BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7003

Length=948
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011071583.1|  PREDICTED: FRIGIDA-like protein 4a                 283   1e-87   Sesamum indicum [beniseed]
ref|XP_006489388.1|  PREDICTED: FRIGIDA-like protein 4a-like            281   2e-86   Citrus sinensis [apfelsine]
ref|XP_002517136.1|  Protein FRIGIDA, putative                          280   2e-86   Ricinus communis
ref|XP_011026525.1|  PREDICTED: FRIGIDA-like protein 4a                 277   4e-85   Populus euphratica
ref|XP_012069629.1|  PREDICTED: FRIGIDA-like protein 4a                 276   8e-85   Jatropha curcas
ref|XP_006360794.1|  PREDICTED: FRIGIDA-like protein 4a-like            275   2e-84   Solanum tuberosum [potatoes]
ref|XP_002311627.2|  hydroxyproline-rich glycoprotein                   275   3e-84   Populus trichocarpa [western balsam poplar]
ref|XP_004247354.1|  PREDICTED: FRIGIDA-like protein 4a                 272   2e-83   Solanum lycopersicum
gb|EYU45654.1|  hypothetical protein MIMGU_mgv1a004401mg                272   4e-83   Erythranthe guttata [common monkey flower]
ref|XP_007034760.1|  FRIGIDA-like protein isoform 1                     272   4e-83   
gb|AEK20760.1|  FRIGIDA                                                 271   1e-82   Coffea arabica [arabica coffee]
emb|CDO99060.1|  unnamed protein product                                260   2e-82   Coffea canephora [robusta coffee]
gb|KHG27689.1|  Protein FRIGIDA -like protein                           270   3e-82   Gossypium arboreum [tree cotton]
emb|CAN69766.1|  hypothetical protein VITISV_022061                     270   3e-82   Vitis vinifera
ref|XP_002282465.1|  PREDICTED: FRIGIDA-like protein 4a                 270   4e-82   Vitis vinifera
gb|KDO74576.1|  hypothetical protein CISIN_1g010192mg                   268   7e-82   Citrus sinensis [apfelsine]
gb|KJB28346.1|  hypothetical protein B456_005G042900                    274   3e-81   Gossypium raimondii
gb|KEH43877.1|  frigida-LIKE protein                                    260   9e-79   Medicago truncatula
ref|XP_010090919.1|  hypothetical protein L484_004461                   260   1e-78   Morus notabilis
gb|KJB38152.1|  hypothetical protein B456_006G239300                    256   1e-78   Gossypium raimondii
gb|AFP97615.1|  frigida-like protein                                    259   5e-78   Medicago sativa [alfalfa]
ref|XP_003556050.1|  PREDICTED: FRIGIDA-like protein 4a-like            259   5e-78   
gb|KHN15769.1|  hypothetical protein glysoja_012561                     250   5e-78   Glycine soja [wild soybean]
gb|KJB38151.1|  hypothetical protein B456_006G239300                    258   1e-77   Gossypium raimondii
gb|ABM05952.1|  proline-rich protein                                    248   2e-77   Gossypium hirsutum [American cotton]
ref|XP_009610915.1|  PREDICTED: FRIGIDA-like protein 4a                 257   2e-77   Nicotiana tomentosiformis
ref|XP_007225712.1|  hypothetical protein PRUPE_ppa004224mg             256   4e-77   Prunus persica
gb|KCW60755.1|  hypothetical protein EUGRSUZ_H03480                     255   4e-77   Eucalyptus grandis [rose gum]
ref|XP_009784382.1|  PREDICTED: FRIGIDA-like protein 4a                 256   5e-77   Nicotiana sylvestris
ref|XP_006419936.1|  hypothetical protein CICLE_v100047531mg            246   7e-77   
ref|XP_003536533.1|  PREDICTED: FRIGIDA-like protein 4a-like            256   7e-77   Glycine max [soybeans]
gb|KHG22505.1|  Protein FRIGIDA -like protein                           255   8e-77   Gossypium arboreum [tree cotton]
ref|XP_010024304.1|  PREDICTED: LOW QUALITY PROTEIN: FRIGIDA-like...    255   1e-76   Eucalyptus grandis [rose gum]
ref|XP_007143260.1|  hypothetical protein PHAVU_007G057500g             254   2e-76   Phaseolus vulgaris [French bean]
ref|XP_011659019.1|  PREDICTED: FRIGIDA-like protein 4a                 253   5e-76   Cucumis sativus [cucumbers]
ref|XP_010256039.1|  PREDICTED: FRIGIDA-like protein 4a                 253   5e-76   Nelumbo nucifera [Indian lotus]
ref|XP_008447152.1|  PREDICTED: FRIGIDA-like protein 4a                 253   6e-76   
ref|XP_008340987.1|  PREDICTED: FRIGIDA-like protein 4a                 253   6e-76   
ref|XP_006414627.1|  hypothetical protein EUTSA_v10024868mg             253   8e-76   Eutrema salsugineum [saltwater cress]
ref|XP_009369844.1|  PREDICTED: FRIGIDA-like protein 4a                 248   9e-74   Pyrus x bretschneideri [bai li]
ref|XP_010695287.1|  PREDICTED: FRIGIDA-like protein 4a                 247   2e-73   Beta vulgaris subsp. vulgaris [field beet]
gb|ACV83306.2|  hypothetical protein UP-5                               236   5e-73   Dimocarpus longan [longan]
ref|XP_010449973.1|  PREDICTED: FRIGIDA-like protein 4b                 245   1e-72   Camelina sativa [gold-of-pleasure]
gb|AAL31182.1|  AT4g14900/dl3490c                                       242   7e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567447.1|  FRIGIDA-like protein                                  242   2e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008390891.1|  PREDICTED: FRIGIDA-like protein 4a                 241   2e-71   Malus domestica [apple tree]
gb|KFK43732.1|  hypothetical protein AALP_AA1G165500                    241   2e-71   Arabis alpina [alpine rockcress]
ref|XP_010435051.1|  PREDICTED: FRIGIDA-like protein 4b                 242   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010488272.1|  PREDICTED: FRIGIDA-like protein 4a                 240   7e-71   Camelina sativa [gold-of-pleasure]
ref|XP_002868244.1|  hydroxyproline-rich glycoprotein family protein    240   7e-71   Arabidopsis lyrata subsp. lyrata
ref|NP_566709.1|  FRIGIDA-like protein                                  240   7e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010440374.1|  PREDICTED: FRIGIDA-like protein 4b                 240   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006283490.1|  hypothetical protein CARUB_v10004542mg             240   1e-70   Capsella rubella
gb|KFK39537.1|  hypothetical protein AALP_AA3G257000                    239   1e-70   Arabis alpina [alpine rockcress]
ref|XP_010511354.1|  PREDICTED: FRIGIDA-like protein 4a                 239   2e-70   Camelina sativa [gold-of-pleasure]
gb|KCW60756.1|  hypothetical protein EUGRSUZ_H03480                     238   3e-70   Eucalyptus grandis [rose gum]
ref|XP_010525189.1|  PREDICTED: FRIGIDA-like protein 4a                 238   1e-69   Tarenaya hassleriana [spider flower]
ref|XP_002883367.1|  hydroxyproline-rich glycoprotein family protein    236   3e-69   
emb|CDY34252.1|  BnaA01g24690D                                          236   4e-69   Brassica napus [oilseed rape]
ref|XP_006299103.1|  hypothetical protein CARUB_v10015242mg             236   4e-69   Capsella rubella
ref|XP_010551726.1|  PREDICTED: FRIGIDA-like protein 4a                 233   2e-68   Tarenaya hassleriana [spider flower]
emb|CDY46317.1|  BnaC01g31510D                                          233   5e-68   Brassica napus [oilseed rape]
ref|XP_009108852.1|  PREDICTED: FRIGIDA-like protein 4a                 233   6e-68   Brassica rapa
ref|XP_010466529.1|  PREDICTED: FRIGIDA-like protein 4a                 233   6e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010533277.1|  PREDICTED: FRIGIDA-like protein 4a                 229   2e-66   
ref|XP_004299118.1|  PREDICTED: FRIGIDA-like protein 4a                 220   7e-63   Fragaria vesca subsp. vesca
ref|XP_010277260.1|  PREDICTED: FRIGIDA-like protein 4a                 218   2e-62   Nelumbo nucifera [Indian lotus]
gb|EPS62727.1|  hypothetical protein M569_12062                         211   3e-60   Genlisea aurea
ref|XP_008224458.1|  PREDICTED: FRIGIDA-like protein 4a                 209   2e-59   Prunus mume [ume]
ref|XP_006406163.1|  hypothetical protein EUTSA_v10020440mg             194   2e-53   
ref|XP_009389010.1|  PREDICTED: FRIGIDA-like protein 4a                 187   6e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008796767.1|  PREDICTED: FRIGIDA-like protein 4a                 185   5e-50   Phoenix dactylifera
ref|XP_010906476.1|  PREDICTED: FRIGIDA-like protein 4a                 184   2e-49   Elaeis guineensis
ref|XP_009408489.1|  PREDICTED: FRIGIDA-like protein 4a                 178   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010909467.1|  PREDICTED: FRIGIDA-like protein 4a                 173   1e-45   Elaeis guineensis
ref|XP_008778905.1|  PREDICTED: FRIGIDA-like protein 4a                 170   1e-44   Phoenix dactylifera
ref|XP_006826275.1|  PREDICTED: FRIGIDA-like protein 4a                 169   3e-44   Amborella trichopoda
emb|CDY38318.1|  BnaC05g30110D                                          168   9e-44   Brassica napus [oilseed rape]
gb|AGV54404.1|  frigida protein                                         167   2e-43   Phaseolus vulgaris [French bean]
gb|AGV54236.1|  hydroxyproline-rich glycoprotein                        167   2e-43   Phaseolus vulgaris [French bean]
emb|CAB10269.1|  hydroxyproline-rich glycoprotein homolog               162   6e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CBI26255.3|  unnamed protein product                                150   4e-41   Vitis vinifera
ref|XP_010228309.1|  PREDICTED: FRIGIDA-like protein 4a                 160   6e-41   Brachypodium distachyon [annual false brome]
dbj|BAC83627.1|  putative hydroxyproline-rich glycoprotein              153   1e-38   Oryza sativa Japonica Group [Japonica rice]
gb|EEE66652.1|  hypothetical protein OsJ_23273                          153   3e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009388157.1|  PREDICTED: FRIGIDA-like protein 4a                 143   4e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006658319.1|  PREDICTED: FRIGIDA-like protein 4a-like            146   1e-36   Oryza brachyantha
ref|XP_004955594.1|  PREDICTED: protein FRIGIDA-like                    146   4e-36   Setaria italica
ref|XP_002461525.1|  hypothetical protein SORBIDRAFT_02g004090          142   1e-34   
ref|NP_001051543.1|  Os03g0794900                                       140   6e-34   
gb|EEC76321.1|  hypothetical protein OsI_13877                          140   7e-34   Oryza sativa Indica Group [Indian rice]
gb|EEE60086.1|  hypothetical protein OsJ_12936                          139   7e-34   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK00009.1|  predicted protein                                      136   1e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009395189.1|  PREDICTED: FRIGIDA-like protein 4a                 130   4e-32   
ref|NP_001145922.1|  uncharacterized protein LOC100279445               131   8e-32   Zea mays [maize]
ref|XP_008652075.1|  PREDICTED: FRIGIDA-like protein 4a                 134   1e-31   Zea mays [maize]
ref|XP_006650719.1|  PREDICTED: FRIGIDA-like protein 4a-like            134   1e-31   
tpg|DAA42568.1|  TPA: hypothetical protein ZEAMMB73_160821              132   3e-31   
gb|ABK25209.1|  unknown                                                 131   6e-31   Picea sitchensis
gb|ABR17868.1|  unknown                                                 129   7e-30   Picea sitchensis
ref|XP_010228481.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-3' exorib...    130   2e-29   
ref|XP_006842236.1|  PREDICTED: FRIGIDA-like protein 4a                 127   3e-29   Amborella trichopoda
gb|KDO74579.1|  hypothetical protein CISIN_1g010192mg                   118   9e-27   Citrus sinensis [apfelsine]
gb|KDO74578.1|  hypothetical protein CISIN_1g010192mg                   118   1e-26   Citrus sinensis [apfelsine]
gb|EMS54431.1|  5'-3' exoribonuclease 4                                 118   2e-25   Triticum urartu
gb|EMT08825.1|  5'-3' exoribonuclease 4                                 117   2e-25   
ref|XP_010254145.1|  PREDICTED: FRIGIDA-like protein 4a                 115   3e-25   Nelumbo nucifera [Indian lotus]
gb|KJB38150.1|  hypothetical protein B456_006G239300                    114   3e-25   Gossypium raimondii
gb|AIN75610.1|  FRIGIDA4a                                               111   2e-24   Dimocarpus longan [longan]
ref|XP_007034761.1|  FRIGIDA-like protein isoform 2                     111   2e-24   
gb|KHG13959.1|  Protein FRIGIDA -like protein                           111   8e-24   Gossypium arboreum [tree cotton]
gb|KJB06948.1|  hypothetical protein B456_001G004500                    110   1e-23   Gossypium raimondii
ref|XP_011043451.1|  PREDICTED: FRIGIDA-like protein 4a                 110   2e-23   Populus euphratica
ref|XP_006371900.1|  hypothetical protein POPTR_0018s05910g             110   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_007013214.1|  FRIGIDA-like protein                               109   3e-23   
gb|KDO50860.1|  hypothetical protein CISIN_1g009377mg                   109   4e-23   Citrus sinensis [apfelsine]
gb|AAP31312.2|  ABI3-interacting protein 2                              110   4e-23   Callitropsis nootkatensis [Nootka cypress]
ref|XP_006451127.1|  hypothetical protein CICLE_v10007961mg             109   4e-23   Citrus clementina [clementine]
ref|XP_012076667.1|  PREDICTED: FRIGIDA-like protein 4a                 108   6e-23   Jatropha curcas
gb|AHH02379.1|  FRIGIDA-like protein                                    100   6e-23   Aegiceras corniculatum
ref|XP_008337438.1|  PREDICTED: FRIGIDA-like protein 4a                 108   9e-23   
ref|XP_002514326.1|  conserved hypothetical protein                     108   1e-22   Ricinus communis
ref|NP_001059003.1|  Os07g0173200                                       107   1e-22   
dbj|BAC83628.1|  putative hydroxyproline-rich glycoprotein              106   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010915057.1|  PREDICTED: FRIGIDA-like protein 4b isoform X1      107   2e-22   Elaeis guineensis
ref|XP_007160344.1|  hypothetical protein PHAVU_002G313900g             107   2e-22   Phaseolus vulgaris [French bean]
emb|CBI28087.3|  unnamed protein product                                104   3e-22   Vitis vinifera
ref|XP_007204566.1|  hypothetical protein PRUPE_ppa003799mg             106   4e-22   Prunus persica
ref|XP_008242610.1|  PREDICTED: FRIGIDA-like protein 4a                 106   4e-22   Prunus mume [ume]
ref|XP_002961449.1|  hypothetical protein SELMODRAFT_76871              106   4e-22   
ref|XP_011016586.1|  PREDICTED: FRIGIDA-like protein 4a                 102   5e-22   Populus euphratica
ref|XP_002281155.2|  PREDICTED: FRIGIDA-like protein 4a isoform X2      105   1e-21   Vitis vinifera
ref|XP_010915058.1|  PREDICTED: FRIGIDA-like protein 4b isoform X2      104   1e-21   Elaeis guineensis
ref|XP_010047742.1|  PREDICTED: FRIGIDA-like protein 4a                 104   3e-21   Eucalyptus grandis [rose gum]
ref|XP_004503419.1|  PREDICTED: uncharacterized protein LOC101489761    102   6e-21   Cicer arietinum [garbanzo]
ref|XP_009336927.1|  PREDICTED: FRIGIDA-like protein 4a                 103   7e-21   Pyrus x bretschneideri [bai li]
ref|XP_008386583.1|  PREDICTED: FRIGIDA-like protein 4a                 102   7e-21   
ref|XP_004295864.1|  PREDICTED: truncated FRIGIDA-like protein 1        102   8e-21   Fragaria vesca subsp. vesca
ref|XP_011458926.1|  PREDICTED: FRIGIDA-like protein 4a isoform X2      102   2e-20   Fragaria vesca subsp. vesca
ref|XP_009338897.1|  PREDICTED: FRIGIDA-like protein 2                  101   2e-20   Pyrus x bretschneideri [bai li]
ref|XP_009338911.1|  PREDICTED: FRIGIDA-like protein 2                  101   2e-20   Pyrus x bretschneideri [bai li]
ref|XP_010097353.1|  hypothetical protein L484_010231                   102   2e-20   Morus notabilis
gb|ACJ85672.1|  unknown                                               99.4    2e-20   Medicago truncatula
ref|XP_009347163.1|  PREDICTED: FRIGIDA-like protein 4a                 101   2e-20   Pyrus x bretschneideri [bai li]
ref|XP_009598293.1|  PREDICTED: FRIGIDA-like protein 4a                 100   4e-20   Nicotiana tomentosiformis
ref|XP_004287092.1|  PREDICTED: FRIGIDA-like protein 4a isoform X1      100   4e-20   Fragaria vesca subsp. vesca
ref|XP_008227104.1|  PREDICTED: FRIGIDA-like protein 1                  100   5e-20   Prunus mume [ume]
ref|XP_010271588.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2       100   6e-20   Nelumbo nucifera [Indian lotus]
ref|XP_009766201.1|  PREDICTED: FRIGIDA-like protein 4a                 100   6e-20   Nicotiana sylvestris
gb|AFK43654.1|  unknown                                                 100   6e-20   Medicago truncatula
ref|XP_003629646.1|  Protein FRIGIDA                                    100   6e-20   Medicago truncatula
ref|XP_008780981.1|  PREDICTED: truncated FRIGIDA-like protein 1      99.8    7e-20   Phoenix dactylifera
gb|KHN16599.1|  Protein FRIGIDA                                       98.2    7e-20   Glycine soja [wild soybean]
ref|XP_010271580.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1       100   7e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010270166.1|  PREDICTED: truncated FRIGIDA-like protein 1      99.4    1e-19   Nelumbo nucifera [Indian lotus]
ref|XP_008790629.1|  PREDICTED: FRIGIDA-like protein 3                99.0    1e-19   
ref|XP_010656337.1|  PREDICTED: FRIGIDA-like protein 4a isoform X1    99.0    1e-19   Vitis vinifera
ref|XP_008787217.1|  PREDICTED: FRIGIDA-like protein 3                99.0    2e-19   
ref|XP_008366422.1|  PREDICTED: FRIGIDA-like protein 2                99.0    2e-19   
ref|XP_009401034.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     98.6    2e-19   
gb|KHN44015.1|  Protein FRIGIDA                                       98.6    2e-19   Glycine soja [wild soybean]
ref|XP_009401032.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     98.6    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007211879.1|  hypothetical protein PRUPE_ppa003499mg           98.6    2e-19   
ref|XP_009416846.1|  PREDICTED: truncated FRIGIDA-like protein 1      97.4    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006600926.1|  PREDICTED: FRIGIDA-like protein 3-like           97.8    4e-19   Glycine max [soybeans]
ref|XP_003532490.1|  PREDICTED: FRIGIDA-like protein 4a-like          97.4    4e-19   Glycine max [soybeans]
ref|XP_007020622.1|  FRIGIDA like 1, putative                         97.4    6e-19   
ref|XP_010939086.1|  PREDICTED: FRIGIDA-like protein 3                96.7    1e-18   Elaeis guineensis
ref|XP_010907692.1|  PREDICTED: FRIGIDA-like protein 1                95.9    1e-18   Elaeis guineensis
ref|XP_006858746.1|  PREDICTED: FRIGIDA-like protein 3                95.9    1e-18   Amborella trichopoda
ref|XP_011463627.1|  PREDICTED: FRIGIDA-like protein 3                95.9    2e-18   Fragaria vesca subsp. vesca
gb|KDO62201.1|  hypothetical protein CISIN_1g009061mg                 95.5    2e-18   Citrus sinensis [apfelsine]
ref|XP_006474949.1|  PREDICTED: FRIGIDA-like protein 1-like           95.5    2e-18   Citrus sinensis [apfelsine]
gb|KHN41556.1|  Protein FRIGIDA                                       95.5    3e-18   Glycine soja [wild soybean]
ref|XP_003524673.1|  PREDICTED: FRIGIDA-like protein 3-like isofo...  95.1    3e-18   Glycine max [soybeans]
gb|AIZ49836.1|  ABI3-interacting protein 2                            90.5    3e-18   Araucaria scopulorum
ref|XP_008786398.1|  PREDICTED: FRIGIDA-like protein 4a               94.7    3e-18   Phoenix dactylifera
gb|AIZ49835.1|  ABI3-interacting protein 2                            90.5    3e-18   Araucaria scopulorum
gb|AIZ49823.1|  ABI3-interacting protein 2                            90.5    3e-18   Araucaria humboldtensis
ref|XP_004242450.1|  PREDICTED: FRIGIDA-like protein 3                95.1    3e-18   Solanum lycopersicum
gb|AIZ49833.1|  ABI3-interacting protein 2                            90.5    3e-18   Araucaria rulei
gb|AIZ49820.1|  ABI3-interacting protein 2                            90.5    3e-18   Araucaria muelleri
gb|KHN41626.1|  Protein FRIGIDA                                       92.4    3e-18   Glycine soja [wild soybean]
gb|AIZ49839.1|  ABI3-interacting protein 2                            90.1    3e-18   Araucaria columnaris
gb|AIZ49814.1|  ABI3-interacting protein 2                            90.5    4e-18   Araucaria bernieri
ref|XP_010088834.1|  hypothetical protein L484_020817                 94.7    4e-18   Morus notabilis
ref|XP_006452513.1|  hypothetical protein CICLE_v10007929mg           94.4    5e-18   Citrus clementina [clementine]
emb|CBI23332.3|  unnamed protein product                              90.5    5e-18   Vitis vinifera
ref|XP_009358937.1|  PREDICTED: FRIGIDA-like protein 3                93.6    8e-18   Pyrus x bretschneideri [bai li]
ref|XP_008462976.1|  PREDICTED: FRIGIDA-like protein 1                93.6    9e-18   Cucumis melo [Oriental melon]
emb|CBI33736.3|  unnamed protein product                              91.3    9e-18   Vitis vinifera
ref|XP_010938943.1|  PREDICTED: truncated FRIGIDA-like protein 1      93.2    1e-17   Elaeis guineensis
ref|XP_006829297.1|  PREDICTED: FRIGIDA-like protein 3                93.2    1e-17   Amborella trichopoda
ref|XP_012070966.1|  PREDICTED: FRIGIDA-like protein 1                92.8    1e-17   Jatropha curcas
ref|XP_006426018.1|  hypothetical protein CICLE_v10025275mg           91.7    2e-17   
ref|XP_002283922.2|  PREDICTED: FRIGIDA-like protein 3                92.4    2e-17   Vitis vinifera
ref|XP_008458098.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     92.8    2e-17   
ref|XP_003525267.2|  PREDICTED: FRIGIDA-like protein 4a-like          92.0    2e-17   Glycine max [soybeans]
ref|XP_008458100.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     92.0    3e-17   Cucumis melo [Oriental melon]
emb|CDY05684.1|  BnaC02g38530D                                        92.0    3e-17   
ref|XP_011659218.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     92.0    4e-17   Cucumis sativus [cucumbers]
ref|XP_010251408.1|  PREDICTED: FRIGIDA-like protein 3                91.7    4e-17   Nelumbo nucifera [Indian lotus]
emb|CDY48750.1|  BnaA02g30110D                                        91.7    4e-17   Brassica napus [oilseed rape]
ref|XP_003608453.1|  ABI3-interacting protein                         88.2    4e-17   
ref|XP_001752883.1|  predicted protein                                90.9    4e-17   
ref|XP_004149315.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     91.7    4e-17   Cucumis sativus [cucumbers]
ref|XP_006366815.1|  PREDICTED: FRIGIDA-like protein 3-like isofo...  91.7    4e-17   Solanum tuberosum [potatoes]
ref|XP_011010336.1|  PREDICTED: FRIGIDA-like protein 3                91.3    5e-17   Populus euphratica
gb|KDO79035.1|  hypothetical protein CISIN_1g008359mg                 91.3    6e-17   Citrus sinensis [apfelsine]
ref|XP_006426019.1|  hypothetical protein CICLE_v10025275mg           91.3    6e-17   Citrus clementina [clementine]
ref|XP_006371905.1|  hypothetical protein POPTR_0018s059601g          88.6    6e-17   
ref|XP_006371903.1|  hypothetical protein POPTR_0018s05930g           87.4    7e-17   
ref|XP_007155867.1|  hypothetical protein PHAVU_003G238500g           90.9    7e-17   Phaseolus vulgaris [French bean]
ref|XP_012084486.1|  PREDICTED: FRIGIDA-like protein 3                90.9    8e-17   Jatropha curcas
gb|KJB10822.1|  hypothetical protein B456_001G227000                  90.5    8e-17   Gossypium raimondii
ref|XP_010688181.1|  PREDICTED: FRIGIDA-like protein 4a               90.5    9e-17   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB81662.1|  hypothetical protein B456_013G155600                  90.5    9e-17   Gossypium raimondii
gb|KJB10825.1|  hypothetical protein B456_001G227000                  90.5    9e-17   Gossypium raimondii
gb|KDO43512.1|  hypothetical protein CISIN_1g008061mg                 90.1    1e-16   Citrus sinensis [apfelsine]
gb|KHG07820.1|  Protein FRIGIDA -like protein                         90.1    1e-16   Gossypium arboreum [tree cotton]
ref|XP_009129722.1|  PREDICTED: FRIGIDA-like protein 3                90.1    1e-16   Brassica rapa
ref|XP_006447936.1|  hypothetical protein CICLE_v10014710mg           90.1    1e-16   Citrus clementina [clementine]
ref|XP_006447935.1|  hypothetical protein CICLE_v10014710mg           90.1    2e-16   Citrus clementina [clementine]
ref|XP_010097278.1|  hypothetical protein L484_009510                 89.4    2e-16   Morus notabilis
ref|XP_006371906.1|  hypothetical protein POPTR_0018s059601g          85.9    2e-16   
ref|XP_006579919.1|  PREDICTED: FRIGIDA-like protein 3-like isofo...  89.0    2e-16   Glycine max [soybeans]
ref|XP_006466524.1|  PREDICTED: FRIGIDA-like protein 3-like isofo...  89.4    2e-16   Citrus sinensis [apfelsine]
ref|XP_004958191.1|  PREDICTED: protein FRIGIDA-like                  89.4    2e-16   Setaria italica
ref|XP_008813697.1|  PREDICTED: truncated FRIGIDA-like protein 1      89.0    3e-16   Phoenix dactylifera
ref|XP_010028142.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     89.0    3e-16   Eucalyptus grandis [rose gum]
ref|XP_006387116.1|  hypothetical protein POPTR_1811s00200g           86.3    3e-16   
gb|AIN75614.1|  FRIGIDA3b-1                                           89.0    3e-16   Dimocarpus longan [longan]
ref|XP_006579918.1|  PREDICTED: FRIGIDA-like protein 3-like isofo...  88.6    4e-16   Glycine max [soybeans]
ref|XP_008344098.1|  PREDICTED: FRIGIDA-like protein 4a               85.5    4e-16   
ref|XP_010037083.1|  PREDICTED: FRIGIDA-like protein 3                88.2    5e-16   Eucalyptus grandis [rose gum]
gb|AIZ49817.1|  ABI3-interacting protein 2                            83.6    6e-16   Araucaria biramulata
ref|XP_003634846.1|  PREDICTED: FRIGIDA-like protein 3                87.8    6e-16   Vitis vinifera
gb|AIZ49827.1|  ABI3-interacting protein 2                            83.6    7e-16   Araucaria montana
ref|XP_002529047.1|  Protein FRIGIDA, putative                        87.4    9e-16   
gb|ABK95640.1|  unknown                                               81.3    9e-16   Populus trichocarpa [western balsam poplar]
gb|ABK42079.1|  hypothetical protein                                  87.4    1e-15   Capsicum annuum
gb|EYU27415.1|  hypothetical protein MIMGU_mgv1a005047mg              87.4    1e-15   Erythranthe guttata [common monkey flower]
gb|ABU89578.1|  ABI3-interacting protein 2                            80.9    1e-15   Pinus sylvestris [Scotch pine]
gb|KHG07809.1|  Protein FRIGIDA -like protein                         87.4    1e-15   Gossypium arboreum [tree cotton]
ref|XP_003562780.1|  PREDICTED: FRIGIDA-like protein 3                87.4    1e-15   Brachypodium distachyon [annual false brome]
ref|XP_011008039.1|  PREDICTED: truncated FRIGIDA-like protein 1      87.0    1e-15   Populus euphratica
ref|XP_002320559.2|  hypothetical protein POPTR_0014s17360g           87.0    1e-15   
gb|ABU89618.1|  ABI3-interacting protein 2                            80.5    1e-15   Pinus pinaster [cluster pine]
gb|KEH18040.1|  ABI3-interacting protein                              86.7    2e-15   Medicago truncatula
ref|XP_009794659.1|  PREDICTED: FRIGIDA-like protein 3                87.0    2e-15   Nicotiana sylvestris
ref|XP_009629152.1|  PREDICTED: FRIGIDA-like protein 3                87.0    2e-15   Nicotiana tomentosiformis
ref|XP_007049532.1|  FRIGIDA-like protein isoform 1                   86.7    2e-15   
ref|XP_009406027.1|  PREDICTED: truncated FRIGIDA-like protein 1      86.3    2e-15   
gb|AIN75612.1|  FRIGIDA3a-1                                           86.7    2e-15   Dimocarpus longan [longan]
gb|AIN75613.1|  FRIGIDA3a-2                                           86.7    2e-15   Dimocarpus longan [longan]
ref|XP_002967308.1|  hypothetical protein SELMODRAFT_144478           85.5    2e-15   
ref|XP_010087279.1|  hypothetical protein L484_009412                 86.3    2e-15   Morus notabilis
ref|XP_010028143.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     86.3    3e-15   Eucalyptus grandis [rose gum]
ref|XP_010679002.1|  PREDICTED: FRIGIDA-like protein 3                85.9    3e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|AIZ49840.1|  ABI3-interacting protein 2                            81.6    3e-15   Araucaria muelleri
ref|XP_010482087.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     85.9    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010482089.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     85.9    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_004509091.1|  PREDICTED: protein FRIGIDA-like                  85.5    4e-15   Cicer arietinum [garbanzo]
gb|KHG21752.1|  Protein FRIGIDA -like protein                         85.5    4e-15   Gossypium arboreum [tree cotton]
gb|KEH31518.1|  frigida-like protein                                  85.5    4e-15   Medicago truncatula
ref|XP_009802214.1|  PREDICTED: FRIGIDA-like protein 3                85.5    5e-15   Nicotiana sylvestris
gb|KDO42703.1|  hypothetical protein CISIN_1g036475mg                 85.5    5e-15   Citrus sinensis [apfelsine]
ref|XP_002302705.1|  FRIGIDA LIKE 1 family protein                    85.5    5e-15   Populus trichocarpa [western balsam poplar]
gb|ABU89580.1|  ABI3-interacting protein 2                            79.3    5e-15   Pinus sylvestris [Scotch pine]
ref|XP_011024727.1|  PREDICTED: FRIGIDA-like protein 3                85.5    5e-15   Populus euphratica
ref|XP_006433115.1|  hypothetical protein CICLE_v10000462mg           85.5    5e-15   Citrus clementina [clementine]
ref|XP_011080559.1|  PREDICTED: LOW QUALITY PROTEIN: FRIGIDA-like...  85.5    5e-15   Sesamum indicum [beniseed]
gb|KJB71128.1|  hypothetical protein B456_011G107000                  84.7    5e-15   Gossypium raimondii
ref|XP_004251422.1|  PREDICTED: FRIGIDA-like protein 4a               85.1    5e-15   Solanum lycopersicum
ref|XP_006340271.1|  PREDICTED: FRIGIDA-like protein 4a-like isof...  85.1    5e-15   Solanum tuberosum [potatoes]
ref|XP_012079338.1|  PREDICTED: FRIGIDA-like protein 3                85.1    6e-15   Jatropha curcas
gb|KJB71129.1|  hypothetical protein B456_011G107000                  84.7    6e-15   Gossypium raimondii
ref|XP_009767900.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     85.1    6e-15   Nicotiana sylvestris
ref|XP_002524951.1|  Protein FRIGIDA, putative                        85.1    7e-15   Ricinus communis
ref|XP_008801033.1|  PREDICTED: FRIGIDA-like protein 3                84.7    7e-15   
ref|XP_002455057.1|  hypothetical protein SORBIDRAFT_03g003680        85.1    7e-15   
ref|XP_010912749.1|  PREDICTED: FRIGIDA-like protein 3                84.7    8e-15   
ref|XP_010060241.1|  PREDICTED: FRIGIDA-like protein 1                84.7    8e-15   
ref|XP_010493658.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     84.7    8e-15   
gb|KJB71130.1|  hypothetical protein B456_011G107000                  84.7    9e-15   
ref|XP_009367793.1|  PREDICTED: FRIGIDA-like protein 3                84.7    9e-15   
gb|KJB08745.1|  hypothetical protein B456_001G101100                  84.3    9e-15   
gb|EEE67512.1|  hypothetical protein OsJ_24962                        84.7    9e-15   
ref|XP_009342384.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     84.3    9e-15   
ref|XP_008813784.1|  PREDICTED: FRIGIDA-like protein 3                84.3    9e-15   
ref|XP_009342382.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     84.3    9e-15   
ref|NP_001060162.1|  Os07g0592300                                     84.7    1e-14   
gb|EEC82372.1|  hypothetical protein OsI_26706                        84.7    1e-14   
gb|KJB71125.1|  hypothetical protein B456_011G107000                  84.3    1e-14   
gb|ABU89606.1|  ABI3-interacting protein 2                            78.2    1e-14   
ref|XP_009610151.1|  PREDICTED: FRIGIDA-like protein 3                84.3    1e-14   
gb|ABK94872.1|  unknown                                               84.0    1e-14   
gb|EEC70056.1|  hypothetical protein OsI_00656                        84.0    1e-14   
dbj|BAD68038.1|  hypothetical protein                                 84.0    1e-14   
ref|XP_002303026.1|  hypothetical protein POPTR_0002s24090g           84.0    1e-14   
ref|NP_001172206.1|  Os01g0181000                                     84.0    1e-14   
ref|XP_010442259.1|  PREDICTED: FRIGIDA-like protein 3                84.0    1e-14   
ref|XP_007201712.1|  hypothetical protein PRUPE_ppa003836mg           84.0    1e-14   
emb|CDP03992.1|  unnamed protein product                              84.0    1e-14   
ref|XP_009385695.1|  PREDICTED: FRIGIDA-like protein 3                84.0    1e-14   
ref|XP_008343464.1|  PREDICTED: LOW QUALITY PROTEIN: FRIGIDA-like...  84.0    2e-14   
ref|XP_010930297.1|  PREDICTED: FRIGIDA-like protein 3                83.6    2e-14   
emb|CAN61251.1|  hypothetical protein VITISV_004639                   84.0    2e-14   
gb|EEE53996.1|  hypothetical protein OsJ_00631                        84.0    2e-14   
ref|XP_010679566.1|  PREDICTED: FRIGIDA-like protein 3                83.6    2e-14   
ref|XP_006380669.1|  hypothetical protein POPTR_0007s10310g           83.6    2e-14   
gb|KHG06626.1|  Protein FRIGIDA -like protein                         83.6    2e-14   
ref|XP_006280261.1|  hypothetical protein CARUB_v10026179mg           83.6    2e-14   
ref|XP_006657905.1|  PREDICTED: FRIGIDA-like protein 3-like           83.6    2e-14   
ref|XP_009771266.1|  PREDICTED: FRIGIDA-like protein 3                83.2    2e-14   
ref|XP_009629356.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     82.8    3e-14   
gb|ABR17421.1|  unknown                                               82.8    3e-14   
gb|ACL14227.1|  ABI3-interacting protein 2                            77.0    3e-14   
ref|XP_002527289.1|  conserved hypothetical protein                   82.8    3e-14   
ref|XP_010659991.1|  PREDICTED: inactive FRIGIDA-like protein 2 i...  82.8    3e-14   
gb|ABK24390.1|  unknown                                               82.8    3e-14   
ref|XP_011008571.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     82.8    3e-14   
gb|ACL14229.1|  ABI3-interacting protein 2                            76.6    3e-14   
ref|XP_011008572.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     82.8    3e-14   
ref|XP_011620955.1|  PREDICTED: uncharacterized protein LOC18427663   83.2    3e-14   
ref|XP_010659992.1|  PREDICTED: FRIGIDA-like protein 2 isoform X2     82.4    4e-14   
ref|XP_011089589.1|  PREDICTED: FRIGIDA-like protein 3                82.8    4e-14   
ref|XP_007134303.1|  hypothetical protein PHAVU_010G035900g           82.4    4e-14   
ref|XP_009588185.1|  PREDICTED: FRIGIDA-like protein 3                82.4    4e-14   
ref|XP_009629363.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     82.4    4e-14   
ref|XP_010277794.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     82.4    5e-14   
ref|XP_010277793.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     82.4    5e-14   
ref|XP_002512283.1|  conserved hypothetical protein                   82.0    6e-14   
ref|XP_008382546.1|  PREDICTED: FRIGIDA-like protein 3                82.0    6e-14   
gb|EMT11233.1|  hypothetical protein F775_00858                       82.0    7e-14   
ref|XP_006344098.1|  PREDICTED: uncharacterized LOC102577701 isof...  82.0    7e-14   
ref|XP_003521013.1|  PREDICTED: FRIGIDA-like protein 3-like           81.6    7e-14   
gb|KHN30845.1|  Protein FRIGIDA                                       81.6    7e-14   
ref|XP_009352429.1|  PREDICTED: FRIGIDA-like protein 1                82.0    8e-14   
ref|XP_009342014.1|  PREDICTED: FRIGIDA-like protein 1                81.6    8e-14   
ref|XP_009767897.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     81.6    9e-14   
gb|EPS68182.1|  hypothetical protein M569_06588                       81.3    1e-13   
gb|ABB86244.1|  unknown                                               81.3    1e-13   
gb|EMS51150.1|  hypothetical protein TRIUR3_31082                     81.3    1e-13   
ref|XP_002463117.1|  hypothetical protein SORBIDRAFT_02g038160        81.3    1e-13   
ref|XP_008235869.1|  PREDICTED: FRIGIDA-like protein 3                81.3    1e-13   
ref|XP_004510190.1|  PREDICTED: protein FRIGIDA-like                  81.3    1e-13   
gb|ACL14226.1|  ABI3-interacting protein 2                            75.1    1e-13   
ref|XP_011095502.1|  PREDICTED: truncated FRIGIDA-like protein 1      80.9    1e-13   
ref|XP_010095585.1|  hypothetical protein L484_007424                 80.9    1e-13   
emb|CDX86307.1|  BnaA06g30240D                                        81.3    1e-13   
ref|XP_004290112.1|  PREDICTED: FRIGIDA-like protein 3                80.9    1e-13   
ref|XP_009415031.1|  PREDICTED: FRIGIDA-like protein 3                80.9    2e-13   
ref|XP_004240442.1|  PREDICTED: FRIGIDA-like protein 3                80.5    2e-13   
ref|XP_007204987.1|  hypothetical protein PRUPE_ppa003454mg           80.5    2e-13   
ref|XP_006599130.1|  PREDICTED: FRIGIDA-like protein 3-like           80.5    2e-13   
ref|XP_008652494.1|  PREDICTED: FRIGIDA-like protein 3                80.5    2e-13   
emb|CBI34294.3|  unnamed protein product                              80.1    2e-13   
ref|XP_009151640.1|  PREDICTED: FRIGIDA-like protein 3                80.1    2e-13   
ref|XP_002960412.1|  hypothetical protein SELMODRAFT_34543            78.6    2e-13   
ref|XP_002457174.1|  hypothetical protein SORBIDRAFT_03g002730        80.1    3e-13   
ref|XP_007047434.1|  FRIGIDA-like protein, putative                   80.1    3e-13   
gb|AGX28284.1|  hydroxyproline-rich glycoprotein-like protein         73.2    3e-13   
ref|XP_009392592.1|  PREDICTED: FRIGIDA-like protein 3                80.1    3e-13   
ref|XP_010550845.1|  PREDICTED: FRIGIDA-like protein 1                80.1    3e-13   
ref|XP_008238516.1|  PREDICTED: FRIGIDA-like protein 3                80.1    3e-13   
ref|XP_004956399.1|  PREDICTED: protein FRIGIDA-like                  79.7    3e-13   
gb|AAZ32849.1|  hydroxyproline-rich glycoprotein-like protein         76.3    3e-13   
gb|KHN30846.1|  Protein FRIGIDA                                       79.7    4e-13   
gb|AGV54168.1|  protein FRIGIDA-like protein                          79.7    4e-13   
ref|XP_004288232.1|  PREDICTED: FRIGIDA-like protein 4a               79.7    4e-13   
ref|XP_004510189.1|  PREDICTED: protein FRIGIDA-like                  79.7    4e-13   
ref|XP_010551997.1|  PREDICTED: FRIGIDA-like protein 3                79.7    4e-13   
ref|XP_003521014.1|  PREDICTED: FRIGIDA-like protein 3-like isofo...  79.7    4e-13   
ref|XP_009416991.1|  PREDICTED: FRIGIDA-like protein 3                79.3    4e-13   
ref|XP_010547174.1|  PREDICTED: FRIGIDA-like protein 3                79.3    4e-13   
emb|CDX85335.1|  BnaC07g26460D                                        80.1    4e-13   
ref|NP_001274872.1|  uncharacterized protein LOC102577701             79.3    5e-13   
gb|AAZ32878.1|  putative ABI3-interacting protein                     75.5    6e-13   
ref|XP_010660000.1|  PREDICTED: FRIGIDA-like protein 1                79.3    6e-13   
ref|XP_007134304.1|  hypothetical protein PHAVU_010G036000g           79.0    7e-13   
gb|EMS68713.1|  hypothetical protein TRIUR3_32895                     78.6    8e-13   
gb|ACL14231.1|  ABI3-interacting protein 2                            72.8    1e-12   
gb|ACF87005.1|  unknown                                               77.8    1e-12   
gb|EYU40676.1|  hypothetical protein MIMGU_mgv1a004360mg              78.2    1e-12   
ref|NP_001130881.1|  uncharacterized protein LOC100191985             78.6    1e-12   
ref|NP_001151902.1|  ABI3-interacting protein 2                       78.2    1e-12   
ref|XP_008370654.1|  PREDICTED: FRIGIDA-like protein 3                78.2    1e-12   
ref|XP_006395188.1|  hypothetical protein EUTSA_v10003930mg           77.8    1e-12   
ref|XP_010663779.1|  PREDICTED: FRIGIDA-like protein 2                77.4    2e-12   
emb|CAN71369.1|  hypothetical protein VITISV_023350                   77.0    2e-12   
gb|EYU46076.1|  hypothetical protein MIMGU_mgv1a004149mg              77.4    2e-12   
ref|NP_001141761.1|  hypothetical protein                             77.4    2e-12   
ref|XP_004968433.1|  PREDICTED: uncharacterized abhydrolase domai...  77.4    2e-12   
ref|XP_003577079.1|  PREDICTED: FRIGIDA-like protein 3                77.0    3e-12   
gb|AGV54643.1|  frigida protein                                       77.0    3e-12   
ref|XP_006360844.1|  PREDICTED: FRIGIDA-like protein 3-like isofo...  76.6    4e-12   
gb|KEH18039.1|  ABI3-interacting protein                              76.6    4e-12   
ref|XP_003518541.1|  PREDICTED: FRIGIDA-like protein 1-like           76.3    4e-12   
ref|XP_003565433.1|  PREDICTED: FRIGIDA-like protein 4b               76.3    5e-12   
gb|KJB08746.1|  hypothetical protein B456_001G101100                  75.9    6e-12   
ref|XP_004491473.1|  PREDICTED: uncharacterized protein LOC101501660  75.9    7e-12   
gb|ERM99627.1|  hypothetical protein AMTR_s00088p00168730             75.5    7e-12   
ref|XP_007142378.1|  hypothetical protein PHAVU_008G275200g           75.5    8e-12   
ref|XP_008383437.1|  PREDICTED: FRIGIDA-like protein 3                75.5    9e-12   
gb|KJB44639.1|  hypothetical protein B456_007G262900                  75.9    1e-11   
gb|KJB44641.1|  hypothetical protein B456_007G262900                  75.5    1e-11   
ref|XP_008359973.1|  PREDICTED: FRIGIDA-like protein 3                75.1    1e-11   
dbj|BAD19899.1|  putative ABI3-interacting protein 2                  74.7    1e-11   
gb|AGV54832.1|  frigida-like protein                                  75.1    1e-11   
ref|XP_006645569.1|  PREDICTED: FRIGIDA-like protein 4a-like          74.7    1e-11   
emb|CDP13747.1|  unnamed protein product                              74.7    2e-11   
gb|KHG06262.1|  Protein FRIGIDA -like protein                         74.7    2e-11   
gb|EMT33610.1|  hypothetical protein F775_05829                       73.9    2e-11   
ref|NP_001062668.1|  Os09g0248300                                     74.3    2e-11   
gb|AIZ49841.1|  ABI3-interacting protein 2                            70.1    3e-11   
ref|XP_004236868.1|  PREDICTED: FRIGIDA-like protein 3                73.9    3e-11   
ref|NP_850923.1|  FRIGIDA-like protein                                73.9    3e-11   
emb|CAN83600.1|  hypothetical protein VITISV_033094                   73.2    5e-11   
gb|ACL14230.1|  ABI3-interacting protein 2                            68.2    5e-11   
ref|NP_001141095.1|  hypothetical protein                             73.2    6e-11   
gb|KFK25859.1|  protein frigida like 1                                72.8    7e-11   
gb|ABK24802.1|  unknown                                               72.8    7e-11   
ref|XP_007206585.1|  hypothetical protein PRUPE_ppa020357mg           71.6    7e-11   
emb|CDM81767.1|  unnamed protein product                              72.4    9e-11   
gb|AAM96992.1|  putative protein                                      72.4    1e-10   
emb|CDY00062.1|  BnaC09g02390D                                        69.7    1e-10   
ref|XP_008246557.1|  PREDICTED: FRIGIDA-like protein 5                72.0    1e-10   
gb|EMS54104.1|  hypothetical protein TRIUR3_33659                     72.0    1e-10   
ref|XP_009765094.1|  PREDICTED: FRIGIDA-like protein 5 isoform X2     72.0    2e-10   
gb|ABK24919.1|  unknown                                               71.6    2e-10   
emb|CDY00066.1|  BnaC09g02350D                                        71.6    2e-10   
ref|XP_009765093.1|  PREDICTED: FRIGIDA-like protein 5 isoform X1     72.0    2e-10   
ref|XP_010453791.1|  PREDICTED: FRIGIDA-like protein 1                70.9    2e-10   
tpg|DAA59720.1|  TPA: hypothetical protein ZEAMMB73_037297            70.5    3e-10   
ref|XP_002981887.1|  hypothetical protein SELMODRAFT_115612           70.9    3e-10   
ref|XP_002986007.1|  hypothetical protein SELMODRAFT_123480           70.9    4e-10   
ref|XP_011032552.1|  PREDICTED: FRIGIDA-like protein 5                70.5    4e-10   
ref|XP_009587587.1|  PREDICTED: FRIGIDA-like protein 5                70.5    5e-10   
gb|AEW70271.1|  ABI3-interacting protein 2                            65.1    6e-10   
dbj|BAD19898.1|  putative ABI3-interacting protein 2                  70.1    6e-10   
ref|XP_006400170.1|  hypothetical protein EUTSA_v10013493mg           69.7    7e-10   
ref|XP_006660447.1|  PREDICTED: FRIGIDA-like protein 3-like           69.7    7e-10   
ref|NP_001062667.1|  Os09g0248200                                     69.7    7e-10   
gb|EEC84154.1|  hypothetical protein OsI_30525                        69.7    8e-10   
ref|XP_008218217.1|  PREDICTED: FRIGIDA-like protein 3                69.7    8e-10   
gb|ABK24547.1|  unknown                                               69.7    9e-10   
ref|XP_003600257.1|  ABI3-interacting protein                         69.3    1e-09   
ref|XP_006287669.1|  hypothetical protein CARUB_v10000879mg           69.3    1e-09   
ref|XP_010420319.1|  PREDICTED: FRIGIDA-like protein 1                68.9    1e-09   
ref|XP_010674954.1|  PREDICTED: flagellar attachment zone protein...  69.3    1e-09   
ref|XP_009353182.1|  PREDICTED: uncharacterized protein LOC103944439  68.6    2e-09   
ref|XP_007030124.1|  Uncharacterized protein TCM_025941               68.2    4e-09   
ref|XP_006354307.1|  PREDICTED: FRIGIDA-like protein 5-like           67.8    4e-09   
ref|XP_006347840.1|  PREDICTED: myosin-10-like isoform X1             67.8    4e-09   
ref|XP_006347842.1|  PREDICTED: myosin-10-like isoform X3             67.8    4e-09   
gb|ABR17986.1|  unknown                                               67.4    4e-09   
gb|AET00652.2|  frigida-LIKE protein                                  67.4    4e-09   
ref|XP_010672182.1|  PREDICTED: FRIGIDA-like protein 5                67.8    4e-09   
ref|XP_003617693.1|  CCP                                              67.4    4e-09   
gb|ADR31574.1|  frigida-like 1                                        64.7    5e-09   
gb|ACN39868.1|  unknown                                               67.4    5e-09   
gb|KJB44648.1|  hypothetical protein B456_007G263000                  67.4    5e-09   
gb|ADR31573.1|  frigida-like 1                                        64.7    6e-09   
gb|ADR31569.1|  frigida-like 1                                        64.7    6e-09   
gb|KHM99488.1|  Protein FRIGIDA                                       67.0    6e-09   
gb|ADR31560.1|  frigida-like 1                                        64.7    6e-09   
ref|XP_003530783.1|  PREDICTED: FRIGIDA-like protein 1-like           67.0    7e-09   
ref|XP_006602160.1|  PREDICTED: FRIGIDA-like protein 1-like           67.0    7e-09   
ref|XP_006303200.1|  hypothetical protein CARUB_v10011101mg           66.6    7e-09   
ref|XP_008246558.1|  PREDICTED: girdin-like                           67.0    8e-09   
gb|KHN43813.1|  Protein FRIGIDA                                       66.6    8e-09   
gb|ADR31565.1|  frigida-like 1                                        64.3    9e-09   
ref|XP_008391792.1|  PREDICTED: uncharacterized protein LOC103453978  66.6    9e-09   
ref|XP_006382696.1|  hypothetical protein POPTR_0005s04540g           66.6    1e-08   
ref|NP_197136.1|  protein FRIGIDA like 1                              65.9    1e-08   
ref|XP_009769823.1|  PREDICTED: FRIGIDA-like protein 5                66.2    1e-08   
ref|XP_002871715.1|  hypothetical protein ARALYDRAFT_488485           65.9    1e-08   
ref|XP_009616192.1|  PREDICTED: FRIGIDA-like protein 5 isoform X2     66.2    2e-08   
ref|XP_009616193.1|  PREDICTED: FRIGIDA-like protein 5 isoform X3     66.2    2e-08   
ref|XP_009616191.1|  PREDICTED: FRIGIDA-like protein 5 isoform X1     66.2    2e-08   
ref|XP_010492516.1|  PREDICTED: FRIGIDA-like protein 1 isoform X1     65.5    2e-08   
ref|XP_009627156.1|  PREDICTED: FRIGIDA-like protein 5                65.5    3e-08   
gb|AFK42258.1|  unknown                                               64.7    3e-08   
ref|XP_007146591.1|  hypothetical protein PHAVU_006G053200g           64.7    3e-08   
ref|XP_006382697.1|  hypothetical protein POPTR_0005s04550g           65.1    3e-08   
ref|XP_010910192.1|  PREDICTED: protein FRIGIDA                       64.3    4e-08   
ref|XP_011032565.1|  PREDICTED: flagellar attachment zone protein...  64.7    5e-08   
ref|XP_009348269.1|  PREDICTED: uncharacterized protein LOC103939890  64.3    5e-08   
ref|XP_007206633.1|  hypothetical protein PRUPE_ppa022020mg           64.3    5e-08   
ref|XP_009406994.1|  PREDICTED: FRIGIDA-like protein 4a               60.8    6e-08   
ref|XP_004231255.1|  PREDICTED: FRIGIDA-like protein 5                63.9    8e-08   
ref|XP_008246559.1|  PREDICTED: FRIGIDA-like protein 5                63.5    8e-08   
ref|XP_010644522.1|  PREDICTED: truncated FRIGIDA-like protein 1      63.5    8e-08   
ref|XP_009779773.1|  PREDICTED: FRIGIDA-like protein 5 isoform X1     63.9    9e-08   
ref|XP_009779775.1|  PREDICTED: FRIGIDA-like protein 5 isoform X3     63.5    9e-08   
ref|XP_009779774.1|  PREDICTED: FRIGIDA-like protein 5 isoform X2     63.5    9e-08   
emb|CBI26735.3|  unnamed protein product                              63.2    9e-08   
emb|CAN75645.1|  hypothetical protein VITISV_031268                   63.2    1e-07   
ref|XP_006286988.1|  hypothetical protein CARUB_v10000134mg           63.2    2e-07   



>ref|XP_011071583.1| PREDICTED: FRIGIDA-like protein 4a [Sesamum indicum]
Length=520

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 178/203 (88%), Gaps = 5/203 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGDKMP++IEELI RGQQVDAVHFTYEVGL +KFPPVPLLKAFLKDAK
Sbjct  285  RKQMPKLAVSLGLGDKMPDMIEELIGRGQQVDAVHFTYEVGLADKFPPVPLLKAFLKDAK  344

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAAT+ILEDPNNSGRAAH+AAKKE SAIRAVLKCIEEYKLEAEFPPE+LKKRL+QLEK K
Sbjct  345  KAATSILEDPNNSGRAAHMAAKKEQSAIRAVLKCIEEYKLEAEFPPENLKKRLEQLEKAK  404

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
             E       A+PAAKRTR SNGGPMPPAKAGRSTNAYVSSFP + PT+VRSPSHTQYP  
Sbjct  405  IE---KKKPASPAAKRTRASNGGPMPPAKAGRSTNAYVSSFP-SPPTYVRSPSHTQYPAP  460

Query  406  LPAYPASP-IYTHGSMSPQYVYS  341
            +PAYPA P +Y HGS SP Y Y+
Sbjct  461  VPAYPAVPAVYGHGSRSPPYAYT  483



>ref|XP_006489388.1| PREDICTED: FRIGIDA-like protein 4a-like [Citrus sinensis]
 gb|KDO74577.1| hypothetical protein CISIN_1g010192mg [Citrus sinensis]
Length=515

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 180/206 (87%), Gaps = 4/206 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGDKMPE+IEELISRGQQ+DAVHFTYEVGL++KFPPVPLLKAFLKDAK
Sbjct  280  RKQMPKLAVSLGLGDKMPEMIEELISRGQQLDAVHFTYEVGLVDKFPPVPLLKAFLKDAK  339

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA +ILEDPNN+GRAAHLAA+KE SA+RAV+KCIE+YKL+ EFPPE+LKKRL+QLEK K
Sbjct  340  KAAVSILEDPNNAGRAAHLAARKEQSALRAVIKCIEDYKLQGEFPPENLKKRLEQLEKAK  399

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   AA PA KRTR SNGGPMPPAKAGR TNAYVSSFP A PTFVRSPSHTQYP G
Sbjct  400  TE--KKKPAAVPATKRTRASNGGPMPPAKAGRLTNAYVSSFP-APPTFVRSPSHTQYPAG  456

Query  406  LPAYPASPIYTHGSMSPQYVYSPEAA  329
            + AY ASP   +GS SP Y YSPEAA
Sbjct  457  VTAY-ASPPAVYGSRSPPYAYSPEAA  481



>ref|XP_002517136.1| Protein FRIGIDA, putative [Ricinus communis]
 gb|EEF45299.1| Protein FRIGIDA, putative [Ricinus communis]
Length=520

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 182/208 (88%), Gaps = 6/208 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLALSLGLGDKMP++IEELISRGQQ+DAVHFTYEVGL++KFPPVPLLKAFLKDAK
Sbjct  283  RKQMPKLALSLGLGDKMPDMIEELISRGQQLDAVHFTYEVGLVDKFPPVPLLKAFLKDAK  342

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA +ILEDP+N+GRAAHLAA+KE SA+RAV+KCIEEYKLEAEFPPE+LKKRL+QLEKTK
Sbjct  343  KAAASILEDPDNTGRAAHLAARKEQSALRAVIKCIEEYKLEAEFPPENLKKRLEQLEKTK  402

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   AA PA KRTR SNGGPMPPAKAGR TNAYVSSFP A P FVRSPSHTQYPT 
Sbjct  403  TE--KKRPAAVPANKRTRASNGGPMPPAKAGRLTNAYVSSFP-APPAFVRSPSHTQYPTA  459

Query  406  LPAYPASPIYTHGSMSP--QYVYSPEAA  329
            LPAYP SP   +G+ SP   Y YSPEAA
Sbjct  460  LPAYP-SPPAVYGTRSPPSPYAYSPEAA  486



>ref|XP_011026525.1| PREDICTED: FRIGIDA-like protein 4a [Populus euphratica]
Length=521

 Score =   277 bits (708),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 182/208 (88%), Gaps = 6/208 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGDKMP++IEELISRGQQ+DAVHFTYEVGL++KFPPVPLLKAFLKDAK
Sbjct  284  RKQMPKLAVSLGLGDKMPDMIEELISRGQQLDAVHFTYEVGLVDKFPPVPLLKAFLKDAK  343

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA ++LEDP N+GRAAHLAA+KE SA+RAV+KC+E+YKLEA+FPPE+LKKRL+QLEK K
Sbjct  344  KAAASVLEDPENTGRAAHLAARKEQSALRAVIKCVEDYKLEAQFPPENLKKRLEQLEKAK  403

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   AA PA KRTR SNGGPMPPAKAGR TNAYVSSFP A PTFVRSPSHTQYPTG
Sbjct  404  TE--KKRPAAVPANKRTRASNGGPMPPAKAGRLTNAYVSSFP-APPTFVRSPSHTQYPTG  460

Query  406  LPAYPASPIYTHGSMSP--QYVYSPEAA  329
            +PAYP SP   +GS SP   Y YSPEAA
Sbjct  461  VPAYP-SPPAVYGSRSPPSPYAYSPEAA  487



>ref|XP_012069629.1| PREDICTED: FRIGIDA-like protein 4a [Jatropha curcas]
 gb|KDP40175.1| hypothetical protein JCGZ_02173 [Jatropha curcas]
Length=520

 Score =   276 bits (706),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 182/208 (88%), Gaps = 7/208 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLG+KMP++IEELISRGQQ+DAVHFTYEVGL++KFPPVPLLK FLKD+K
Sbjct  283  RKQMPKLAVSLGLGEKMPDMIEELISRGQQLDAVHFTYEVGLVDKFPPVPLLKKFLKDSK  342

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA +ILEDP ++GRAAHLAA+KE SA+RAV+KCIEEYKLEAEFPPE+LKKRL+QLEK K
Sbjct  343  KAAASILEDP-DTGRAAHLAARKEQSALRAVIKCIEEYKLEAEFPPENLKKRLEQLEKAK  401

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   AA PA KRTR SNGGPMPPAKAGR TNAYVSSFP A PTFVRSPSHTQYPTG
Sbjct  402  TE--KKRPAAVPANKRTRASNGGPMPPAKAGRLTNAYVSSFP-APPTFVRSPSHTQYPTG  458

Query  406  LPAYPASPIYTHGSMSPQ--YVYSPEAA  329
            +PAYP SP   +GS SPQ  Y YSPEAA
Sbjct  459  VPAYP-SPAAVYGSRSPQSPYAYSPEAA  485



>ref|XP_006360794.1| PREDICTED: FRIGIDA-like protein 4a-like [Solanum tuberosum]
Length=514

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 178/206 (86%), Gaps = 4/206 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGDKMPE+IEELISRGQQVDAVHFTYEVGL +KFPPVPLLKAFLKDAK
Sbjct  284  RKQMPKLAISLGLGDKMPEMIEELISRGQQVDAVHFTYEVGLAHKFPPVPLLKAFLKDAK  343

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA AILEDPNN GRAAH AAKKE SAIR+VLKCIEEYKLEAEFPP++LKK+L+QLEK K
Sbjct  344  KAAAAILEDPNNFGRAAHFAAKKEQSAIRSVLKCIEEYKLEAEFPPDNLKKQLEQLEKPK  403

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   AA PA KRTR +NGGPMPPAKAGRSTNAYVSSFP  AP FVRSPSHTQYP  
Sbjct  404  NE--KKRPAAVPANKRTRANNGGPMPPAKAGRSTNAYVSSFP-VAPAFVRSPSHTQYPQA  460

Query  406  LPAYPASPIYTHGSMSPQYVYSPEAA  329
            +PAY ASP   +GS SP Y YSPEAA
Sbjct  461  VPAY-ASPPAMYGSRSPPYPYSPEAA  485



>ref|XP_002311627.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE88994.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=521

 Score =   275 bits (703),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 181/208 (87%), Gaps = 6/208 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGDKMP++IEELISRGQQ+DAVHFTYEVGL++KFPPVPLLKAFLKDAK
Sbjct  284  RKQMPKLAVSLGLGDKMPDMIEELISRGQQLDAVHFTYEVGLVDKFPPVPLLKAFLKDAK  343

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA ++LEDP N+GRAAHLAA+KE SA+RAV+KC+E+YKLE+ FPPE+LKKRL+QLEK K
Sbjct  344  KAAASVLEDPENTGRAAHLAARKEQSALRAVIKCVEDYKLESRFPPENLKKRLEQLEKAK  403

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   AA PA KRTR SNGGPMPPAKAGR TNAYVSSFP A PTFVRSPSHTQYPTG
Sbjct  404  TE--KKRPAAVPANKRTRASNGGPMPPAKAGRLTNAYVSSFP-APPTFVRSPSHTQYPTG  460

Query  406  LPAYPASPIYTHGSMSP--QYVYSPEAA  329
            +PAYP SP   +GS SP   Y YSPEAA
Sbjct  461  VPAYP-SPPAVYGSRSPPSPYAYSPEAA  487



>ref|XP_004247354.1| PREDICTED: FRIGIDA-like protein 4a [Solanum lycopersicum]
Length=514

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 177/206 (86%), Gaps = 4/206 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGDKMPE+IEELISRGQQVDAVHFTYEVGL +KFPPVPLLKAFLKDAK
Sbjct  284  RKQMPKLAISLGLGDKMPEMIEELISRGQQVDAVHFTYEVGLADKFPPVPLLKAFLKDAK  343

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA AILEDPNN GRAAH A+KKE SAIR+VLKCIEEYKLEAEFPPE+LKK+L+QLEK K
Sbjct  344  KAAAAILEDPNNFGRAAHFASKKEQSAIRSVLKCIEEYKLEAEFPPENLKKQLEQLEKPK  403

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   AA PA KRTR +NGGPMPPAKAGRSTNAYVSSFP  AP FVRSP HTQYP  
Sbjct  404  NE--KKRPAAVPANKRTRANNGGPMPPAKAGRSTNAYVSSFP-VAPAFVRSPPHTQYPQA  460

Query  406  LPAYPASPIYTHGSMSPQYVYSPEAA  329
            +PAY ASP   +G+ SP Y YSPEAA
Sbjct  461  VPAY-ASPPTIYGNRSPPYPYSPEAA  485



>gb|EYU45654.1| hypothetical protein MIMGU_mgv1a004401mg [Erythranthe guttata]
Length=529

 Score =   272 bits (696),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 178/206 (86%), Gaps = 6/206 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGL DKMP++I+ELI RGQQVDAVHFTYEVGL ++FPPVP+LKAFLKDAK
Sbjct  291  RKQMPKLAVSLGLADKMPDMIKELIGRGQQVDAVHFTYEVGLADRFPPVPMLKAFLKDAK  350

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAAT+I+EDPNNSGRAAH+AAKKE SAIRAVL+CIEEYKLE +FP ++LKKRL +LEK K
Sbjct  351  KAATSIMEDPNNSGRAAHMAAKKEQSAIRAVLRCIEEYKLENDFPSDNLKKRLSELEKVK  410

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
             E       A+PAAKRTR SNGGPMPPAKAGRSTNAYVSSFP + PT++RSPSHTQYP+ 
Sbjct  411  IE---KKKPASPAAKRTRASNGGPMPPAKAGRSTNAYVSSFP-SPPTYMRSPSHTQYPSA  466

Query  406  LPAYPASP-IYTHGSMSPQYVYSPEA  332
            + AYPA P +Y HGS SP YVYSPEA
Sbjct  467  V-AYPAMPAVYAHGSRSPSYVYSPEA  491



>ref|XP_007034760.1| FRIGIDA-like protein isoform 1 [Theobroma cacao]
 gb|EOY05686.1| FRIGIDA-like protein isoform 1 [Theobroma cacao]
Length=520

 Score =   272 bits (695),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 182/209 (87%), Gaps = 7/209 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGDKMP++IEEL+S+GQQ+DAVHFTYEVGL++KFPPVPLLKAFL+DAK
Sbjct  281  RKQMPKLAVSLGLGDKMPDMIEELVSKGQQLDAVHFTYEVGLVDKFPPVPLLKAFLRDAK  340

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA++ILEDP+N+GRAA LAA+KE SA+RAV+KCIEEYKLEAEFPPE+LKKRL+QLEKTK
Sbjct  341  KAASSILEDPSNAGRAAQLAARKEQSALRAVIKCIEEYKLEAEFPPENLKKRLEQLEKTK  400

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K  AAA PA KRTR SNGGPMPPAKAGR  NAYVSSFP A PTFVRSPSHTQYP  
Sbjct  401  TE--KRKAAAVPANKRTRASNGGPMPPAKAGRLMNAYVSSFP-APPTFVRSPSHTQYPAA  457

Query  406  LPAYPASPIYTHGSMSP---QYVYSPEAA  329
            +PAYP SP   +GS SP    Y YSPEAA
Sbjct  458  VPAYP-SPPAMYGSRSPPTNPYAYSPEAA  485



>gb|AEK20760.1| FRIGIDA [Coffea arabica]
Length=532

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 159/207 (77%), Positives = 177/207 (86%), Gaps = 5/207 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGL DKMP++IEELISRGQQVDAVHF +EV L+++FPPVPLLKAFLKDAK
Sbjct  302  RKQMPKLAVSLGLADKMPDIIEELISRGQQVDAVHFIFEVDLVDEFPPVPLLKAFLKDAK  361

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K AT+ILEDPNN+GRAAH+AAKKE SAIRAV+KCIEEYKLEAEFPPE+LKKRL+QLEKTK
Sbjct  362  KLATSILEDPNNTGRAAHMAAKKEQSAIRAVIKCIEEYKLEAEFPPENLKKRLEQLEKTK  421

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K      PA KRTR SNG  +PPAKAGR TNAYVSSFP AAPTFVRSPSH+ Y  G
Sbjct  422  TE--KRKPVVVPANKRTRASNGEHVPPAKAGRLTNAYVSSFP-AAPTFVRSPSHSPYHAG  478

Query  406  LPAYPASP-IYTHGSMSPQ-YVYSPEA  332
            +PAYP+ P IY HGS SP  YVYSPEA
Sbjct  479  VPAYPSPPAIYGHGSRSPSPYVYSPEA  505



>emb|CDO99060.1| unnamed protein product [Coffea canephora]
Length=228

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 174/204 (85%), Gaps = 5/204 (2%)
 Frame = -3

Query  937  MXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaA  758
            M KLA+SLGL DKMP++IEELISRGQQVDAVHF +EV L+++FPPVPLLKAFLKDAKK A
Sbjct  1    MPKLAVSLGLADKMPDIIEELISRGQQVDAVHFIFEVDLVDEFPPVPLLKAFLKDAKKLA  60

Query  757  TAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEk  578
            T+IL DPNN+GRAAH+AAKKE SAIRAV+KCIEEYKLEAEFPPE+LKKRL+QLEKTK+E 
Sbjct  61   TSILGDPNNTGRAAHMAAKKEQSAIRAVIKCIEEYKLEAEFPPENLKKRLEQLEKTKTE-  119

Query  577  kkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPA  398
             K      PA KRTR SNG  +PPAKAGR TNAYVSSFP AAPTFVRSPSH+ Y  G+PA
Sbjct  120  -KRKPVVVPANKRTRASNGEHVPPAKAGRLTNAYVSSFP-AAPTFVRSPSHSPYHAGVPA  177

Query  397  YPASP-IYTHGSMSPQ-YVYSPEA  332
            YP+ P IY HGS SP  YVYSPEA
Sbjct  178  YPSPPAIYGHGSRSPSPYVYSPEA  201



>gb|KHG27689.1| Protein FRIGIDA -like protein [Gossypium arboreum]
Length=516

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 156/209 (75%), Positives = 181/209 (87%), Gaps = 6/209 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGDKMP++IEELIS+GQQ+DAVHFTYEVGL+++FPPVPLLKAFLKDAK
Sbjct  278  RKQMPKLAVSLGLGDKMPDMIEELISKGQQLDAVHFTYEVGLVDRFPPVPLLKAFLKDAK  337

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA++ILEDPNN+GRAA LAA+KE SA+RAV+KCIEEYKLEAE PPE+LKKRL+QLEKTK
Sbjct  338  KAASSILEDPNNAGRAAQLAARKEQSALRAVMKCIEEYKLEAELPPENLKKRLEQLEKTK  397

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   +A PA KRTR SNGGPMPPAKAGRSTNAYVSSF AA P+ VRSPSH QYP  
Sbjct  398  TE--KRKPSAVPANKRTRASNGGPMPPAKAGRSTNAYVSSF-AAPPSIVRSPSHPQYPAA  454

Query  406  LPAYPASPIYTHGSMSP---QYVYSPEAA  329
            +PAYP+ P   +G+ +P    Y+YSPEAA
Sbjct  455  VPAYPSPPPAIYGTQTPPTCPYMYSPEAA  483



>emb|CAN69766.1| hypothetical protein VITISV_022061 [Vitis vinifera]
Length=524

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 181/213 (85%), Gaps = 11/213 (5%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGDKM ++IEEL++RGQQVDAVHFTYEVGL++KFPPVPLLKAFL+D+K
Sbjct  281  RKQMPKLAVSLGLGDKMADMIEELVNRGQQVDAVHFTYEVGLVDKFPPVPLLKAFLRDSK  340

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAAT+ILEDPNNSGRA +LA +KE SA+RAV+KCIEEYKLEAEFPPE+LKKRL+QLEK K
Sbjct  341  KAATSILEDPNNSGRAVNLAGRKEQSALRAVIKCIEEYKLEAEFPPENLKKRLEQLEKAK  400

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            ++  K   AA PA KRTR SNGGPMPPAKAGR TNAYVSSFP AAPTF+RSPSHTQYP  
Sbjct  401  TD--KKRPAAVPANKRTRASNGGPMPPAKAGRLTNAYVSSFP-AAPTFIRSPSHTQYPAA  457

Query  406  LPAY----PASPIYTHGSMSP---QYVYSPEAA  329
            +PAY    PA+P   +GS SP    Y YSPEAA
Sbjct  458  VPAYPYDRPAAPA-MYGSRSPPANPYAYSPEAA  489



>ref|XP_002282465.1| PREDICTED: FRIGIDA-like protein 4a [Vitis vinifera]
Length=522

 Score =   270 bits (689),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 181/213 (85%), Gaps = 11/213 (5%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGDKM ++IEEL++RGQQVDAVHFTYEVGL++KFPPVPLLKAFL+D+K
Sbjct  281  RKQMPKLAVSLGLGDKMADMIEELVNRGQQVDAVHFTYEVGLVDKFPPVPLLKAFLRDSK  340

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAAT+ILEDPNNSGRA +LA +KE SA+RAV+KCIEEYKLEAEFPPE+LKKRL+QLEK K
Sbjct  341  KAATSILEDPNNSGRAVNLAGRKEQSALRAVIKCIEEYKLEAEFPPENLKKRLEQLEKAK  400

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            ++  K   AA PA KRTR SNGGPMPPAKAGR TNAYVSSFP AAPTF+RSPSHTQYP  
Sbjct  401  TD--KKRPAAVPANKRTRASNGGPMPPAKAGRLTNAYVSSFP-AAPTFIRSPSHTQYPAA  457

Query  406  LPAY----PASPIYTHGSMSP---QYVYSPEAA  329
            +PAY    PA+P   +GS SP    Y YSPEAA
Sbjct  458  VPAYPYDRPAAPA-MYGSRSPPANPYAYSPEAA  489



>gb|KDO74576.1| hypothetical protein CISIN_1g010192mg [Citrus sinensis]
Length=511

 Score =   268 bits (686),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 176/206 (85%), Gaps = 8/206 (4%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGDKMPELI    SRGQQ+DAVHFTYEVGL++KFPPVPLLKAFLKDAK
Sbjct  280  RKQMPKLAVSLGLGDKMPELI----SRGQQLDAVHFTYEVGLVDKFPPVPLLKAFLKDAK  335

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA +ILEDPNN+GRAAHLAA+KE SA+RAV+KCIE+YKL+ EFPPE+LKKRL+QLEK K
Sbjct  336  KAAVSILEDPNNAGRAAHLAARKEQSALRAVIKCIEDYKLQGEFPPENLKKRLEQLEKAK  395

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   AA PA KRTR SNGGPMPPAKAGR TNAYVSSFP A PTFVRSPSHTQYP G
Sbjct  396  TE--KKKPAAVPATKRTRASNGGPMPPAKAGRLTNAYVSSFP-APPTFVRSPSHTQYPAG  452

Query  406  LPAYPASPIYTHGSMSPQYVYSPEAA  329
            + AY ASP   +GS SP Y YSPEAA
Sbjct  453  VTAY-ASPPAVYGSRSPPYAYSPEAA  477



>gb|KJB28346.1| hypothetical protein B456_005G042900 [Gossypium raimondii]
Length=830

 Score =   274 bits (701),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 182/209 (87%), Gaps = 6/209 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGDKMP++IEELIS+GQQ+DAVHFTYEVGL+N+FPPVPLLKAFLKDAK
Sbjct  278  RKQMPKLAVSLGLGDKMPDMIEELISKGQQLDAVHFTYEVGLVNRFPPVPLLKAFLKDAK  337

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA++ILEDPNN+GRAA LAA+KE SA+RAV+KCIEEYKLEAEFPPE+LKKRL+QLEKTK
Sbjct  338  KAASSILEDPNNAGRAAQLAARKEQSALRAVMKCIEEYKLEAEFPPENLKKRLEQLEKTK  397

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   AA PA KRTR SNGGPMPPAKAGRSTNAYVSSF AA P+ VRSPSH QYP  
Sbjct  398  TE--KRKPAAVPANKRTRASNGGPMPPAKAGRSTNAYVSSF-AAPPSIVRSPSHPQYPAA  454

Query  406  LPAYPASPIYTHGSMSP---QYVYSPEAA  329
            +PAYP+ P   +G+ +P    Y+YSPEAA
Sbjct  455  VPAYPSPPPAMYGTQTPPTCPYMYSPEAA  483



>gb|KEH43877.1| frigida-LIKE protein [Medicago truncatula]
Length=519

 Score =   260 bits (665),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 169/206 (82%), Gaps = 2/206 (1%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RKHM KLALSLGL D+M ++I+ELIS+GQQ+DAVHFT+EVGL++KFPPVPLLK++LKDAK
Sbjct  282  RKHMPKLALSLGLTDQMADMIQELISKGQQLDAVHFTFEVGLVDKFPPVPLLKSYLKDAK  341

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K A +ILEDPNN+GRA +LAA+KE SA++AV+KCIEEY LEAEFP E LKKRL+QLEK K
Sbjct  342  KVAASILEDPNNAGRAGYLAARKEQSALKAVIKCIEEYNLEAEFPAESLKKRLEQLEKVK  401

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
             EK+K     A    R   SNGGPMPPAKAGR TNAYVSSFPAA+ TFVRSPSH QYP  
Sbjct  402  PEKRKQIVVPANKRTRASNSNGGPMPPAKAGRLTNAYVSSFPAAS-TFVRSPSHGQYPAA  460

Query  406  LPAYPASPIYTHGSMSPQYVYSPEAA  329
            LP YP SP + +GS SP Y YSPE A
Sbjct  461  LPLYP-SPPHMYGSRSPSYAYSPEPA  485



>ref|XP_010090919.1| hypothetical protein L484_004461 [Morus notabilis]
 gb|EXB41291.1| hypothetical protein L484_004461 [Morus notabilis]
Length=519

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 156/209 (75%), Positives = 174/209 (83%), Gaps = 7/209 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGL DKMP++IEELIS+GQQ+DAVHFTYEVGL++KFPPVPLLKAFLKDAK
Sbjct  282  RKQMPKLAVSLGLSDKMPDMIEELISKGQQLDAVHFTYEVGLVDKFPPVPLLKAFLKDAK  341

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA +ILEDPNN GR+ HLA +KE SA+RAV+KCIEEYKLEAEFPPE+LKKRL+QLEK K
Sbjct  342  KAAASILEDPNNIGRSVHLAGRKEQSALRAVIKCIEEYKLEAEFPPENLKKRLEQLEKGK  401

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K    A PA KRTR +NGGPMPPAKAGR TNAYVSSFP AAPTFVRSPSH QYP  
Sbjct  402  TE--KRKPVAVPANKRTRANNGGPMPPAKAGRLTNAYVSSFP-AAPTFVRSPSHAQYPAP  458

Query  406  LPAYPASPIYTHGSMSP---QYVYSPEAA  329
            +P Y  SP   +GS SP    Y YSPEAA
Sbjct  459  VPPY-HSPPTMYGSRSPPTNPYAYSPEAA  486



>gb|KJB38152.1| hypothetical protein B456_006G239300 [Gossypium raimondii]
Length=389

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 176/209 (84%), Gaps = 7/209 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGD+MP++IEELIS+GQQ+DAVHFTYEVGL++KFPPVPLLK+FL+DAK
Sbjct  150  RKQMPKLAVSLGLGDQMPDMIEELISKGQQLDAVHFTYEVGLVDKFPPVPLLKSFLRDAK  209

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA++IL+DPNNSGRAA LAA+KE SA+RAV+KCIEEYKLEAEFPPE+LKKRL+QLEKTK
Sbjct  210  KAASSILDDPNNSGRAAQLAARKEQSALRAVIKCIEEYKLEAEFPPENLKKRLEQLEKTK  269

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K      PA KRTRV+NGGPMPPAKAGR TNAYVSSFP A P FVRSPSHTQYP  
Sbjct  270  TE--KRKPVVVPANKRTRVNNGGPMPPAKAGRLTNAYVSSFP-APPPFVRSPSHTQYPAP  326

Query  406  LPAYPASPIYTHGSMSP---QYVYSPEAA  329
            +     SP   +GS SP    Y YSPEAA
Sbjct  327  V-PGYPSPPPMYGSRSPPTNPYAYSPEAA  354



>gb|AFP97615.1| frigida-like protein [Medicago sativa]
Length=519

 Score =   259 bits (661),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RKHM K ALSLGL ++MP++IEELIS+GQQ+DAVHFT+EVGL+ KFPPVPLLK++LKDAK
Sbjct  282  RKHMPKPALSLGLENQMPDMIEELISKGQQLDAVHFTFEVGLVEKFPPVPLLKSYLKDAK  341

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K A +ILEDPNN+GRA +LAA+KE SA++AV+KCIEEY LEAEFP E LKKRL+QLEK K
Sbjct  342  KVAASILEDPNNAGRAGYLAARKEQSALKAVIKCIEEYNLEAEFPAESLKKRLEQLEKVK  401

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
             EK+K     A    R   SNGGPMPPAKAGR TNAYVSSFP AAPTFVRSPSH QYP  
Sbjct  402  PEKRKQIVVPANKRTRASNSNGGPMPPAKAGRLTNAYVSSFP-AAPTFVRSPSHGQYPAA  460

Query  406  LPAYPASPIYTHGSMSPQYVYSPEAA  329
            LP YP SP + +GS SP Y YSPE A
Sbjct  461  LPPYP-SPPHMYGSRSPSYAYSPEPA  485



>ref|XP_003556050.1| PREDICTED: FRIGIDA-like protein 4a-like [Glycine max]
Length=524

 Score =   259 bits (661),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 171/210 (81%), Gaps = 6/210 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLALSLGL  +MP++IEELIS+GQQ+DAVHFTYEVGL+ KFPPVPLLK+FLKDAK
Sbjct  282  RKQMPKLALSLGLAQQMPDMIEELISKGQQLDAVHFTYEVGLVEKFPPVPLLKSFLKDAK  341

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K A +ILEDPNN+GRAA+LAA+KE SA+RAV+KCIEEYKLE EFPPE+LKKRLDQLEK K
Sbjct  342  KVAASILEDPNNAGRAAYLAARKEQSALRAVIKCIEEYKLEDEFPPENLKKRLDQLEKVK  401

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +EK+KP A  A    R    NGGPMPPAKAGR TNAYVSSFP AAPTFVRSPSH QYP  
Sbjct  402  TEKRKPVAVPANKRTRASNGNGGPMPPAKAGRLTNAYVSSFP-AAPTFVRSPSHGQYPAA  460

Query  406  LPAYPASPIYTHGSMS----PQYVYSPEAA  329
            LP YP SP + +GS S    P   YSPE A
Sbjct  461  LPPYP-SPPHMYGSRSPPANPYAAYSPEPA  489



>gb|KHN15769.1| hypothetical protein glysoja_012561 [Glycine soja]
Length=243

 Score =   250 bits (638),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 170/210 (81%), Gaps = 9/210 (4%)
 Frame = -3

Query  937  MXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaA  758
            M KLALSLGL  +MP++IEELIS+GQQ+DAVHFTYEVGL+ KFPPVPLLK+FLKDAKK A
Sbjct  1    MPKLALSLGLAQQMPDMIEELISKGQQLDAVHFTYEVGLVEKFPPVPLLKSFLKDAKKVA  60

Query  757  TAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEK---TK  587
             +ILEDPNN+GRAA+LAA+KE SA+RAV+KCIEEYKLE EFPPE+LKKRLDQLEK    K
Sbjct  61   ASILEDPNNAGRAAYLAARKEQSALRAVIKCIEEYKLEDEFPPENLKKRLDQLEKVKTVK  120

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +EK+KP A  A    R   SNGGPMPPAKAGR TNAYVSSFP AAPTFVRSPSH QYP  
Sbjct  121  TEKRKPVAVPANKRTRASNSNGGPMPPAKAGRLTNAYVSSFP-AAPTFVRSPSHGQYPAA  179

Query  406  LPAYPASPIYTHGSMS----PQYVYSPEAA  329
            LP YP SP + +GS S    P   YSPE A
Sbjct  180  LPPYP-SPPHMYGSRSPPANPYAAYSPEPA  208



>gb|KJB38151.1| hypothetical protein B456_006G239300 [Gossypium raimondii]
Length=520

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 175/209 (84%), Gaps = 7/209 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGD+MP++IEELIS+GQQ+DAVHFTYEVGL++KFPPVPLLK+FL+DAK
Sbjct  281  RKQMPKLAVSLGLGDQMPDMIEELISKGQQLDAVHFTYEVGLVDKFPPVPLLKSFLRDAK  340

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA++IL+DPNNSGRAA LAA+KE SA+RAV+KCIEEYKLEAEFPPE+LKKRL+QLEKTK
Sbjct  341  KAASSILDDPNNSGRAAQLAARKEQSALRAVIKCIEEYKLEAEFPPENLKKRLEQLEKTK  400

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K      PA KRTRV+NGGPMPPAKAGR TNAYVSSFPA  P FVRSPSHTQYP  
Sbjct  401  TE--KRKPVVVPANKRTRVNNGGPMPPAKAGRLTNAYVSSFPAPPP-FVRSPSHTQYP-A  456

Query  406  LPAYPASPIYTHGSMSP---QYVYSPEAA  329
                  SP   +GS SP    Y YSPEAA
Sbjct  457  PVPGYPSPPPMYGSRSPPTNPYAYSPEAA  485



>gb|ABM05952.1| proline-rich protein [Gossypium hirsutum]
Length=237

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 173/205 (84%), Gaps = 7/205 (3%)
 Frame = -3

Query  937  MXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaA  758
            M KLA+SLGLGD+MP++IEELIS+GQQ+DAVHFTYEVGL++KFPPVPLLK+FL+DAKKAA
Sbjct  1    MPKLAVSLGLGDQMPDMIEELISKGQQLDAVHFTYEVGLVDKFPPVPLLKSFLRDAKKAA  60

Query  757  TAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEk  578
            ++IL+DPNN+GRAA LAA+KE SA+RAV+KCIEEYKLEAEFPPE+LKKRL+QLEKTK+E 
Sbjct  61   SSILDDPNNTGRAAQLAARKEQSALRAVIKCIEEYKLEAEFPPENLKKRLEQLEKTKTE-  119

Query  577  kkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPA  398
             K      PA KRTRV+NGGPMPPAKAGR TNAYVSSFP A P FVRSPSHTQYP  +  
Sbjct  120  -KRKPVVVPANKRTRVNNGGPMPPAKAGRLTNAYVSSFP-APPPFVRSPSHTQYPAPV-P  176

Query  397  YPASPIYTHGSMSP---QYVYSPEA  332
               SP   +GS SP    Y YSPEA
Sbjct  177  GYPSPPPMYGSRSPPTNPYAYSPEA  201



>ref|XP_009610915.1| PREDICTED: FRIGIDA-like protein 4a [Nicotiana tomentosiformis]
Length=516

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 174/206 (84%), Gaps = 4/206 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGDKMPE+IEELISRGQQVDAVHFTYEVGL ++FPPVPLLKA+LKDAK
Sbjct  278  RKQMPKLAVSLGLGDKMPEMIEELISRGQQVDAVHFTYEVGLADRFPPVPLLKAYLKDAK  337

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAATAILEDPNNSGRAAHLAAKKE SAIR+VLKCIEEYKLEAEFPPE+LKK+L+Q EK K
Sbjct  338  KAATAILEDPNNSGRAAHLAAKKEQSAIRSVLKCIEEYKLEAEFPPENLKKQLEQSEKPK  397

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   AA PA KRTR SN GPMPPAKAGRSTNAYVSSFP  AP FVRSPSHTQY   
Sbjct  398  NE--KKRPAAVPANKRTRASNVGPMPPAKAGRSTNAYVSSFP-VAPAFVRSPSHTQY-PA  453

Query  406  LPAYPASPIYTHGSMSPQYVYSPEAA  329
                 A+P   +G+ SP Y YSPEAA
Sbjct  454  AVPAYAAPPAIYGNRSPPYPYSPEAA  479



>ref|XP_007225712.1| hypothetical protein PRUPE_ppa004224mg [Prunus persica]
 gb|EMJ26911.1| hypothetical protein PRUPE_ppa004224mg [Prunus persica]
Length=522

 Score =   256 bits (655),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 172/209 (82%), Gaps = 6/209 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGL  KMP++IEELISRGQQ+DAVHFTYEVGL++KFPPVPLLKAFLKDAK
Sbjct  283  RKQMPKLAVSLGLAKKMPDMIEELISRGQQLDAVHFTYEVGLVHKFPPVPLLKAFLKDAK  342

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA +I+EDPNN+GRAA+LA +KE SA+RAV+KCIE+YKLEAEFPPE+LKKRL+QLEK K
Sbjct  343  KAAASIMEDPNNAGRAANLAGRKEQSALRAVVKCIEDYKLEAEFPPENLKKRLEQLEKVK  402

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
             E  K   AA PA KRTR +NGGPMPPAKAGR TNAYVSSFP   PTFVRSPSH QYP G
Sbjct  403  PE--KKRPAAVPANKRTRANNGGPMPPAKAGRLTNAYVSSFPTPPPTFVRSPSHAQYPAG  460

Query  406  LPAYPASPIYTHGSMSP---QYVYSPEAA  329
               Y  SP   +GS SP    Y YSPEAA
Sbjct  461  YSPY-HSPPTMYGSRSPPTNPYAYSPEAA  488



>gb|KCW60755.1| hypothetical protein EUGRSUZ_H03480 [Eucalyptus grandis]
Length=477

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 175/209 (84%), Gaps = 6/209 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGDKMP++I+ELISRGQQ+DAVHFTYEVGL++ FPPVPLLKAFLKDA+
Sbjct  237  RKQMPKLAVSLGLGDKMPDIIKELISRGQQLDAVHFTYEVGLVDMFPPVPLLKAFLKDAR  296

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA  +LEDPNN GRAA+LA++KE SA+RAVLKCIEEYKLEA+FPPE+LKKRL+QLEK K
Sbjct  297  KAAATMLEDPNNGGRAANLASRKEQSALRAVLKCIEEYKLEAQFPPENLKKRLEQLEKVK  356

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
             + KK   AA PA KRTR +NGGPMPPAKAGR  NAYVSSFP AAP +VRSPSH QYP G
Sbjct  357  ID-KKRQPAAVPANKRTRANNGGPMPPAKAGRLANAYVSSFP-AAPAYVRSPSHGQYPAG  414

Query  406  LPAYPASPIYTHGSMSP---QYVYSPEAA  329
            +P Y  SP   +G +SP    Y YSPEAA
Sbjct  415  VPTY-HSPQPMYGGLSPPTNPYAYSPEAA  442



>ref|XP_009784382.1| PREDICTED: FRIGIDA-like protein 4a [Nicotiana sylvestris]
Length=516

 Score =   256 bits (654),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 174/206 (84%), Gaps = 4/206 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGDKMPE+IEELISRGQQVDAVHFTYEVGL ++FPPVPLLKA+LKDAK
Sbjct  278  RKQMPKLAVSLGLGDKMPEMIEELISRGQQVDAVHFTYEVGLADRFPPVPLLKAYLKDAK  337

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAATAILEDPNNSGR+AHLAAKKE SAIR+VLKCIEEYKLEAEFPPE+LKK+L+Q EK K
Sbjct  338  KAATAILEDPNNSGRSAHLAAKKEQSAIRSVLKCIEEYKLEAEFPPENLKKQLEQSEKPK  397

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   AA PA KRTR SN GPMPPAKAGRSTNAYVSSFP  AP FVRSPSHTQY   
Sbjct  398  NE--KKRPAAVPANKRTRASNVGPMPPAKAGRSTNAYVSSFP-VAPAFVRSPSHTQY-PA  453

Query  406  LPAYPASPIYTHGSMSPQYVYSPEAA  329
                 A+P   +G+ SP Y YSPEAA
Sbjct  454  AVPAYAAPPAIYGNRSPPYPYSPEAA  479



>ref|XP_006419936.1| hypothetical protein CICLE_v100047531mg, partial [Citrus clementina]
 gb|ESR33176.1| hypothetical protein CICLE_v100047531mg, partial [Citrus clementina]
Length=217

 Score =   246 bits (628),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 163/187 (87%), Gaps = 4/187 (2%)
 Frame = -3

Query  889  LIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATAILEDPNNSGRAAHL  710
            +IEELISRGQQ+DAVHFTYEVGL++KFPPVPLLKAFLKDAKKAA +ILEDPNN+GRAAHL
Sbjct  1    MIEELISRGQQLDAVHFTYEVGLVDKFPPVPLLKAFLKDAKKAAVSILEDPNNAGRAAHL  60

Query  709  AAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRV  530
            AA+KE SA+RAV+KCIE+YKL+ EFPPE+LKKRL+QLEK K+E  K   AA PA KRTR 
Sbjct  61   AARKEQSALRAVIKCIEDYKLQGEFPPENLKKRLEQLEKAKTE--KKKPAAVPATKRTRA  118

Query  529  SNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQY  350
            SNGGPMPPAKAGR TNAYVSSFP A PTFVRSPSHTQYP G+ AY ASP   +GS SP Y
Sbjct  119  SNGGPMPPAKAGRLTNAYVSSFP-APPTFVRSPSHTQYPAGVTAY-ASPPAVYGSRSPPY  176

Query  349  VYSPEAA  329
             YSPEAA
Sbjct  177  AYSPEAA  183



>ref|XP_003536533.1| PREDICTED: FRIGIDA-like protein 4a-like [Glycine max]
Length=530

 Score =   256 bits (653),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 172/213 (81%), Gaps = 9/213 (4%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLALSLGL  +MP++IEELIS+GQQ+DAVHFTYEVGL+ KFPPVPLLK+FLKDAK
Sbjct  285  RKQMPKLALSLGLAQQMPDMIEELISKGQQLDAVHFTYEVGLVEKFPPVPLLKSFLKDAK  344

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEK--  593
            K A +ILEDPNN+GRAA+LAA+KE SA+RAV+KCIEEYKLE EFPPE+LKKRLDQLEK  
Sbjct  345  KVAASILEDPNNAGRAAYLAARKEQSALRAVIKCIEEYKLEDEFPPENLKKRLDQLEKVK  404

Query  592  -TKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQY  416
              K+EK+KP A  A    R   SNGGPMPPAKAGR TNAYVSSFP AAPTFVRSPSH QY
Sbjct  405  TVKTEKRKPVAVPANKRTRASNSNGGPMPPAKAGRLTNAYVSSFP-AAPTFVRSPSHGQY  463

Query  415  PTGLPAYPASPIYTHGSMS----PQYVYSPEAA  329
            P  LP YP SP + +GS S    P   YSPE A
Sbjct  464  PAALPPYP-SPPHMYGSRSPPTNPYAAYSPEPA  495



>gb|KHG22505.1| Protein FRIGIDA -like protein [Gossypium arboreum]
Length=520

 Score =   255 bits (652),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 174/209 (83%), Gaps = 7/209 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGD+MP++IEELIS+GQQ+DAVHFTYEVGL++KFPPVPLLK+FL+DAK
Sbjct  281  RKQMPKLAVSLGLGDQMPDMIEELISKGQQLDAVHFTYEVGLVDKFPPVPLLKSFLRDAK  340

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA++IL+DPNN+GRAA LAA+KE SA+RAV+KCIEEYKLEAEFPPE+LKKRL+QLEKTK
Sbjct  341  KAASSILDDPNNTGRAAQLAARKEQSALRAVIKCIEEYKLEAEFPPENLKKRLEQLEKTK  400

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K      PA KRTRV+NGGPMPPAKAGR TNAYVSSFPA  P FVRSPSHTQYP  
Sbjct  401  TE--KRKPVVVPANKRTRVNNGGPMPPAKAGRLTNAYVSSFPAPPP-FVRSPSHTQYP-A  456

Query  406  LPAYPASPIYTHGSMSP---QYVYSPEAA  329
                  SP   +GS SP    Y YSPEA 
Sbjct  457  PVPGYPSPPPMYGSRSPPTNPYAYSPEAV  485



>ref|XP_010024304.1| PREDICTED: LOW QUALITY PROTEIN: FRIGIDA-like protein 4a [Eucalyptus 
grandis]
Length=530

 Score =   255 bits (652),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 175/209 (84%), Gaps = 6/209 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGDKMP++I+ELISRGQQ+DAVHFTYEVGL++ FPPVPLLKAFLKDA+
Sbjct  290  RKQMPKLAVSLGLGDKMPDIIKELISRGQQLDAVHFTYEVGLVDMFPPVPLLKAFLKDAR  349

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA  +LEDPNN GRAA+LA++KE SA+RAVLKCIEEYKLEA+FPPE+LKKRL+QLEK K
Sbjct  350  KAAATMLEDPNNGGRAANLASRKEQSALRAVLKCIEEYKLEAQFPPENLKKRLEQLEKVK  409

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
             + KK   AA PA KRTR +NGGPMPPAKAGR  NAYVSSFP AAP +VRSPSH QYP G
Sbjct  410  ID-KKRQPAAVPANKRTRANNGGPMPPAKAGRLANAYVSSFP-AAPAYVRSPSHGQYPAG  467

Query  406  LPAYPASPIYTHGSMSP---QYVYSPEAA  329
            +P Y  SP   +G +SP    Y YSPEAA
Sbjct  468  VPTY-HSPQPMYGGLSPPTNPYAYSPEAA  495



>ref|XP_007143260.1| hypothetical protein PHAVU_007G057500g [Phaseolus vulgaris]
 gb|ESW15254.1| hypothetical protein PHAVU_007G057500g [Phaseolus vulgaris]
Length=525

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 174/213 (82%), Gaps = 9/213 (4%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLALSLGL  +MP++IEELIS+GQQ+DAVHFTYEVGL++KFPPVPLLK+FLKDAK
Sbjct  281  RKQMPKLALSLGLTQQMPDMIEELISKGQQLDAVHFTYEVGLVDKFPPVPLLKSFLKDAK  340

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEK--  593
            K A +ILEDPNN+GRAA+LAA+KE SA+RAV+KCIEEYKLEA+FPPE+LKKRL+QLEK  
Sbjct  341  KVAASILEDPNNAGRAAYLAARKEQSALRAVIKCIEEYKLEADFPPENLKKRLEQLEKVK  400

Query  592  -TKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQY  416
              K+EK+KP A  A    R   SNGGPMPPAKAGR TNAYVSSFP AAPTFVRSPSH QY
Sbjct  401  TVKTEKRKPVAVPANKRTRASNSNGGPMPPAKAGRLTNAYVSSFP-AAPTFVRSPSHGQY  459

Query  415  PTGLPAYPASPIYTHGSMS----PQYVYSPEAA  329
            P  LP YP SP + +GS S    P   YSPE A
Sbjct  460  PAALPPYP-SPPHMYGSRSPPANPYAAYSPEPA  491



>ref|XP_011659019.1| PREDICTED: FRIGIDA-like protein 4a [Cucumis sativus]
 gb|KGN44244.1| hypothetical protein Csa_7G234160 [Cucumis sativus]
Length=518

 Score =   253 bits (647),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 174/209 (83%), Gaps = 7/209 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGD MP++IEELISRGQQ+DAVHFTYEVGL +KFPPVPLLKA+LKDAK
Sbjct  281  RKQMPKLAVSLGLGDIMPDMIEELISRGQQLDAVHFTYEVGLADKFPPVPLLKAYLKDAK  340

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA AI EDPNN+GRA HLAA+KE SA+RAV+KCIEEYKL+AEFPPE+LKKRL+QLEK K
Sbjct  341  KAAAAISEDPNNTGRAMHLAARKEQSALRAVIKCIEEYKLQAEFPPENLKKRLEQLEKVK  400

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
             E  K   A  PA KRTR ++GGPMPPAKAGR TNAYVSS+P AAP FVRSPSH+QYP G
Sbjct  401  VE--KRKPAPVPANKRTRANSGGPMPPAKAGRLTNAYVSSYP-AAPAFVRSPSHSQYPAG  457

Query  406  LPAYPASPIYTHGSMSP---QYVYSPEAA  329
            +P Y  SP   +GS SP    Y YSPEAA
Sbjct  458  VPPY-HSPPSMYGSRSPPTNPYSYSPEAA  485



>ref|XP_010256039.1| PREDICTED: FRIGIDA-like protein 4a [Nelumbo nucifera]
Length=522

 Score =   253 bits (647),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 173/215 (80%), Gaps = 13/215 (6%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGDKM ++IEELISRGQQVDAVHFTYEVGL++KFPP+PLLKA+LKD+K
Sbjct  277  RKQMPKLAVSLGLGDKMADMIEELISRGQQVDAVHFTYEVGLVDKFPPIPLLKAYLKDSK  336

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K A +ILED NN G+AAHLA +KE SA+RAV+KCIEEYKLE++FPPE L+KRL+QLEK K
Sbjct  337  KVANSILEDRNNPGKAAHLAGRKEQSALRAVIKCIEEYKLESDFPPETLRKRLEQLEKAK  396

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   AA PA KRTR SNGGPMPPAKAGR  NAYVSSFP AAPTFVRSPSH QYPTG
Sbjct  397  TE--KKKPAAVPANKRTRASNGGPMPPAKAGRLANAYVSSFP-AAPTFVRSPSHGQYPTG  453

Query  406  LPAY----PASPIYTHGSMSP-----QYVYSPEAA  329
            +P Y     A+P   +GS SP      Y Y PE A
Sbjct  454  VPPYAYERSAAPT-MYGSRSPPAVRDHYGYPPEEA  487



>ref|XP_008447152.1| PREDICTED: FRIGIDA-like protein 4a [Cucumis melo]
Length=517

 Score =   253 bits (646),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 174/209 (83%), Gaps = 7/209 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGD MP++IEELISRGQQ+DAVHFTYEVG+ +KFPPVPLLKA+LKDAK
Sbjct  280  RKQMPKLAVSLGLGDIMPDMIEELISRGQQLDAVHFTYEVGIADKFPPVPLLKAYLKDAK  339

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA AI EDPNN+GRA HLAA+KE SA+RAV+KCIEEYKL+AEFPPE+LKKRL+QLEK K
Sbjct  340  KAAAAISEDPNNTGRAMHLAARKEQSALRAVIKCIEEYKLQAEFPPENLKKRLEQLEKVK  399

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
             E  K   A  PA KRTR ++GGPMPPAKAGR TNAYVSS+P AAP FVRSPSH+QYP G
Sbjct  400  VE--KRKPAPVPANKRTRANSGGPMPPAKAGRLTNAYVSSYP-AAPAFVRSPSHSQYPAG  456

Query  406  LPAYPASPIYTHGSMSP---QYVYSPEAA  329
            +P Y  SP   +GS SP    Y YSPEAA
Sbjct  457  VPPY-HSPPSMYGSRSPPTNPYTYSPEAA  484



>ref|XP_008340987.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
Length=521

 Score =   253 bits (646),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 168/208 (81%), Gaps = 5/208 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGL  +MP++IEELISRGQQ+DAVHFTYEVGL++KFPPVPLLKAFLKDAK
Sbjct  283  RKQMPKLAVSLGLAKQMPDMIEELISRGQQLDAVHFTYEVGLVHKFPPVPLLKAFLKDAK  342

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA +ILEDPNN+GRAA+LA +KELSA+RAV+KCIE+Y LE EFPPE+LKKRL+QLEK K
Sbjct  343  KAAASILEDPNNAGRAANLAGRKELSALRAVVKCIEDYNLETEFPPENLKKRLEQLEKVK  402

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
             E  K      PA KRTR +NGGPMPPAKAGR TNAYVSSFP   PTFV SPSH QYP G
Sbjct  403  PE--KKRPVVVPANKRTRANNGGPMPPAKAGRLTNAYVSSFPTTPPTFVMSPSHGQYPAG  460

Query  406  LPAYPASPIYTHGSMSP--QYVYSPEAA  329
               Y  SP   +GS SP   Y YSPEAA
Sbjct  461  FSPY-HSPPTMYGSRSPPTPYAYSPEAA  487



>ref|XP_006414627.1| hypothetical protein EUTSA_v10024868mg [Eutrema salsugineum]
 gb|ESQ56080.1| hypothetical protein EUTSA_v10024868mg [Eutrema salsugineum]
Length=539

 Score =   253 bits (647),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 169/207 (82%), Gaps = 5/207 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLALS+GLGD+MP++IEELI RGQQ+DAVHFT+EVGL++KFPPVPLLKA+L+DAK
Sbjct  290  RKQMPKLALSVGLGDQMPDMIEELIIRGQQLDAVHFTFEVGLVHKFPPVPLLKAYLRDAK  349

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K+  +I EDPNN GR+AHL A+K+ SA+RAV+KCIEEYKLE EFPPE LKKRLDQLEKTK
Sbjct  350  KSTASITEDPNNPGRSAHLVARKKQSALRAVIKCIEEYKLEEEFPPEDLKKRLDQLEKTK  409

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHT-QYPT  410
            +E  K   A  PA KRTR S  GPMPPAKAGR TNAYVSSFP A PTF+RSPSH+ QY  
Sbjct  410  TE--KRKPATIPANKRTRASYNGPMPPAKAGRITNAYVSSFPPAPPTFIRSPSHSPQY--  465

Query  409  GLPAYPASPIYTHGSMSPQYVYSPEAA  329
            G+PAY  SP   + + SP Y YSPEA 
Sbjct  466  GVPAYTTSPPTIYSNRSPPYQYSPEAV  492



>ref|XP_009369844.1| PREDICTED: FRIGIDA-like protein 4a [Pyrus x bretschneideri]
Length=521

 Score =   248 bits (632),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 166/208 (80%), Gaps = 5/208 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGL  +MP++IEELISRGQQ+DAVHFTYEVGL++KFPPVPLLKAFLKDAK
Sbjct  283  RKQMPKLAVSLGLAKQMPDMIEELISRGQQLDAVHFTYEVGLVHKFPPVPLLKAFLKDAK  342

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA +ILEDPNN+GRAA+LA +KELSA+RAV+KCIE+Y LE EFPPE+LKKRL+QLEK K
Sbjct  343  KAAASILEDPNNAGRAANLAGRKELSALRAVVKCIEDYNLETEFPPENLKKRLEQLEKVK  402

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
             E  K      PA KRTR +NGGPMPPAKAGR  NAYVSS P   PTFV SPSH QYP G
Sbjct  403  PE--KKRPVVVPANKRTRANNGGPMPPAKAGRLMNAYVSSVPTPPPTFVMSPSHGQYPAG  460

Query  406  LPAYPASPIYTHGSMSP--QYVYSPEAA  329
               Y  SP   +GS SP   Y YSPEAA
Sbjct  461  FSPY-HSPPTMYGSRSPPTPYAYSPEAA  487



>ref|XP_010695287.1| PREDICTED: FRIGIDA-like protein 4a [Beta vulgaris subsp. vulgaris]
Length=524

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 168/204 (82%), Gaps = 5/204 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLG+ MP++IEELISRGQQVDAVHFTYEVGL+ KFPPVPLLK+FLKDA+
Sbjct  286  RKQMPKLAVSLGLGENMPDMIEELISRGQQVDAVHFTYEVGLVGKFPPVPLLKSFLKDAR  345

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA AILEDPN+ GRAAHLA +KE SA+RAVLKCIEEYKLE EFP E++KKRL+QLEK K
Sbjct  346  KAAAAILEDPNHGGRAAHLANRKEQSALRAVLKCIEEYKLEDEFPQENIKKRLEQLEKNK  405

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            ++  K  +A  PA KRTRV N GPMPPAKAGRSTNAYVSSF A AP +VRSPSH QYP G
Sbjct  406  TD--KKKSAPIPANKRTRVCNNGPMPPAKAGRSTNAYVSSF-APAPAYVRSPSHPQYPAG  462

Query  406  LPAYPAS-PIYT-HGSMSPQYVYS  341
            +  YP   P +  +GS SP Y YS
Sbjct  463  VAPYPYDRPAHVMYGSSSPPYHYS  486



>gb|ACV83306.2| hypothetical protein UP-5 [Dimocarpus longan]
Length=226

 Score =   236 bits (603),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 163/194 (84%), Gaps = 10/194 (5%)
 Frame = -3

Query  889  LIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATAILEDPNNSGRAAHL  710
            +I+ELISRGQQ+D VHFTYEVGL++KFPPVPLLKAFLKDA+KAA +ILEDPNN+GRAAHL
Sbjct  1    MIKELISRGQQLDTVHFTYEVGLVDKFPPVPLLKAFLKDARKAAASILEDPNNAGRAAHL  60

Query  709  AAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRV  530
            AA+KE SA+R+V+KCIEEYKLEAEFPPE+LKKRL+QLEK K E  K   AA PA KRTR 
Sbjct  61   AARKEQSALRSVIKCIEEYKLEAEFPPENLKKRLEQLEKAKIE--KKKPAAVPANKRTRA  118

Query  529  SNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYPA----SPIYTHGSM  362
            SNGGPMPPAKAGRSTNAYVSSFP A PTFVRSPSH+QYP G+  Y +    SP   +GS 
Sbjct  119  SNGGPMPPAKAGRSTNAYVSSFP-APPTFVRSPSHSQYPAGVSPYQSPPYQSPPAVYGSR  177

Query  361  SPQ---YVYSPEAA  329
            SPQ   Y YSPEAA
Sbjct  178  SPQAHPYAYSPEAA  191



>ref|XP_010449973.1| PREDICTED: FRIGIDA-like protein 4b [Camelina sativa]
Length=544

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 167/207 (81%), Gaps = 5/207 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELI RGQQ+DAVHFT+EVGL++KFPPVPLLKA+L+DAK
Sbjct  296  RKQMPKLAVSVGLGDQMPDMIEELIIRGQQLDAVHFTFEVGLVHKFPPVPLLKAYLRDAK  355

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA   I ED NN GR+AHL A+KE SA+RAVLKCIEEYKLE EFPPE+LKKRLDQLEKTK
Sbjct  356  KATALITEDSNNPGRSAHLVARKEQSALRAVLKCIEEYKLEEEFPPENLKKRLDQLEKTK  415

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHT-QYPT  410
            +E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSSFP   PTF+RSPSH+ QY  
Sbjct  416  TE--KRKPAAIPANKRTRASYNGPMPPAKAGRITNAYVSSFPPPPPTFIRSPSHSPQY--  471

Query  409  GLPAYPASPIYTHGSMSPQYVYSPEAA  329
            G+PAY  SP   + + SP Y YSPE  
Sbjct  472  GVPAYTTSPPTIYNNRSPPYQYSPEVV  498



>gb|AAL31182.1| AT4g14900/dl3490c [Arabidopsis thaliana]
Length=505

 Score =   242 bits (618),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 166/207 (80%), Gaps = 5/207 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELI RGQQ+DAVHFT+EVGL++ FPPVPLLKA+L+DAK
Sbjct  258  RKQMPKLAVSVGLGDQMPDMIEELIIRGQQLDAVHFTFEVGLVHLFPPVPLLKAYLRDAK  317

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA   I +D NNSGR+AHL A+KE SA+RAVLKCIEEYKLE EFPPE+LKKRLDQLEKTK
Sbjct  318  KATALITDDSNNSGRSAHLVARKEQSALRAVLKCIEEYKLEEEFPPENLKKRLDQLEKTK  377

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHT-QYPT  410
            +E  K   A  PA KRTR S  GPMPPAKAGR TNAYVSSFP   PTF+RS SH+ QY  
Sbjct  378  TE--KRKPAVIPANKRTRASYSGPMPPAKAGRITNAYVSSFPPPPPTFIRSQSHSPQY--  433

Query  409  GLPAYPASPIYTHGSMSPQYVYSPEAA  329
            G+PAY  SP   + + SP Y YSPEA 
Sbjct  434  GVPAYTTSPPTIYSNRSPPYQYSPEAV  460



>ref|NP_567447.1| FRIGIDA-like protein [Arabidopsis thaliana]
 sp|Q940H8.1|FRL4B_ARATH RecName: Full=FRIGIDA-like protein 4b [Arabidopsis thaliana]
 gb|AAK96809.1| hydroxyproline-rich glycoprotein homolog [Arabidopsis thaliana]
 gb|AAM10105.1| hydroxyproline-rich glycoprotein homolog [Arabidopsis thaliana]
 gb|AAM63474.1| hydroxyproline-rich glycoprotein-like protein [Arabidopsis thaliana]
 gb|AEE83517.1| FRIGIDA-like protein [Arabidopsis thaliana]
Length=532

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 166/207 (80%), Gaps = 5/207 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELI RGQQ+DAVHFT+EVGL++ FPPVPLLKA+L+DAK
Sbjct  285  RKQMPKLAVSVGLGDQMPDMIEELIIRGQQLDAVHFTFEVGLVHLFPPVPLLKAYLRDAK  344

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA   I +D NNSGR+AHL A+KE SA+RAVLKCIEEYKLE EFPPE+LKKRLDQLEKTK
Sbjct  345  KATALITDDSNNSGRSAHLVARKEQSALRAVLKCIEEYKLEEEFPPENLKKRLDQLEKTK  404

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHT-QYPT  410
            +E  K   A  PA KRTR S  GPMPPAKAGR TNAYVSSFP   PTF+RS SH+ QY  
Sbjct  405  TE--KRKPAVIPANKRTRASYSGPMPPAKAGRITNAYVSSFPPPPPTFIRSQSHSPQY--  460

Query  409  GLPAYPASPIYTHGSMSPQYVYSPEAA  329
            G+PAY  SP   + + SP Y YSPEA 
Sbjct  461  GVPAYTTSPPTIYSNRSPPYQYSPEAV  487



>ref|XP_008390891.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
Length=522

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 163/204 (80%), Gaps = 6/204 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGL  +MP++IEELISRGQQ+DAVHFTY VGL++KFPPVPLLKAFLKDAK
Sbjct  283  RKQMPKLAVSLGLAKQMPDMIEELISRGQQLDAVHFTYGVGLVHKFPPVPLLKAFLKDAK  342

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA +ILEDPNN+GRAA+LA +KELSA+RAV+KCIE+Y LEAEFPPE LKKRL+QLEK K
Sbjct  343  KAAASILEDPNNAGRAANLAGRKELSAVRAVIKCIEDYNLEAEFPPEDLKKRLEQLEKVK  402

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
             E  K      PA KR R +NGGPMPPAKAGR TNAYVSSFP   PTFVRSPSH QYP G
Sbjct  403  PE--KKRPVVVPANKRVRANNGGPMPPAKAGRLTNAYVSSFP-TPPTFVRSPSHGQYPAG  459

Query  406  LPAYPASPIYTHGSMSP--QYVYS  341
               Y  SP   +GS SP   Y YS
Sbjct  460  FSPY-HSPPTMYGSRSPPTPYAYS  482



>gb|KFK43732.1| hypothetical protein AALP_AA1G165500 [Arabis alpina]
Length=531

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 164/206 (80%), Gaps = 5/206 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELI +GQQ+DAVHF++EVGL+ KFPPVPLLKA+L+DAK
Sbjct  283  RKQMPKLAVSVGLGDQMPDMIEELIIKGQQLDAVHFSFEVGLVQKFPPVPLLKAYLRDAK  342

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA   I ED NN GR AHL A+KE +A+RAVL+CIEEYKLE EFPPE+LKKRLDQLEKTK
Sbjct  343  KATVLITEDSNNPGRVAHLVARKEQAALRAVLRCIEEYKLEEEFPPENLKKRLDQLEKTK  402

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHT-QYPT  410
            +E  K   A  PA KRTR S  GPMPPAKAGR  NAYVSSFP + PTF+ SPSH+ QY  
Sbjct  403  TE--KRKPATIPANKRTRASYNGPMPPAKAGRIANAYVSSFPPSPPTFITSPSHSPQY--  458

Query  409  GLPAYPASPIYTHGSMSPQYVYSPEA  332
            GLPAY  SP   + + SP Y YSPEA
Sbjct  459  GLPAYTPSPPTIYSNRSPPYQYSPEA  484



>ref|XP_010435051.1| PREDICTED: FRIGIDA-like protein 4b [Camelina sativa]
Length=548

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 168/208 (81%), Gaps = 6/208 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELI RGQQ+DAVHFT+EVGL++KFPPVPLLKA+L+DAK
Sbjct  299  RKQMPKLAVSVGLGDQMPDMIEELIIRGQQLDAVHFTFEVGLVHKFPPVPLLKAYLRDAK  358

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA   I ED NN GR+AHL A+KE SA+RAVLKCIEEYKLE EFPPE+LKKRLDQLEKTK
Sbjct  359  KATALITEDSNNPGRSAHLVARKEQSALRAVLKCIEEYKLEEEFPPENLKKRLDQLEKTK  418

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHT-QYPT  410
            +E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSSFP   PTF+RSPSH+ QY  
Sbjct  419  TE--KRKPAAIPANKRTRASYNGPMPPAKAGRITNAYVSSFPPPPPTFIRSPSHSPQY--  474

Query  409  GLP-AYPASPIYTHGSMSPQYVYSPEAA  329
            G+P AY  SP   + + SP Y YSPEA 
Sbjct  475  GVPAAYTTSPPTIYNNRSPPYQYSPEAV  502



>ref|XP_010488272.1| PREDICTED: FRIGIDA-like protein 4a [Camelina sativa]
Length=539

 Score =   240 bits (613),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 165/204 (81%), Gaps = 7/204 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELISRGQQ+DAVHFTYEVGL++KFPPVPLLKA+L+DAK
Sbjct  287  RKQMPKLAVSVGLGDQMPDMIEELISRGQQLDAVHFTYEVGLVDKFPPVPLLKAYLRDAK  346

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K+A +I+ED +N+GRA HL A+KE SA++AVLKCIEEYKLE EFPPE+LKKRLDQLEKTK
Sbjct  347  KSAASIMEDSSNTGRATHLVARKEQSALKAVLKCIEEYKLEEEFPPENLKKRLDQLEKTK  406

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSSFP     F+RSPSH+     
Sbjct  407  TE--KRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSSFP-----FIRSPSHSPQYAS  459

Query  406  LPAYPASPIYTHGSMSPQYVYSPE  335
              AYP+ P   + + SP Y YSPE
Sbjct  460  PAAYPSPPTTVYSNRSPPYPYSPE  483



>ref|XP_002868244.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH44503.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=532

 Score =   240 bits (613),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 166/207 (80%), Gaps = 5/207 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELI RGQQ+DAVHFT+EVGL++KFPPVPLLKA+L+DAK
Sbjct  285  RKQMPKLAVSVGLGDQMPDMIEELIFRGQQLDAVHFTFEVGLVHKFPPVPLLKAYLRDAK  344

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA   I ED NN GR+AHL  +KE SA+RAVLKCIEEYKLE EFPP++LKKRLDQLEKTK
Sbjct  345  KATALITEDSNNPGRSAHLVGRKEQSALRAVLKCIEEYKLEEEFPPDNLKKRLDQLEKTK  404

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHT-QYPT  410
            +E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSSFP   PTF+RSPSH+ QY  
Sbjct  405  TE--KRKPAAIPANKRTRASYNGPMPPAKAGRITNAYVSSFPPPPPTFIRSPSHSPQY--  460

Query  409  GLPAYPASPIYTHGSMSPQYVYSPEAA  329
             +P+Y  SP   + + SP Y YSPEA 
Sbjct  461  AVPSYTTSPPTIYSNRSPPYQYSPEAV  487



>ref|NP_566709.1| FRIGIDA-like protein [Arabidopsis thaliana]
 sp|Q9LUV4.1|FRL4A_ARATH RecName: Full=FRIGIDA-like protein 4a [Arabidopsis thaliana]
 dbj|BAB01784.1| hydroxyproline-rich glycoprotein [Arabidopsis thaliana]
 gb|AAK92705.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20275.1| putative hydroxyproline-rich glycoprotein [Arabidopsis thaliana]
 gb|AAM61695.1| hydroxyproline-rich glycoprotein-like protein [Arabidopsis thaliana]
 gb|AEE76640.1| FRIGIDA-like protein [Arabidopsis thaliana]
Length=532

 Score =   240 bits (613),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 165/204 (81%), Gaps = 7/204 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELISRGQQ+DAVHFTYEVGL++KFPPVPLLKA+L+DAK
Sbjct  287  RKQMPKLAVSVGLGDQMPDMIEELISRGQQLDAVHFTYEVGLVDKFPPVPLLKAYLRDAK  346

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K+A +I+ED +N+GRA HL A+KE SA++AVLKCIEEYKLE EFPPE+LKKRLDQLEKTK
Sbjct  347  KSAASIMEDSSNTGRATHLVARKEQSALKAVLKCIEEYKLEEEFPPENLKKRLDQLEKTK  406

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSSFP     F+RSPSH+     
Sbjct  407  TE--KRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSSFP-----FIRSPSHSPQYAS  459

Query  406  LPAYPASPIYTHGSMSPQYVYSPE  335
              AYP+ P   + + SP Y YSPE
Sbjct  460  PAAYPSPPTTVYSNRSPPYPYSPE  483



>ref|XP_010440374.1| PREDICTED: FRIGIDA-like protein 4b [Camelina sativa]
Length=549

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 167/208 (80%), Gaps = 6/208 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELI RGQQ+DAVHFT+EVGL++KFPPVPLLKA+L+DAK
Sbjct  300  RKQMPKLAVSVGLGDQMPDMIEELIIRGQQLDAVHFTFEVGLVHKFPPVPLLKAYLRDAK  359

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA   I ED NN GR+AHL A+KE SA+RAVLKCIEEYKLE EFPPE+LKKRLDQLEKTK
Sbjct  360  KATALITEDSNNPGRSAHLVARKEQSALRAVLKCIEEYKLEEEFPPENLKKRLDQLEKTK  419

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHT-QYPT  410
            +E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSSFP   PTF+RSPSH+ QY  
Sbjct  420  TE--KRKPAAIPANKRTRASYNGPMPPAKAGRITNAYVSSFPPPPPTFIRSPSHSPQY--  475

Query  409  GLP-AYPASPIYTHGSMSPQYVYSPEAA  329
            G+P AY  SP   + + SP Y YSPE  
Sbjct  476  GVPAAYTTSPPTIYNNRSPPYQYSPEVV  503



>ref|XP_006283490.1| hypothetical protein CARUB_v10004542mg [Capsella rubella]
 gb|EOA16388.1| hypothetical protein CARUB_v10004542mg [Capsella rubella]
Length=540

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 167/207 (81%), Gaps = 5/207 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELI RGQQ+DAVHF++EVGL++KFPPVPLLKA+L+DAK
Sbjct  291  RKQMPKLAVSVGLGDQMPDMIEELIIRGQQLDAVHFSFEVGLVHKFPPVPLLKAYLRDAK  350

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA   I ED NN GR+AHL A+KE SA+RAVLKCIEEYKLE EFPPE+LKKRLDQLEKTK
Sbjct  351  KATALITEDSNNPGRSAHLVARKEQSALRAVLKCIEEYKLEEEFPPENLKKRLDQLEKTK  410

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHT-QYPT  410
            +E  K   A  PA KRTR S  GPMPPAKAGR TNAYVSSFP   PTF++SPS++ QY  
Sbjct  411  TE--KRKPAVVPANKRTRASYNGPMPPAKAGRITNAYVSSFPPPPPTFIKSPSYSPQY--  466

Query  409  GLPAYPASPIYTHGSMSPQYVYSPEAA  329
            G+PAY  SP   + + SP Y YSPEA 
Sbjct  467  GVPAYTPSPPTIYNNRSPPYQYSPEAV  493



>gb|KFK39537.1| hypothetical protein AALP_AA3G257000 [Arabis alpina]
Length=529

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 165/204 (81%), Gaps = 7/204 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELI+RGQQ+DAVHFTYEVGL++KFPPVPLLKA+L+DAK
Sbjct  283  RKQMPKLAVSVGLGDQMPDMIEELITRGQQLDAVHFTYEVGLVDKFPPVPLLKAYLRDAK  342

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA +I+ED +N+GRA H+ A+KE SA+RAVLKCIEEYKLE EFPPE+LKKRLDQLEKTK
Sbjct  343  KAAASIMEDSSNNGRATHIVARKEQSALRAVLKCIEEYKLEEEFPPENLKKRLDQLEKTK  402

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSSFP     F+RSPSH+     
Sbjct  403  TE--KRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSSFP-----FIRSPSHSPQYAS  455

Query  406  LPAYPASPIYTHGSMSPQYVYSPE  335
              AYP+ P   + + SP Y YSPE
Sbjct  456  PAAYPSPPTTVYSNRSPPYPYSPE  479



>ref|XP_010511354.1| PREDICTED: FRIGIDA-like protein 4a [Camelina sativa]
Length=530

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 165/204 (81%), Gaps = 7/204 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELISRGQQ+DAVHFTYEVGL++KFPPVPLLKA+L+DAK
Sbjct  285  RKQMPKLAVSVGLGDQMPDMIEELISRGQQLDAVHFTYEVGLVDKFPPVPLLKAYLRDAK  344

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K+A +I+ED +++GRA HL A+KE SA++AVLKCIEEYKLE EFPPE+LKKRLDQLEKTK
Sbjct  345  KSAASIMEDSSSTGRATHLVARKEQSALKAVLKCIEEYKLEEEFPPENLKKRLDQLEKTK  404

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSSFP     F+RSPSH+     
Sbjct  405  TE--KRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSSFP-----FIRSPSHSPQYAS  457

Query  406  LPAYPASPIYTHGSMSPQYVYSPE  335
              AYP+ P   + + SP Y YSPE
Sbjct  458  PAAYPSPPTTVYSNRSPAYPYSPE  481



>gb|KCW60756.1| hypothetical protein EUGRSUZ_H03480 [Eucalyptus grandis]
Length=511

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 153/243 (63%), Positives = 175/243 (72%), Gaps = 40/243 (16%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPE----------------------------------LIEELIS  869
            RK M KLA+SLGLGDKMP+                                  +I+ELIS
Sbjct  237  RKQMPKLAVSLGLGDKMPDEEGQWCYLVPEFTTSDNLATFVFGEATSTCWISDIIKELIS  296

Query  868  RGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATAILEDPNNSGRAAHLAAKKELS  689
            RGQQ+DAVHFTYEVGL++ FPPVPLLKAFLKDA+KAA  +LEDPNN GRAA+LA++KE S
Sbjct  297  RGQQLDAVHFTYEVGLVDMFPPVPLLKAFLKDARKAAATMLEDPNNGGRAANLASRKEQS  356

Query  688  AIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMP  509
            A+RAVLKCIEEYKLEA+FPPE+LKKRL+QLEK K + KK   AA PA KRTR +NGGPMP
Sbjct  357  ALRAVLKCIEEYKLEAQFPPENLKKRLEQLEKVKID-KKRQPAAVPANKRTRANNGGPMP  415

Query  508  PAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP---QYVYSP  338
            PAKAGR  NAYVSSFP AAP +VRSPSH QYP G+P Y  SP   +G +SP    Y YSP
Sbjct  416  PAKAGRLANAYVSSFP-AAPAYVRSPSHGQYPAGVPTY-HSPQPMYGGLSPPTNPYAYSP  473

Query  337  EAA  329
            EAA
Sbjct  474  EAA  476



>ref|XP_010525189.1| PREDICTED: FRIGIDA-like protein 4a [Tarenaya hassleriana]
Length=548

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 170/210 (81%), Gaps = 9/210 (4%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELISRGQQ+DAVHFTYEVGL++KFPPVPLLKA+L+DAK
Sbjct  294  RKQMPKLAVSVGLGDQMPDMIEELISRGQQLDAVHFTYEVGLVDKFPPVPLLKAYLRDAK  353

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA +I+EDPNN GRAA LA +KE SA+RAVLKCIEEYKLE EFPPE+LKKRLDQLEK+K
Sbjct  354  KAAASIMEDPNNPGRAAQLAVRKEQSALRAVLKCIEEYKLEEEFPPENLKKRLDQLEKSK  413

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHT-QYPT  410
            +E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSSFP   PT++RSP+H+ QY +
Sbjct  414  TE--KRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSSFP-TPPTYIRSPTHSPQYAS  470

Query  409  ---GLPAYPASPIYTHGSMSPQYVYSPEAA  329
                    P + +Y++G  SP Y YSPE  
Sbjct  471  PPYASFPPPPTTVYSNG--SPPYPYSPEVG  498



>ref|XP_002883367.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59626.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=531

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 164/204 (80%), Gaps = 7/204 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELISRGQQ+DAVHFTYEVGL++KFPPVPLLKA+L+DAK
Sbjct  286  RKQMPKLAVSVGLGDQMPDMIEELISRGQQLDAVHFTYEVGLVDKFPPVPLLKAYLRDAK  345

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K+A +I+E+ +N+GR  HL A+KE SA++AVLKCIEEYKLE EFPPE+LKKRLDQLEKTK
Sbjct  346  KSAASIMEESSNTGRPTHLVARKEQSALKAVLKCIEEYKLEEEFPPENLKKRLDQLEKTK  405

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSSFP     F+RSPSH+     
Sbjct  406  TE--KRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSSFP-----FIRSPSHSPQYAS  458

Query  406  LPAYPASPIYTHGSMSPQYVYSPE  335
              AYP+ P   + + SP Y YSPE
Sbjct  459  PAAYPSPPTTVYSNRSPPYPYSPE  482



>emb|CDY34252.1| BnaA01g24690D [Brassica napus]
Length=522

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 165/205 (80%), Gaps = 11/205 (5%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+ +GLGD+MP++IEELISRGQQ+DAVHFTYEVGL++KFPPVPLLKA+L+DAK
Sbjct  275  RKQMPKLAVLVGLGDQMPDMIEELISRGQQLDAVHFTYEVGLVDKFPPVPLLKAYLRDAK  334

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K    + EDP+N+GRA+HL A+KE SA++AVLKCIEEYKLE EFPPE+LKKRL+QLEKTK
Sbjct  335  K---TVAEDPSNTGRASHLVARKEQSALKAVLKCIEEYKLEEEFPPENLKKRLEQLEKTK  391

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHT-QYPT  410
            +E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSSFP     F+RSPSH+ QY +
Sbjct  392  TE--KRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSSFP-----FIRSPSHSPQYAS  444

Query  409  GLPAYPASPIYTHGSMSPQYVYSPE  335
               AYP+ P   + + SP Y YSPE
Sbjct  445  PAAAYPSPPTTVYSNRSPPYPYSPE  469



>ref|XP_006299103.1| hypothetical protein CARUB_v10015242mg [Capsella rubella]
 gb|EOA32001.1| hypothetical protein CARUB_v10015242mg [Capsella rubella]
Length=533

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 164/204 (80%), Gaps = 7/204 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELISRGQQ+DAVHFT+EVGL++KFPPVPLLKA+L+DAK
Sbjct  288  RKQMPKLAVSVGLGDQMPDMIEELISRGQQLDAVHFTFEVGLVDKFPPVPLLKAYLRDAK  347

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA +++ED +N+ RA HL A+KE SA++AVLKCIEEYKLE EFPPE+LKKRLDQLEKTK
Sbjct  348  KAAASMMEDSSNTSRATHLVARKEQSALKAVLKCIEEYKLEEEFPPENLKKRLDQLEKTK  407

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSSFP     F+RSPSH+     
Sbjct  408  TE--KRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSSFP-----FIRSPSHSPQYAS  460

Query  406  LPAYPASPIYTHGSMSPQYVYSPE  335
              AYP+ P   + + SP Y YSPE
Sbjct  461  PAAYPSPPTTVYSNRSPPYPYSPE  484



>ref|XP_010551726.1| PREDICTED: FRIGIDA-like protein 4a [Tarenaya hassleriana]
Length=525

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 164/206 (80%), Gaps = 11/206 (5%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELISRGQQ+DAVHFTYEVGL +KFP V LLKA+L+DAK
Sbjct  294  RKQMPKLAVSIGLGDQMPDMIEELISRGQQLDAVHFTYEVGLSDKFPLVSLLKAYLRDAK  353

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA +I+EDP+N GR+ HLA +KE SAIRAVLKCIEEYKLE +FPPE+LKKRLDQLEK K
Sbjct  354  KAAASIVEDPSNPGRSVHLAVRKEQSAIRAVLKCIEEYKLEEKFPPENLKKRLDQLEKAK  413

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   A+ PA KRTR S  GPMPPAKAGR TNAYVSSFP A PTF+RS +H+     
Sbjct  414  TE--KRKPASVPANKRTRASYNGPMPPAKAGRITNAYVSSFP-APPTFIRSLTHS-----  465

Query  406  LPAYPASPIYTHGSMSPQYVYSPEAA  329
             P YP  P  +H  MSP Y YSPEA 
Sbjct  466  -PQYPTPPYTSH--MSPPYQYSPEAG  488



>emb|CDY46317.1| BnaC01g31510D [Brassica napus]
Length=525

 Score =   233 bits (593),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 164/205 (80%), Gaps = 11/205 (5%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+ +GLGD+MP++IEELISRGQQ+DAVHFTYEVGL++KFPPVPLLKA+L+DAK
Sbjct  278  RKQMPKLAVLVGLGDQMPDMIEELISRGQQLDAVHFTYEVGLVDKFPPVPLLKAYLRDAK  337

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K    + ED +N+GRA+HL A+KE SA++AVLKCIEEYKLE EFPPE+LKKRL+QLEKTK
Sbjct  338  K---TVAEDSSNTGRASHLVARKEQSALKAVLKCIEEYKLEEEFPPENLKKRLEQLEKTK  394

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHT-QYPT  410
            +E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSSFP     F+RSPSH+ QY +
Sbjct  395  TE--KRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSSFP-----FIRSPSHSPQYAS  447

Query  409  GLPAYPASPIYTHGSMSPQYVYSPE  335
               AYP+ P   + + SP Y YSPE
Sbjct  448  PAAAYPSPPTTVYSNRSPPYPYSPE  472



>ref|XP_009108852.1| PREDICTED: FRIGIDA-like protein 4a [Brassica rapa]
Length=534

 Score =   233 bits (593),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 164/205 (80%), Gaps = 11/205 (5%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+ +GLGD+MP++IEELISRGQQ+DAVHFTYEVGL++KFPPVPLLKA+L+DAK
Sbjct  287  RKQMPKLAVLVGLGDQMPDMIEELISRGQQLDAVHFTYEVGLVDKFPPVPLLKAYLRDAK  346

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K    + ED +N+GRA+HL A+KE SA++AVLKCIEEYKLE EFPPE+LKKRL+QLEKTK
Sbjct  347  K---TVAEDSSNTGRASHLVARKEQSALKAVLKCIEEYKLEEEFPPENLKKRLEQLEKTK  403

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHT-QYPT  410
            +E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSSFP     F+RSPSH+ QY +
Sbjct  404  TE--KRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSSFP-----FIRSPSHSPQYAS  456

Query  409  GLPAYPASPIYTHGSMSPQYVYSPE  335
               AYP+ P   + + SP Y YSPE
Sbjct  457  PAAAYPSPPTTVYSNRSPPYPYSPE  481



>ref|XP_010466529.1| PREDICTED: FRIGIDA-like protein 4a [Camelina sativa]
Length=533

 Score =   233 bits (593),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 164/204 (80%), Gaps = 8/204 (4%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELISRGQQ+DAVHFTYEVGL++KF PVPLLKA+L+DAK
Sbjct  287  RKQMPKLAVSVGLGDQMPDMIEELISRGQQLDAVHFTYEVGLVDKFRPVPLLKAYLRDAK  346

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K+A +I+ED +N+GRA HL A+KE SA++AVLKCIEEYKLE EFPPE+LKKRLDQLEKTK
Sbjct  347  KSAASIMEDSSNTGRATHLVARKEQSALKAVLKCIEEYKLEEEFPPENLKKRLDQLEKTK  406

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +E  K   AA PA KRTR S  GPMPPAKAGR TNAYVSSFP     F+RSPSH+     
Sbjct  407  TE--KRKPAAVPANKRTRASY-GPMPPAKAGRITNAYVSSFP-----FIRSPSHSPQYAS  458

Query  406  LPAYPASPIYTHGSMSPQYVYSPE  335
              AYP+ P   + + SP Y YSPE
Sbjct  459  PAAYPSPPTTVYSNRSPPYPYSPE  482



>ref|XP_010533277.1| PREDICTED: FRIGIDA-like protein 4a [Tarenaya hassleriana]
Length=539

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 164/208 (79%), Gaps = 6/208 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELI RGQQ+DAVHFTYEVGL +KFPPVPLLKA+L+DAK
Sbjct  294  RKQMPKLAVSVGLGDQMPDMIEELIRRGQQLDAVHFTYEVGLTDKFPPVPLLKAYLRDAK  353

Query  766  kaATAILEDPN-NSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKT  590
            KAA +I+EDPN N GRA HLA +KE SA+RAV+KCIEEYKLE EFPPE+LKKRLDQLEK 
Sbjct  354  KAAASIMEDPNSNPGRAPHLAVRKEQSALRAVVKCIEEYKLEEEFPPENLKKRLDQLEKA  413

Query  589  KSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHT-QYP  413
            K+E  K   AA PA KRTR    GPMPPAKAGRSTNAYVSSFP  +     SP+H+ QY 
Sbjct  414  KTE--KRKPAAVPANKRTRAGYNGPMPPAKAGRSTNAYVSSFPPPSAYTRSSPTHSPQYA  471

Query  412  TGLPAYPASPIYTHGSMSPQYVYSPEAA  329
            T  P Y + P   + + SP Y YSPEAA
Sbjct  472  T--PPYASPPPSVYSNRSPPYPYSPEAA  497



>ref|XP_004299118.1| PREDICTED: FRIGIDA-like protein 4a [Fragaria vesca subsp. vesca]
Length=584

 Score =   220 bits (561),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 159/198 (80%), Gaps = 3/198 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+ LGL  KMP++IEELISRGQQ+DAVHF YEVGL++KF PVPLLKAFL+DA+
Sbjct  286  RKQMPKLAVLLGLTKKMPDMIEELISRGQQLDAVHFIYEVGLVHKFRPVPLLKAFLRDAR  345

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA +ILED N+ G+AA+LA +KE SA+RAV+KCIE+Y LEAEFPPE+LKKRL+QL++  
Sbjct  346  KAAASILEDANSPGKAANLAGRKEQSALRAVIKCIEDYNLEAEFPPENLKKRLEQLDQKV  405

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
               +K    AAPA KRTR ++GGPMPPAKAGR  NAYVSSFP + PTFVRSPSH QYP G
Sbjct  406  KP-EKKKPVAAPANKRTRANHGGPMPPAKAGRLANAYVSSFP-SPPTFVRSPSHAQYPVG  463

Query  406  LPAYPASPIYTHGSMSPQ  353
               Y  SP   +GS SPQ
Sbjct  464  FSPY-HSPPTMYGSRSPQ  480



>ref|XP_010277260.1| PREDICTED: FRIGIDA-like protein 4a [Nelumbo nucifera]
Length=534

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 166/205 (81%), Gaps = 11/205 (5%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLG+KM ++IEELIS+GQQVDAVHFTYEVGL++KFPPVPLLKA+L+D+K
Sbjct  277  RKQMPKLAISLGLGEKMADMIEELISKGQQVDAVHFTYEVGLVDKFPPVPLLKAYLRDSK  336

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAAT+ILED NN G+A +LA +KE SA+RAV+KCIEEYKLEAEFPPE L+KRL+QLEK K
Sbjct  337  KAATSILEDRNNPGKATYLAGRKEQSALRAVIKCIEEYKLEAEFPPEPLRKRLEQLEKAK  396

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSF--PAAAPTFVRSPSHTQYP  413
            +  +K   A  PA KRTR SNGGPMPPAKAGR  NAYVSSF   AAAPTFVRSPSH  YP
Sbjct  397  A--EKKKPAVIPANKRTRASNGGPMPPAKAGRLANAYVSSFPAAAAAPTFVRSPSHGPYP  454

Query  412  --TGLPAY----PASPIYTHGSMSP  356
               G+P Y    PA P   +GS SP
Sbjct  455  AGAGVPPYAYDRPAPPA-IYGSRSP  478



>gb|EPS62727.1| hypothetical protein M569_12062, partial [Genlisea aurea]
Length=454

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 158/202 (78%), Gaps = 11/202 (5%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGL DKMP++I+ELI  GQQVDAVHFTYEVGL+++FPPVPLLKAFL DA+
Sbjct  255  RKQMPKLAISLGLRDKMPDMIQELIGNGQQVDAVHFTYEVGLVDRFPPVPLLKAFLNDAR  314

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA +ILED NNSGRAAH+AAKKE SAIRAVLKCIEEYKLE+EFP E+L+KRLD L+K K
Sbjct  315  KAANSILEDQNNSGRAAHMAAKKEQSAIRAVLKCIEEYKLESEFPTENLRKRLDHLDKAK  374

Query  586  SEkkkpaaaaapaaKRTRVSNGGPM-PPAKAGRSTNAYVSSFPAAAPT-----FVRSPSH  425
             E       ++P AKRTR S GGPM PPAKA RS+NAYVSSFP+  P       + SPSH
Sbjct  375  VE---KKKPSSPTAKRTRASIGGPMPPPAKAVRSSNAYVSSFPSPPPPPPTTYIISSPSH  431

Query  424  TQYPT--GLPAYPASPIYTHGS  365
            TQYP     P+ P  P+Y HG+
Sbjct  432  TQYPVSAAYPSAPPPPVYGHGT  453



>ref|XP_008224458.1| PREDICTED: FRIGIDA-like protein 4a [Prunus mume]
Length=497

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 155/209 (74%), Gaps = 31/209 (15%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGL  KMP++IEELISRGQQ+DAVHFTYEVGL++KFPPVPLLKAFLKDAK
Sbjct  283  RKQMPKLAVSLGLAKKMPDMIEELISRGQQLDAVHFTYEVGLVHKFPPVPLLKAFLKDAK  342

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA +I+EDPNN+GRAA+LA +KE SA+RAV+KCIE+YKLEAEFPPE+LKKRL+QLEK K
Sbjct  343  KAAASIMEDPNNAGRAANLAGRKEQSALRAVIKCIEDYKLEAEFPPENLKKRLEQLEKVK  402

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
             E  K   AA PA KRTR +NGGPMPPAKAGR TNA              SP H      
Sbjct  403  PE--KKRPAAVPANKRTRANNGGPMPPAKAGRLTNA--------------SPYH------  440

Query  406  LPAYPASPIYTHGSMSP---QYVYSPEAA  329
                  SP   +GS SP    Y YSPEAA
Sbjct  441  ------SPPTMYGSRSPPTNPYAYSPEAA  463



>ref|XP_006406163.1| hypothetical protein EUTSA_v10020440mg [Eutrema salsugineum]
 gb|ESQ47616.1| hypothetical protein EUTSA_v10020440mg [Eutrema salsugineum]
Length=552

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 130/149 (87%), Gaps = 2/149 (1%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELI+RGQQ+DAVHFTYEVGL++KFPPVPLLKA+L+DAK
Sbjct  288  RKQMPKLAVSVGLGDQMPDMIEELITRGQQLDAVHFTYEVGLVDKFPPVPLLKAYLRDAK  347

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K A +I+ED +N+GRA HL A+KE SA+RAVLKCIEEYKLE +FPPE+LKKRLDQLEKTK
Sbjct  348  KTAASIMEDSSNTGRATHLVARKEQSALRAVLKCIEEYKLEEDFPPENLKKRLDQLEKTK  407

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAK  500
            +E  K   AA PA KRTR S  GPMPPAK
Sbjct  408  TE--KRKPAAVPANKRTRASYNGPMPPAK  434



>ref|XP_009389010.1| PREDICTED: FRIGIDA-like protein 4a [Musa acuminata subsp. malaccensis]
Length=528

 Score =   187 bits (475),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 142/202 (70%), Gaps = 9/202 (4%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGL DKM ++IEELIS G Q+DA++F YE GL +KFPPVP L        
Sbjct  275  RKQMPKLAISLGLEDKMEDIIEELISNGHQLDAINFAYEAGLQDKFPPVP-LLKSFLKDS  333

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K AT+  +D NN G+ A+   +KE S IRA +KCI+E+KLEAEFP E L+KRL+QLEK K
Sbjct  334  KKATSTSDDRNNCGQTANNTCRKEQSVIRAAIKCIQEHKLEAEFPLEGLQKRLEQLEKAK  393

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGR-STNAYVSSFPAAAPTFVRSP-SHTQYP  413
             E KK  +   PA KRTR SNGGPMPPAKAGR ++NA VSSFP AAP FVRSP SH  YP
Sbjct  394  VE-KKRPSGGGPANKRTRASNGGPMPPAKAGRLTSNACVSSFP-AAPAFVRSPSSHATYP  451

Query  412  TGLPAYP-ASP--IYTHGSMSP  356
               P YP  SP  +  +GS SP
Sbjct  452  AAAP-YPYDSPAGLGVYGSRSP  472



>ref|XP_008796767.1| PREDICTED: FRIGIDA-like protein 4a [Phoenix dactylifera]
Length=538

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 140/174 (80%), Gaps = 3/174 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLALSLGL D M ++I ELIS+GQQ+DA++F+YE GL +KFPPVPLLK+FLKD+K
Sbjct  282  RRQMPKLALSLGLEDSMADIIVELISKGQQLDAINFSYEAGLQDKFPPVPLLKSFLKDSK  341

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA ++  ED NNSG+A +  ++KE SA+R+V+KCIE++KLEAEFP E L+KRL+ LEK K
Sbjct  342  KATSSCSEDRNNSGQAVNNGSRKEQSALRSVMKCIEDHKLEAEFPLEALQKRLENLEKAK  401

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRST-NAYVSSFPAAAPTFVRSPS  428
             E KK  +   PA KRTR +NGGPMPPAKAGR T NAYVSSFPA   TFVRSPS
Sbjct  402  VE-KKRPSGGGPANKRTRANNGGPMPPAKAGRLTNNAYVSSFPATT-TFVRSPS  453



>ref|XP_010906476.1| PREDICTED: FRIGIDA-like protein 4a [Elaeis guineensis]
Length=541

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 140/174 (80%), Gaps = 3/174 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M +LA+SLGL D+M ++IEELIS+GQQ+DA++F YE GL +KFPPVPLLK+FLKD+K
Sbjct  285  RRQMPRLAVSLGLEDRMADIIEELISKGQQLDAINFAYEAGLQDKFPPVPLLKSFLKDSK  344

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA ++  ED NNSG+A +  ++KE SA+R+V+KCIE+ KLEAEFP E L+KRL+ LEK K
Sbjct  345  KATSSSSEDRNNSGQAVNNGSRKEQSALRSVMKCIEDRKLEAEFPLEGLQKRLENLEKAK  404

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRST-NAYVSSFPAAAPTFVRSPS  428
             E KK  +   PA KRTR +NGGPMPPAKAGR T NAYVSSFPA   TFVRSPS
Sbjct  405  VE-KKKPSGGGPANKRTRANNGGPMPPAKAGRLTNNAYVSSFPATT-TFVRSPS  456



>ref|XP_009408489.1| PREDICTED: FRIGIDA-like protein 4a [Musa acuminata subsp. malaccensis]
Length=529

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 143/195 (73%), Gaps = 6/195 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA+SLGL D M ++IEELIS G Q+DA++F YE GL +KFPP+PLLK+FL+D+K
Sbjct  275  RRQMPKLAISLGLEDSMEDIIEELISTGHQLDAINFAYEAGLQDKFPPIPLLKSFLEDSK  334

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA T+  ED NN G+ A+   +KELS IRA +KCI+E+KLEAEFP + L+KRL+ LEK K
Sbjct  335  KA-TSTSEDRNNYGQTANTTCRKELSVIRAAMKCIQEHKLEAEFPLDSLQKRLENLEKAK  393

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRST-NAYVSSFPAAAPTFVRSPS-HTQYP  413
             E KK  + A PA KRTR +NGGPMPPAKAGR T NA VSSFP A P +VRSPS HT YP
Sbjct  394  VE-KKKPSGAGPANKRTRANNGGPMPPAKAGRLTNNACVSSFP-AGPAYVRSPSAHTTYP  451

Query  412  TGLPAYPASPIYTHG  368
                 YP      HG
Sbjct  452  AA-ALYPYDRPSGHG  465



>ref|XP_010909467.1| PREDICTED: FRIGIDA-like protein 4a [Elaeis guineensis]
Length=534

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 151/218 (69%), Gaps = 23/218 (11%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLALSLGL D+M ++IEELIS+GQQ+DA++F YE  L +KFPPVPLLK+FLKD+K
Sbjct  279  RRQMPKLALSLGLEDRMADIIEELISKGQQLDAINFAYEAALQDKFPPVPLLKSFLKDSK  338

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K  ++  ED N+SG+A    ++KE SA+RAV+KCIE++KLEAEFP E L+KR + LEK K
Sbjct  339  KGTSSSSEDRNSSGQAVGNGSRKEQSALRAVMKCIEDHKLEAEFPLEDLQKRFENLEKAK  398

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRST-NAYVSSFPAAAPTFVRSPS-HT---  422
             E KK  +   PA KRTR +NGGPMPPAKAGR T NAYVSSFPAA  TFVRSPS HT   
Sbjct  399  VE-KKKPSGGGPANKRTRANNGGPMPPAKAGRLTNNAYVSSFPAAT-TFVRSPSAHTTYP  456

Query  421  --------QYPTGLPAYPASPIYTHGSMSPQYVYSPEA  332
                      PTG   Y        GS SP  V  P A
Sbjct  457  AAAPPYPYDRPTGHGVY--------GSRSPPTVRDPYA  486



>ref|XP_008778905.1| PREDICTED: FRIGIDA-like protein 4a [Phoenix dactylifera]
Length=535

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 138/174 (79%), Gaps = 3/174 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLALSLGL D+M +++EELIS+GQQ+DA++F  E GL +KFPPVPLLK+FLKD+K
Sbjct  279  RRQMPKLALSLGLEDRMTDIVEELISKGQQLDAINFACEAGLQDKFPPVPLLKSFLKDSK  338

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K  ++  ED N+SG+A    ++KE SA+RAV+KCIE+ KLEAEFP E L+KRL+ LEK K
Sbjct  339  KGTSSSSEDRNSSGQAVGNGSRKEQSALRAVMKCIEDRKLEAEFPLEGLQKRLENLEKAK  398

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRST-NAYVSSFPAAAPTFVRSPS  428
             E KK  +   PA KRTR +NGGPMPPAKAGR T NAYVSSFPAA  TFVRSPS
Sbjct  399  VE-KKKPSGCGPANKRTRANNGGPMPPAKAGRLTNNAYVSSFPAAT-TFVRSPS  450



>ref|XP_006826275.1| PREDICTED: FRIGIDA-like protein 4a [Amborella trichopoda]
 gb|ERM93512.1| hypothetical protein AMTR_s00004p00045050 [Amborella trichopoda]
Length=513

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 146/214 (68%), Gaps = 12/214 (6%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+ LGL D+MP++IEEL+++G+QVDAVHF  E GLI K+PPVPLL+A+L++++
Sbjct  275  RKQMPKLAVLLGLKDRMPDIIEELVNKGKQVDAVHFIVESGLIEKYPPVPLLEAYLRNSR  334

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            +   +IL+D NNS RA H A  KE +A+RAV+KC+EE+KLE+  P E L+KRL Q++K K
Sbjct  335  EVVASILKDGNNSTRAMHEAGIKEHAALRAVIKCVEEHKLESNLPLEPLQKRLAQIDKLK  394

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQ---Y  416
            +E+KK AA++    KR RV NG  +PPAKAGR  N++   FPA    FVRSP+  Q   +
Sbjct  395  AERKKAAASSQQQNKRGRVGNGAALPPAKAGRLANSH---FPARR-VFVRSPNSGQSPQF  450

Query  415  PTGLPAYPASPIYTHGSMSPQ-----YVYSPEAA  329
            P   P Y     Y  G+ SP      Y Y PE A
Sbjct  451  PAPPPPYNYGQAYMGGNRSPTSLVDAYGYPPENA  484



>emb|CDY38318.1| BnaC05g30110D [Brassica napus]
Length=531

 Score =   168 bits (425),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 112/153 (73%), Gaps = 22/153 (14%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELISRG Q+DAVHFTYEVGL++KFPP            
Sbjct  260  RKQMPKLAVSVGLGDQMPDMIEELISRGHQLDAVHFTYEVGLVDKFPP------------  307

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
                    D +N+GR ++L A+KE SA++AVLKCIEEYKLE EFPPE+LKKRLDQLEKTK
Sbjct  308  --------DSSNTGRPSNLVAQKEQSALKAVLKCIEEYKLEEEFPPENLKKRLDQLEKTK  359

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRS  488
            ++  K   AA PA KRTR S  GPMPPA   ++
Sbjct  360  TD--KRKPAAVPANKRTRASYNGPMPPANVSQT  390



>gb|AGV54404.1| frigida protein [Phaseolus vulgaris]
Length=525

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 113/148 (76%), Gaps = 9/148 (6%)
 Frame = -3

Query  751  ILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEK---TKSE  581
            ILEDPNN+GRAA+LAA+KE SA+RAV+KCIEEYKLEA+FPPE+LKKRL+QLEK    K+E
Sbjct  346  ILEDPNNAGRAAYLAARKEQSALRAVIKCIEEYKLEADFPPENLKKRLEQLEKVKTVKTE  405

Query  580  kkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLP  401
            K+KP A  A    R   SNGGPMPPAKAGR TNAYVSSFP AAPTFVR PSH QYP  L 
Sbjct  406  KRKPVAVPANKRTRASNSNGGPMPPAKAGRLTNAYVSSFP-AAPTFVRFPSHGQYPAALS  464

Query  400  AYPASPIYTHGSMS----PQYVYSPEAA  329
             +P SP + +GS S    P   YSPE A
Sbjct  465  PHP-SPPHMYGSRSPPANPYAAYSPEPA  491



>gb|AGV54236.1| hydroxyproline-rich glycoprotein [Phaseolus vulgaris]
Length=523

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 132/198 (67%), Gaps = 9/198 (5%)
 Frame = -3

Query  901  KMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATAILEDPNNSGR  722
            +M    +EL  + +  + V   YEVG +  F  V LLK ++K           DPN +GR
Sbjct  294  QMCCFFDELDRKKKGQEMVKALYEVGCVVLFFRVILLKRWVKYINDLFVFFRVDPNLAGR  353

Query  721  AAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEK---TKSEkkkpaaaaap  551
            AA+LAA+KE SA+RAV+KCIEEYKLEA+FPPE+LKKRL+QLEK    K+EK+KP A  A 
Sbjct  354  AAYLAARKEQSALRAVIKCIEEYKLEADFPPENLKKRLEQLEKVKTVKTEKRKPVAVPAN  413

Query  550  aaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYPASPIYTH  371
               R   SNGGPMPPAKAGR TNAYVSSFP AAPTFVRSPSH QYP  LP  P SP + +
Sbjct  414  KRTRASNSNGGPMPPAKAGRLTNAYVSSFP-AAPTFVRSPSHGQYPAALPPIP-SPPHMY  471

Query  370  GSMS----PQYVYSPEAA  329
            GS S    P   YSPE A
Sbjct  472  GSRSPPANPYAAYSPEPA  489



>emb|CAB10269.1| hydroxyproline-rich glycoprotein homolog [Arabidopsis thaliana]
 emb|CAB78532.1| hydroxyproline-rich glycoprotein homolog [Arabidopsis thaliana]
Length=507

 Score =   162 bits (410),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 134/207 (65%), Gaps = 30/207 (14%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+S+GLGD+MP++IEELI RGQQ+DAVHFT+EVGL++ FPPVPLLKA+L+DAK
Sbjct  285  RKQMPKLAVSVGLGDQMPDMIEELIIRGQQLDAVHFTFEVGLVHLFPPVPLLKAYLRDAK  344

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA   I +D NNSGR+A   +    SA+     C+E+ K E   P               
Sbjct  345  KATALITDDSNNSGRSAGSVS----SALAYQCMCLEKTKTEKRKP---------------  385

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHT-QYPT  410
                    A  PA KRTR S  GPMPPAKAGR TNAYVSSFP   PTF+RS SH+ QY  
Sbjct  386  --------AVIPANKRTRASYSGPMPPAKAGRITNAYVSSFPPPPPTFIRSQSHSPQY--  435

Query  409  GLPAYPASPIYTHGSMSPQYVYSPEAA  329
            G+PAY  SP   + + SP Y YSPEA 
Sbjct  436  GVPAYTTSPPTIYSNRSPPYQYSPEAV  462



>emb|CBI26255.3| unnamed protein product [Vitis vinifera]
Length=103

 Score =   150 bits (378),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -3

Query  937  MXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaA  758
            M KLA+SLGLGDKM ++IEEL++RGQQVDAVHFTYEVGL++KFPPVPLLKAFL+D+KKAA
Sbjct  1    MPKLAVSLGLGDKMADMIEELVNRGQQVDAVHFTYEVGLVDKFPPVPLLKAFLRDSKKAA  60

Query  757  TAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEF  635
            T+ILEDPNNSGRA +LA +KE SA+RAV+KCIEEYKLEAE 
Sbjct  61   TSILEDPNNSGRAVNLAGRKEQSALRAVIKCIEEYKLEAEL  101



>ref|XP_010228309.1| PREDICTED: FRIGIDA-like protein 4a [Brachypodium distachyon]
Length=569

 Score =   160 bits (405),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 150/210 (71%), Gaps = 9/210 (4%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M +LAL++GL + MP++IEELI++ QQ+DAV+F YE GL  KFPPVPLLK++L+D+K
Sbjct  282  RRQMPRLALAVGLDEDMPDIIEELIAKRQQLDAVNFAYEAGLQEKFPPVPLLKSYLEDSK  341

Query  766  kaATAILED-PNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKT  590
            K +  + ++   +SG++     KKE SA+RAV+KCIE+ KLE+EFPPE L+K+L+ LEK 
Sbjct  342  KTSCTVSDNLSTSSGQSGSNTNKKEQSALRAVIKCIEDRKLESEFPPEDLQKQLEDLEKA  401

Query  589  KSEkkkpaaaaap------aaKRTRVSNGGPMPPAKAGR-STNAYVSSFPAAAPTFVRSP  431
            K+EKKK +++A+       A KR R SNGGPMPPAKAGR + N  VSS P AA TFVRSP
Sbjct  402  KTEKKKASSSASSGGSSEPANKRIRASNGGPMPPAKAGRLANNTSVSSLPVAA-TFVRSP  460

Query  430  SHTQYPTGLPAYPASPIYTHGSMSPQYVYS  341
            SHT Y +      ASP +T  +  P   Y+
Sbjct  461  SHTSYASPSQTSYASPSHTSYASPPHTSYA  490



>dbj|BAC83627.1| putative hydroxyproline-rich glycoprotein [Oryza sativa Japonica 
Group]
 dbj|BAG89444.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81597.1| hypothetical protein OsI_25073 [Oryza sativa Indica Group]
Length=534

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 142/201 (71%), Gaps = 10/201 (5%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M +LAL+LGL + M ++IEELI++GQQ+DAV+F YE GL  KFPPVPLLK++L D+K
Sbjct  271  RRQMPRLALTLGLEEDMADIIEELIAKGQQLDAVNFAYEAGLQEKFPPVPLLKSYLADSK  330

Query  766  kaATAILEDPNNSGRAAHL-AAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKT  590
            K +  + ++ + S   +   A KKE S +RAV+KCIE+ KLEAEFP E L+++L++LEK 
Sbjct  331  KTSCTVSDNSSTSSGQSGSNANKKEQSVLRAVIKCIEDRKLEAEFPLEDLQRQLEELEKA  390

Query  589  KSEkkkpaaaaap------aaKRTRVSNGGPMPPAKAGRST-NAYVSSFPAAAPTFVRSP  431
            K+EKKK  ++A+       A KR R SNGGPMPPAKAGR T NA VSS PAA  TFVRSP
Sbjct  391  KTEKKKATSSASSGGSSGPATKRIRASNGGPMPPAKAGRLTNNACVSSTPAAT-TFVRSP  449

Query  430  SHTQYPTGLPAYPASPIYTHG  368
            SHT Y    P YP      HG
Sbjct  450  SHTSYAMASP-YPYDRPVGHG  469



>gb|EEE66652.1| hypothetical protein OsJ_23273 [Oryza sativa Japonica Group]
Length=684

 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 142/201 (71%), Gaps = 10/201 (5%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M +LAL+LGL + M ++IEELI++GQQ+DAV+F YE GL  KFPPVPLLK++L D+K
Sbjct  421  RRQMPRLALTLGLEEDMADIIEELIAKGQQLDAVNFAYEAGLQEKFPPVPLLKSYLADSK  480

Query  766  kaATAILEDPNNSGRAAHL-AAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKT  590
            K +  + ++ + S   +   A KKE S +RAV+KCIE+ KLEAEFP E L+++L++LEK 
Sbjct  481  KTSCTVSDNSSTSSGQSGSNANKKEQSVLRAVIKCIEDRKLEAEFPLEDLQRQLEELEKA  540

Query  589  KSEkkkpaaaaap------aaKRTRVSNGGPMPPAKAGRST-NAYVSSFPAAAPTFVRSP  431
            K+EKKK  ++A+       A KR R SNGGPMPPAKAGR T NA VSS PAA  TFVRSP
Sbjct  541  KTEKKKATSSASSGGSSGPATKRIRASNGGPMPPAKAGRLTNNACVSSTPAAT-TFVRSP  599

Query  430  SHTQYPTGLPAYPASPIYTHG  368
            SHT Y    P YP      HG
Sbjct  600  SHTSYAMASP-YPYDRPVGHG  619



>ref|XP_009388157.1| PREDICTED: FRIGIDA-like protein 4a, partial [Musa acuminata subsp. 
malaccensis]
Length=233

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 114/174 (66%), Gaps = 6/174 (3%)
 Frame = -3

Query  880  ELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATAILEDPNNSGRAAHLAAK  701
            ELIS+G Q+DA++F YE GL +KF PV  L          AT+  ED N  G+  +   +
Sbjct  1    ELISKGHQLDAINFAYEAGLQDKFTPV-SLLKSFLKDSNKATSTFEDHNGGGQTTNYTCR  59

Query  700  KELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaa--aapaaKRTRVS  527
            KE S IRA +KCI+E+KLEAEFP E L+KRL+QLEK K EKKKP+    AAPA KRTR +
Sbjct  60   KEQSIIRAAIKCIQEHKLEAEFPLESLQKRLEQLEKAKVEKKKPSGGGPAAPANKRTRAN  119

Query  526  NGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPS-HTQYPTGLPAYPASPIYTHG  368
            NGGPMPPAKAGR TN    S P AAP FVRSPS HT YP   P YP      HG
Sbjct  120  NGGPMPPAKAGRLTNNVHVSSP-AAPAFVRSPSAHTTYPAAAP-YPYDSPAGHG  171



>ref|XP_006658319.1| PREDICTED: FRIGIDA-like protein 4a-like [Oryza brachyantha]
Length=394

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 138/189 (73%), Gaps = 8/189 (4%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M +LAL+LGL + M +++ ELI++GQQ+DAV+F YE GL  KFPPVPLLK++L+DAK
Sbjct  132  RRQMPRLALTLGLEEDMADIVGELIAKGQQLDAVNFAYEAGLQEKFPPVPLLKSYLEDAK  191

Query  766  kaATAILEDPNNSGRAAHL-AAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKT  590
            K +  + ++ + S   +   A KKE SA+RAV+KCIE+ KLE E+P E L+++L++LEK 
Sbjct  192  KTSYTVSDNSSTSSGQSGSNANKKEQSALRAVIKCIEDRKLETEYPLEDLQRQLEELEKA  251

Query  589  KSEkkkpaaaaap-----aaKRTRVSNGGPMPPAKAGRST-NAYVSSFPAAAPTFVRSPS  428
            K++KK  ++A++      A KR R SNGGPMPPA+AG  T NA VSS PAA  TFVRSPS
Sbjct  252  KTKKKATSSASSGGSSGPATKRIRASNGGPMPPARAGHLTNNACVSSTPAAT-TFVRSPS  310

Query  427  HTQYPTGLP  401
            HT Y T  P
Sbjct  311  HTSYATASP  319



>ref|XP_004955594.1| PREDICTED: protein FRIGIDA-like [Setaria italica]
Length=570

 Score =   146 bits (369),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 141/191 (74%), Gaps = 8/191 (4%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M +LAL+LGL ++M ++IEELI++ QQ+DAV+F YE GL  KFPP+PLLK++L+D+K
Sbjct  286  RRQMPRLALTLGLEEEMADIIEELIAKRQQLDAVNFAYEAGLQEKFPPIPLLKSYLEDSK  345

Query  766  kaATAILEDPNNSGRAAHL-AAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKT  590
            K ++   ++ + S   +     KKE SA+RAV+KC+E+ KLEAEFP E L+K+L++LEK 
Sbjct  346  KTSSIASDNSSTSSGQSGSNVNKKEQSALRAVIKCVEDRKLEAEFPLEDLRKQLEELEKA  405

Query  589  KSEkkkpaaaaap------aaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPS  428
            K+EKKK A++A+       A KR R SNGGPMPPAKAGR+ NA VSSFP    TF RSPS
Sbjct  406  KTEKKKAASSASSGGSSGPATKRIRASNGGPMPPAKAGRTNNASVSSFPTPT-TFARSPS  464

Query  427  HTQYPTGLPAY  395
            HT Y T  P++
Sbjct  465  HTSYATTSPSH  475



>ref|XP_002461525.1| hypothetical protein SORBIDRAFT_02g004090 [Sorghum bicolor]
 gb|EER98046.1| hypothetical protein SORBIDRAFT_02g004090 [Sorghum bicolor]
Length=524

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 139/190 (73%), Gaps = 9/190 (5%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M +LAL+LGL ++M ++IEELI++ QQ+DAV+F YE GL  KFPPVPLLK++L+D+K
Sbjct  293  RRQMPRLALTLGLEEEMADIIEELIAKRQQLDAVNFAYEAGLQEKFPPVPLLKSYLEDSK  352

Query  766  kaATAILEDPNNSGRAAHL-AAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKT  590
            K +TA  ++ + S   +   A KKE SA+RAV+KC+E++ LEAEF  E L+K+L++LEK 
Sbjct  353  KTSTAASDNSSTSSGQSGSNANKKEQSALRAVIKCVEDHNLEAEFSLEDLRKQLEELEKA  412

Query  589  KSEkkkpaaaaap------aaKRTRVSNGGPMPPAKAGRST-NAYVSSFPAAAPTFVRSP  431
            K+EKKK A++A        A KR R SNGGPMPPAKAGR T NA VSSFPA   TF +SP
Sbjct  413  KTEKKKAASSATSGSSSGPATKRIRASNGGPMPPAKAGRLTNNACVSSFPAPT-TFTQSP  471

Query  430  SHTQYPTGLP  401
            SH  Y   LP
Sbjct  472  SHASYANDLP  481



>ref|NP_001051543.1| Os03g0794900 [Oryza sativa Japonica Group]
 gb|AAT76425.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99329.1| hydroxyproline-rich glycoprotein family protein, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13457.1| Os03g0794900 [Oryza sativa Japonica Group]
 dbj|BAG95534.1| unnamed protein product [Oryza sativa Japonica Group]
Length=550

 Score =   140 bits (352),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 131/203 (65%), Gaps = 32/203 (16%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M +LA++LGL D+M ++IEELI++GQQ+DAV+F YE GL  KFPP PLLK       
Sbjct  284  RRQMPRLAITLGLEDEMDDIIEELITKGQQLDAVNFAYEAGLQEKFPPAPLLK-------  336

Query  766  kaATAILED----PNNS-------GRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHL  620
                A LED    P+NS       G++   A KKE SA+RAV+KC+E++KLEAEFP E L
Sbjct  337  ----AYLEDSKKIPSNSDNLSTSTGQSGSNANKKEQSALRAVIKCVEDHKLEAEFPLEDL  392

Query  619  KKRLDQLEKTKSEkkkpaaaaap------aaKRTRVSNGGPMPPAKAGRSTN----AYVS  470
            ++RL++LEK K+EKKK A++++       A KR R S GGPMPPAKAGR T+        
Sbjct  393  RERLEELEKAKTEKKKAASSSSSGGSSGPANKRIRASTGGPMPPAKAGRLTDYTGTPSSP  452

Query  469  SFPAAAPTFVRSPSHTQYPTGLP  401
            +      TF+RSPSH  Y T  P
Sbjct  453  ATTTTNATFIRSPSHASYGTASP  475



>gb|EEC76321.1| hypothetical protein OsI_13877 [Oryza sativa Indica Group]
Length=550

 Score =   140 bits (352),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 131/203 (65%), Gaps = 32/203 (16%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M +LA++LGL D+M ++IEELI++GQQ+DAV+F YE GL  KFPP PLLK       
Sbjct  284  RRQMPRLAITLGLEDEMDDIIEELITKGQQLDAVNFAYEAGLQEKFPPAPLLK-------  336

Query  766  kaATAILED----PNNS-------GRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHL  620
                A LED    P+NS       G++   A KKE SA+RAV+KC+E++KLEAEFP E L
Sbjct  337  ----AYLEDSKKIPSNSDNLSTSTGQSGSNANKKEQSALRAVIKCVEDHKLEAEFPLEDL  392

Query  619  KKRLDQLEKTKSEkkkpaaaaap------aaKRTRVSNGGPMPPAKAGRSTN----AYVS  470
            ++RL++LEK K+EKKK A++++       A KR R S GGPMPPAKAGR T+        
Sbjct  393  RERLEELEKAKTEKKKAASSSSSGGSSGPANKRIRASTGGPMPPAKAGRLTDYTGTPSSP  452

Query  469  SFPAAAPTFVRSPSHTQYPTGLP  401
            +      TF+RSPSH  Y T  P
Sbjct  453  ATTTTNATFIRSPSHASYGTASP  475



>gb|EEE60086.1| hypothetical protein OsJ_12936 [Oryza sativa Japonica Group]
Length=516

 Score =   139 bits (351),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 131/203 (65%), Gaps = 32/203 (16%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M +LA++LGL D+M ++IEELI++GQQ+DAV+F YE GL  KFPP PLLK       
Sbjct  250  RRQMPRLAITLGLEDEMDDIIEELITKGQQLDAVNFAYEAGLQEKFPPAPLLK-------  302

Query  766  kaATAILED----PNNS-------GRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHL  620
                A LED    P+NS       G++   A KKE SA+RAV+KC+E++KLEAEFP E L
Sbjct  303  ----AYLEDSKKIPSNSDNLSTSTGQSGSNANKKEQSALRAVIKCVEDHKLEAEFPLEDL  358

Query  619  KKRLDQLEKTKSEkkkpaaaaap------aaKRTRVSNGGPMPPAKAGRSTN----AYVS  470
            ++RL++LEK K+EKKK A++++       A KR R S GGPMPPAKAGR T+        
Sbjct  359  RERLEELEKAKTEKKKAASSSSSGGSSGPANKRIRASTGGPMPPAKAGRLTDYTGTPSSP  418

Query  469  SFPAAAPTFVRSPSHTQYPTGLP  401
            +      TF+RSPSH  Y T  P
Sbjct  419  ATTTTNATFIRSPSHASYGTASP  441



>dbj|BAK00009.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 130/193 (67%), Gaps = 11/193 (6%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M +LAL+LGL D M ++IEELI++GQQ+DAV+F YE GL+ KF PVPLLK +L+D+K
Sbjct  293  RRQMPRLALTLGLEDDMEDIIEELITKGQQLDAVNFAYEAGLLEKFSPVPLLKTYLEDSK  352

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K   A      +SG++   A KKE SA+RAV+KC+E++KLEAEFP E L+KRL++LE  K
Sbjct  353  KIYCAPDNVSTSSGQSGVNANKKEQSALRAVIKCVEDHKLEAEFPLEDLRKRLEELEMAK  412

Query  586  SEkkkpaaaaap---aaKRTRVSNGGPMPPAKAGRSTN-------AYVSSFPAAAPTFVR  437
            +EKKK A++ +    A+KR + S GG M P+KAGR  +          ++  +    F+ 
Sbjct  413  TEKKKAASSCSSGGPASKRIKGSAGGAMSPSKAGRLGDNTGAPSSPATATSSSTTTAFIG  472

Query  436  SP-SHTQYPTGLP  401
            SP SH  Y TG P
Sbjct  473  SPASHVSYGTGSP  485



>ref|XP_009395189.1| PREDICTED: FRIGIDA-like protein 4a [Musa acuminata subsp. malaccensis]
Length=257

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 114/187 (61%), Gaps = 18/187 (10%)
 Frame = -3

Query  883  EELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATAILEDPNNSGRAAH---  713
            +ELIS+G Q+DA++F YE GL +KF PV  L          AT+ +ED N  G+      
Sbjct  12   KELISKGHQLDAINFAYEAGLQDKFTPV-SLLKSFLKDSNKATSTIEDHNGGGQTTKSMV  70

Query  712  ---------LAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaa  560
                      AA+     IRA +KCI+E+KLEAEFP E L+KRL+Q EKTK EKKKP+  
Sbjct  71   LILFYCRITRAARNSQLIIRAAIKCIQEHKLEAEFPLESLQKRLEQSEKTKVEKKKPSGG  130

Query  559  --aapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPS-HTQYPTGLPAYPA  389
              AAPA KRTR +NGGPMPPAKAGR TN    S P AAP FVRSPS HT YP   P YP 
Sbjct  131  GPAAPANKRTRANNGGPMPPAKAGRLTNTVHVSSP-AAPAFVRSPSAHTTYPAAAP-YPY  188

Query  388  SPIYTHG  368
                 HG
Sbjct  189  DSPAGHG  195



>ref|NP_001145922.1| uncharacterized protein LOC100279445 [Zea mays]
 gb|ACL52856.1| unknown [Zea mays]
Length=302

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 125/195 (64%), Gaps = 33/195 (17%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M +LAL+LGL ++M ++IEELI++ QQ+DAV+F YE GL  KFPPVPLLK       
Sbjct  14   RRQMPRLALTLGLEEEMADIIEELIAKRQQLDAVNFAYEAGLQEKFPPVPLLK-------  66

Query  766  kaATAILEDPNNSGRAAHL-------------AAKKELSAIRAVLKCIEEYKLEAEFPPE  626
                + LED   +  AA               A KKE SA+RAV+KC+E+  LE EFP E
Sbjct  67   ----SYLEDSKKTSTAASDNSSTSSSGQSGSNANKKEQSALRAVIKCVEDRNLEVEFPLE  122

Query  625  HLKKRLDQLEKTKSEkkkpaaaaap-------aaKRTRVSNGGPMPPAKAGR-STNAYVS  470
             L+K+L++LEK K+EKKK A++A         A KR R SNGGPMPPAKAGR +TNA  S
Sbjct  123  GLRKQLEELEKAKTEKKKAASSATSGGSSSGPATKRIRASNGGPMPPAKAGRLATNACAS  182

Query  469  SFPAAAPTFVRSPSH  425
            SFP    TF +SPSH
Sbjct  183  SFPGPT-TFTQSPSH  196



>ref|XP_008652075.1| PREDICTED: FRIGIDA-like protein 4a [Zea mays]
 tpg|DAA59721.1| TPA: hypothetical protein ZEAMMB73_037297 [Zea mays]
Length=607

 Score =   134 bits (337),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 136/191 (71%), Gaps = 9/191 (5%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M +LAL+LGL ++M ++IEELI++ QQ+DAV+F YE GL  KFPPVPLLK++L+D+K
Sbjct  301  RRQMPRLALTLGLEEQMADIIEELIAKRQQLDAVNFAYEAGLQEKFPPVPLLKSYLEDSK  360

Query  766  kaATAILEDPNNSGRAAHL-AAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKT  590
            K +TA  ++ + S   +     KKE SA+RAV+KC+E+ KLEAEFP E L+K+L++LEK 
Sbjct  361  KTSTAASDNSSTSSGQSGSNVNKKEQSALRAVIKCVEDRKLEAEFPLEGLRKQLEELEKA  420

Query  589  KSEkkkpaaaaap------aaKRTRVSNGGPMPPAKAGRST-NAYVSSFPAAAPTFVRSP  431
            K+EKKK A++A        A KR R S GGPMPPAKAGR T NA VSS PA   T  +SP
Sbjct  421  KTEKKKAASSATSGGSGGPATKRIRASTGGPMPPAKAGRLTNNACVSSLPAPT-TLTQSP  479

Query  430  SHTQYPTGLPA  398
            SH  Y    P+
Sbjct  480  SHASYANTSPS  490



>ref|XP_006650719.1| PREDICTED: FRIGIDA-like protein 4a-like, partial [Oryza brachyantha]
Length=536

 Score =   134 bits (336),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 132/205 (64%), Gaps = 34/205 (17%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M +LA++LGL D+M ++IEELI++GQQ+DAV+F YE GL  KFP  PLLK       
Sbjct  266  RRQMPRLAITLGLEDEMNDIIEELITKGQQLDAVNFAYEAGLHEKFPAAPLLK-------  318

Query  766  kaATAILED----PNNS-------GRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHL  620
                A LED    P+NS       G++   A KKE SA+RAV+KC+E+ KLEAEFP E L
Sbjct  319  ----AYLEDSKKIPSNSDNLSTSTGQSGTNANKKEQSALRAVIKCVEDRKLEAEFPLEDL  374

Query  619  KKRLDQLEKTKSEkkkpaaaaap------aaKRTRVSNGGPMPPAKAGRSTN------AY  476
             +RL++LEK K+EKKK A++++       A KR R SNGGPMPPAKAGR T+      + 
Sbjct  375  CERLEELEKAKTEKKKAASSSSSGASSGPANKRIRASNGGPMPPAKAGRHTDYTGTPSSP  434

Query  475  VSSFPAAAPTFVRSPSHTQYPTGLP  401
             ++    A TFVRSPSH  Y T  P
Sbjct  435  ATTTTTTAATFVRSPSHASYGTASP  459



>tpg|DAA42568.1| TPA: hypothetical protein ZEAMMB73_160821 [Zea mays]
Length=578

 Score =   132 bits (333),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 134/184 (73%), Gaps = 11/184 (6%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M +LAL+LGL ++M ++IEELI++ QQ+DAV+F YE GL  KFPPVPLLK++L+D+K
Sbjct  290  RRQMPRLALTLGLEEEMADIIEELIAKRQQLDAVNFAYEAGLQEKFPPVPLLKSYLEDSK  349

Query  766  kaATAILEDPNNSGRAAHL--AAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEK  593
            K +TA  ++ + S        A KKE SA+RAV+KC+E+  LEAEFP E L+K+L++LEK
Sbjct  350  KTSTAASDNSSTSSSGQSGSNANKKEQSALRAVIKCVEDRNLEAEFPLEGLRKQLEELEK  409

Query  592  TKSEkkkpaaaaap-------aaKRTRVSNGGPMPPAKAGR-STNAYVSSFPAAAPTFVR  437
             K+EKKK A++A         A KR R SNGGPMPPAKAGR +TNA  SSFP    TF +
Sbjct  410  AKTEKKKAASSATSGGSSSGPATKRIRASNGGPMPPAKAGRLATNACASSFPGPT-TFTQ  468

Query  436  SPSH  425
            SPSH
Sbjct  469  SPSH  472



>gb|ABK25209.1| unknown [Picea sitchensis]
 gb|ACN40848.1| unknown [Picea sitchensis]
Length=534

 Score =   131 bits (330),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 129/203 (64%), Gaps = 5/203 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ + KL  +L L +KMP+++E+LI++G+QV+AV+F +  GL  KFPPVPLLKA+LK++K
Sbjct  270  RRQIPKLCGALALIEKMPDIVEDLINKGKQVEAVYFAHAAGLFEKFPPVPLLKAYLKNSK  329

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA  A L+  NNS  A + A  KEL+A+R V+KCIEE+ LE+ FP   L+ R+  LEK +
Sbjct  330  KATLATLKSGNNSA-AVNEANTKELTALRTVIKCIEEHNLESLFPINSLQSRVADLEKKR  388

Query  586  SEkkkpaaaaapaaKRTRVSNGGP---MPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQY  416
            +E+KK   +     KR+R + GG    MPPAKAG++ NAY SS   +   + R     QY
Sbjct  389  AERKKSGGSLKSQNKRSRSNAGGSGAHMPPAKAGKAPNAYASS-NISDRNYYRPSDMVQY  447

Query  415  PTGLPAYPASPIYTHGSMSPQYV  347
            P G  A    P  ++   S Q +
Sbjct  448  PVGAVASYNLPGQSNYDRSSQAI  470



>gb|ABR17868.1| unknown [Picea sitchensis]
Length=601

 Score =   129 bits (323),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 119/186 (64%), Gaps = 3/186 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+   +L  SLGL  KMP+++E L++ G+Q++AV+F +  GL  KFPPVPLLK +LKDAK
Sbjct  333  RRQTPELCRSLGLESKMPDVVETLVNSGRQIEAVNFAHAFGLTEKFPPVPLLKEYLKDAK  392

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA+ A L+  NNS  A + A  KELSA RAV+KCIEE+KLE++F P+ L+KR+ QLEK K
Sbjct  393  KASQASLKSGNNSTAAQNEANTKELSAYRAVIKCIEEHKLESQFSPDPLQKRVAQLEKAK  452

Query  586  SEkkkpaaaaapaaKRTRVSNGGP---MPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQY  416
            +++K+ A A     KR R + G     MPP  A   T A  +S  AA  +F RS    QY
Sbjct  453  ADRKRSAGAVKSQPKRPRANGGNAGVYMPPLSAAERTPALYASSNAADRSFYRSLDRVQY  512

Query  415  PTGLPA  398
                P 
Sbjct  513  SGAAPG  518



>ref|XP_010228481.1| PREDICTED: LOW QUALITY PROTEIN: 5'-3' exoribonuclease 4-like 
[Brachypodium distachyon]
Length=1306

 Score =   130 bits (326),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 131/199 (66%), Gaps = 11/199 (6%)
 Frame = -3

Query  946   RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
             R+ M +LAL+LGL D+M ++IEEL+++GQQ+DAV+F  E GL+ KF PVPLLK++L+D+K
Sbjct  1041  RRQMPRLALTLGLEDEMDDIIEELVTKGQQLDAVNFASESGLLEKFSPVPLLKSYLEDSK  1100

Query  766   kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
             K +          G++   A KKE SA+RAV+KC+E++KLE +FP E L+KRL++LE  K
Sbjct  1101  KISCTSDNLSTGCGQSGTNANKKEQSALRAVIKCVEDHKLEPDFPLEDLRKRLEELEMAK  1160

Query  586   SEkkkpaaaaap------aaKRTRVSNGGPMPPAKAGRSTNA----YVSSFPAAAPTFVR  437
             +EKKK A++++       A KR R SNGG + PAKAG   +        +   +  TF+R
Sbjct  1161  TEKKKAASSSSSGGASEPANKRIRASNGGAISPAKAGGLNDCTGAPSSPAATTSTTTFIR  1220

Query  436   SP-SHTQYPTGLPAYPASP  383
             SP SH  Y TG P    SP
Sbjct  1221  SPSSHASYGTGSPYSYDSP  1239



>ref|XP_006842236.1| PREDICTED: FRIGIDA-like protein 4a [Amborella trichopoda]
 gb|ERN03911.1| hypothetical protein AMTR_s00078p00186900 [Amborella trichopoda]
Length=568

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 131/211 (62%), Gaps = 12/211 (6%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M K A++LG GDKM  +IEELIS+G+++DAV+F  E GL  +F P+PL+KA+LK+++
Sbjct  264  RRDMPKTAIALGFGDKMEGIIEELISKGKEIDAVYFALESGLTERFAPIPLIKAYLKNSR  323

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            + A AI ++ NNS      +   EL+A+R+V+KCIE+ KLE EFP E+LKKR+ +LEK K
Sbjct  324  RNAQAISKNGNNSASTPEESNALELNALRSVIKCIEDNKLEHEFPIENLKKRVIELEKAK  383

Query  586  SEkkkpaaaaapaaKRTRVSNGGP--MP---PAKAGRSTNAYVSSFPAAAPTF-VRSPSH  425
            +   +   A  P  KR+R S GG   +P   PAKAGR TN+  S F        V S +H
Sbjct  384  A--SRRKTANRPNPKRSRASTGGSSALPSGRPAKAGRHTNS--SRFVGGRNQSPVASLAH  439

Query  424  TQYPTGLPAYPASPIYTHGSMSPQYVYSPEA  332
             Q P G+P     P++    M    +++  A
Sbjct  440  YQAPMGVPM--GQPVHHQSPMGSTMIHAVGA  468



>gb|KDO74579.1| hypothetical protein CISIN_1g010192mg [Citrus sinensis]
Length=364

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 76/80 (95%), Gaps = 1/80 (1%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGDKMPE+IEELISRGQQ+DAVHFTYEVGL++KFPPVPLLKAFLKDAK
Sbjct  280  RKQMPKLAVSLGLGDKMPEMIEELISRGQQLDAVHFTYEVGLVDKFPPVPLLKAFLKDAK  339

Query  766  kaATAILEDPNNSGRAA-HL  710
            KAA +ILEDPNN+GRAA HL
Sbjct  340  KAAVSILEDPNNAGRAAVHL  359



>gb|KDO74578.1| hypothetical protein CISIN_1g010192mg [Citrus sinensis]
Length=412

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGDKMPE+IEELISRGQQ+DAVHFTYEVGL++KFPPVPLLKAFLKDAK
Sbjct  280  RKQMPKLAVSLGLGDKMPEMIEELISRGQQLDAVHFTYEVGLVDKFPPVPLLKAFLKDAK  339

Query  766  kaATAILEDPNNSGRAA  716
            KAA +ILEDPNN+GRAA
Sbjct  340  KAAVSILEDPNNAGRAA  356



>gb|EMS54431.1| 5'-3' exoribonuclease 4 [Triticum urartu]
Length=1362

 Score =   118 bits (296),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 131/193 (68%), Gaps = 11/193 (6%)
 Frame = -3

Query  946   RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
             R+ M +LAL+LGL D M E+IEELI++GQQ+DAV+F YE GL+ KF PVPLLK++L+D+K
Sbjct  1095  RRQMPRLALTLGLEDDMEEIIEELITKGQQLDAVNFAYEAGLLEKFSPVPLLKSYLEDSK  1154

Query  766   kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
             K          +SG++   A KKE SA+RAV+KC+E++KLEAEFP E L+KRL+ LE  K
Sbjct  1155  KIYCTSDNVSTSSGQSGVNANKKEQSALRAVIKCVEDHKLEAEFPLEDLRKRLEDLEMAK  1214

Query  586   SEkkkpaaaaap---aaKRTRVSNGGPMPPAKAGRSTN-------AYVSSFPAAAPTFVR  437
             +EKKK A++ +    A+KR + S GG M P+K+GR ++          ++  + A  F+ 
Sbjct  1215  TEKKKAASSCSSGGPASKRIKGSTGGAMSPSKSGRLSDNTGAPSSPATATSSSTATAFIG  1274

Query  436   SP-SHTQYPTGLP  401
             SP SH  Y TG P
Sbjct  1275  SPASHVSYGTGSP  1287



>gb|EMT08825.1| 5'-3' exoribonuclease 4 [Aegilops tauschii]
Length=1323

 Score =   117 bits (294),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 132/193 (68%), Gaps = 11/193 (6%)
 Frame = -3

Query  946   RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
             R+ M +LAL+LGL D M E+IEELI++GQQ+DAV+F YE GL+ KF PVPLLK++L+D+K
Sbjct  1056  RRQMPRLALTLGLEDDMEEIIEELITKGQQLDAVNFAYEAGLLEKFSPVPLLKSYLEDSK  1115

Query  766   kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
             K          +SG++   A KKE SA+RAV+KC+E++KLEAEFP E L+KRL++LE  K
Sbjct  1116  KMYCTSDNVSTSSGQSGVNANKKEQSALRAVIKCVEDHKLEAEFPLEDLRKRLEELEMAK  1175

Query  586   SEkkkpaaaaap---aaKRTRVSNGGPMPPAKAGRSTN-------AYVSSFPAAAPTFVR  437
             +EKKK A++ +    A+KR + S GG M P+K+GR ++          ++  + A  F+ 
Sbjct  1176  TEKKKAASSCSSGGPASKRIKGSAGGAMSPSKSGRLSDNTGAPSSPATATSSSTATAFIG  1235

Query  436   SP-SHTQYPTGLP  401
             SP SH  Y TG P
Sbjct  1236  SPASHVSYGTGSP  1248



>ref|XP_010254145.1| PREDICTED: FRIGIDA-like protein 4a [Nelumbo nucifera]
Length=539

 Score =   115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 112/161 (70%), Gaps = 4/161 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA SLG G+KM ++I+EL+  G++++A++F  E GL  +FPP+ LLK++L++++
Sbjct  276  RKEMPKLAASLGFGEKMGDIIDELVKNGKEIEAIYFASESGLTERFPPLSLLKSYLRNSR  335

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            + AT IL++ + S  A   A+  EL++I+A++KC+E++KLEAEF  + LKKRL QLEK K
Sbjct  336  RNATTILKNGHYSAAATEEASVLELNSIKAIIKCVEDHKLEAEFTLDSLKKRLTQLEKAK  395

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMP----PAKAGRSTNAY  476
            +++KK  AA +    +      G  P    P+KAGR +N+Y
Sbjct  396  ADRKKNMAATSKPQNKRGRGGSGGGPPNFRPSKAGRPSNSY  436



>gb|KJB38150.1| hypothetical protein B456_006G239300 [Gossypium raimondii]
Length=391

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGD+MP++IEELIS+GQQ+DAVHFTYEVGL++KFPPVPLLK+FL+DAK
Sbjct  281  RKQMPKLAVSLGLGDQMPDMIEELISKGQQLDAVHFTYEVGLVDKFPPVPLLKSFLRDAK  340

Query  766  kaATAILEDPNNSGRAA  716
            KAA++IL+DPNNSGRAA
Sbjct  341  KAASSILDDPNNSGRAA  357



>gb|AIN75610.1| FRIGIDA4a [Dimocarpus longan]
Length=408

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 111/166 (67%), Gaps = 7/166 (4%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA SLGLGDK+ ++++EL+  G++++AV+F  E GL  +FPPV LLK++L+++K
Sbjct  141  RRDMPKLAASLGLGDKLADILDELVKSGKEIEAVYFASESGLTERFPPVSLLKSYLRNSK  200

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K AT  L++ N    A   ++  EL++I+A+++C+E++KL++EF  + LKKR  QLEK K
Sbjct  201  KNATNKLKNGNYRNAATEESSNMELNSIKAIIRCVEDHKLDSEFSIDSLKKRASQLEKAK  260

Query  586  SEkkkpaaaaapaaKR-------TRVSNGGPMPPAKAGRSTNAYVS  470
            +E+KK +        +       +R S   P+ P+KA + +NAY S
Sbjct  261  AERKKSSVTNTKPQNKRGYGAGSSRGSGPPPLRPSKAAKFSNAYQS  306



>ref|XP_007034761.1| FRIGIDA-like protein isoform 2 [Theobroma cacao]
 gb|EOY05687.1| FRIGIDA-like protein isoform 2 [Theobroma cacao]
Length=375

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA+SLGLGDKMP++IEEL+S+GQQ+DAVHFTYEVGL++KFPPVPLLKAFL+DAK
Sbjct  281  RKQMPKLAVSLGLGDKMPDMIEELVSKGQQLDAVHFTYEVGLVDKFPPVPLLKAFLRDAK  340

Query  766  kaATAILEDPNNSGRAA  716
            KAA++ILEDP+N+GRAA
Sbjct  341  KAASSILEDPSNAGRAA  357



>gb|KHG13959.1| Protein FRIGIDA -like protein [Gossypium arboreum]
Length=534

 Score =   111 bits (277),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 109/164 (66%), Gaps = 7/164 (4%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA +LG  DKM ++I+EL+  G++++AV+F    GL  +FPPV LLK++ +++K
Sbjct  268  RRDMAKLAAALGFDDKMGDIIDELVKNGKEIEAVYFARAAGLTERFPPVYLLKSYQQNSK  327

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K AT IL++ N S  A   +   EL++I+A++KC+E++KLE+EF  + L+KR  QLEK K
Sbjct  328  KNATTILKNGNFSTAATEESKNVELNSIKAIIKCVEDHKLESEFSTDLLRKRATQLEKVK  387

Query  586  SEkkkpaaaaapaaKRTRVSNG-----GP--MPPAKAGRSTNAY  476
            S++KK +AAA     +   S G     GP    PAKA + +NAY
Sbjct  388  SDRKKSSAAAGKPQNKRSHSAGSARGSGPPAFRPAKAAKFSNAY  431



>gb|KJB06948.1| hypothetical protein B456_001G004500 [Gossypium raimondii]
Length=534

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 108/164 (66%), Gaps = 7/164 (4%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA +LG  DKM ++I+EL+  G++++AV+F    GL  +FPPV LLK++ +++K
Sbjct  268  RRDMAKLAAALGFDDKMGDIIDELVKNGKEIEAVYFARAAGLTERFPPVSLLKSYQQNSK  327

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K AT IL++ N S  A   +   EL++I+A++KC+E++KLE+EF  + L+KR  QLEK K
Sbjct  328  KNATTILKNGNFSAAATEESKNVELNSIKAIIKCVEDHKLESEFSTDLLRKRATQLEKVK  387

Query  586  SEkkkpaaaaapaaKRTRVSNG---GPMPPA----KAGRSTNAY  476
            S++KK +AAA     +   S G   G  PPA    KA + +N Y
Sbjct  388  SDRKKSSAAAGKPQNKRSHSAGSARGSGPPAFRPTKAAKFSNVY  431



>ref|XP_011043451.1| PREDICTED: FRIGIDA-like protein 4a [Populus euphratica]
Length=561

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 128/201 (64%), Gaps = 14/201 (7%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA ++G G+KM ++I+EL+  G++++AV+F  E GL  +F PV LLK++LK++K
Sbjct  278  RRDMAKLAAAIGFGEKMGDIIDELVKNGKEIEAVYFASESGLTKRFSPVSLLKSYLKNSK  337

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K  T +L++ N S  A   ++  EL++I+A++KC+E++KLE+EF  + L+KR   LEKTK
Sbjct  338  KITTTVLKNGNYSAAATDESSTLELNSIKAIIKCVEDHKLESEFSLDSLRKRASLLEKTK  397

Query  586  SEkkkpaaaaapaaKRTRVSNG-------GPMP--PAKAGRSTNAYVSSFP--AAAPTFV  440
            +E+K+  +AA     + +  +G       GP P   AKA + +N Y SSF    +AP   
Sbjct  398  AERKRGTSAATATKSQNKRGHGSSGGRDSGPTPYRQAKAAKFSNNY-SSFSRRNSAPPAQ  456

Query  439  RSPSHTQYPTGLPAYPASPIY  377
             SP+  +Y +G   YP+  +Y
Sbjct  457  HSPAR-RY-SGPFHYPSQNVY  475



>ref|XP_006371900.1| hypothetical protein POPTR_0018s05910g [Populus trichocarpa]
 gb|ERP49697.1| hypothetical protein POPTR_0018s05910g [Populus trichocarpa]
Length=564

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 113/170 (66%), Gaps = 10/170 (6%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA ++G G+KM ++I+EL+  G++++AV+F  E GL  +F PV LLK++LK++K
Sbjct  281  RRDMAKLAAAIGFGEKMGDIIDELVKNGKEIEAVYFASESGLTKRFSPVSLLKSYLKNSK  340

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K  T +L++ N S  A   ++  EL++I+A++KC+E++KLE+EF  + L+KR   LEKTK
Sbjct  341  KITTTVLKNGNYSAAATDESSTLELNSIKAIIKCVEDHKLESEFSLDSLRKRASLLEKTK  400

Query  586  SEkkkpaaaaapaaKRTRVSNG-------GPMP--PAKAGRSTNAYVSSF  464
            +E+K+  +AA     + +  +G       GP P   AKA + +N Y SSF
Sbjct  401  AERKRGTSAATATKSQNKRGHGSSGARDSGPTPYRQAKAAKFSNNY-SSF  449



>ref|XP_007013214.1| FRIGIDA-like protein [Theobroma cacao]
 gb|EOY30833.1| FRIGIDA-like protein [Theobroma cacao]
Length=534

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 108/164 (66%), Gaps = 7/164 (4%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA +L  GDKM ++I+EL+  G++++AV+F  E GL  +F PV LLK++L+++K
Sbjct  268  RRDMAKLAAALEFGDKMGDIIDELVKNGKEIEAVYFAMEAGLTERFSPVSLLKSYLRNSK  327

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K AT IL++ N S  A   +   EL++I+A++KC+E++KLE+EF  + L+KR  QLEK K
Sbjct  328  KNATTILKNENYSAAATEESNNVELNSIKAIIKCVEDHKLESEFSVDSLRKRATQLEKVK  387

Query  586  SEkkkpaaaaapaaKR-------TRVSNGGPMPPAKAGRSTNAY  476
            ++++K ++A      +       +R S      PAKA + +N+Y
Sbjct  388  ADRRKSSSATGKPQNKRGHNAGSSRGSGPSAFRPAKAAKFSNSY  431



>gb|KDO50860.1| hypothetical protein CISIN_1g009377mg [Citrus sinensis]
Length=536

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 125/199 (63%), Gaps = 11/199 (6%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M +LA  LG G+KM ++I EL+  G++++AV+F  E GL  KFPPV LLK+ L+++K
Sbjct  267  RRDMARLAACLGFGEKMEDIIAELVKSGKEIEAVYFASESGLTEKFPPVSLLKSHLRNSK  326

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K +T+IL++ N+S  A   +   EL++I+A++KC+E++KLE+ F  ++L+KR  QLEK K
Sbjct  327  KNSTSILKNGNHSNSATEESNNLELNSIKAIIKCVEDHKLESAFSVDNLRKRATQLEKVK  386

Query  586  SEkkkpaaaaapaaKRTR---VSN---GGP--MPPAKAGRSTNAYVS-SFPAAAPTFVRS  434
             E+KK +AA     +  R    SN    GP    PAKA + +N+  S S    AP    S
Sbjct  387  VERKKSSAATNSKPQNKRGHGASNSRGSGPPAFRPAKAAKFSNSSQSFSRRNPAPKAQHS  446

Query  433  PSHTQYPTGLPAYPASPIY  377
            P+  +Y +G   YP+  +Y
Sbjct  447  PA-ARY-SGPYGYPSQSVY  463



>gb|AAP31312.2| ABI3-interacting protein 2 [Callitropsis nootkatensis]
Length=672

 Score =   110 bits (274),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 115/181 (64%), Gaps = 2/181 (1%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK   +L  SLGL +K+P +++ LI+ G+Q++AV+F +  GL++ +PPVPLLKA+LK+A+
Sbjct  382  RKQTPELCQSLGLEEKLPGVMDTLINNGKQIEAVNFAFTCGLVDTYPPVPLLKAYLKEAR  441

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K   A ++  N S  A + A  +EL A++AV+KCIEE+ LE+E+P + L+KR+ QLEK K
Sbjct  442  K--AAQVKSGNTSVAAQNEANARELFALKAVVKCIEEHNLESEYPSDTLRKRVLQLEKAK  499

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            ++KK+ A       K+ R +  G   P  +G   +   ++  AA  +  RS    QYP+ 
Sbjct  500  TDKKRSADGIKSQYKKPRTNTAGGYLPTASGIDRSGVFATANAADMSLYRSADRVQYPSS  559

Query  406  L  404
            +
Sbjct  560  V  560



>ref|XP_006451127.1| hypothetical protein CICLE_v10007961mg [Citrus clementina]
 ref|XP_006475599.1| PREDICTED: FRIGIDA-like protein 4a-like [Citrus sinensis]
 gb|ESR64367.1| hypothetical protein CICLE_v10007961mg [Citrus clementina]
Length=536

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 125/199 (63%), Gaps = 11/199 (6%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M +LA  LG G+KM ++I EL+  G++++AV+F  E GL  KFPPV LLK+ L+++K
Sbjct  267  RRDMARLAACLGFGEKMEDIIAELVKSGKEIEAVYFASESGLTEKFPPVSLLKSHLRNSK  326

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K +T+IL++ N+S  A   +   EL++I+A++KC+E++KLE+ F  ++L+KR  QLEK K
Sbjct  327  KNSTSILKNGNHSNSATEESNNLELNSIKAIIKCVEDHKLESAFSVDNLRKRATQLEKVK  386

Query  586  SEkkkpaaaaapaaKRTR---VSN---GGP--MPPAKAGRSTNAYVS-SFPAAAPTFVRS  434
             E+KK +AA     +  R    SN    GP    PAKA + +N+  S S    AP    S
Sbjct  387  VERKKSSAATNSKPQNKRGHGASNSRGSGPPAFRPAKAAKFSNSSQSFSRRNPAPKAQHS  446

Query  433  PSHTQYPTGLPAYPASPIY  377
            P+  +Y +G   YP+  +Y
Sbjct  447  PA-ARY-SGPYGYPSQSVY  463



>ref|XP_012076667.1| PREDICTED: FRIGIDA-like protein 4a [Jatropha curcas]
 gb|KDP33654.1| hypothetical protein JCGZ_07225 [Jatropha curcas]
Length=539

 Score =   108 bits (271),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 112/164 (68%), Gaps = 7/164 (4%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA+++G G+KM E+I EL+  G++++A +F  E GL ++FPPV LLK+++K++K
Sbjct  271  RRDMAKLAVAIGFGEKMEEMICELVKNGKEIEAAYFASESGLTDRFPPVSLLKSYIKNSK  330

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K    IL++ N +  A   +   EL++I+AV+KC+E++KLE+EFP + L+KR+ +LEK K
Sbjct  331  KNTATILKNGNYNAAATEESNAVELNSIKAVIKCVEDHKLESEFPLDSLRKRVTRLEKAK  390

Query  586  SEkkkpaaaaapaaKRTRVSNG---GPMPPA----KAGRSTNAY  476
            +E+KK +AAA  A  + +       G  PPA    KA + +NAY
Sbjct  391  AERKKSSAAAVAAKSQNKRGANIGRGQRPPAFRPPKAAKFSNAY  434



>gb|AHH02379.1| FRIGIDA-like protein, partial [Aegiceras corniculatum]
Length=74

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = -3

Query  697  ELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGG  518
            E SA+RAV+KCIEEYKLEAEFPPE+LKKRL+QLEKTK+  +K    A PA KRTR + GG
Sbjct  1    EQSALRAVIKCIEEYKLEAEFPPENLKKRLEQLEKTKT-SEKRKPVAVPANKRTRANIGG  59

Query  517  PMPPAKAGRSTNAYV  473
            PMPPAKAGRSTNAYV
Sbjct  60   PMPPAKAGRSTNAYV  74



>ref|XP_008337438.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
Length=539

 Score =   108 bits (269),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 80/217 (37%), Positives = 130/217 (60%), Gaps = 28/217 (13%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA +L LG+KM ++I+EL+  G++++AV+F  E GL   FPPV LLK++L++++
Sbjct  269  RRDMAKLAGALELGEKMGDVIDELVKNGKEIEAVYFASESGLTESFPPVSLLKSYLRNSR  328

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
             +AT IL++ NNS  A   ++  EL++I+A++KC+E++KLE+EF  E L+KR   LEK K
Sbjct  329  XSATIILKNGNNSVAATEESSTLELNSIKAIIKCVEDHKLESEFSLESLRKRATHLEKAK  388

Query  586  SEkkkpaaaaapaaKRTRV----------SNGGPMPPAKAGRSTNAYVSSFPAAAPTFVR  437
            +E+KK +A+++      R                  PAKA + +N+Y        P+F R
Sbjct  389  TERKKSSASSSKPHNNKRAYXGGGGGGXGVGQSSFRPAKAAKFSNSY--------PSFTR  440

Query  436  S-----PSH---TQYPTGLPAYPASPIYTHGSMSPQY  350
                  P H   T+Y +G  +YP+  ++  G  +P Y
Sbjct  441  RNPNPLPQHSPXTRY-SGPYSYPSQSVF-DGPTAPSY  475



>ref|XP_002514326.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48280.1| conserved hypothetical protein [Ricinus communis]
Length=547

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 83/207 (40%), Positives = 123/207 (59%), Gaps = 11/207 (5%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA+++G G+KM  +I+EL+  G++V+AV+F  E  L  KFPPV LLK+++K++K
Sbjct  278  RRDMAKLAVAVGFGEKMEGMIDELVKNGKEVEAVYFASESVLTEKFPPVSLLKSYIKNSK  337

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K    IL++ N S  A   +   ELS+I+AV+ C+E++KLE+EF  + L+KR+ +LEKTK
Sbjct  338  KITATILKNGNFSAAATDESNTVELSSIKAVINCVEDHKLESEFSLDSLRKRVTRLEKTK  397

Query  586  SE----kkkpaaaaapaaKRTRVSNGGPMP------PAKAGRSTNAYVSSFPAAAPTFVR  437
            +E        AAAA    KR   ++GG  P      P KA + +NAY S F    P  V 
Sbjct  398  AERKKSSAAAAAAAKSQNKRGPSASGGRDPRAPTFRPGKAAKFSNAY-SPFGRRNPAPVT  456

Query  436  SPSHTQYPTGLPAYPASPIYTHGSMSP  356
              S     +G   YP+  +Y   S +P
Sbjct  457  QHSPAARYSGPYNYPSQNVYEGHSTAP  483



>ref|NP_001059003.1| Os07g0173200 [Oryza sativa Japonica Group]
 dbj|BAF20917.1| Os07g0173200 [Oryza sativa Japonica Group]
Length=453

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 89/117 (76%), Gaps = 1/117 (1%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M +LAL+LGL + M ++IEELI++GQQ+DAV+F YE GL  KFPPVPLLK++L D+K
Sbjct  271  RRQMPRLALTLGLEEDMADIIEELIAKGQQLDAVNFAYEAGLQEKFPPVPLLKSYLADSK  330

Query  766  kaATAILEDPNNSGRAAHL-AAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQL  599
            K +  + ++ + S   +   A KKE S +RAV+KCIE+ KLEAEFP E L+++L++L
Sbjct  331  KTSCTVSDNSSTSSGQSGSNANKKEQSVLRAVIKCIEDRKLEAEFPLEDLQRQLEEL  387



>dbj|BAC83628.1| putative hydroxyproline-rich glycoprotein [Oryza sativa Japonica 
Group]
Length=419

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 89/117 (76%), Gaps = 1/117 (1%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M +LAL+LGL + M ++IEELI++GQQ+DAV+F YE GL  KFPPVPLLK++L D+K
Sbjct  271  RRQMPRLALTLGLEEDMADIIEELIAKGQQLDAVNFAYEAGLQEKFPPVPLLKSYLADSK  330

Query  766  kaATAILEDPNNSGRAAHL-AAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQL  599
            K +  + ++ + S   +   A KKE S +RAV+KCIE+ KLEAEFP E L+++L++L
Sbjct  331  KTSCTVSDNSSTSSGQSGSNANKKEQSVLRAVIKCIEDRKLEAEFPLEDLQRQLEEL  387



>ref|XP_010915057.1| PREDICTED: FRIGIDA-like protein 4b isoform X1 [Elaeis guineensis]
Length=509

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 120/189 (63%), Gaps = 12/189 (6%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK + KLA  LGLG+KM ++I EL+  G++++AV+F +E GL  +F P+P+LK++L+ ++
Sbjct  266  RKEIGKLAPGLGLGEKMADIIGELVKNGKELEAVYFAHEAGLTERFSPLPVLKSYLQSSR  325

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            + A AIL+D N+S  +   A   E+S +R++++C+E  +LE+EF  + LKKR+ Q+EK K
Sbjct  326  EKANAILKDGNHSTASTEQATGAEMSDLRSIIRCVETCRLESEFSIDGLKKRVAQMEKAK  385

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMP--PAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYP  413
            +EKKK A A    +KR R + G  +   PAKA R+ N         AP+  RSP+  Q P
Sbjct  386  AEKKKAATANKSGSKRKRSTGGTALSFRPAKATRTFN---------APSH-RSPTVPQLP  435

Query  412  TGLPAYPAS  386
             G   Y  S
Sbjct  436  VGRQPYSCS  444



>ref|XP_007160344.1| hypothetical protein PHAVU_002G313900g [Phaseolus vulgaris]
 gb|ESW32338.1| hypothetical protein PHAVU_002G313900g [Phaseolus vulgaris]
Length=529

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/214 (35%), Positives = 117/214 (55%), Gaps = 32/214 (15%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA SL  GDK+ ++I+ELIS G++++AV+F  E GL  +FPP+ LLK++ ++ K
Sbjct  260  RRDMAKLAASLQFGDKIIDIIDELISSGKEIEAVYFASESGLTERFPPINLLKSYHRNYK  319

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K  T      NN+      ++  EL++I++++KC+E++KLE+EF  +HL+KR   LEK K
Sbjct  320  KNVTTTSRKGNNNHATTDDSSTSELNSIKSIIKCVEDHKLESEFNLDHLRKRATLLEKAK  379

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMP---------------PAKAGRSTNAYVSSF--PA  458
            +E             R + S  G  P               PAK+ + +NA+ SSF    
Sbjct  380  AE-------------RKKSSTSGTKPQNKRGSRGNGSSSSRPAKSAKFSNAHSSSFGRRN  426

Query  457  AAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP  356
             AP+    PS     +G   YP+  I+   + +P
Sbjct  427  LAPSL--QPSPGARFSGPFNYPSQTIFDGATANP  458



>emb|CBI28087.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 95/149 (64%), Gaps = 13/149 (9%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA++LG G+KM ++I+EL+  G++++AV+F  E GL  +F PV LLK++L +++
Sbjct  30   RRDMPKLAIALGFGEKMGDIIDELVKSGKEIEAVYFASESGLTERFSPVSLLKSYLHNSR  89

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K AT IL++ N S  A   +   EL++I+ ++KC+E++KLE+EF  + L+KR  QLEK K
Sbjct  90   KNATTILKNGNYSTAATEESGNVELNSIKTIIKCVEDHKLESEFSIDSLRKRATQLEKAK  149

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAK  500
             E             R + S G   PP K
Sbjct  150  VE-------------RKKSSAGASKPPNK  165



>ref|XP_007204566.1| hypothetical protein PRUPE_ppa003799mg [Prunus persica]
 gb|EMJ05765.1| hypothetical protein PRUPE_ppa003799mg [Prunus persica]
Length=548

 Score =   106 bits (265),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 90/122 (74%), Gaps = 0/122 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA +L  G+KM ++I+EL+  G++++AV+F  E GL  +FPPV LLK++L+++K
Sbjct  271  RRDMAKLAGALEFGEKMGDVIDELVKNGKEIEAVYFASETGLTERFPPVSLLKSYLRNSK  330

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K AT IL + NNS  A   ++  EL++I+A++KC+E++KLE+EF  + L+KR   LEK K
Sbjct  331  KNATTILRNGNNSLAATEESSTLELNSIKAIIKCVEDHKLESEFSLDSLRKRATHLEKAK  390

Query  586  SE  581
            +E
Sbjct  391  AE  392



>ref|XP_008242610.1| PREDICTED: FRIGIDA-like protein 4a [Prunus mume]
Length=551

 Score =   106 bits (265),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 90/122 (74%), Gaps = 0/122 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA +L  G+KM ++I+EL+  G++++AV+F  E GL  +FPPV LLK++L+++K
Sbjct  273  RRDMAKLAGALEFGEKMGDVIDELVKNGKEIEAVYFASETGLTERFPPVSLLKSYLRNSK  332

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K AT IL + NNS  A   ++  EL++I+A++KC+E++KLE+EF  + L+KR   LEK K
Sbjct  333  KNATTILRNGNNSLAATEESSTLELNSIKAIIKCVEDHKLESEFSLDSLRKRATHLEKAK  392

Query  586  SE  581
            +E
Sbjct  393  AE  394



>ref|XP_002961449.1| hypothetical protein SELMODRAFT_76871 [Selaginella moellendorffii]
 gb|EFJ36709.1| hypothetical protein SELMODRAFT_76871 [Selaginella moellendorffii]
Length=579

 Score =   106 bits (265),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 125/211 (59%), Gaps = 6/211 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L  +LGL  K+P+++++L   G+QV+A+ F +   ++++  PVPLLKA+LKDA+
Sbjct  331  RRQSPALCRALGLAPKIPDVVDKLAKEGKQVEALAFAHAFEIMDRVEPVPLLKAYLKDAR  390

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K+A  IL++ NNS  A + ++ KELSA+++V+KCIEEYKL+A+FPP+ L+KR+D LE+ K
Sbjct  391  KSAQVILKNGNNSAAAQNDSSMKELSALKSVIKCIEEYKLDAQFPPQSLQKRIDVLERAK  450

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTN--AYVSSFPAAAPTFVRSPSHTQYP  413
            +++K+ A A    AKR R  NG         RS    +  + F     +     S T Y 
Sbjct  451  ADRKRAAVAVKAQAKRPRACNGNGTVYGNGERSFYRPSDRAQFGGVGLSTYGLASQTGYD  510

Query  412  TGLPAYPASPIYTHG----SMSPQYVYSPEA  332
                   A+  YT      SMS  Y+YS + 
Sbjct  511  RRNQGGFATTTYTGNRTPVSMSTSYLYSADG  541



>ref|XP_011016586.1| PREDICTED: FRIGIDA-like protein 4a, partial [Populus euphratica]
Length=207

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 108/171 (63%), Gaps = 10/171 (6%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ + KLA ++  G+KM ++I+EL+  G++++AV+F  E GL  +F PV LLK++LK+ K
Sbjct  30   RRDIAKLAAAIDFGEKMGDIIDELVKNGKEIEAVYFASESGLTKRFSPVSLLKSYLKNFK  89

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K  T +L++ N +  A   ++  EL++I+A++KC+E++ LE+EF  + L KR   LEKTK
Sbjct  90   KITTTVLKNSNYNAAATDESSTLELNSIKAIIKCVEDHNLESEFSLDSLGKRASLLEKTK  149

Query  586  SEkkkpaaaaapaaKRTRVSNG-------GPMP--PAKAGRSTNAYVSSFP  461
            +E+K+  +AA     R +   G       GP P   AKA + +N Y SSF 
Sbjct  150  AERKRGTSAATATKSRNKRGYGSSGARDSGPTPYRKAKAAKFSNNY-SSFS  199



>ref|XP_002281155.2| PREDICTED: FRIGIDA-like protein 4a isoform X2 [Vitis vinifera]
Length=533

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 111/197 (56%), Gaps = 26/197 (13%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA++LG G+KM ++I+EL+  G++++AV+F  E GL  +F PV LLK++L +++
Sbjct  266  RRDMPKLAIALGFGEKMGDIIDELVKSGKEIEAVYFASESGLTERFSPVSLLKSYLHNSR  325

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K AT IL++ N S  A   +   EL++I+ ++KC+E++KLE+EF  + L+KR  QLEK K
Sbjct  326  KNATTILKNGNYSTAATEESGNVELNSIKTIIKCVEDHKLESEFSIDSLRKRATQLEKAK  385

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSF---------PAAAPTFVRS  434
             E             R + S G   PP K      +   S          PA AP F   
Sbjct  386  VE-------------RKKSSAGASKPPNKRAHGGGSGSGSGRGSGPSAFRPAKAPKF---  429

Query  433  PSHTQYPTGLPAYPASP  383
             S++ YP+     PA P
Sbjct  430  -SNSTYPSFGRRNPAPP  445



>ref|XP_010915058.1| PREDICTED: FRIGIDA-like protein 4b isoform X2 [Elaeis guineensis]
Length=507

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 120/189 (63%), Gaps = 14/189 (7%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK + KLA  LGLG+KM ++I EL+  G++++AV+F +E GL  +F P+P+LK++L+ ++
Sbjct  266  RKEIGKLAPGLGLGEKMADIIGELVKNGKELEAVYFAHEAGLTERFSPLPVLKSYLQSSR  325

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            + A AIL+D N+S   A  A   E+S +R++++C+E  +LE+EF  + LKKR+ Q+EK K
Sbjct  326  EKANAILKDGNHS--TASTATGAEMSDLRSIIRCVETCRLESEFSIDGLKKRVAQMEKAK  383

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMP--PAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYP  413
            +EKKK A A    +KR R + G  +   PAKA R+ N         AP+  RSP+  Q P
Sbjct  384  AEKKKAATANKSGSKRKRSTGGTALSFRPAKATRTFN---------APSH-RSPTVPQLP  433

Query  412  TGLPAYPAS  386
             G   Y  S
Sbjct  434  VGRQPYSCS  442



>ref|XP_010047742.1| PREDICTED: FRIGIDA-like protein 4a [Eucalyptus grandis]
 gb|KCW79702.1| hypothetical protein EUGRSUZ_C01055 [Eucalyptus grandis]
Length=568

 Score =   104 bits (259),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 107/182 (59%), Gaps = 19/182 (10%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ + KLA++L  G+K+ ++IEEL+  G++++AV+F  E G+ ++F P  LLK++L +AK
Sbjct  280  RRDLAKLAVALDFGEKLADIIEELVKNGKEIEAVYFAAEAGMTDRFSPASLLKSYLGNAK  339

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K A  +L+  NNS  +A  A+  ELSAIRAV+KC+E+ KLE+ FP + LKKR   LEK K
Sbjct  340  KNAQNVLKSGNNSVVSAEEASTIELSAIRAVVKCVEDQKLESVFPLDSLKKRAGILEKAK  399

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAK-----AGRSTNAYVSSFPAAAPTFVR-SPSH  425
            +E             R + S+ G  P  K      G  +    S+ PA A  F   SPS 
Sbjct  400  AE-------------RKKNSSSGSKPSNKRALGPGGSRSGGQPSTHPAKAAKFANPSPSF  446

Query  424  TQ  419
             +
Sbjct  447  NR  448



>ref|XP_004503419.1| PREDICTED: uncharacterized protein LOC101489761 [Cicer arietinum]
Length=537

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 87/122 (71%), Gaps = 4/122 (3%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M K+A SL  GDKM ++I++L+  G++++AV+F  E GL  +F P+ LL +++++  
Sbjct  265  RRDMAKIAASLEFGDKMIDIIDDLVKNGKEIEAVYFASESGLTERFQPIKLLNSYVQNY-  323

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
               T+IL   NN+  A++ +   EL++I+ V+KC+E++KLE+EF  + LK+R+ QLEK+K
Sbjct  324  ---TSILTSGNNTQSASNESTTLELNSIKDVIKCVEDHKLESEFKLDKLKRRVSQLEKSK  380

Query  586  SE  581
            +E
Sbjct  381  AE  382



>ref|XP_009336927.1| PREDICTED: FRIGIDA-like protein 4a [Pyrus x bretschneideri]
Length=554

 Score =   103 bits (256),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 90/122 (74%), Gaps = 0/122 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA +L  G+KM ++I+EL+  G++++AV+F  E  L  +FPPV LLK++LK+++
Sbjct  279  RRDMAKLARALEFGEKMGDVIDELVKNGKEIEAVYFASESDLTERFPPVSLLKSYLKNSR  338

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K A  IL++ NNS  A   ++  EL++I+A++KC+E++KLE+EF  E+L+KR   LEK +
Sbjct  339  KNAATILKNGNNSVAATEESSTFELNSIKAIIKCVEDHKLESEFSLENLRKRATHLEKAR  398

Query  586  SE  581
            +E
Sbjct  399  TE  400



>ref|XP_008386583.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
 ref|XP_008386605.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
Length=546

 Score =   102 bits (255),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 125/208 (60%), Gaps = 20/208 (10%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA +L  G+KM ++I+EL+  G++++AV+F  E  L  +FPPV LLK++LK+++
Sbjct  271  RRDMAKLARALEFGEKMGDVIDELVKNGKEIEAVYFASESDLTERFPPVSLLKSYLKNSR  330

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K A  IL++ NN   AA  ++  EL++I+A++KC+E++KLE+EF  E+L+KR   LEK +
Sbjct  331  KNAATILKNGNNCVAAAEESSTFELNSIKAIIKCVEDHKLESEFSLENLRKRATHLEKAR  390

Query  586  SEkkkpaaaaapaaKRTRV------------------SNGGPMPPAKAGRSTNAYVSSFP  461
            +E+KK +A+++      R                          PAKA + +NAY S+  
Sbjct  391  TERKKRSASSSRPHNNKRAYGGSRGGGSGSGGGGGRGVGQSSSRPAKAAKFSNAYPSTRR  450

Query  460  AAAPTFVRSPSHTQYPTGLPAYPASPIY  377
             + P    SP+ T+Y +G   YP+  +Y
Sbjct  451  NSNPLPQHSPA-TRY-SGPYNYPSQSVY  476



>ref|XP_004295864.1| PREDICTED: truncated FRIGIDA-like protein 1 [Fragaria vesca subsp. 
vesca]
Length=544

 Score =   102 bits (255),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 88/120 (73%), Gaps = 0/120 (0%)
 Frame = -3

Query  943  KHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakk  764
            +    L  +LGLGDK+  LI++L+S+G+ + A+ F  E  + +KFPPVP+LKA++K++K+
Sbjct  289  RQATDLCRTLGLGDKITVLIQKLMSKGKHLLAIKFISEFDMTDKFPPVPILKAYVKESKR  348

Query  763  aATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKS  584
             A  + E+ NNS +AA+ A  KE  A+++V+K IE+ KLE+E+PP  L+KR+DQLEK K+
Sbjct  349  LAKKVSEEGNNSKKAANEAIAKETGALKSVIKIIEDLKLESEYPPSSLEKRIDQLEKKKA  408



>ref|XP_011458926.1| PREDICTED: FRIGIDA-like protein 4a isoform X2 [Fragaria vesca 
subsp. vesca]
Length=547

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 131/214 (61%), Gaps = 20/214 (9%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA +L  GD + ++I+EL+  G++++A++F +E GL  +FPP+ LLK++LK++K
Sbjct  271  RRDMAKLAGALQFGD-IGDVIDELVKNGKEIEAIYFAFESGLTERFPPISLLKSYLKNSK  329

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K A+ I+++ NNS  A+  ++  EL++IRAV+KC+E++KLE+EF  + L+KR+  LE+ K
Sbjct  330  KNASTIMKNGNNSVAASEESSTLELNSIRAVIKCVEDHKLESEFTLDSLRKRVTALERAK  389

Query  586  SEkkkpaaaaapaaKR------------TRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTF  443
            +++KK +AAA+  +                        PAKA + +NA+ SSF    P  
Sbjct  390  ADRKKNSAAASSKSNNKRSYGSGGGGGGRGGVGSSSSRPAKAAKYSNAHPSSFNRRIPN-  448

Query  442  VRSPSH---TQYPTGLPAYPASPIYTHGSMSPQY  350
               P H   T+YP G   YP+  +Y  G+ S  Y
Sbjct  449  -PPPQHSPVTRYP-GPYNYPSPTVY-DGATSVSY  479



>ref|XP_009338897.1| PREDICTED: FRIGIDA-like protein 2 [Pyrus x bretschneideri]
Length=571

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 89/121 (74%), Gaps = 0/121 (0%)
 Frame = -3

Query  943  KHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakk  764
            +   +L   +GLGDK+ +LI++L+S+G+ + AV F  E GL +KFPPV +LK+++K++KK
Sbjct  316  RQAVELCRKIGLGDKLADLIQKLVSKGKHLLAVKFISEFGLTDKFPPVTILKSYVKESKK  375

Query  763  aATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKS  584
             A  + +D NNS ++ + A  KE  A+++V+K IE+ KLE+E+PP  L+KRL+QLEK K+
Sbjct  376  LAKKVCKDGNNSRQSMNEATAKESGALKSVIKVIEDLKLESEYPPTFLQKRLEQLEKEKA  435

Query  583  E  581
            +
Sbjct  436  D  436



>ref|XP_009338911.1| PREDICTED: FRIGIDA-like protein 2 [Pyrus x bretschneideri]
Length=562

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 89/121 (74%), Gaps = 0/121 (0%)
 Frame = -3

Query  943  KHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakk  764
            +   +L   +GLGDK+ +LI++L+S+G+ + AV F  E GL +KFPPV +LK+++K++KK
Sbjct  316  RQAVELCRKIGLGDKLADLIQKLVSKGKHLLAVKFISEFGLTDKFPPVTILKSYVKESKK  375

Query  763  aATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKS  584
             A  + +D NNS ++ + A  KE  A+++V+K IE+ KLE+E+PP  L+KRL+QLEK K+
Sbjct  376  LAKKVCKDGNNSRQSMNEATAKESGALKSVIKVIEDLKLESEYPPTFLQKRLEQLEKEKA  435

Query  583  E  581
            +
Sbjct  436  D  436



>ref|XP_010097353.1| hypothetical protein L484_010231 [Morus notabilis]
 gb|EXB67663.1| hypothetical protein L484_010231 [Morus notabilis]
Length=674

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 83/122 (68%), Gaps = 0/122 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+   +L  SLGL DK  + I+ LISR + ++AV F Y   L++KFPPVPLL+  LKD K
Sbjct  236  RRQAPELFKSLGLSDKASDFIQNLISRMKYLEAVRFIYAFELVDKFPPVPLLQDHLKDVK  295

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
             AA  I +  N+S +    AA KE++A+R V++CIEEYKLE+E+ PE LK+R++ L K K
Sbjct  296  MAARTIWKKNNSSPKEKDDAANKEIAALRGVIRCIEEYKLESEYSPEELKERVEWLRKQK  355

Query  586  SE  581
             E
Sbjct  356  YE  357



>gb|ACJ85672.1| unknown [Medicago truncatula]
Length=353

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RKHM KLALSLGL D+M ++++ELIS+GQQ+DAVHFT+EVGL++KFPPVPLLK++LKDAK
Sbjct  282  RKHMPKLALSLGLTDQMADMVQELISKGQQLDAVHFTFEVGLVDKFPPVPLLKSYLKDAK  341

Query  766  kaATAILEDPNN  731
            K A +ILEDPNN
Sbjct  342  KVAASILEDPNN  353



>ref|XP_009347163.1| PREDICTED: FRIGIDA-like protein 4a [Pyrus x bretschneideri]
Length=539

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA +L  G+KM ++I+E +  G++++AV+F  E GL   FPPV LLK++L+ ++
Sbjct  269  RRDMAKLAGALEFGEKMGDVIDEFVKNGKEIEAVYFASESGLTESFPPVSLLKSYLRSSR  328

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKT  590
            K AT IL++ NNS  A   ++  EL++I+A++KC+E++KLE+EF  E L+KR   LEK 
Sbjct  329  KNATTILKNGNNSVAATEESSTVELNSIKAIIKCVEDHKLESEFSLESLRKRATHLEKV  387



>ref|XP_009598293.1| PREDICTED: FRIGIDA-like protein 4a [Nicotiana tomentosiformis]
Length=562

 Score =   100 bits (250),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 121/205 (59%), Gaps = 25/205 (12%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA++ G G+K+ ++IEEL+  G++V+AV+F YE GL  +FPPV LLKA+L++ +
Sbjct  270  RKDMPKLAVAFGFGNKIVDIIEELVKSGKEVEAVYFAYESGLAERFPPVSLLKAYLRNCR  329

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            + +  I +    S  A   A   E  A +A++KC+E++KLE EF  E LKKR+ +LE+++
Sbjct  330  RNSNNISKKGRFSSAAVDKANIIEWEATKAIIKCVEDHKLEQEFSLEGLKKRVTELEQSR  389

Query  586  SEkkkpaa-aaapaaKRTRVSNGGPM------PPAKAGRSTNAYVSSFPAAAPTFVRS--  434
            +++KK  A     + KR R S  G         P K+GR +N        A+P+F RS  
Sbjct  390  AKRKKGTAPGHKHSKKRGRGSGSGKAIDQSTSRPVKSGRLSN--------ASPSF-RSRN  440

Query  433  --PSHTQYP----TGLPAYPASPIY  377
              PSH Q P    TG  +Y +  +Y
Sbjct  441  PPPSH-QVPPVRYTGAHSYTSQSVY  464



>ref|XP_004287092.1| PREDICTED: FRIGIDA-like protein 4a isoform X1 [Fragaria vesca 
subsp. vesca]
Length=570

 Score =   100 bits (250),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA +L  GD + ++I+EL+  G++++A++F +E GL  +FPP+ LLK++LK++K
Sbjct  271  RRDMAKLAGALQFGD-IGDVIDELVKNGKEIEAIYFAFESGLTERFPPISLLKSYLKNSK  329

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K A+ I+++ NNS  A+  ++  EL++IRAV+KC+E++KLE+EF  + L+KR+  LE+ K
Sbjct  330  KNASTIMKNGNNSVAASEESSTLELNSIRAVIKCVEDHKLESEFTLDSLRKRVTALERAK  389

Query  586  SE  581
            ++
Sbjct  390  AD  391



>ref|XP_008227104.1| PREDICTED: FRIGIDA-like protein 1 [Prunus mume]
Length=585

 Score =   100 bits (249),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = -3

Query  928  LALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATAI  749
            L   +GLGDK+ +LI++L+S+G+ + AV F  E  L +KFPPVPLLK++LK++KK A  +
Sbjct  336  LCQKIGLGDKIADLIQKLVSKGKHLLAVKFISEFDLTDKFPPVPLLKSYLKESKKLAKKV  395

Query  748  LEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKS  584
             +D NNS ++ + A  KE  A+++V+K IE+ KLE+E+PP  L+KRL+QLEK K+
Sbjct  396  CKDGNNSRKSMNEATAKETGALKSVIKVIEDLKLESEYPPAVLQKRLEQLEKEKA  450



>ref|XP_010271588.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Nelumbo nucifera]
 ref|XP_010271594.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Nelumbo nucifera]
Length=573

 Score =   100 bits (249),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 89/150 (59%), Gaps = 18/150 (12%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+   +L  SLGL  KMP ++E LI RG+QVDAVHF     L   FPPVPLLK       
Sbjct  337  RRQTPELCRSLGLTHKMPGVVESLIIRGRQVDAVHFVQAFQLTESFPPVPLLK-------  389

Query  766  kaATAILED--PNNSGRAAHLAAK-----KELSAIRAVLKCIEEYKLEAEFPPEHLKKRL  608
                  L+D   N+ G+ A    +     +EL+A+RAV++C+EEYKLEAE+P + L+KR+
Sbjct  390  ----TYLKDLRRNSQGKGAAGGTQSDVNTQELAALRAVIRCVEEYKLEAEYPLDPLQKRV  445

Query  607  DQLEKTKSEkkkpaaaaapaaKRTRVSNGG  518
             QLEK+KSEKK+          +   +NGG
Sbjct  446  AQLEKSKSEKKRTGEVVKHQPPKKARANGG  475



>ref|XP_009766201.1| PREDICTED: FRIGIDA-like protein 4a [Nicotiana sylvestris]
Length=563

 Score =   100 bits (248),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 125/232 (54%), Gaps = 29/232 (13%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA++ G G+K+ ++IEEL+  G++V+AV+F YE GL  +FPPV LLKA+L++ +
Sbjct  270  RRDMPKLAVAFGFGNKIGDIIEELVKSGKEVEAVYFAYESGLAERFPPVSLLKAYLRNCR  329

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            + +  I +    S  A   A   E  A +A++KC+E++KLE EF  E LKKR+ +LE+++
Sbjct  330  RNSNNISKKGRFSSAAVDKANIIEWEATKAIIKCVEDHKLEQEFSLEGLKKRVTELEESR  389

Query  586  SEkkkpaa-aaapaaKRTRVSNGGPMP------PAKAGRSTNA-----------------  479
            +++KK  A     + KR R S  G         P K+GR +NA                 
Sbjct  390  AKRKKGTAPRDKHSKKRGRRSGTGKSSDPSTSRPVKSGRLSNASPSFRSRNPPPSHQVPP  449

Query  478  --YVSSFPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYSPEAA  329
              Y  +    + +   +PS   Y    PAY  +   +  ++ PQY Y+ + A
Sbjct  450  VRYTGAHSYTSQSVYEAPSTVSYA---PAYNGTHTTSPAALPPQYGYAIQEA  498



>gb|AFK43654.1| unknown [Medicago truncatula]
Length=539

 Score =   100 bits (248),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 83/122 (68%), Gaps = 0/122 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M K+A SL  GDKM ++I+EL+  G++++AV+F  E GL  +F P+ LL +++++ +
Sbjct  263  RRDMAKVAASLEFGDKMIDIIDELVKNGKEMEAVYFASESGLTERFKPIELLNSYVRNYE  322

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
                 IL+  NNS  A   A   EL++I+ V+KC+E++KLE++F  + LK+R+ QL+K K
Sbjct  323  NNVATILKSGNNSQVATDEANTLELTSIKDVIKCVEDHKLESKFRLDKLKRRVSQLDKNK  382

Query  586  SE  581
             E
Sbjct  383  FE  384



>ref|XP_003629646.1| Protein FRIGIDA [Medicago truncatula]
 ref|XP_003630808.1| Protein FRIGIDA [Medicago truncatula]
 gb|AET04122.1| frigida-LIKE protein [Medicago truncatula]
Length=539

 Score =   100 bits (248),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 83/122 (68%), Gaps = 0/122 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M K+A SL  GDKM ++I+EL+  G++++AV+F  E GL  +F P+ LL +++++ +
Sbjct  263  RRDMAKVAASLEFGDKMIDIIDELVKNGKEMEAVYFASESGLTERFKPIELLNSYVRNYE  322

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
                 IL+  NNS  A   A   EL++I+ V+KC+E++KLE++F  + LK+R+ QL+K K
Sbjct  323  NNVATILKSGNNSQVATDEANTLELTSIKDVIKCVEDHKLESKFRLDKLKRRVSQLDKNK  382

Query  586  SE  581
             E
Sbjct  383  FE  384



>ref|XP_008780981.1| PREDICTED: truncated FRIGIDA-like protein 1 [Phoenix dactylifera]
Length=496

 Score = 99.8 bits (247),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK    L  SLG  +++P+LI++L SRG+Q+D+V F Y   L+ K PPVPLLKA++ ++K
Sbjct  242  RKQTVHLCKSLGFTERIPDLIQKLNSRGKQLDSVKFVYAFNLVEKCPPVPLLKAYVMESK  301

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEK  593
            KAA  I +  NNS ++ + A  KEL A+++VLK +EEYKLEA +P E+L+K++ +LEK
Sbjct  302  KAAQEIRKKGNNSNQSQNEAISKELGALKSVLKAVEEYKLEAVYPCENLEKQIAKLEK  359



>gb|KHN16599.1| Protein FRIGIDA [Glycine soja]
Length=367

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA SL  GDK+ ++I+ELI  G++++AV+F+ E GL  +FPP+ LLK++ ++ K
Sbjct  101  RRDMAKLAASLQFGDKIIDIIDELIKNGKEIEAVYFSSESGLTERFPPIDLLKSYHRNYK  160

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKR  611
            K  +AI +  NN+      ++  EL++I+A++KC+E++KLE+EF  ++L+KR
Sbjct  161  KNVSAIFKKGNNNHATMDDSSTSELNSIKAIIKCVEDHKLESEFNLDNLRKR  212



>ref|XP_010271580.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Nelumbo nucifera]
 ref|XP_010271586.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Nelumbo nucifera]
Length=617

 Score =   100 bits (248),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 89/150 (59%), Gaps = 18/150 (12%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+   +L  SLGL  KMP ++E LI RG+QVDAVHF     L   FPPVPLLK       
Sbjct  381  RRQTPELCRSLGLTHKMPGVVESLIIRGRQVDAVHFVQAFQLTESFPPVPLLK-------  433

Query  766  kaATAILED--PNNSGRAAHLAAK-----KELSAIRAVLKCIEEYKLEAEFPPEHLKKRL  608
                  L+D   N+ G+ A    +     +EL+A+RAV++C+EEYKLEAE+P + L+KR+
Sbjct  434  ----TYLKDLRRNSQGKGAAGGTQSDVNTQELAALRAVIRCVEEYKLEAEYPLDPLQKRV  489

Query  607  DQLEKTKSEkkkpaaaaapaaKRTRVSNGG  518
             QLEK+KSEKK+          +   +NGG
Sbjct  490  AQLEKSKSEKKRTGEVVKHQPPKKARANGG  519



>ref|XP_010270166.1| PREDICTED: truncated FRIGIDA-like protein 1 [Nelumbo nucifera]
Length=519

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L  ++G  DK+P+ IE+L + G+ ++AV F +   L++KFPPVPLLKA +K +K
Sbjct  256  RRQAVDLCRAIGFSDKIPDFIEKLKNNGKHLEAVKFVFAFELVDKFPPVPLLKAHVKASK  315

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K A  I +  N+S +A + A+ KE++A++AV+K IE++KLE+E+P E L KR++Q+EK K
Sbjct  316  KVAQEIRKKGNDSIQAQNEASAKEIAALKAVIKYIEDHKLESEYPRESLDKRIEQMEKQK  375

Query  586  SE  581
            S+
Sbjct  376  SD  377



>ref|XP_008790629.1| PREDICTED: FRIGIDA-like protein 3 [Phoenix dactylifera]
Length=514

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 90/159 (57%), Gaps = 22/159 (14%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+   +L  SLGL  KMP ++E+L++RG+Q+DAVHF +   L   FPPVP          
Sbjct  332  RRQAPELCRSLGLTQKMPGVVEDLVNRGRQIDAVHFAHAFQLTESFPPVP----------  381

Query  766  kaATAILED-----PNNSGRAAHLAAKK-----ELSAIRAVLKCIEEYKLEAEFPPEHLK  617
                A LED      N +G   +  A+K     EL A++AV+KCIEEYKL+ E+P E L+
Sbjct  382  -LLQAYLEDLKNAKNNGNGDVQNKLAQKDPNAQELGALKAVIKCIEEYKLQEEYPIEPLQ  440

Query  616  KRLDQLEKTKSEkkkpaaaaapaaKRTRVSNG-GPMPPA  503
            KR+ QLEK K +KK+   +     K+ R + G  P  PA
Sbjct  441  KRIAQLEKAKDDKKRMGESVKLQTKKPRDTGGYAPRRPA  479



>ref|XP_010656337.1| PREDICTED: FRIGIDA-like protein 4a isoform X1 [Vitis vinifera]
Length=539

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 95/155 (61%), Gaps = 19/155 (12%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKM------PELIEELISRGQQVDAVHFTYEVGLINKFPPVPllka  785
            R+ M KLA++LG G+KM       ++I+EL+  G++++AV+F  E GL  +F PV LLK+
Sbjct  266  RRDMPKLAIALGFGEKMGGTCVFTDIIDELVKSGKEIEAVYFASESGLTERFSPVSLLKS  325

Query  784  flkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLD  605
            +L +++K AT IL++ N S  A   +   EL++I+ ++KC+E++KLE+EF  + L+KR  
Sbjct  326  YLHNSRKNATTILKNGNYSTAATEESGNVELNSIKTIIKCVEDHKLESEFSIDSLRKRAT  385

Query  604  QLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAK  500
            QLEK K E             R + S G   PP K
Sbjct  386  QLEKAKVE-------------RKKSSAGASKPPNK  407



>ref|XP_008787217.1| PREDICTED: FRIGIDA-like protein 3 [Phoenix dactylifera]
Length=576

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 75/128 (59%), Gaps = 19/128 (15%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+   +L  SLGL  KMP+++E+LI+RG+Q+DAVHF +   L   FPPVP          
Sbjct  299  RRQAPQLCRSLGLTQKMPDVVEDLINRGRQIDAVHFAHVFQLTESFPPVP----------  348

Query  766  kaATAILEDPNN--------SGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKR  611
                A LED  N        +G        +EL A+RAV++CI++YKL+ E+P E L+KR
Sbjct  349  -LLKAYLEDLKNAKKNGGTSTGNVQKDPNAQELGALRAVIRCIKDYKLQEEYPVEPLQKR  407

Query  610  LDQLEKTK  587
            + QLEK K
Sbjct  408  VAQLEKAK  415



>ref|XP_008366422.1| PREDICTED: FRIGIDA-like protein 2 [Malus domestica]
Length=561

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 89/121 (74%), Gaps = 2/121 (2%)
 Frame = -3

Query  943  KHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakk  764
            +   +L   +GLGDK+P+LI++L+S+G+ + AV F  E GL NKFPPVP+LK+++K++KK
Sbjct  302  RQAVELCRKIGLGDKLPDLIQKLVSKGKHLLAVKFISEFGLTNKFPPVPILKSYIKESKK  361

Query  763  aATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKS  584
             A  + +D   + ++ + A  KE  A+++V+K IE+ KLE+E+PP  L+KRL+QLEK K+
Sbjct  362  LAKKVCKD--GTRQSMNEATAKESGALKSVIKVIEDLKLESEYPPAFLQKRLEQLEKEKA  419

Query  583  E  581
            +
Sbjct  420  D  420



>ref|XP_009401034.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=562

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 97/155 (63%), Gaps = 3/155 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+   +   SLGL  K P LIE+L S+G+Q+DAVHF +   L ++FPPVPLLKA+L+D K
Sbjct  298  RRQAPEFCRSLGLTHKTPGLIEDLASKGRQIDAVHFAHAFQLTDQFPPVPLLKAYLRDLK  357

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
             A      +  ++      +A  EL AIRAV+KCIEEYKL+ E+P + L+K++ QLEK K
Sbjct  358  DAKET--NEDTSTAAVQKDSASDELGAIRAVIKCIEEYKLQEEYPLDPLQKQVAQLEKAK  415

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTN  482
            ++KK+    A    KR R S GG +P   AG   N
Sbjct  416  ADKKRGGDTAKFQPKRPRAS-GGYVPRRHAGAVNN  449



>gb|KHN44015.1| Protein FRIGIDA [Glycine soja]
Length=553

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -3

Query  931  KLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATA  752
            +L  S+GL  KMP ++E LI+ G+Q+ AVHF +   L   FPPVPLLKA+LK+ ++ +  
Sbjct  334  ELCCSIGLIHKMPVVVESLINNGKQIAAVHFIHAFQLQESFPPVPLLKAYLKNRRRNSQV  393

Query  751  ILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  581
               +  +   A + A  +ELSA+RAV+KCIEEYKLE+E+PP+ L+KR+ QLEK+K +
Sbjct  394  KTGNVRDIASAKNDANAQELSALRAVIKCIEEYKLESEYPPDTLRKRVLQLEKSKGD  450



>ref|XP_009401032.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401033.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=594

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 97/155 (63%), Gaps = 3/155 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+   +   SLGL  K P LIE+L S+G+Q+DAVHF +   L ++FPPVPLLKA+L+D K
Sbjct  330  RRQAPEFCRSLGLTHKTPGLIEDLASKGRQIDAVHFAHAFQLTDQFPPVPLLKAYLRDLK  389

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
             A      +  ++      +A  EL AIRAV+KCIEEYKL+ E+P + L+K++ QLEK K
Sbjct  390  DAKET--NEDTSTAAVQKDSASDELGAIRAVIKCIEEYKLQEEYPLDPLQKQVAQLEKAK  447

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTN  482
            ++KK+    A    KR R S GG +P   AG   N
Sbjct  448  ADKKRGGDTAKFQPKRPRAS-GGYVPRRHAGAVNN  481



>ref|XP_007211879.1| hypothetical protein PRUPE_ppa003499mg [Prunus persica]
 gb|EMJ13078.1| hypothetical protein PRUPE_ppa003499mg [Prunus persica]
Length=569

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 88/120 (73%), Gaps = 0/120 (0%)
 Frame = -3

Query  943  KHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakk  764
            +   +L   +GLGDK+ +LI++L+S+G+ + AV F  E  L +KFPPVPLLK++LK++KK
Sbjct  315  RQAIELCQKIGLGDKIADLIQKLVSKGKHLLAVKFISEFDLTDKFPPVPLLKSYLKESKK  374

Query  763  aATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKS  584
             A  + +D NNS ++ + A  KE  A+++V+K IE+ KL++++PP  L+KRL+QLEK K+
Sbjct  375  LAKKVCKDGNNSRKSMNEATAKETGALKSVIKVIEDLKLQSDYPPAVLQKRLEQLEKEKA  434



>ref|XP_009416846.1| PREDICTED: truncated FRIGIDA-like protein 1 [Musa acuminata subsp. 
malaccensis]
Length=506

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK    L  SLGL + +PELIE L ++G+Q+DAV F Y   L+ K+PPVPLLKA++K+ K
Sbjct  257  RKQAVDLCKSLGLTENVPELIERLNNKGRQLDAVKFVYAFNLVEKYPPVPLLKAYIKEIK  316

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRL  608
            KAA  +    NNS  + ++A  KEL A+R+V+K +EEYKLE+++P E L+K++
Sbjct  317  KAAQDVRNKGNNSSESENVATSKELGALRSVIKAVEEYKLESQYPREFLEKQV  369



>ref|XP_006600926.1| PREDICTED: FRIGIDA-like protein 3-like [Glycine max]
Length=553

 Score = 97.8 bits (242),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -3

Query  931  KLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATA  752
            +L  S+GL  KMP ++E LI+ G+Q+ AVHF +   L   FPPVPLLKA+LK+ ++ +  
Sbjct  334  ELCRSIGLIHKMPVVVESLINNGKQIAAVHFIHAFQLQESFPPVPLLKAYLKNRRRNSQV  393

Query  751  ILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  581
               +  +   A + A  +ELSA+RAV+KCIEEYKLE+E+PP+ L+KR+ QLEK+K +
Sbjct  394  KTGNVRDIASAKNDANAQELSALRAVIKCIEEYKLESEYPPDTLRKRVLQLEKSKGD  450



>ref|XP_003532490.1| PREDICTED: FRIGIDA-like protein 4a-like [Glycine max]
Length=520

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA SL  GDK+ ++I+ELI  G++++AV+F+ E GL  +FPP+ LLK++ ++ K
Sbjct  254  RRDMAKLAASLQFGDKIIDIIDELIKNGKEIEAVYFSSESGLTERFPPIDLLKSYHRNYK  313

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKR  611
            K  +AI +  NN+      ++  EL++I+A++KC+E++KLE+EF  ++L+KR
Sbjct  314  KNVSAIFKKGNNNHATMDDSSTSELNSIKAIIKCVEDHKLESEFNLDNLRKR  365



>ref|XP_007020622.1| FRIGIDA like 1, putative [Theobroma cacao]
 gb|EOY12147.1| FRIGIDA like 1, putative [Theobroma cacao]
Length=596

 Score = 97.4 bits (241),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = -3

Query  928  LALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATAI  749
            L  S+GLG+K+ +LI++L+  G+Q+ AV F +E GL  KFPPV LLK +LK+  K A  +
Sbjct  323  LCRSIGLGEKVHDLIQKLLDSGKQLLAVRFIFEFGLAEKFPPVHLLKEYLKETTKLAKQV  382

Query  748  LEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  581
             +D  NS ++ + A  KE+ A++AV+K I+E+KLE E+P E L+KR++QLEK +++
Sbjct  383  CKDGKNSLKSQNEATAKEIGALKAVIKVIQEHKLETEYPQEDLQKRIEQLEKQQAD  438



>ref|XP_010939086.1| PREDICTED: FRIGIDA-like protein 3 [Elaeis guineensis]
 ref|XP_010939087.1| PREDICTED: FRIGIDA-like protein 3 [Elaeis guineensis]
Length=586

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 74/125 (59%), Gaps = 16/125 (13%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+   +L  SLGL  KMP ++ +L++RG+Q+DAVHF +   L   FPPVP          
Sbjct  332  RRQAPELCHSLGLTQKMPGVVADLVNRGRQIDAVHFAHAFKLTESFPPVP----------  381

Query  766  kaATAILEDPNNSGRAAHLAAKK-----ELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQ  602
                A LED  N+ +  +   +K     EL A++AV+KCIEEYKL  E+P E L+KR+ Q
Sbjct  382  -LLIAYLEDLKNAEKNGNGDGQKDPNAQELGALKAVIKCIEEYKLREEYPIEPLQKRVAQ  440

Query  601  LEKTK  587
            LEK K
Sbjct  441  LEKAK  445



>ref|XP_010907692.1| PREDICTED: FRIGIDA-like protein 1 [Elaeis guineensis]
Length=498

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK    L  SLG  + +P+LI++L SRG+Q+D+V F Y   L  + PPVPLLKA++ ++K
Sbjct  244  RKQTVDLCKSLGFTEHIPDLIQKLNSRGKQLDSVKFVYAFNLEEQCPPVPLLKAYVMESK  303

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA  + +  NNS ++ + A  KEL A+++VL+ +EEYKLEA +P E+L+K++ +LEK K
Sbjct  304  KAAKEVRKKGNNSSQSQNEAISKELGALKSVLRAVEEYKLEAAYPRENLEKQIARLEKLK  363

Query  586  SE  581
            ++
Sbjct  364  AD  365



>ref|XP_006858746.1| PREDICTED: FRIGIDA-like protein 3 [Amborella trichopoda]
 gb|ERN20213.1| hypothetical protein AMTR_s00066p00134410 [Amborella trichopoda]
Length=544

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 121/204 (59%), Gaps = 17/204 (8%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+   +L  +LGL +KMP +IE LI+ G+Q++AV+  Y   L  +F PVPLLK +LK+ +
Sbjct  323  RRQTPELCRALGLSEKMPAVIEVLINAGRQLEAVNLAYAFDLTEQFAPVPLLKTYLKEVR  382

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K++       ++   A + A+++ELSA++AV+KCIEE+KLE ++P + L+KR+ QLEK K
Sbjct  383  KSSQG--RGGSSPAAALNEASERELSALKAVIKCIEEHKLEEQYPIDPLQKRIAQLEKAK  440

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            ++K++   A+ P +KR R +NG    P    R T             F R+P   +YP G
Sbjct  441  ADKRRAVEASKPQSKRPR-ANGISYAP----RPT--------VQEKVFYRAPE--RYPYG  485

Query  406  LPAYPASPIYTHGSMSPQYVYSPE  335
                P   +Y   ++   Y+Y+PE
Sbjct  486  TYDRPGQDLYAQSTLQRPYLYAPE  509



>ref|XP_011463627.1| PREDICTED: FRIGIDA-like protein 3 [Fragaria vesca subsp. vesca]
Length=574

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 105/199 (53%), Gaps = 21/199 (11%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+   +L  SLGL  KMP L+E +I  G+Q+DAVHF +   L   FPPVPLLK +LK+ +
Sbjct  331  RRQTPELCRSLGLTHKMPGLVESIIRIGKQIDAVHFIHAFELTESFPPVPLLKTYLKELR  390

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            + +       +++G A      KELS ++AV+ C++EYKLEAE+P + L+KRL QLE+++
Sbjct  391  RNSQG-----DSNGDAQEDVNAKELSGLKAVVGCVQEYKLEAEYPLDPLQKRLVQLERSR  445

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            ++             R R  + G        +        + +  P  + + S T    G
Sbjct  446  AD-------------RKRSGDSGKRQQLPKKQKATGRWRGY-SGGPGLLIASSPTVGRHG  491

Query  406  LPAYPASPIYTHGSMSPQY  350
             PAY   P YT   MS +Y
Sbjct  492  QPAYGERPAYT--GMSERY  508



>gb|KDO62201.1| hypothetical protein CISIN_1g009061mg [Citrus sinensis]
Length=545

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = -3

Query  928  LALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATAI  749
            L   +GLGDK+ +L+++LI  G+ + AV + +E+ L +K+PPVP+L+ ++K++ K A  I
Sbjct  280  LCKVIGLGDKVQDLVQKLIDNGKHLLAVKYVFELQLTSKYPPVPILETYVKESNKIAMKI  339

Query  748  LEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKS  584
             ED  NS ++ + A  KE+ A++AV+K IEE+KLE+E+P   L+KR++QLEK K+
Sbjct  340  CEDGKNSLKSQNEATAKEIGALKAVIKVIEEHKLESEYPKGTLEKRIEQLEKQKA  394



>ref|XP_006474949.1| PREDICTED: FRIGIDA-like protein 1-like [Citrus sinensis]
Length=545

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = -3

Query  928  LALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATAI  749
            L   +GLGDK+ +L+++LI  G+ + AV + +E+ L +K+PPVP+L+ ++K++ K A  I
Sbjct  280  LCKVIGLGDKVQDLVQKLIDNGKHLLAVKYVFELQLTSKYPPVPILETYVKESNKIAMKI  339

Query  748  LEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKS  584
             ED  NS ++ + A  KE+ A++AV+K IEE+KLE+E+P   L+KR++QLEK K+
Sbjct  340  CEDGKNSLKSQNEATAKEIGALKAVIKVIEEHKLESEYPKGTLEKRIEQLEKQKA  394



>gb|KHN41556.1| Protein FRIGIDA [Glycine soja]
Length=568

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -3

Query  931  KLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATA  752
            +L  S+GL  KMP ++E LI+ G+Q+ AVHF +   L   FPPVPLLKA+LK+ ++ +  
Sbjct  349  ELCCSIGLIHKMPAVVESLINTGKQIAAVHFIHAFQLQESFPPVPLLKAYLKNRRRNSQV  408

Query  751  ILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  581
               +  +   A + A  +EL+A+RAV+KCIEEYKLE+++PP+ L+KR+ QLEK+K +
Sbjct  409  KTGNVRDITSAKNDANAQELAALRAVIKCIEEYKLESDYPPDTLRKRVLQLEKSKGD  465



>ref|XP_003524673.1| PREDICTED: FRIGIDA-like protein 3-like isoform X1 [Glycine max]
Length=553

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -3

Query  931  KLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATA  752
            +L  S+GL  KMP ++E LI+ G+Q+ AVHF +   L   FPPVPLLKA+LK+ ++ +  
Sbjct  334  ELCCSIGLIHKMPAVVESLINTGKQIAAVHFIHAFQLQESFPPVPLLKAYLKNRRRNSQV  393

Query  751  ILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  581
               +  +   A + A  +EL+A+RAV+KCIEEYKLE+++PP+ L+KR+ QLEK+K +
Sbjct  394  KTGNVRDITSAKNDANAQELAALRAVIKCIEEYKLESDYPPDTLRKRVLQLEKSKGD  450



>gb|AIZ49836.1| ABI3-interacting protein 2, partial [Araucaria scopulorum]
 gb|AIZ49837.1| ABI3-interacting protein 2, partial [Araucaria subulata]
Length=175

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 101/158 (64%), Gaps = 6/158 (4%)
 Frame = -3

Query  853  DAVHFTYEVGLINKFPPVPllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAV  674
            +AV+F +   LI KFPPVPLLK +LKDAKKA+ A ++  NNS  A + A  KELSA+RAV
Sbjct  1    EAVNFAFAFELIEKFPPVPLLKEYLKDAKKASQASIKSGNNSTAAQNEANTKELSALRAV  60

Query  673  LKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP----MPP  506
            +KCIEE+KLE+++ P+ L+KR+ QLEK K+++K+ A A     KR R +NGG     + P
Sbjct  61   IKCIEEHKLESQYSPDSLQKRVAQLEKAKADRKRSAGAVKSQPKRPR-ANGGNVGAYVAP  119

Query  505  AKAGRSTNAYVSSFPAAAPTFVRSPSHTQYP-TGLPAY  395
              A   T A  +S  AA  +F R     QY   G+ +Y
Sbjct  120  LSAPERTPAMYASSNAADRSFYRPVERVQYSGAGVASY  157



>ref|XP_008786398.1| PREDICTED: FRIGIDA-like protein 4a [Phoenix dactylifera]
Length=486

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 101/148 (68%), Gaps = 1/148 (1%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK M KLA  LG G+K+ ++I+EL   G++++AV+F +E GL  +F P  LLK++L+ ++
Sbjct  273  RKEMGKLAPGLGFGEKLADIIDELAKNGKELEAVYFAHEAGLTERFSPASLLKSYLQSSR  332

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K A A+++  N+S  A   A+  E+S +R+++KC+E   LE++F  + LKKRL Q+EK K
Sbjct  333  KKANAMVKSGNHSAAATEEASAAEMSDLRSIIKCVESCHLESKFSVDGLKKRLAQMEKVK  392

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPA  503
            +++KK AAA     KRTR S GG  PP+
Sbjct  393  ADRKKSAAARKTQGKRTR-STGGTGPPS  419



>gb|AIZ49835.1| ABI3-interacting protein 2, partial [Araucaria scopulorum]
Length=174

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 101/158 (64%), Gaps = 6/158 (4%)
 Frame = -3

Query  853  DAVHFTYEVGLINKFPPVPllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAV  674
            +AV+F +   LI KFPPVPLLK +LKDAKKA+ A ++  NNS  A + A  KELSA+RAV
Sbjct  1    EAVNFAFAFELIEKFPPVPLLKEYLKDAKKASQASIKSGNNSTAAQNEANTKELSALRAV  60

Query  673  LKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP----MPP  506
            +KCIEE+KLE+++ P+ L+KR+ QLEK K+++K+ A A     KR R +NGG     + P
Sbjct  61   IKCIEEHKLESQYSPDSLQKRVAQLEKAKADRKRSAGAVKSQPKRPR-ANGGNVGAYVAP  119

Query  505  AKAGRSTNAYVSSFPAAAPTFVRSPSHTQYP-TGLPAY  395
              A   T A  +S  AA  +F R     QY   G+ +Y
Sbjct  120  LSAPERTPAMYASSNAADRSFYRPVERVQYSGAGVASY  157



>gb|AIZ49823.1| ABI3-interacting protein 2, partial [Araucaria humboldtensis]
 gb|AIZ49824.1| ABI3-interacting protein 2, partial [Araucaria laubenfelsii]
Length=172

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 101/158 (64%), Gaps = 6/158 (4%)
 Frame = -3

Query  853  DAVHFTYEVGLINKFPPVPllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAV  674
            +AV+F +   LI KFPPVPLLK +LKDAKKA+ A ++  NNS  A + A  KELSA+RAV
Sbjct  1    EAVNFAFAFELIEKFPPVPLLKEYLKDAKKASQASIKSGNNSTAAQNEANTKELSALRAV  60

Query  673  LKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP----MPP  506
            +KCIEE+KLE+++ P+ L+KR+ QLEK K+++K+ A A     KR R +NGG     + P
Sbjct  61   IKCIEEHKLESQYSPDSLQKRVAQLEKAKADRKRSAGAVKSQPKRPR-ANGGNVGAYVAP  119

Query  505  AKAGRSTNAYVSSFPAAAPTFVRSPSHTQYP-TGLPAY  395
              A   T A  +S  AA  +F R     QY   G+ +Y
Sbjct  120  LSAPERTPAMYASSNAADRSFYRPVERVQYSGAGVASY  157



>ref|XP_004242450.1| PREDICTED: FRIGIDA-like protein 3 [Solanum lycopersicum]
 ref|XP_010323105.1| PREDICTED: FRIGIDA-like protein 3 [Solanum lycopersicum]
Length=545

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 117/205 (57%), Gaps = 26/205 (13%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L  SLGL D+MP +I+ LI+ G+ +DAV+  +   L  +FPPV LLK++L +A 
Sbjct  333  RRQTADLCRSLGLSDRMPGVIDVLINNGRHIDAVNLAFAFELTEQFPPVSLLKSYLNEAS  392

Query  766  kaATAILEDPNNSGRAA----HLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQL  599
            KA+T     P+NSG A+    +   +KELSA++AVLKCIE++KLE ++  + L+KR+ QL
Sbjct  393  KAST-----PSNSGNASPTVQNDVNEKELSALKAVLKCIEDHKLEEQYLVDPLQKRVHQL  447

Query  598  EKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAG--------RSTNAY---VSSFPAAA  452
            EK KS+KKK      P +KR R +  G  P             R T+ Y   V   P A 
Sbjct  448  EKAKSDKKKATEVTKPQSKRPRPNGVGNGPRVNNVVTEKNFYPRMTDRYPQPVYDGPYAY  507

Query  451  PTFVRSPSHTQYPT--GLPAYPASP  383
            P     P++T  P+  G PAY  SP
Sbjct  508  P----GPTNTHVPSFIGAPAYNFSP  528



>gb|AIZ49833.1| ABI3-interacting protein 2, partial [Araucaria rulei]
Length=178

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 101/158 (64%), Gaps = 6/158 (4%)
 Frame = -3

Query  853  DAVHFTYEVGLINKFPPVPllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAV  674
            +AV+F +   LI KFPPVPLLK +LKDAKKA+ A ++  NNS  A + A  KELSA+RAV
Sbjct  1    EAVNFAFAFELIEKFPPVPLLKEYLKDAKKASQASIKSGNNSTAAQNEANTKELSALRAV  60

Query  673  LKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP----MPP  506
            +KCIEE+KLE+++ P+ L+KR+ QLEK K+++K+ A A     KR R +NGG     + P
Sbjct  61   IKCIEEHKLESQYSPDSLQKRVAQLEKAKADRKRSAGAVKSQPKRPR-ANGGNVGAYVAP  119

Query  505  AKAGRSTNAYVSSFPAAAPTFVRSPSHTQYP-TGLPAY  395
              A   T A  +S  AA  +F R     QY   G+ +Y
Sbjct  120  LSAPERTPAMYASSNAADRSFYRPVERVQYSGAGVASY  157



>gb|AIZ49820.1| ABI3-interacting protein 2, partial [Araucaria muelleri]
 gb|AIZ49828.1| ABI3-interacting protein 2, partial [Araucaria montana]
 gb|AIZ49838.1| ABI3-interacting protein 2, partial [Araucaria subulata]
Length=176

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 101/158 (64%), Gaps = 6/158 (4%)
 Frame = -3

Query  853  DAVHFTYEVGLINKFPPVPllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAV  674
            +AV+F +   LI KFPPVPLLK +LKDAKKA+ A ++  NNS  A + A  KELSA+RAV
Sbjct  1    EAVNFAFAFELIEKFPPVPLLKEYLKDAKKASQASIKSGNNSTAAQNEANTKELSALRAV  60

Query  673  LKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP----MPP  506
            +KCIEE+KLE+++ P+ L+KR+ QLEK K+++K+ A A     KR R +NGG     + P
Sbjct  61   IKCIEEHKLESQYSPDSLQKRVAQLEKAKADRKRSAGAVKSQPKRPR-ANGGNVGAYVAP  119

Query  505  AKAGRSTNAYVSSFPAAAPTFVRSPSHTQYP-TGLPAY  395
              A   T A  +S  AA  +F R     QY   G+ +Y
Sbjct  120  LSAPERTPAMYASSNAADRSFYRPVERVQYSGAGVASY  157



>gb|KHN41626.1| Protein FRIGIDA [Glycine soja]
Length=296

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA SL  GDK+ ++I+ELI  G++++AV+F  E GL  +FPP+ LLK++ ++ K
Sbjct  30   RRDMAKLAASLQFGDKIIDIIDELIKNGKEIEAVYFASESGLTERFPPIDLLKSYHRNYK  89

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKK  614
            K  +  L+  NN+      ++  EL++I+A++KC+E++KLE+EF  ++L+K
Sbjct  90   KNVSTALKKGNNNRATTDDSSTSELNSIKAIIKCVEDHKLESEFNLDNLRK  140



>gb|AIZ49839.1| ABI3-interacting protein 2, partial [Araucaria columnaris]
Length=168

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 101/158 (64%), Gaps = 6/158 (4%)
 Frame = -3

Query  853  DAVHFTYEVGLINKFPPVPllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAV  674
            +AV+F +   LI KFPPVPLLK +LKDAKKA+ A ++  NNS  A + A  KELSA+RAV
Sbjct  1    EAVNFAFAFELIEKFPPVPLLKEYLKDAKKASQASIKSGNNSTAAQNEANTKELSALRAV  60

Query  673  LKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP----MPP  506
            +KCIEE+KLE+++ P+ L+KR+ QLEK K+++K+ A A     KR R +NGG     + P
Sbjct  61   IKCIEEHKLESQYSPDSLQKRVAQLEKAKADRKRSAGAVKSQPKRPR-ANGGNVGAYVAP  119

Query  505  AKAGRSTNAYVSSFPAAAPTFVRSPSHTQYP-TGLPAY  395
              A   T A  +S  AA  +F R     QY   G+ +Y
Sbjct  120  LSAPERTPAMYASSNAADRSFYRPVERVQYSGAGVASY  157



>gb|AIZ49814.1| ABI3-interacting protein 2, partial [Araucaria bernieri]
 gb|AIZ49815.1| ABI3-interacting protein 2, partial [Araucaria bernieri]
 gb|AIZ49816.1| ABI3-interacting protein 2, partial [Araucaria biramulata]
 gb|AIZ49818.1| ABI3-interacting protein 2, partial [Araucaria columnaris]
 gb|AIZ49819.1| ABI3-interacting protein 2, partial [Araucaria columnaris]
 gb|AIZ49821.1| ABI3-interacting protein 2, partial [Araucaria heterophylla]
 gb|AIZ49822.1| ABI3-interacting protein 2, partial [Araucaria humboldtensis]
 gb|AIZ49825.1| ABI3-interacting protein 2, partial [Araucaria laubenfelsii]
 gb|AIZ49826.1| ABI3-interacting protein 2, partial [Araucaria luxurians]
 gb|AIZ49829.1| ABI3-interacting protein 2, partial [Araucaria muelleri]
 gb|AIZ49830.1| ABI3-interacting protein 2, partial [Araucaria nemorosa]
 gb|AIZ49831.1| ABI3-interacting protein 2, partial [Araucaria nemorosa]
 gb|AIZ49832.1| ABI3-interacting protein 2, partial [Araucaria rulei]
 gb|AIZ49834.1| ABI3-interacting protein 2, partial [Araucaria schmidii]
Length=182

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 101/158 (64%), Gaps = 6/158 (4%)
 Frame = -3

Query  853  DAVHFTYEVGLINKFPPVPllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAV  674
            +AV+F +   LI KFPPVPLLK +LKDAKKA+ A ++  NNS  A + A  KELSA+RAV
Sbjct  1    EAVNFAFAFELIEKFPPVPLLKEYLKDAKKASQASIKSGNNSTAAQNEANTKELSALRAV  60

Query  673  LKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP----MPP  506
            +KCIEE+KLE+++ P+ L+KR+ QLEK K+++K+ A A     KR R +NGG     + P
Sbjct  61   IKCIEEHKLESQYSPDSLQKRVAQLEKAKADRKRSAGAVKSQPKRPR-ANGGNVGAYVAP  119

Query  505  AKAGRSTNAYVSSFPAAAPTFVRSPSHTQYP-TGLPAY  395
              A   T A  +S  AA  +F R     QY   G+ +Y
Sbjct  120  LSAPERTPAMYASSNAADRSFYRPVERVQYSGAGVASY  157



>ref|XP_010088834.1| hypothetical protein L484_020817 [Morus notabilis]
 gb|EXB37031.1| hypothetical protein L484_020817 [Morus notabilis]
Length=541

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 73/209 (35%), Positives = 119/209 (57%), Gaps = 28/209 (13%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA  L   +KM ++I+EL+  G++++A++   E GL  +F PV LLK+FL+++K
Sbjct  268  RRDMAKLAAQLESKEKMEDIIDELVKNGKEIEAIYLASESGLTERFSPVALLKSFLQNSK  327

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K A+ IL++ NN+  A   +   EL++IRA++KC+E++KLE+EF  ++L+KR   +EK K
Sbjct  328  KNASNILKNGNNNLSAMEESNNLELNSIRAIIKCVEDHKLESEFSVDNLRKRATHIEKAK  387

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMP---------PAKAGRSTNAYVSSFPAAAPTFVR-  437
            +E+KK +A ++    +   S               PAKA + +NAY        P+F R 
Sbjct  388  AERKKSSAGSSKTQNKRGYSGASGGRGGGGSSSSRPAKAAKYSNAY--------PSFSRR  439

Query  436  ---------SPSHTQYPTGLPAYPASPIY  377
                     SP   +Y +G   YP   +Y
Sbjct  440  NGNPPPARSSPVIARY-SGPHNYPVQSVY  467



>ref|XP_006452513.1| hypothetical protein CICLE_v10007929mg [Citrus clementina]
 gb|ESR65753.1| hypothetical protein CICLE_v10007929mg [Citrus clementina]
Length=545

 Score = 94.4 bits (233),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = -3

Query  928  LALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATAI  749
            L   +GLGDK+ +L+++LI  G+ + AV + +E+ L +K+PPVP+L+ ++K++ K A  I
Sbjct  280  LCKVIGLGDKVQDLVQKLIDNGKHLLAVKYVFELQLTSKYPPVPILETYVKESNKIAMKI  339

Query  748  LEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKS  584
             ED  NS ++ + A  KE+ A++AV+K IEE KLE+E+P   L+KR++QLEK K+
Sbjct  340  CEDGKNSLKSQNEATAKEIGALKAVIKVIEERKLESEYPKGTLEKRIEQLEKQKA  394



>emb|CBI23332.3| unnamed protein product [Vitis vinifera]
Length=218

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 104/155 (67%), Gaps = 6/155 (4%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L  SLGL +KMP +IE LI+ G+Q+DAV+  +   L  +F PVPLLK++LK+A+
Sbjct  5    RRQTADLCRSLGLSEKMPGVIEILINSGRQIDAVNLAFAFELTEQFSPVPLLKSYLKEAR  64

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA++  L+  N S  A +   ++EL+A++AV+KCIE++KLE E+P + L+KR+ QLEK K
Sbjct  65   KASSP-LKPGNASPTAQNEVNERELTALKAVIKCIEDHKLEEEYPLDPLQKRVVQLEKAK  123

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTN  482
            ++KK+   AA P  KR R +  G  P     R+TN
Sbjct  124  ADKKRATEAAKPQPKRPRANGVGYGP-----RATN  153



>ref|XP_009358937.1| PREDICTED: FRIGIDA-like protein 3 [Pyrus x bretschneideri]
 ref|XP_009358938.1| PREDICTED: FRIGIDA-like protein 3 [Pyrus x bretschneideri]
Length=538

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 82/201 (41%), Positives = 119/201 (59%), Gaps = 18/201 (9%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L  SLGL ++MP +IE L++ G+Q+DAV+  +   L  KFPPVPLLK++LK+A+
Sbjct  333  RRQAADLCRSLGLTERMPGVIEVLVNSGRQIDAVNLAFAFELTEKFPPVPLLKSYLKEAR  392

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K  T+ ++  N S  A +    +EL+A++AVLK IEE+KLE ++P + L+KR+ QLEK K
Sbjct  393  K--TSTVKSGNASPTAQNEVNDRELAALKAVLKSIEEHKLEEQYPVDPLQKRVLQLEKAK  450

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            ++KK+ A A+ P  KR R +  G  P     R TNA       A  TF    +  +YP  
Sbjct  451  ADKKRVAEASKPQPKRPRANGVGYAP-----RVTNA------VADKTFYPRVAENRYPQY  499

Query  406  LP----AYPASPIYTHGSMSP  356
            +      YP  P   H +MSP
Sbjct  500  VYDRQFVYPG-PADNHYNMSP  519



>ref|XP_008462976.1| PREDICTED: FRIGIDA-like protein 1 [Cucumis melo]
Length=576

 Score = 93.6 bits (231),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = -3

Query  943  KHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakk  764
            +   KL   +GLGDK+ +L+++L+ +G+Q+ AV F +E  L  KF PVP+LK ++K++KK
Sbjct  254  RQATKLCKVVGLGDKVGDLVQKLLDKGKQLLAVKFIFEFELTEKFSPVPILKDYVKESKK  313

Query  763  aATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKS  584
            AA A+ ++  NS RA + A  KE+ A+++V++ IEEYKL++++P  +L+KR++QLEK ++
Sbjct  314  AAKAVSKEGKNSLRALNEATAKEVGALKSVIRLIEEYKLDSDYPRVNLEKRIEQLEKQQA  373



>emb|CBI33736.3| unnamed protein product [Vitis vinifera]
Length=326

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 94/143 (66%), Gaps = 0/143 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+   +L  SLGL  KMP +IE L++ G+Q+DAVHF +   L  +FPPVPLLK +LKD +
Sbjct  156  RRQAPELCRSLGLTHKMPGVIEVLVNGGRQIDAVHFVHAFELTERFPPVPLLKTYLKDLR  215

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            + +     +   +G     A  +EL+A++AV++C+EEYKLEA++  + L+KR+ QLEK+K
Sbjct  216  RNSQGKGGNMGGAGGGLGDANAQELAALKAVIRCVEEYKLEADYALDPLQKRVAQLEKSK  275

Query  586  SEkkkpaaaaapaaKRTRVSNGG  518
            ++KK+   A      + + +NGG
Sbjct  276  ADKKRMGEAGKYQQPKKQRANGG  298



>ref|XP_010938943.1| PREDICTED: truncated FRIGIDA-like protein 1 [Elaeis guineensis]
Length=513

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK    L  SLG+ + M +LI  L S+G+Q+DAV F + + L++K+PPVP+LKA+LK++K
Sbjct  239  RKQALDLCKSLGVMENMADLIGGLNSKGRQLDAVKFIHALNLMDKYPPVPILKAYLKESK  298

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA  + +  NNS ++ + A  KEL+A++AV+  I+EYKLE+E+  E LKKR+ QLE+ K
Sbjct  299  KAAQEVRKKGNNSIKSQNEAIVKELAALKAVIGAIKEYKLESEYSCETLKKRIAQLEQQK  358

Query  586  S  584
            +
Sbjct  359  A  359



>ref|XP_006829297.1| PREDICTED: FRIGIDA-like protein 3 [Amborella trichopoda]
 gb|ERM96713.1| hypothetical protein AMTR_s00001p00273060 [Amborella trichopoda]
Length=578

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 87/128 (68%), Gaps = 13/128 (10%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+H  +L  SLGL  KMP LIE LI   +Q++AV+F     L  +FPPVPLLK++LKDAK
Sbjct  329  RRHTPELCRSLGLAYKMPGLIESLIISKKQIEAVNFAQAFNLTERFPPVPLLKSYLKDAK  388

Query  766  kaATAILEDPN-NSGRAAHLAAKK-----ELSAIRAVLKCIEEYKLEAEFPPEHLKKRLD  605
                   +DP  N+G A+  +++K     EL A+RAV++CIEE+KLE ++P E L+KR++
Sbjct  389  -------KDPQGNNGNASAASSQKDANSRELVALRAVIRCIEEHKLEEQYPLEQLQKRVN  441

Query  604  QLEKTKSE  581
             LEK K++
Sbjct  442  NLEKAKAQ  449



>ref|XP_012070966.1| PREDICTED: FRIGIDA-like protein 1 [Jatropha curcas]
 gb|KDP39236.1| hypothetical protein JCGZ_00993 [Jatropha curcas]
Length=562

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = -3

Query  943  KHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakk  764
            K    L  ++GLGDK+ +LI++LI  G+ + AV F +E GL +KF PV LLK +LKD  +
Sbjct  286  KQATSLCRAIGLGDKIADLIQKLIENGKHLLAVRFAFEFGLTDKFEPVSLLKDYLKDCNE  345

Query  763  aATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKS  584
             +  I  D  NS +A + A  +E++A+++VLK ++EYKLE+E+P   L+KR++ LEK K+
Sbjct  346  LSKKICMDTKNSIKAQNEARSREVNALKSVLKVVDEYKLESEYPRPELEKRIETLEKQKA  405



>ref|XP_006426018.1| hypothetical protein CICLE_v10025275mg [Citrus clementina]
 gb|ESR39258.1| hypothetical protein CICLE_v10025275mg [Citrus clementina]
Length=418

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 106/196 (54%), Gaps = 14/196 (7%)
 Frame = -3

Query  931  KLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATA  752
            +L  SLGL  K+P +IE L++  +Q+DAVH  +   L   FPPVPLLK +LKD ++ +  
Sbjct  183  ELCHSLGLAHKVPGIIEILVNNAKQIDAVHLIHAFQLTENFPPVPLLKTYLKDLRRNSQG  242

Query  751  ILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkk  572
               +   +  A + A  +EL+A++AV+ CIE YKLEAE+P + L+KR+ QLE++KS+KK+
Sbjct  243  KGGNSGGATGAQNDANAQELAALKAVISCIERYKLEAEYPLDPLQKRVAQLERSKSDKKR  302

Query  571  paaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYP  392
                +     +   +NGG     +  R++    +S   A P +              AY 
Sbjct  303  GRDFSKHQQSKKHRANGG----YRGFRASGGNAASSRQAPPVYADR----------TAYG  348

Query  391  ASPIYTHGSMSPQYVY  344
            A P   H + S  Y Y
Sbjct  349  AMPARYHQAASNHYDY  364



>ref|XP_002283922.2| PREDICTED: FRIGIDA-like protein 3 [Vitis vinifera]
Length=577

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 94/143 (66%), Gaps = 0/143 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+   +L  SLGL  KMP +IE L++ G+Q+DAVHF +   L  +FPPVPLLK +LKD +
Sbjct  334  RRQAPELCRSLGLTHKMPGVIEVLVNGGRQIDAVHFVHAFELTERFPPVPLLKTYLKDLR  393

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            + +     +   +G     A  +EL+A++AV++C+EEYKLEA++  + L+KR+ QLEK+K
Sbjct  394  RNSQGKGGNMGGAGGGLGDANAQELAALKAVIRCVEEYKLEADYALDPLQKRVAQLEKSK  453

Query  586  SEkkkpaaaaapaaKRTRVSNGG  518
            ++KK+   A      + + +NGG
Sbjct  454  ADKKRMGEAGKYQQPKKQRANGG  476



>ref|XP_008458098.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Cucumis melo]
Length=638

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 86/122 (70%), Gaps = 1/122 (1%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L  SLGL DKMP +IE L++ G+Q+DAV+  +   L  +F PVPLLK++LK+AK
Sbjct  422  RRQAADLCRSLGLSDKMPGVIEVLVNSGRQIDAVNLAFAFELTQEFSPVPLLKSYLKEAK  481

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K ++ +    N S  A +  + +EL+A++AV+KCIEE+KLE ++P + L+KR+ QLEK K
Sbjct  482  KVSSPV-RSGNTSQTAQNDVSDRELTALKAVIKCIEEHKLEEQYPVDPLQKRVIQLEKAK  540

Query  586  SE  581
            ++
Sbjct  541  AD  542



>ref|XP_003525267.2| PREDICTED: FRIGIDA-like protein 4a-like [Glycine max]
Length=520

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M KLA SL  GDK+ ++I+ELI  G++++AV+F  E GL  +FPP+ LLK++ ++ K
Sbjct  254  RRDMAKLAASLQFGDKIIDIIDELIKNGKEIEAVYFASESGLTERFPPIDLLKSYHRNYK  313

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKK  614
            K  +  L+  NN+      ++  EL++I+A++KC+E++KLE+EF  ++L+K
Sbjct  314  KNVSTALKKGNNNRATTDDSSTSELNSIKAIIKCVEDHKLESEFNLDNLRK  364



>ref|XP_008458100.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Cucumis melo]
Length=549

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 86/122 (70%), Gaps = 1/122 (1%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L  SLGL DKMP +IE L++ G+Q+DAV+  +   L  +F PVPLLK++LK+AK
Sbjct  333  RRQAADLCRSLGLSDKMPGVIEVLVNSGRQIDAVNLAFAFELTQEFSPVPLLKSYLKEAK  392

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K ++ +    N S  A +  + +EL+A++AV+KCIEE+KLE ++P + L+KR+ QLEK K
Sbjct  393  KVSSPV-RSGNTSQTAQNDVSDRELTALKAVIKCIEEHKLEEQYPVDPLQKRVIQLEKAK  451

Query  586  SE  581
            ++
Sbjct  452  AD  453



>emb|CDY05684.1| BnaC02g38530D [Brassica napus]
Length=517

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 93/169 (55%), Gaps = 10/169 (6%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+   +L  SLGL +KMP +IE L++ G+Q+DAV+  +  GL  KFPPV LLK +L +  
Sbjct  312  RRQAAELCRSLGLSEKMPGVIEVLVNSGKQIDAVNLAFAFGLTEKFPPVELLKCYLTE--  369

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
                A       +   A   +++EL+ ++AV+KC+EE+ LE ++P E L KR+ QLEK K
Sbjct  370  ----ATRSSSQGNASPADEFSERELTGLKAVIKCVEEHNLEEQYPVEPLHKRILQLEKAK  425

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFV  440
            +EKK+      P  KR R    GP P      +   Y    P   P +V
Sbjct  426  AEKKRATEPTKPQTKRPR----GPQPRVTENNNKTGYGRVIPERYPQYV  470



>ref|XP_011659218.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Cucumis sativus]
Length=593

 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 86/122 (70%), Gaps = 1/122 (1%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L  SLGL DKMP +IE L++ G+Q+DAV+  +   +  +F PVPLLK++LK+AK
Sbjct  376  RRQAADLCRSLGLSDKMPGVIEVLVNSGRQIDAVNLAFAFEITQQFSPVPLLKSYLKEAK  435

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K ++ +    N S  A +  + +EL+A++AV+KCIEE+KLE ++P + L+KR+ QLEK K
Sbjct  436  KVSSPV-RSGNTSQTAQNDVSDRELTALKAVIKCIEEHKLEEQYPVDPLQKRVIQLEKAK  494

Query  586  SE  581
            ++
Sbjct  495  AD  496



>ref|XP_010251408.1| PREDICTED: FRIGIDA-like protein 3 [Nelumbo nucifera]
 ref|XP_010251409.1| PREDICTED: FRIGIDA-like protein 3 [Nelumbo nucifera]
Length=545

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 106/166 (64%), Gaps = 6/166 (4%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M  L  SLGL +KMP +IE L++ G+ +DAV+  Y   L  +F PV LLK +LK+A+
Sbjct  334  RRQMADLCRSLGLSEKMPGVIEVLLNSGRHIDAVNLAYAFELTGQFSPVTLLKNYLKEAR  393

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA++ + +  N S  A +   ++ELSA++AV+KCIE++KLE ++P + L KR+ QLEK K
Sbjct  394  KASSPV-KPGNTSPTAQNEVNERELSALKAVIKCIEDHKLEEQYPVDPLHKRVAQLEKAK  452

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAP  449
            ++KK+ A  A P +KR R + GG  P     R TN    SF   AP
Sbjct  453  ADKKRVAETAKPQSKRPRANGGGYGP-----RVTNFPDKSFYTRAP  493



>emb|CDY48750.1| BnaA02g30110D [Brassica napus]
Length=527

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 113/216 (52%), Gaps = 28/216 (13%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+   +L  SLGL +KMP +IE L+  G+Q+DAV+  +  GL  KFPPV LLK +L +  
Sbjct  312  RRQAAELCRSLGLSEKMPGVIEVLVDSGKQIDAVNLAFAFGLTEKFPPVELLKCYLTETS  371

Query  766  kaAT---------AILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKK  614
            ++++         AI+  P           ++EL+ ++AV+KC+EE+ LE ++P E L K
Sbjct  372  RSSSQGNASPAVQAIICVPMQDD-----FNERELTGLKAVIKCVEEHNLEEQYPVEPLHK  426

Query  613  RLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRS  434
            R+ QLEKTK+EKK+      P  KR R    GP P      +   Y    P   P ++  
Sbjct  427  RILQLEKTKAEKKRATEPTKPQTKRPR----GPQPRVTDNNNKTGYGRVIPERYPQYLY-  481

Query  433  PSHTQYPTGLPAYPASPIYTHGSMSPQ-YVYSPEAA  329
              + Q+ +G       PI    +  PQ Y +SP AA
Sbjct  482  -DNRQFLSG-------PIMAAQAPPPQTYTFSPAAA  509



>ref|XP_003608453.1| ABI3-interacting protein, partial [Medicago truncatula]
Length=230

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = -3

Query  931  KLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATA  752
            +L  S+GL  K+P LIE LI+ G+ + AVHF     L   FPPVPLL+ +LK+ ++ +  
Sbjct  12   ELCRSIGLTHKVPALIEALINNGKHIAAVHFVQLFKLQESFPPVPLLRTYLKNQRRNSQV  71

Query  751  ILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  581
              ++  +   A   A  +EL+A+R V+KCIEEY+ E+E+P + L KR+ QLEK K+E
Sbjct  72   KADNVRDIATAKIDANAQELAALRNVIKCIEEYEFESEYPLDTLHKRVHQLEKAKTE  128



>ref|XP_001752883.1| predicted protein [Physcomitrella patens]
 gb|EDQ82387.1| predicted protein, partial [Physcomitrella patens]
Length=436

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 97/140 (69%), Gaps = 0/140 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L  SLGL  K+P++++ L   G+Q++A+ F +  G++++  P+PLLKA+LK+A+
Sbjct  297  RRQTPALCRSLGLTAKIPDVVDRLAKEGKQIEALSFAHSFGIMDRVLPIPLLKAYLKEAR  356

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            + A +IL+  ++S  A + A  KEL+A++AVLKCIEEY+LE+++P   L+KR+  LEK K
Sbjct  357  RTAQSILKSGSSSAAAQNDATMKELAALKAVLKCIEEYQLESQYPSMPLQKRVLHLEKAK  416

Query  586  SEkkkpaaaaapaaKRTRVS  527
            S++K+ A A     KR R S
Sbjct  417  SDRKRAAVAVKAQTKRPRAS  436



>ref|XP_004149315.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Cucumis sativus]
 gb|KGN44673.1| hypothetical protein Csa_7G368740 [Cucumis sativus]
Length=550

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 86/122 (70%), Gaps = 1/122 (1%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L  SLGL DKMP +IE L++ G+Q+DAV+  +   +  +F PVPLLK++LK+AK
Sbjct  333  RRQAADLCRSLGLSDKMPGVIEVLVNSGRQIDAVNLAFAFEITQQFSPVPLLKSYLKEAK  392

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K ++ +    N S  A +  + +EL+A++AV+KCIEE+KLE ++P + L+KR+ QLEK K
Sbjct  393  KVSSPV-RSGNTSQTAQNDVSDRELTALKAVIKCIEEHKLEEQYPVDPLQKRVIQLEKAK  451

Query  586  SE  581
            ++
Sbjct  452  AD  453



>ref|XP_006366815.1| PREDICTED: FRIGIDA-like protein 3-like isoform X1 [Solanum tuberosum]
 ref|XP_006366816.1| PREDICTED: FRIGIDA-like protein 3-like isoform X2 [Solanum tuberosum]
Length=545

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 114/201 (57%), Gaps = 18/201 (9%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L  SLGL D+MP +I+ LI+ G+ +DAV+  +   L  +FPPV LLK++L +A 
Sbjct  333  RRQTADLCRSLGLSDRMPGVIDVLINNGRHIDAVNLAFAFELTEQFPPVSLLKSYLNEAS  392

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA+T +L   N S    +   +KELSA++AVLKCIE++KLE ++  + L+KR+ QLEK K
Sbjct  393  KAST-LLNSGNASPTVQNDVNEKELSALKAVLKCIEDHKLEEQYLVDPLQKRVHQLEKVK  451

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAG--------RSTNAY---VSSFPAAAPTFV  440
            ++KKK    A P +KR R +  G  P             R T+ Y   V   P A P   
Sbjct  452  ADKKKATEVAKPQSKRPRPNGVGNGPRVNNVVTEKNFYPRMTDRYPQPVYDRPYAYP---  508

Query  439  RSPSHTQYPT--GLPAYPASP  383
              P+ T  P+  G PAY  SP
Sbjct  509  -GPTSTHVPSFMGAPAYNFSP  528



>ref|XP_011010336.1| PREDICTED: FRIGIDA-like protein 3 [Populus euphratica]
 ref|XP_011010338.1| PREDICTED: FRIGIDA-like protein 3 [Populus euphratica]
 ref|XP_011010339.1| PREDICTED: FRIGIDA-like protein 3 [Populus euphratica]
 ref|XP_011010340.1| PREDICTED: FRIGIDA-like protein 3 [Populus euphratica]
Length=545

 Score = 91.3 bits (225),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 104/171 (61%), Gaps = 4/171 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+   +L   LGL +KMP +IE L++ G+Q+DAV+  +   L  +F PVPLLK++LK+A+
Sbjct  330  RRQAAELCRFLGLSEKMPGVIEVLVNSGRQIDAVNLAFAFDLTERFSPVPLLKSYLKEAR  389

Query  766  kaATAILEDPNNSG--RAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEK  593
            K  +++   P N+      +   ++EL+A++AV+KCIEE+KLE ++P + L+KRL QLEK
Sbjct  390  KVTSSV--KPGNASPITGQNEVNERELAALKAVIKCIEEHKLEEQYPEDPLQKRLLQLEK  447

Query  592  TKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFV  440
             K+EKK+   AA P  KR R S  G  P    G     +    P   P +V
Sbjct  448  AKAEKKRATEAAKPQPKRPRASGVGCGPRITNGAPERTFYPIVPDRYPQYV  498



>gb|KDO79035.1| hypothetical protein CISIN_1g008359mg [Citrus sinensis]
 gb|KDO79036.1| hypothetical protein CISIN_1g008359mg [Citrus sinensis]
 gb|KDO79037.1| hypothetical protein CISIN_1g008359mg [Citrus sinensis]
Length=568

 Score = 91.3 bits (225),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 106/196 (54%), Gaps = 14/196 (7%)
 Frame = -3

Query  931  KLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATA  752
            +L  SLGL  K+P +IE L++  +Q+DAVH  +   L   FPPVPLLK +LKD ++ +  
Sbjct  333  ELCHSLGLAHKVPGIIEILVNNAKQIDAVHLIHAFQLTENFPPVPLLKTYLKDLRRNSQG  392

Query  751  ILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkk  572
               +   +  A + A  +EL+A++AV+ CIE YKLEAE+P + L+KR+ QLE++KS+KK+
Sbjct  393  KGGNSGGATGAQNDANAQELAALKAVISCIERYKLEAEYPLDPLQKRVAQLERSKSDKKR  452

Query  571  paaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYP  392
                +     +   +NGG     +  R++    +S   A P +              AY 
Sbjct  453  GRDFSKHQQSKKHRANGG----YRGFRASGGNAASSRQAPPVYADR----------TAYG  498

Query  391  ASPIYTHGSMSPQYVY  344
            A P   H + S  Y Y
Sbjct  499  AMPARYHQAASNHYDY  514



>ref|XP_006426019.1| hypothetical protein CICLE_v10025275mg [Citrus clementina]
 ref|XP_006426020.1| hypothetical protein CICLE_v10025275mg [Citrus clementina]
 gb|ESR39259.1| hypothetical protein CICLE_v10025275mg [Citrus clementina]
 gb|ESR39260.1| hypothetical protein CICLE_v10025275mg [Citrus clementina]
Length=568

 Score = 91.3 bits (225),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 106/196 (54%), Gaps = 14/196 (7%)
 Frame = -3

Query  931  KLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATA  752
            +L  SLGL  K+P +IE L++  +Q+DAVH  +   L   FPPVPLLK +LKD ++ +  
Sbjct  333  ELCHSLGLAHKVPGIIEILVNNAKQIDAVHLIHAFQLTENFPPVPLLKTYLKDLRRNSQG  392

Query  751  ILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkk  572
               +   +  A + A  +EL+A++AV+ CIE YKLEAE+P + L+KR+ QLE++KS+KK+
Sbjct  393  KGGNSGGATGAQNDANAQELAALKAVISCIERYKLEAEYPLDPLQKRVAQLERSKSDKKR  452

Query  571  paaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYP  392
                +     +   +NGG     +  R++    +S   A P +              AY 
Sbjct  453  GRDFSKHQQSKKHRANGG----YRGFRASGGNAASSRQAPPVYADR----------TAYG  498

Query  391  ASPIYTHGSMSPQYVY  344
            A P   H + S  Y Y
Sbjct  499  AMPARYHQAASNHYDY  514



>ref|XP_006371905.1| hypothetical protein POPTR_0018s059601g [Populus trichocarpa]
 gb|ERP49702.1| hypothetical protein POPTR_0018s059601g [Populus trichocarpa]
Length=278

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 98/152 (64%), Gaps = 9/152 (6%)
 Frame = -3

Query  898  MPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATAILEDPNNSGRA  719
            M ++I+EL+  G++++AV+F  E GL   F PV LLK++LK++KK  T +L++ N S  A
Sbjct  11   MRDIIDELVKNGKEIEAVYFASESGLTKIFSPVSLLKSYLKNSKKITTTVLKNGNYSAAA  70

Query  718  AHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKR  539
               ++  EL++I+A++KC+E++KLE+EF  + L+KR   LEKTK+E+K+  +AA     +
Sbjct  71   TDESSTLELNSIKAIIKCVEDHKLESEFSLDSLRKRASLLEKTKAERKRGTSAATATKSQ  130

Query  538  TRVSNG-------GPMP--PAKAGRSTNAYVS  470
             +  +G       GP P   AKA + +N Y S
Sbjct  131  NKRGHGSSGARDSGPPPYRQAKAAKFSNNYSS  162



>ref|XP_006371903.1| hypothetical protein POPTR_0018s05930g, partial [Populus trichocarpa]
 gb|ERP49700.1| hypothetical protein POPTR_0018s05930g, partial [Populus trichocarpa]
Length=230

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 98/151 (65%), Gaps = 10/151 (7%)
 Frame = -3

Query  889  LIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATAILEDPNNSGRAAHL  710
            +I+EL+  G++++AV+F  E GL   F PV LLK++LK++KK  T +L++ N S  A   
Sbjct  40   IIDELVKNGKEIEAVYFASESGLTKIFSPVSLLKSYLKNSKKITTTVLKNGNYSAAATDE  99

Query  709  AAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRV  530
            ++  EL++I+A++KC+E++KLE+EF  + L+KR   LEKTK+E+K+  +AA     + + 
Sbjct  100  SSTLELNSIKAIIKCVEDHKLESEFSLDSLRKRASLLEKTKAERKRGTSAATATKSQNKR  159

Query  529  SNG-------GPMP--PAKAGRSTNAYVSSF  464
             +G       GP P   AKA + +N Y SSF
Sbjct  160  GHGSSGARDSGPTPYRQAKAAKFSNNY-SSF  189



>ref|XP_007155867.1| hypothetical protein PHAVU_003G238500g [Phaseolus vulgaris]
 gb|ESW27861.1| hypothetical protein PHAVU_003G238500g [Phaseolus vulgaris]
Length=551

 Score = 90.9 bits (224),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 110/209 (53%), Gaps = 29/209 (14%)
 Frame = -3

Query  931  KLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATA  752
            +L  S+GL  K+P ++E LI+ G+Q+ AVHF +   L   FPPVPLLK +LK+ ++ +  
Sbjct  334  ELCRSIGLIHKIPVVVETLINNGKQIAAVHFIHAFQLQESFPPVPLLKGYLKNRRRNSQV  393

Query  751  ILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkk  572
               +  +   A + A  +EL+A+RAV+KCIEEYKLE+++P + LKKR+ QLEK+K +   
Sbjct  394  KTGNVRDIASAKNDANAQELAALRAVIKCIEEYKLESDYPLDTLKKRVLQLEKSKGD---  450

Query  571  paaaaapaaKRTRVSNGGPMPPAKAGRSTNAYV---SSFPAAAPTF--------VRSPSH  425
                      + R  +    P +K  R    Y    SS  +AA T         VR+P  
Sbjct  451  ----------KKRSGDFSKRPQSKRSRPNERYFSLHSSGVSAASTVGLGRQVPHVRAP--  498

Query  424  TQYPTGLPAYPASPIYTHGSMSP-QYVYS  341
              Y   L  YP +    +    P Q +YS
Sbjct  499  --YAGNLDRYPHAGTIPYDFQVPGQSIYS  525



>ref|XP_012084486.1| PREDICTED: FRIGIDA-like protein 3 [Jatropha curcas]
 ref|XP_012084494.1| PREDICTED: FRIGIDA-like protein 3 [Jatropha curcas]
 gb|KDP45205.1| hypothetical protein JCGZ_15070 [Jatropha curcas]
Length=538

 Score = 90.9 bits (224),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 101/164 (62%), Gaps = 16/164 (10%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+   +L   LGL +KMP +IE LI+ G+Q+DAV+  +   L  +F PVPLLK++LK+AK
Sbjct  330  RRQAAELCRFLGLSEKMPGVIEVLINSGRQIDAVNLAFAFELTEQFSPVPLLKSYLKEAK  389

Query  766  kaATAILEDPNNSGRAA-----HLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQ  602
            K +      P  SG A+     H   ++EL+A++AV+KCIEE+KLE ++P + ++KRL Q
Sbjct  390  KTS------PVKSGNASPTAVQHEVNERELAALKAVIKCIEEHKLEEQYPIDPVQKRLSQ  443

Query  601  LEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVS  470
            LEK K++KK+    A P  KR R +  G  P     R TN  V 
Sbjct  444  LEKAKADKKRATEVAKPQCKRPRANGAGCAP-----RVTNVAVD  482



>gb|KJB10822.1| hypothetical protein B456_001G227000 [Gossypium raimondii]
 gb|KJB10823.1| hypothetical protein B456_001G227000 [Gossypium raimondii]
 gb|KJB10824.1| hypothetical protein B456_001G227000 [Gossypium raimondii]
Length=542

 Score = 90.5 bits (223),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 119/208 (57%), Gaps = 17/208 (8%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L  SLGL +KMP +IE L++ G+Q+DAV+  +   L  +F PVPLLKA+LK+A+
Sbjct  332  RRQTADLCRSLGLSEKMPGVIEVLVNNGRQIDAVNLAFAFDLTVQFLPVPLLKAYLKEAR  391

Query  766  kaATAILEDPNNSGRAAHLA-AKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKT  590
            KA++ +   P NS   A +  +++EL+A++AV+KCIEE+ +E ++P + L+KR+  LEK 
Sbjct  392  KASSPV--KPGNSSSTAQIEFSERELAALKAVIKCIEEHNIEEQYPIDPLQKRVLLLEKV  449

Query  589  KSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPS-HTQYP  413
            K++KK    AA P  KR R +  G  P     R TN       A  P + R+   + QY 
Sbjct  450  KADKKGSTEAAKPQTKRARANGAGYGP-----RVTNV-----AADKPFYSRTTDRYPQYV  499

Query  412  TGLPAYPASPIYTHGSM---SPQYVYSP  338
               P   + P   HG     S  Y +SP
Sbjct  500  YDRPYVYSGPADNHGPALLGSATYNFSP  527



>ref|XP_010688181.1| PREDICTED: FRIGIDA-like protein 4a [Beta vulgaris subsp. vulgaris]
Length=566

 Score = 90.5 bits (223),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 83/120 (69%), Gaps = 1/120 (1%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+ M K+A+ +  GDK+ +LI+EL+  G++V+AV+F  E GL  +F P  LLK++L+++K
Sbjct  279  RRDMAKIAIPI-FGDKIGDLIDELVKNGKEVEAVYFASESGLTERFQPASLLKSYLRNSK  337

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K    IL+  N+S  A   A   E++ I+++++C+E++KLEAEF  + LKKRL  LE+ K
Sbjct  338  KNTAEILKKGNHSAGATDEANNYEINYIKSIVRCVEDHKLEAEFGVDSLKKRLSSLERAK  397



>gb|KJB81662.1| hypothetical protein B456_013G155600 [Gossypium raimondii]
Length=578

 Score = 90.5 bits (223),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -3

Query  928  LALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATAI  749
            L  S+GLG+K+ +LI++L+  G+Q+ AV F +E GL  KF PVPLL+ +L + KK A  +
Sbjct  309  LCRSIGLGEKVHDLIQKLLDSGKQLLAVRFIFEFGLAEKFSPVPLLEEYLNETKKLAQQV  368

Query  748  LEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEK  593
             E+  N+ ++ + AA KE+ A+++V+K IEE+KLE ++  E L+KR++QLEK
Sbjct  369  CENGKNTLKSQNEAASKEIGALKSVIKIIEEHKLETQYSREPLQKRIEQLEK  420



>gb|KJB10825.1| hypothetical protein B456_001G227000 [Gossypium raimondii]
Length=551

 Score = 90.5 bits (223),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 119/208 (57%), Gaps = 17/208 (8%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L  SLGL +KMP +IE L++ G+Q+DAV+  +   L  +F PVPLLKA+LK+A+
Sbjct  341  RRQTADLCRSLGLSEKMPGVIEVLVNNGRQIDAVNLAFAFDLTVQFLPVPLLKAYLKEAR  400

Query  766  kaATAILEDPNNSGRAAHLA-AKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKT  590
            KA++ +   P NS   A +  +++EL+A++AV+KCIEE+ +E ++P + L+KR+  LEK 
Sbjct  401  KASSPV--KPGNSSSTAQIEFSERELAALKAVIKCIEEHNIEEQYPIDPLQKRVLLLEKV  458

Query  589  KSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPS-HTQYP  413
            K++KK    AA P  KR R +  G  P     R TN       A  P + R+   + QY 
Sbjct  459  KADKKGSTEAAKPQTKRARANGAGYGP-----RVTNV-----AADKPFYSRTTDRYPQYV  508

Query  412  TGLPAYPASPIYTHGSM---SPQYVYSP  338
               P   + P   HG     S  Y +SP
Sbjct  509  YDRPYVYSGPADNHGPALLGSATYNFSP  536



>gb|KDO43512.1| hypothetical protein CISIN_1g008061mg [Citrus sinensis]
Length=579

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 119/206 (58%), Gaps = 13/206 (6%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L  SLGL +KMP +IE L++ G+Q+DAV+  +   L  +F PVPLLK++LK+AK
Sbjct  363  RRQTPDLCRSLGLSEKMPGVIEVLVNSGRQIDAVNLAFAFELTEQFSPVPLLKSYLKEAK  422

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA++++ +  N S  A +    +ELSA++AV+KCIEE+ LE ++P + L+KR+ QLEK K
Sbjct  423  KASSSV-KAGNMSPSAENEVNDRELSALKAVIKCIEEHNLEEQYPIDPLQKRILQLEKAK  481

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +EKK+    A P  KR R +  G  P      +  A+   +P  A    R P   QY   
Sbjct  482  AEKKRATEVAKPQPKRPRANGAGYGPRVTNVAADKAF---YPRVAD---RYP---QYVYD  532

Query  406  LPAYPASPIYTHG-SM--SPQYVYSP  338
             P     P   HG S+  S  Y +SP
Sbjct  533  RPYVYTGPADNHGPSLLGSATYSFSP  558



>gb|KHG07820.1| Protein FRIGIDA -like protein [Gossypium arboreum]
 gb|KHG16881.1| Protein FRIGIDA -like protein [Gossypium arboreum]
Length=578

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -3

Query  928  LALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATAI  749
            L  S+GLG+K+ +LI++L+  G+Q+ AV F +E GL  KF PVPLL+ ++ + KK A  +
Sbjct  309  LCRSIGLGEKVHDLIQKLLDSGKQLLAVRFIFEFGLAEKFSPVPLLEEYMNETKKLAQQV  368

Query  748  LEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEK  593
             ++  N+ ++ + AA KE+ A+++V+K IEE+KLE ++  E L+KR++QLEK
Sbjct  369  CQNGKNTLKSQNEAASKEIGALKSVIKIIEEHKLETQYSREPLQKRIEQLEK  420



>ref|XP_009129722.1| PREDICTED: FRIGIDA-like protein 3 [Brassica rapa]
Length=522

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 115/209 (55%), Gaps = 20/209 (10%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+   +L  SLGL +KMP +IE L++ G+Q+DAV+  +  GL  KFPPV LLK +L +A 
Sbjct  313  RRQAAELCRSLGLSEKMPGVIEVLVNSGKQIDAVNLAFAFGLTEKFPPVELLKCYLTEAS  372

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            ++++      N S       +++EL+ ++AV+KC+EE+ LE ++P E L KR+ QLEKTK
Sbjct  373  RSSS----QGNASPAVQDEFSERELTGLKAVIKCVEEHNLEEQYPVEPLHKRILQLEKTK  428

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRST-NAYVSSFPAAAPTFVRSPSHTQYPT  410
            +EKK+      P  KR R    GP P      +    Y    P   P +V    + Q+ +
Sbjct  429  AEKKRATEPTKPQTKRPR----GPQPRVTDNNNNKTGYGRVIPERYPQYVY--DNRQFLS  482

Query  409  G-LPAYPASPIYTHGSMSPQ-YVYSPEAA  329
            G + A  A P        PQ Y +SP AA
Sbjct  483  GPIMAAQAPP-------PPQTYTFSPAAA  504



>ref|XP_006447936.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
 ref|XP_006447937.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
 ref|XP_006469349.1| PREDICTED: FRIGIDA-like protein 3-like isoform X2 [Citrus sinensis]
 ref|XP_006469350.1| PREDICTED: FRIGIDA-like protein 3-like isoform X3 [Citrus sinensis]
 ref|XP_006469351.1| PREDICTED: FRIGIDA-like protein 3-like isoform X4 [Citrus sinensis]
 ref|XP_006469352.1| PREDICTED: FRIGIDA-like protein 3-like isoform X5 [Citrus sinensis]
 ref|XP_006469353.1| PREDICTED: FRIGIDA-like protein 3-like isoform X6 [Citrus sinensis]
 gb|ESR61176.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
 gb|ESR61177.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
Length=549

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 121/206 (59%), Gaps = 13/206 (6%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L  SLGL +KMP +IE L++ G+Q+DAV+  +   L  +F PVPLLK++LK+AK
Sbjct  333  RRQTPDLCRSLGLSEKMPGVIEVLVNSGRQIDAVNLAFAFELTEQFSPVPLLKSYLKEAK  392

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA++++ +  N S  A +    +ELSA++AV+KCIEE+ LE ++P + L+KR+ QLEK K
Sbjct  393  KASSSV-KAGNMSPSAENEVNDRELSALKAVIKCIEEHNLEEQYPIDPLQKRILQLEKAK  451

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +EKK+    A P  KR R +  G  P     R TN  V++  A  P    +  + QY   
Sbjct  452  AEKKRATEVAKPQPKRPRANGAGYGP-----RVTN--VAADKAFYPRV--ADRYPQYVYD  502

Query  406  LPAYPASPIYTHG-SM--SPQYVYSP  338
             P     P   HG S+  S  Y +SP
Sbjct  503  RPYVYTGPADNHGPSLLGSATYSFSP  528



>ref|XP_006447935.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
 ref|XP_006447938.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
 ref|XP_006469348.1| PREDICTED: FRIGIDA-like protein 3-like isoform X1 [Citrus sinensis]
 gb|ESR61175.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
 gb|ESR61178.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
Length=586

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 121/206 (59%), Gaps = 13/206 (6%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L  SLGL +KMP +IE L++ G+Q+DAV+  +   L  +F PVPLLK++LK+AK
Sbjct  370  RRQTPDLCRSLGLSEKMPGVIEVLVNSGRQIDAVNLAFAFELTEQFSPVPLLKSYLKEAK  429

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA++++ +  N S  A +    +ELSA++AV+KCIEE+ LE ++P + L+KR+ QLEK K
Sbjct  430  KASSSV-KAGNMSPSAENEVNDRELSALKAVIKCIEEHNLEEQYPIDPLQKRILQLEKAK  488

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            +EKK+    A P  KR R +  G  P     R TN  V++  A  P    +  + QY   
Sbjct  489  AEKKRATEVAKPQPKRPRANGAGYGP-----RVTN--VAADKAFYPRV--ADRYPQYVYD  539

Query  406  LPAYPASPIYTHG-SM--SPQYVYSP  338
             P     P   HG S+  S  Y +SP
Sbjct  540  RPYVYTGPADNHGPSLLGSATYSFSP  565



>ref|XP_010097278.1| hypothetical protein L484_009510 [Morus notabilis]
 gb|EXB67430.1| hypothetical protein L484_009510 [Morus notabilis]
Length=536

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = -3

Query  904  DKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATAILEDPNNSG  725
            D + +LI++L+S G+Q+ AV F+YE  L ++FPPVPLLK ++K++KK A  + E+  NS 
Sbjct  263  DNVKDLIQKLVSNGKQLLAVKFSYEFKLTDEFPPVPLLKDYVKESKKIAKKVCEEGKNSL  322

Query  724  RAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  581
            ++ + A  KE SA++AV+K IEE++LE+E+P E L+K+++ LEK K++
Sbjct  323  KSQNEATAKETSALKAVIKIIEEHELESEYPKEFLEKQIENLEKQKAD  370



>ref|XP_006371906.1| hypothetical protein POPTR_0018s059601g, partial [Populus trichocarpa]
 gb|ERP49703.1| hypothetical protein POPTR_0018s059601g, partial [Populus trichocarpa]
Length=215

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 96/149 (64%), Gaps = 9/149 (6%)
 Frame = -3

Query  889  LIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATAILEDPNNSGRAAHL  710
            +I+EL+  G++++AV+F  E GL   F PV LLK++LK++KK  T +L++ N S  A   
Sbjct  1    IIDELVKNGKEIEAVYFASESGLTKIFSPVSLLKSYLKNSKKITTTVLKNGNYSAAATDE  60

Query  709  AAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRV  530
            ++  EL++I+A++KC+E++KLE+EF  + L+KR   LEKTK+E+K+  +AA     + + 
Sbjct  61   SSTLELNSIKAIIKCVEDHKLESEFSLDSLRKRASLLEKTKAERKRGTSAATATKSQNKR  120

Query  529  SNG-------GPMP--PAKAGRSTNAYVS  470
             +G       GP P   AKA + +N Y S
Sbjct  121  GHGSSGARDSGPPPYRQAKAAKFSNNYSS  149



>ref|XP_006579919.1| PREDICTED: FRIGIDA-like protein 3-like isoform X3 [Glycine max]
Length=454

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 83/123 (67%), Gaps = 6/123 (5%)
 Frame = -3

Query  931  KLALSLGLGDKMP------ELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkda  770
            +L  S+GL  KMP       ++E LI+ G+Q+ AVHF +   L   FPPVPLLKA+LK+ 
Sbjct  229  ELCCSIGLIHKMPVYTIYAAVVESLINTGKQIAAVHFIHAFQLQESFPPVPLLKAYLKNR  288

Query  769  kkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKT  590
            ++ +     +  +   A + A  +EL+A+RAV+KCIEEYKLE+++PP+ L+KR+ QLEK+
Sbjct  289  RRNSQVKTGNVRDITSAKNDANAQELAALRAVIKCIEEYKLESDYPPDTLRKRVLQLEKS  348

Query  589  KSE  581
            K +
Sbjct  349  KGD  351



>ref|XP_006466524.1| PREDICTED: FRIGIDA-like protein 3-like isoform X1 [Citrus sinensis]
 ref|XP_006466525.1| PREDICTED: FRIGIDA-like protein 3-like isoform X2 [Citrus sinensis]
Length=568

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 105/196 (54%), Gaps = 14/196 (7%)
 Frame = -3

Query  931  KLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATA  752
            +L  SLGL  K+P +IE L++  +Q+DAVH  +   L   FPPVPLLK +LKD ++ +  
Sbjct  333  ELCHSLGLAHKVPGIIEILVNNAKQIDAVHLIHAFQLTENFPPVPLLKTYLKDLRRNSQG  392

Query  751  ILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkk  572
               +   +  A + A  +EL+A++AV+ CIE YKLEAE+P + L+KR+ QLE++KS+KK+
Sbjct  393  KGGNSGGATGAQNDANAQELAALKAVISCIERYKLEAEYPLDPLQKRVAQLERSKSDKKR  452

Query  571  paaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYP  392
                +     +   +NGG     +  R++    +S   A P +               Y 
Sbjct  453  GRDFSKHQQSKKHRANGG----YRGFRASGGNAASSRQAPPVYADR----------TVYG  498

Query  391  ASPIYTHGSMSPQYVY  344
            A P   H + S  Y Y
Sbjct  499  AMPARYHQAASNHYDY  514



>ref|XP_004958191.1| PREDICTED: protein FRIGIDA-like [Setaria italica]
Length=617

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 83/213 (39%), Positives = 120/213 (56%), Gaps = 22/213 (10%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK       SLGL +++P +IEEL++R +Q+DAVHF    GL + FPP PLLK ++ +  
Sbjct  339  RKQTAVTCRSLGLNERIPGIIEELVNRHRQIDAVHFIQAFGLSDTFPPAPLLKTYVDE--  396

Query  766  kaATAILEDP-NNSGRAAHLAAK-----KELSAIRAVLKCIEEYKLEAEFPPEHLKKRLD  605
                  L+D  +N+G A   A+K     KEL A+RAV+KCIEEYKL+ E+    L+KR+ 
Sbjct  397  ------LKDSFDNNGDATAAASKDDPKTKELLALRAVIKCIEEYKLQKEYSLGPLQKRVS  450

Query  604  QLEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAG-RSTNAYVSSFPAAAPTFVRSPS  428
            +L K KSEK+  + A    +K+ R   G   P   AG   + A    FPA+   + R+P+
Sbjct  451  EL-KPKSEKRPSSDAGRAYSKKPR-GPGTSFPRRPAGPVGSAARRPPFPAS--NWQRAPA  506

Query  427  HTQYPTGLPAYPASPIYTHGSMSPQYVYSPEAA  329
                P+  PA P +P+      + QY Y+P AA
Sbjct  507  P--MPSRAPA-PMAPLPDRYGAADQYHYTPPAA  536



>ref|XP_008813697.1| PREDICTED: truncated FRIGIDA-like protein 1 [Phoenix dactylifera]
Length=510

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 87/121 (72%), Gaps = 0/121 (0%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK    L   LG+ + M +LI  L S+G+Q+DAV F + + +++K+PPVP+LKA+LK++K
Sbjct  239  RKQALDLCKILGVMENMADLIGGLNSKGRQLDAVKFIHALNVMDKYPPVPILKAYLKESK  298

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KAA  + +  NNS ++ + A  KEL+A++AV+  I+EYKLE+E+  E LKKR+ QLE+ K
Sbjct  299  KAAQEVRKKGNNSIKSQNEAIVKELAALKAVIGAIKEYKLESEYSCETLKKRIAQLEQQK  358

Query  586  S  584
            +
Sbjct  359  A  359



>ref|XP_010028142.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Eucalyptus grandis]
 gb|KCW54798.1| hypothetical protein EUGRSUZ_I00737 [Eucalyptus grandis]
Length=559

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 106/195 (54%), Gaps = 8/195 (4%)
 Frame = -3

Query  931  KLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATA  752
            +L  SLGL +K+P ++E LI+ GQQVDAVH  +   L  +F PVPLLK +LKD ++ +  
Sbjct  333  ELCRSLGLTEKVPGVVESLINSGQQVDAVHLIHAFQLTERFHPVPLLKTYLKDLRRNSQG  392

Query  751  ILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkk  572
            +         A+  A  +EL A++AV+KC+++Y LEA +  + L++R+ QLEK KS+KK+
Sbjct  393  VGAKSEGGAIASSQANAQELEALKAVIKCVKDYGLEASYQLDPLQRRVTQLEKAKSDKKR  452

Query  571  paaaaapaaKRTRVSNGGPMPP-AKAGRSTNAYVSSFPAAAPTF---VRSPSHTQYPTGL  404
                      +   SNGG     A+   +    V +F   AP     VR  ++ Q P   
Sbjct  453  AGELGGNQKSKKLKSNGGFYKSRAQGANAIGRQVPAFNQNAPYLGPAVRFAANYQLPGQS  512

Query  403  P-AYPASP---IYTH  371
              AY AS     YTH
Sbjct  513  EYAYQASNQGLQYTH  527



>ref|XP_006387116.1| hypothetical protein POPTR_1811s00200g, partial [Populus trichocarpa]
 gb|ERP46030.1| hypothetical protein POPTR_1811s00200g, partial [Populus trichocarpa]
Length=265

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 96/149 (64%), Gaps = 9/149 (6%)
 Frame = -3

Query  889  LIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATAILEDPNNSGRAAHL  710
            +I+EL+  G++++AV+F  E GL   F PV LLK++LK++KK  T +L++ N S  A   
Sbjct  1    IIDELVKNGKEIEAVYFASESGLTKIFSPVSLLKSYLKNSKKITTTVLKNGNYSAAATDE  60

Query  709  AAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRV  530
            ++  EL++I+A++KC+E++KLE+EF  + L+KR   LEKTK+E+K+  +AA     + + 
Sbjct  61   SSTLELNSIKAIIKCVEDHKLESEFSLDSLRKRASLLEKTKAERKRGTSAATATKSQNKR  120

Query  529  SNG-------GPMP--PAKAGRSTNAYVS  470
             +G       GP P   AKA + +N Y S
Sbjct  121  GHGSSGARDSGPPPYRQAKAAKFSNNYSS  149



>gb|AIN75614.1| FRIGIDA3b-1 [Dimocarpus longan]
 gb|AIN75615.1| FRIGIDA3b-2 [Dimocarpus longan]
Length=550

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 115/201 (57%), Gaps = 30/201 (15%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L  SLGL +KMP +I+ L++ G+Q+DAV+  +   L   F PVPLLK++LK+A+
Sbjct  333  RRQTADLCRSLGLSEKMPGIIDVLVNSGRQIDAVNLAFAFELTELFSPVPLLKSYLKEAR  392

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA++ + +  N    A +   ++EL+A++AV+KCIEE+ LE ++P + L+KR+ QLEK K
Sbjct  393  KASSPV-KVGNTFPNAENEVNERELAALKAVIKCIEEHSLEEQYPVDPLQKRILQLEKAK  451

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTG  407
            ++KK+   A+ P  KR R +  G +PP    R TN       AA  TF        YPT 
Sbjct  452  ADKKRATEASKPQPKRPRANGAGYVPP----RVTNV------AADKTF--------YPTR  493

Query  406  LPAYPASPIYTHGSMSPQYVY  344
            +               PQYVY
Sbjct  494  V-----------ADRYPQYVY  503



>ref|XP_006579918.1| PREDICTED: FRIGIDA-like protein 3-like isoform X2 [Glycine max]
Length=559

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 83/123 (67%), Gaps = 6/123 (5%)
 Frame = -3

Query  931  KLALSLGLGDKMP------ELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkda  770
            +L  S+GL  KMP       ++E LI+ G+Q+ AVHF +   L   FPPVPLLKA+LK+ 
Sbjct  334  ELCCSIGLIHKMPVYTIYAAVVESLINTGKQIAAVHFIHAFQLQESFPPVPLLKAYLKNR  393

Query  769  kkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKT  590
            ++ +     +  +   A + A  +EL+A+RAV+KCIEEYKLE+++PP+ L+KR+ QLEK+
Sbjct  394  RRNSQVKTGNVRDITSAKNDANAQELAALRAVIKCIEEYKLESDYPPDTLRKRVLQLEKS  453

Query  589  KSE  581
            K +
Sbjct  454  KGD  456



>ref|XP_008344098.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
Length=253

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -3

Query  892  ELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATAILEDPNNSGRAAH  713
            ++I+EL+  G++++AV+F  E  L  +FPPV LLK++LK+++K A  IL++ NNS  A  
Sbjct  4    DVIDELVKNGKEIEAVYFASESDLTERFPPVSLLKSYLKNSRKNAATILKNGNNSVAATE  63

Query  712  LAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSE  581
             ++  EL++I+A++KC+E++KLE+EF  E+L+KR   LEK ++E
Sbjct  64   ESSTFELNSIKAIIKCVEDHKLESEFSLENLRKRAAHLEKARTE  107



>ref|XP_010037083.1| PREDICTED: FRIGIDA-like protein 3 [Eucalyptus grandis]
 ref|XP_010037084.1| PREDICTED: FRIGIDA-like protein 3 [Eucalyptus grandis]
 ref|XP_010037085.1| PREDICTED: FRIGIDA-like protein 3 [Eucalyptus grandis]
 ref|XP_010037086.1| PREDICTED: FRIGIDA-like protein 3 [Eucalyptus grandis]
 gb|KCW48707.1| hypothetical protein EUGRSUZ_K02358 [Eucalyptus grandis]
 gb|KCW48708.1| hypothetical protein EUGRSUZ_K02358 [Eucalyptus grandis]
 gb|KCW48709.1| hypothetical protein EUGRSUZ_K02358 [Eucalyptus grandis]
Length=546

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 106/203 (52%), Gaps = 33/203 (16%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+   +L  SLGL  KMP +IE L + G+Q+DAV+  +   L N+F PVPLLK++LKD K
Sbjct  332  RRQTAELCRSLGLTSKMPGVIELLANSGRQIDAVNLAFAFELTNQFSPVPLLKSYLKDVK  391

Query  766  kaATAILEDPNNSGRAAHLAA-KKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKT  590
            K ++ +   P NS  +  +   +KELSA++AV+KCIEE+KLE +FP + L+K + Q+EK 
Sbjct  392  KFSSPV--KPGNSSPSGQIEVNEKELSALKAVIKCIEEHKLEEQFPVDPLQKLVLQMEKA  449

Query  589  KSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPT  410
            K+                 V+   P  P   G +   +V +F AA  TF        YP 
Sbjct  450  KA----------DKKSAAEVAKPQPKRPRAGGVANGHHVVTFAAANKTF--------YPN  491

Query  409  GLPAYPASPIYTHGSMSPQYVYS  341
                Y            PQYVY 
Sbjct  492  VADGY------------PQYVYD  502



>gb|AIZ49817.1| ABI3-interacting protein 2, partial [Araucaria biramulata]
Length=162

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 95/148 (64%), Gaps = 6/148 (4%)
 Frame = -3

Query  823  LINKFPPVPllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  644
            LI KFPPVPLLK +LKDAKKA+ A ++  NNS  A + A  KELSA+RAV+KCIEE+KLE
Sbjct  1    LIEKFPPVPLLKEYLKDAKKASQASIKSGNNSTAAQNEANTKELSALRAVIKCIEEHKLE  60

Query  643  AEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP----MPPAKAGRSTNAY  476
            +++ P+ L+KR+ QLEK K+++K+ A A     KR R +NGG     + P  A   T A 
Sbjct  61   SQYSPDSLQKRVAQLEKAKADRKRSAGAVKSQPKRPR-ANGGNVGAYVAPLSAPERTPAM  119

Query  475  VSSFPAAAPTFVRSPSHTQYP-TGLPAY  395
             +S  AA  +F R     QY   G+ +Y
Sbjct  120  YASSNAADRSFYRPVERVQYSGAGVASY  147



>ref|XP_003634846.1| PREDICTED: FRIGIDA-like protein 3 [Vitis vinifera]
 emb|CAN80762.1| hypothetical protein VITISV_014605 [Vitis vinifera]
Length=545

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 108/168 (64%), Gaps = 12/168 (7%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L  SLGL +KMP +IE LI+ G+Q+DAV+  +   L  +F PVPLLK++LK+A+
Sbjct  332  RRQTADLCRSLGLSEKMPGVIEILINSGRQIDAVNLAFAFELTEQFSPVPLLKSYLKEAR  391

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            KA++  L+  N S  A +   ++EL+A++AV+KCIE++KLE E+P + L+KR+ QLEK K
Sbjct  392  KASSP-LKPGNASPTAQNEVNERELTALKAVIKCIEDHKLEEEYPLDPLQKRVVQLEKAK  450

Query  586  SEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTF  443
            ++KK+   AA P  KR R +  G  P     R+TN       AA  TF
Sbjct  451  ADKKRATEAAKPQPKRPRANGVGYGP-----RATNV------AADKTF  487



>gb|AIZ49827.1| ABI3-interacting protein 2, partial [Araucaria montana]
Length=174

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 95/148 (64%), Gaps = 6/148 (4%)
 Frame = -3

Query  823  LINKFPPVPllkaflkdakkaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLE  644
            LI KFPPVPLLK +LKDAKKA+ A ++  NNS  A + A  KELSA+RAV+KCIEE+KLE
Sbjct  3    LIEKFPPVPLLKEYLKDAKKASQASIKSGNNSTAAQNEANTKELSALRAVIKCIEEHKLE  62

Query  643  AEFPPEHLKKRLDQLEKTKSEkkkpaaaaapaaKRTRVSNGGP----MPPAKAGRSTNAY  476
            +++ P+ L+KR+ QLEK K+++K+ A A     KR R +NGG     + P  A   T A 
Sbjct  63   SQYSPDSLQKRVAQLEKAKADRKRSAGAVKSQPKRPR-ANGGNVGAYVAPLSAPERTPAM  121

Query  475  VSSFPAAAPTFVRSPSHTQYP-TGLPAY  395
             +S  AA  +F R     QY   G+ +Y
Sbjct  122  YASSNAADRSFYRPVERVQYSGAGVASY  149



>ref|XP_002529047.1| Protein FRIGIDA, putative [Ricinus communis]
 gb|EEF33358.1| Protein FRIGIDA, putative [Ricinus communis]
Length=491

 Score = 87.4 bits (215),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 83/121 (69%), Gaps = 0/121 (0%)
 Frame = -3

Query  943  KHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakk  764
            K    LA  +GLGDK+ +L+++LI  G+Q+ AV F +E GL +KF P PLL+  LK++K+
Sbjct  244  KQATVLARDIGLGDKINDLVQKLIDSGKQLLAVKFIFEFGLTDKFQPAPLLRDHLKESKE  303

Query  763  aATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKS  584
                + ++  NS +A + A  +E++A+++VL+ I+E+ LE ++P   L+KR++ LEK K+
Sbjct  304  FTDKVCKEEKNSVKAQNEARSREVNALKSVLRYIDEHNLEFDYPHLDLEKRIEMLEKQKA  363

Query  583  E  581
            +
Sbjct  364  D  364



>gb|ABK95640.1| unknown [Populus trichocarpa]
Length=96

 Score = 81.3 bits (199),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 51/64 (80%), Gaps = 4/64 (6%)
 Frame = -3

Query  514  MPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYPASPIYTHGSMSP--QYVYS  341
            MPPAKAGR TNAYVSSFPA  P FVRSPSHTQYPTG+PAYP+ P   +GS SP   Y YS
Sbjct  1    MPPAKAGRLTNAYVSSFPAP-PAFVRSPSHTQYPTGVPAYPSPPA-VYGSRSPPSPYAYS  58

Query  340  PEAA  329
            PEAA
Sbjct  59   PEAA  62



>gb|ABK42079.1| hypothetical protein [Capsicum annuum]
Length=487

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 81/121 (67%), Gaps = 9/121 (7%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L  SLGL D MP +I+ LIS G+ +DAV+  +   L  +FPPV LLK++L DA 
Sbjct  332  RRQTADLCRSLGLSDSMPGVIDVLISNGRHIDAVNLAFAFELTEQFPPVSLLKSYLNDAS  391

Query  766  kaATAILEDPNNSGRAA----HLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQL  599
            KA+T     P NSG A+    +   +KELSA++AVLKCIE++KLE ++P + L+KR+ QL
Sbjct  392  KAST-----PLNSGNASPTVQNEVNEKELSALKAVLKCIEDHKLEEQYPVDPLQKRVLQL  446

Query  598  E  596
            E
Sbjct  447  E  447



>gb|EYU27415.1| hypothetical protein MIMGU_mgv1a005047mg [Erythranthe guttata]
Length=499

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 115/214 (54%), Gaps = 13/214 (6%)
 Frame = -3

Query  943  KHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakk  764
            +    L   LGL  K+ +++++LIS+ +Q+ A+ F +E  L N+FPPVPLLK ++  +K+
Sbjct  250  RQTVDLCRILGLESKVSDIVQKLISKDKQLLALKFIFEFELTNEFPPVPLLKDYVMYSKR  309

Query  763  aATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKS  584
             A  I +   NS ++ + AA KE+S++R+V+KCIE++ LE+++P   L  R+++LEK K+
Sbjct  310  IAQKIRKSGKNSRQSVNEAAMKEISSLRSVIKCIEDHNLESQYPKAELVARVEKLEKEKA  369

Query  583  Ekk------------kpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFV  440
            ++K            +       A KR R +      P+ A  S      ++  A P   
Sbjct  370  DRKRPAAAPVPKPQQQQQPPKQNANKRMRAAAFKRKLPS-AANSVVPQSQTYGMAGPLVA  428

Query  439  RSPSHTQYPTGLPAYPASPIYTHGSMSPQYVYSP  338
             +P +    + L  +   P+  HG+M+P    +P
Sbjct  429  AAPQYVGPSSELYGFSGGPMGFHGNMNPSAASNP  462



>gb|ABU89578.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89579.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89581.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89583.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89584.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89585.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89586.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89587.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89588.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89589.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89590.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89591.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89592.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89593.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89594.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89595.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89596.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89597.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89598.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89599.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89600.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89601.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89602.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89603.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89604.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89605.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89607.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89608.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89609.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89610.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89611.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89612.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89613.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89614.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89615.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89616.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|ABU89617.1| ABI3-interacting protein 2, partial [Pinus sylvestris]
 gb|AIF75856.1| ABI3-interacting protein 2, partial [Pinus massoniana]
 gb|AIF75857.1| ABI3-interacting protein 2, partial [Pinus massoniana]
 gb|AIF75858.1| ABI3-interacting protein 2, partial [Pinus massoniana]
 gb|AIF75859.1| ABI3-interacting protein 2, partial [Pinus massoniana]
 gb|AIF75860.1| ABI3-interacting protein 2, partial [Pinus massoniana]
 gb|AIF75861.1| ABI3-interacting protein 2, partial [Pinus hwangshanensis]
 gb|AIF75862.1| ABI3-interacting protein 2, partial [Pinus hwangshanensis]
 gb|AIF75863.1| ABI3-interacting protein 2, partial [Pinus hwangshanensis]
 gb|AIF75864.1| ABI3-interacting protein 2, partial [Pinus hwangshanensis]
 gb|AIF75865.1| ABI3-interacting protein 2, partial [Pinus hwangshanensis]
Length=91

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 16/100 (16%)
 Frame = -3

Query  931  KLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATA  752
            +L LSLGL  KMP ++E L+S G+Q++AV+F++  GL++KFPPVP              A
Sbjct  3    ELCLSLGLAAKMPGIVEILVSSGKQIEAVNFSHAFGLVDKFPPVP-----------LLKA  51

Query  751  ILEDP-----NNSGRAAHLAAKKELSAIRAVLKCIEEYKL  647
             L+D        SG + +    KELSA+RAV+KCIEE+KL
Sbjct  52   YLKDAKKTSQGKSGISQNEVIAKELSALRAVIKCIEEHKL  91



>gb|KHG07809.1| Protein FRIGIDA -like protein [Gossypium arboreum]
Length=543

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 120/208 (58%), Gaps = 17/208 (8%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L  SLGL +KMP +IE L++ G+Q+DAV+  +   L  +F PVPLLKA+LK+A+
Sbjct  332  RRQTADLCRSLGLSEKMPGVIEVLVNNGRQIDAVNLAFAFDLTVQFLPVPLLKAYLKEAR  391

Query  766  kaATAILEDPNNSGRAAHLA-AKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKT  590
            KA++ +   P NS   A +  +++EL+A++AV+KCIEE+ +E ++P + L+KR+  LEK 
Sbjct  392  KASSPL--KPGNSSSTAQIEFSERELAALKAVIKCIEEHNIEEQYPVDPLQKRVLLLEKV  449

Query  589  KSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPS-HTQYP  413
            K++KK    AA P  KR R +  G  P     R TN       A  P + R+   + QY 
Sbjct  450  KADKKGSTEAAKPQTKRARANGAGYGP-----RVTNV-----AADKPFYSRTTDRYPQYV  499

Query  412  TGLPAYPASPIYTHG-SM--SPQYVYSP  338
               P   + P   H  S+  S  Y +SP
Sbjct  500  YDRPYVYSGPADNHCPSLLGSATYNFSP  527



>ref|XP_003562780.1| PREDICTED: FRIGIDA-like protein 3 [Brachypodium distachyon]
Length=613

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 77/214 (36%), Positives = 111/214 (52%), Gaps = 32/214 (15%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            RK   +L  SLGL +++P +IEELI R +Q+DAV F    GL   FPP PLLK ++ +  
Sbjct  337  RKQTAELCRSLGLTERIPGIIEELIKRHRQIDAVQFIQAFGLSENFPPAPLLKTYVDE--  394

Query  766  kaATAILEDPNNSGRAAHLAA-----KKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQ  602
                 + +  NN+G A   ++      +EL A+RA++KC+EEYKL+ + P   L+KR+  
Sbjct  395  -----LKDSINNNGDANATSSTDDLKTRELLALRAIIKCVEEYKLQKDCPLGPLQKRIAG  449

Query  601  LEKTKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPA--AAPT--FVRS  434
            L K+K EK+  A      AK+ RVS         A R  N  + S P   A P   + R+
Sbjct  450  L-KSKGEKRPSADTGRTNAKKPRVSG------ISAPRRLNNSIGSAPRRPAVPVGAWQRA  502

Query  433  PSHTQYPTGLPAYPASPIYTHGSMSPQYVYSPEA  332
            P         P  PA P   +G  + +Y Y+P A
Sbjct  503  P---------PPMPAYPERVYGVTADRYRYTPPA  527



>ref|XP_011008039.1| PREDICTED: truncated FRIGIDA-like protein 1 [Populus euphratica]
Length=539

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 107/196 (55%), Gaps = 6/196 (3%)
 Frame = -3

Query  928  LALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATAI  749
            L  ++ LG+K  +LI++LI  G+Q  AV F +E GL++KF PVPLLKA LK++K+    I
Sbjct  289  LCRAIDLGEKTADLIQKLIDSGKQFLAVKFIFEFGLVDKFQPVPLLKAHLKESKRLTKKI  348

Query  748  LEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKSEkkkp  569
             +D  NS    + A  +E+  +++ L  I+EYKL +E+P   L+KR++ LEK K+     
Sbjct  349  CQDGKNSINQQNEARSREVKTLKSALVLIDEYKLGSEYPQMDLEKRIEMLEKQKAAAASA  408

Query  568  aaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFVRSPSHTQYPTGLPAYPA  389
                +   K+ + + G   P   A    N+   S PA  P      SH Q  + L A  A
Sbjct  409  DDEPSHQPKKQQQA-GSKRPRTSATAVQNSNNGSNPAIPPF---KQSHVQPASLLLA--A  462

Query  388  SPIYTHGSMSPQYVYS  341
             P  + GS+SP  +Y+
Sbjct  463  GPYGSVGSISPAILYA  478



>ref|XP_002320559.2| hypothetical protein POPTR_0014s17360g [Populus trichocarpa]
 ref|XP_006375598.1| hypothetical protein POPTR_0014s17360g [Populus trichocarpa]
 gb|EEE98874.2| hypothetical protein POPTR_0014s17360g [Populus trichocarpa]
 gb|ERP53395.1| hypothetical protein POPTR_0014s17360g [Populus trichocarpa]
Length=545

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 104/171 (61%), Gaps = 4/171 (2%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+   +L   LGL +KMP +IE L++ G+Q+DAV+  +   L  +F PV LLK++LK+A+
Sbjct  330  RRQAAELCRFLGLSEKMPGVIEVLVNSGRQIDAVNLAFAFDLTEQFSPVTLLKSYLKEAR  389

Query  766  kaATAILEDPNNSG--RAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEK  593
            K ++++   P N+      +   ++EL+A++AV+KCIEE+KLE ++P + L+KRL QLEK
Sbjct  390  KVSSSV--KPGNASPITGQNEVNERELAALKAVIKCIEEHKLEEQYPGDPLQKRLLQLEK  447

Query  592  TKSEkkkpaaaaapaaKRTRVSNGGPMPPAKAGRSTNAYVSSFPAAAPTFV  440
             K+EKK+   AA P  KR R S  G  P   +      +    P   P +V
Sbjct  448  AKAEKKRATEAAKPQPKRPRASGVGCGPRVTSSVPERTFYPRVPERYPQYV  498



>gb|ABU89618.1| ABI3-interacting protein 2 [Pinus pinaster]
Length=91

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 16/100 (16%)
 Frame = -3

Query  931  KLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATA  752
            +L LSLGL  KMP ++E L+S G+Q++AV+F++  GL++KFPPVP              A
Sbjct  3    ELCLSLGLAAKMPGIVEILVSSGKQIEAVNFSHAFGLVDKFPPVP-----------LLKA  51

Query  751  ILEDP-----NNSGRAAHLAAKKELSAIRAVLKCIEEYKL  647
             L+D        SG + +    KELSA+RAV+KCIEE+KL
Sbjct  52   YLKDAKKTLQGKSGISQNEVIAKELSALRAVIKCIEEHKL  91



>gb|KEH18040.1| ABI3-interacting protein [Medicago truncatula]
Length=545

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 99/165 (60%), Gaps = 9/165 (5%)
 Frame = -3

Query  946  RKHMXKLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdak  767
            R+    L   LGL +KMP +I+ L+  G+Q+DAV+  +   L ++F P+PLLK++L DAK
Sbjct  332  RRQTADLCRCLGLSEKMPGVIKVLVKNGRQIDAVNLAFAFDLTDQFSPIPLLKSYLNDAK  391

Query  766  kaATAILEDPNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTK  587
            K ++ + +  N+S  A     ++EL A++AV+KCIEE+KLE ++P + L+KR+ QLEK K
Sbjct  392  KTSSPV-KSGNSSPTAQLDVNERELFALKAVIKCIEEHKLEEQYPIDSLQKRMIQLEKAK  450

Query  586  SEkkkpaaaaapaaKRTRVSNGG--------PMPPAKAGRSTNAY  476
            ++KK+   A  P  KR R +  G        P      GR  + Y
Sbjct  451  ADKKRETEATKPQPKRPRANGAGYGPRVTNIPFDKTSYGRVADRY  495



>ref|XP_009794659.1| PREDICTED: FRIGIDA-like protein 3 [Nicotiana sylvestris]
 ref|XP_009794660.1| PREDICTED: FRIGIDA-like protein 3 [Nicotiana sylvestris]
Length=615

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 71/118 (60%), Gaps = 13/118 (11%)
 Frame = -3

Query  931  KLALSLGLGDKMPELIEELISRGQQVDAVHFTYEVGLINKFPPVPllkaflkdakkaATA  752
            +L  SLGL DKMP +IE LI   +Q+DA  F +   L  +FP VPLLK            
Sbjct  339  ELCRSLGLADKMPGIIEALIHNEKQIDAARFIHSFKLTERFPLVPLLK-----------G  387

Query  751  ILED--PNNSGRAAHLAAKKELSAIRAVLKCIEEYKLEAEFPPEHLKKRLDQLEKTKS  584
             L D   N  G+  +   ++EL+A+RAV++CI +YKLEAE+P + L++R+ QLEK  S
Sbjct  388  YLRDLRRNAQGKGGNSGNREELAAVRAVVRCIRDYKLEAEYPLDPLQRRVGQLEKAIS  445



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2282261823154