypothetical protein AALP_AA6G217300 [Arabis alpina]
Length=441

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 151/177 (85%), Gaps = 2/177 (1%)
 Frame = -1

Query  974  IARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHISTA  795
            IARDAA GLAY HE MDFQ+IFRDFKSSNILLDE++ AKLSDFGLAR GP EGL H+ST+
Sbjct  193  IARDAAHGLAYLHEEMDFQLIFRDFKSSNILLDERFRAKLSDFGLARQGPPEGLGHVSTS  252

Query  794  VVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPHL  615
            VVGT+GYA+PEYVQTGRLT+K+DVWS+GV LYELITGR  LDRN PR EQKLLEWVKP++
Sbjct  253  VVGTIGYAAPEYVQTGRLTAKSDVWSFGVVLYELITGRRALDRNLPRGEQKLLEWVKPYV  312

Query  614  SDSKKFRQIIDPRLEGN--ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE  450
            SDSKKF  I+DPRL+     +KS  +++ +AN+CL++ PKSRPKMSE++ +L  +++
Sbjct  313  SDSKKFHMIVDPRLQDQYYCMKSVQRVAALANKCLMKQPKSRPKMSEIVLLLGSIID  369



>ref|XP_010685749.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Beta 
vulgaris subsp. vulgaris]
Length=469

 Score =   260 bits (665),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 155/182 (85%), Gaps = 3/182 (2%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK+SN+LLDE +NAKLSDFGLARLGP EG +H+ST
Sbjct  222  KIAQDAARGLAYLHEEMDFQLIFRDFKTSNVLLDEDFNAKLSDFGLARLGPAEGYSHVST  281

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYV TG+LT K+DVWS+GV LYELITGR  ++RN PR+EQKLLEWV+P+
Sbjct  282  SVVGTVGYAAPEYVLTGKLTIKSDVWSFGVVLYELITGRRAVERNLPRNEQKLLEWVRPY  341

Query  617  LSDSKKFRQIIDPRLEGNIL-KSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVL--EA  447
            +SDSKKF  I+D RLEG    KSA +L+ +AN+CL + PKSRPKMSEV+++L  ++  EA
Sbjct  342  ISDSKKFHLIVDSRLEGKYCKKSAQRLASLANKCLAKQPKSRPKMSEVVEILGSIIDEEA  401

Query  446  ST  441
            S+
Sbjct  402  SS  403



>ref|XP_010931273.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Elaeis 
guineensis]
Length=442

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 171/232 (74%), Gaps = 17/232 (7%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRDFK+SNILLDE +NAKLSDFG AR GP EG+ H+ST
Sbjct  195  KIAQDAARGLAYLHEEMDFQLIFRDFKTSNILLDEDFNAKLSDFGFARHGPAEGVGHVST  254

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYV TGRLT+K+DVWSYGV LYELITGR  +DRN PR+EQKLL+WV+P+
Sbjct  255  SVVGTVGYAAPEYVHTGRLTAKSDVWSYGVVLYELITGRRSVDRNLPRNEQKLLDWVRPY  314

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE---  450
             +D KKF  IIDPRLE    +KS  KL  +ANRCL++ PKSRP+MSEV+++L +++E   
Sbjct  315  ATDPKKFHIIIDPRLEEQYCVKSVRKLITLANRCLMKQPKSRPRMSEVVEVLEQIIEMLN  374

Query  449  ASTGIGDPRPSIVHSDPISTKDEVDRKGKRRITDMKVGDGSWLVRIWSLKQL  294
              TG     PS             DR+    +T++   +G+   R++ +++L
Sbjct  375  GETGGAITAPS-------------DREDTTDVTEILKENGNGRSRVFDIREL  413



>ref|XP_010441480.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein 
At5g47260, partial [Camelina sativa]
Length=1341

 Score =   271 bits (694),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 169/214 (79%), Gaps = 7/214 (3%)
 Frame = -1

Query  977   KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
             +IA+DAA GL Y  E MDF+IIFRDFKSSNILLDE W AKLS FGLA LGP +  TH+ST
Sbjct  1103  RIAQDAARGLTYLLEEMDFEIIFRDFKSSNILLDEDWIAKLSGFGLASLGPSKEPTHVST  1162

Query  797   AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             +VVGT+GYA+PEY+Q GRLT K+ VW+YGVFLYELITGR P+DR++P+ EQKLLEWVKP+
Sbjct  1163  SVVGTIGYAAPEYIQAGRLTLKSHVWAYGVFLYELITGRRPIDRSKPKGEQKLLEWVKPY  1222

Query  617   LSDSKKFRQIIDPRLEGNI-LKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
             LSD++KF+ I+D RLEG   +KS  KL++VANRCLVR+PK+RPKMSEVL+M+ K++EAS 
Sbjct  1223  LSDTRKFKLILDLRLEGKYPIKSVQKLAVVANRCLVRNPKARPKMSEVLEMVTKIVEASI  1282

Query  440   GIGDPRPSIVHSDPI-STKDEVDRKGKRRITDMK  342
             G G P+      DP+ S K   D  G ++ T  K
Sbjct  1283  GNGSPQL-----DPLNSLKASRDAAGGQKQTQGK  1311



>gb|EYU18978.1| hypothetical protein MIMGU_mgv1a006424mg [Erythranthe guttata]
Length=444

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 153/177 (86%), Gaps = 2/177 (1%)
 Frame = -1

Query  974  IARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHISTA  795
            IARDAA GLAY HE M+FQ+IFRDFK+SNILLDE +NAKLSDFGLAR GP  GL H+ST+
Sbjct  212  IARDAARGLAYLHEEMEFQLIFRDFKTSNILLDEDFNAKLSDFGLARQGPAAGLGHVSTS  271

Query  794  VVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPHL  615
            VVGT+GYA+PEYV TGRLT+K+DVWS+GV LYELITGR  L+RN PR EQKLLEWV+P++
Sbjct  272  VVGTVGYAAPEYVHTGRLTAKSDVWSFGVVLYELITGRRVLERNLPRGEQKLLEWVRPYV  331

Query  614  SDSKKFRQIIDPR-LEG-NILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE  450
            SDS+KF  I+D R LEG N +KSA KL+ +AN+CL+++PKSRPKMSEV++ML  +++
Sbjct  332  SDSRKFHMILDQRLLEGHNCMKSAQKLASLANKCLMKNPKSRPKMSEVIEMLGGIID  388



>ref|XP_009364394.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Pyrus 
x bretschneideri]
Length=443

 Score =   257 bits (656),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 149/177 (84%), Gaps = 1/177 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA DAA GLAY HE MDFQ+IFRDFK SNILLDE +NAKLSDFGLAR GP EG +H+ST
Sbjct  197  RIAHDAARGLAYLHEEMDFQLIFRDFKPSNILLDEDFNAKLSDFGLARQGPPEGTSHVST  256

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             +VGT+GYA+PEYV TG+LT+K+DVWS+GV LYELITGR  +DRN PR+EQKLLEWVKP+
Sbjct  257  TIVGTIGYAAPEYVHTGKLTAKSDVWSFGVVLYELITGRRAVDRNLPRNEQKLLEWVKPY  316

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE  450
            + DSKKF  I+DPRLEG   +KSA  L+ +ANRCL++ PKSRPKMSEV+ +L  +++
Sbjct  317  VPDSKKFHVIVDPRLEGQYCIKSAQNLASLANRCLLKQPKSRPKMSEVVGVLRCIID  373



>emb|CDP09061.1| unnamed protein product [Coffea canephora]
Length=474

 Score =   257 bits (657),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 159/201 (79%), Gaps = 3/201 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            KIA+DAA GLAY HE MDFQ+IFRD K+SNILLDE + AKLSDFGLAR GP  G  H+ST
Sbjct  211  KIAQDAARGLAYLHEEMDFQLIFRDLKASNILLDEDFKAKLSDFGLARQGPTAGFGHVST  270

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            +VVGT+GYA+PEYV TGRLT+K+DVWS+GV LYELITGR  L+RN PR EQKLLEWV+P+
Sbjct  271  SVVGTVGYAAPEYVHTGRLTAKSDVWSFGVVLYELITGRRVLERNLPRGEQKLLEWVRPY  330

Query  617  LSDSKKFRQIIDPRLEG-NILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLEAST  441
            +SDSKKF  I+DPRLEG + LKSA +L+ VAN+CL++  KSRP+MSEV++ML  ++ + T
Sbjct  331  VSDSKKFHLILDPRLEGKDCLKSAQRLASVANKCLLKQSKSRPRMSEVVEMLGNII-SET  389

Query  440  GIGDPRPSIVHSDPISTKDEV  378
               D  P  V+      K+EV
Sbjct  390  ACLDRVPEGVNETE-DVKEEV  409



>ref|XP_003539672.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
[Glycine max]
Length=448

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 152/176 (86%), Gaps = 1/176 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IARDAA GLAY HE MDFQ+IFRDFK+SNILLDE +NAKLSDFGLAR GP EG  ++ST
Sbjct  196  RIARDAARGLAYLHEEMDFQLIFRDFKTSNILLDENFNAKLSDFGLARQGPSEGSGYVST  255

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
            AVVGT+GY +PEYV TG+LT+K+DVWS+GV LYELITGR  ++RN PR+EQKLL+WV+P+
Sbjct  256  AVVGTIGYVAPEYVLTGKLTAKSDVWSFGVVLYELITGRRVVERNLPRNEQKLLDWVRPY  315

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVL  453
            +SD +KF  I+DPRL+G   +KSAHKL+++AN+CL++ PKSRPKMSEV++ L  ++
Sbjct  316  VSDPRKFHHILDPRLKGQYCIKSAHKLAILANKCLMKQPKSRPKMSEVVESLGSII  371



>ref|XP_008357170.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Malus 
domestica]
Length=444

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 148/177 (84%), Gaps = 1/177 (1%)
 Frame = -1

Query  977  KIARDAACGLAYXHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPQEGLTHIST  798
            +IA+DAA GLAY HE MDFQ+IFRDFK SNILLDE +NAKLSDFGLAR GP EG +H+ST
Sbjct  197  RIAQDAARGLAYLHEEMDFQLIFRDFKPSNILLDEDFNAKLSDFGLARQGPPEGTSHVST  256

Query  797  AVVGTMGYASPEYVQTGRLTSKNDVWSYGVFLYELITGRPPLDRNRPRSEQKLLEWVKPH  618
             +VGT+GYA+PEYV TG+LT+K+DVWS+GV LYELITGR  +DRN PR+EQ LLEWVKP+
Sbjct  257  TIVGTIGYAAPEYVHTGKLTAKSDVWSFGVVLYELITGRRAVDRNLPRNEQNLLEWVKPY  316

Query  617  LSDSKKFRQIIDPRLEGN-ILKSAHKLSLVANRCLVRHPKSRPKMSEVLDMLNKVLE  450
            + DSKKF  I+DPRLEG   +KSA  L+ +ANRCL + PKSRPKMSEV+ +L  ++E
Sbjct  317  VPDSKKFHVIVDPRLEGQYCVKSAQNLASLANRCLSKQPKSRPKMSEVVGVLRCIIE  373



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2380164130925