BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6945

Length=799
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002870774.1|  predicted protein                                99.0    2e-20   Arabidopsis lyrata subsp. lyrata
gb|AAN60241.1|  unknown                                               98.2    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568565.2|  uncharacterized protein                             98.2    3e-20   
ref|XP_006405620.1|  hypothetical protein EUTSA_v10027782mg           97.4    9e-20   Eutrema salsugineum [saltwater cress]
ref|XP_006283825.1|  hypothetical protein CARUB_v10004926mg           96.3    2e-19   Capsella rubella
ref|XP_010450798.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  93.6    2e-18   
ref|XP_006283826.1|  hypothetical protein CARUB_v10004926mg           92.4    3e-18   
ref|XP_010435878.1|  PREDICTED: uncharacterized protein At5g39570...  86.7    3e-16   
ref|XP_003618539.1|  hypothetical protein MTR_6g012780                77.4    7e-13   Medicago truncatula
ref|XP_006283824.1|  hypothetical protein CARUB_v10004926mg           77.4    7e-13   
ref|XP_010441070.1|  PREDICTED: uncharacterized protein At5g39570...  77.0    8e-13   
gb|KEH25017.1|  pro-resilin, putative                                 74.3    9e-12   Medicago truncatula
ref|XP_006405619.1|  hypothetical protein EUTSA_v10027782mg           72.4    2e-11   
ref|XP_009139903.1|  PREDICTED: uncharacterized protein At5g39570     70.1    2e-10   Brassica rapa
emb|CDY30254.1|  BnaC04g31650D                                        67.0    1e-09   Brassica napus [oilseed rape]
gb|KJB11082.1|  hypothetical protein B456_001G240600                  67.4    2e-09   Gossypium raimondii
ref|WP_044126747.1|  hypothetical protein                             62.0    2e-08   
emb|CDX74447.1|  BnaA04g09420D                                        63.5    3e-08   
ref|WP_033002123.1|  hypothetical protein                             60.8    4e-08   
ref|XP_005112527.1|  PREDICTED: dentin sialophosphoprotein-like       62.8    9e-08   Aplysia californica
ref|XP_009781780.1|  PREDICTED: uncharacterized protein At5g39570     61.6    2e-07   Nicotiana sylvestris
gb|KFK33197.1|  hypothetical protein AALP_AA6G342800                  61.2    2e-07   Arabis alpina [alpine rockcress]
ref|XP_009608846.1|  PREDICTED: uncharacterized protein At5g39570...  61.2    2e-07   Nicotiana tomentosiformis
ref|XP_004489418.1|  PREDICTED: uncharacterized protein At5g39570...  60.1    4e-07   
ref|XP_006893704.1|  PREDICTED: ellis-van Creveld syndrome protein    59.7    1e-06   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_008353427.1|  PREDICTED: uncharacterized protein At5g39570...  58.5    2e-06   
ref|XP_004304279.1|  PREDICTED: uncharacterized protein At5g39570     58.5    2e-06   Fragaria vesca subsp. vesca
gb|ELU04471.1|  hypothetical protein CAPTEDRAFT_211920                56.2    5e-06   Capitella teleta
ref|XP_004232206.1|  PREDICTED: uncharacterized protein At5g39570     57.0    5e-06   Solanum lycopersicum
ref|XP_008341598.1|  PREDICTED: uncharacterized protein At5g39570     56.2    9e-06   
ref|XP_006338424.1|  PREDICTED: uncharacterized protein At5g39570...  55.8    1e-05   Solanum tuberosum [potatoes]
gb|KJB11090.1|  hypothetical protein B456_001G240600                  54.7    3e-05   Gossypium raimondii
ref|XP_004489417.1|  PREDICTED: uncharacterized protein At5g39570...  54.7    3e-05   Cicer arietinum [garbanzo]
emb|CDX95231.1|  BnaC09g16390D                                        53.5    6e-05   
emb|CDP02257.1|  unnamed protein product                              53.5    7e-05   Coffea canephora [robusta coffee]
ref|XP_010552803.1|  PREDICTED: uncharacterized protein At5g39570     52.8    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_009045296.1|  hypothetical protein LOTGIDRAFT_156394           50.4    2e-04   Lottia gigantea
ref|XP_007215367.1|  hypothetical protein PRUPE_ppa005604mg           52.0    3e-04   Prunus persica
ref|XP_011098657.1|  PREDICTED: uncharacterized protein At5g39570...  51.6    3e-04   Sesamum indicum [beniseed]
ref|XP_008230802.1|  PREDICTED: uncharacterized protein At5g39570     51.2    5e-04   Prunus mume [ume]
ref|XP_010258396.1|  PREDICTED: uncharacterized protein At5g39570...  50.8    5e-04   Nelumbo nucifera [Indian lotus]
gb|KHG07281.1|  hypothetical protein F383_34041                       50.4    8e-04   Gossypium arboreum [tree cotton]
ref|XP_010088125.1|  hypothetical protein L484_013569                 50.4    0.001   Morus notabilis



>ref|XP_002870774.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47033.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=384

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 104/156 (67%), Gaps = 23/156 (15%)
 Frame = -2

Query  780  YGRRNESESEYGSGRKPSYGREEDrpsygrseesegygrssYDRPSYGRSNDEEE-YRKP  604
            YGR  E E  Y   RKPSYGR E++    R             +PSYGRS +EEE YRKP
Sbjct  217  YGRSEEQEEGY---RKPSYGRSEEQEEGYR-------------KPSYGRSEEEEEGYRKP  260

Query  603  SYGRSNDEE-EYRKPSYGRSNDE-EEYRKPSYGRSSDEDE--YRKPSYGRSNDEEE--YR  442
            SYGRS +EE  YRKPSYGRS D+ E Y KPSYGRS +++E  YRKPSYGRS ++EE  YR
Sbjct  261  SYGRSEEEEGSYRKPSYGRSEDQVESYIKPSYGRSEEQEEGSYRKPSYGRSEEQEEGSYR  320

Query  441  KPSYQRRNDDDDESYGrrqrrddddddDSYGRKKYG  334
            KPSY R NDDDD+   R +    DD++ SYGRKKYG
Sbjct  321  KPSYGRGNDDDDDEQRRNRSGSGDDEEGSYGRKKYG  356


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 97/167 (58%), Gaps = 34/167 (20%)
 Frame = -2

Query  798  SEYGSGYGRRNESESEYGSGRKPSYGR----------------------------EEDrp  703
            SEYGSGYG + E+ES YG   +  YGR                            E +  
Sbjct  122  SEYGSGYGGQTETESGYGGQTEVEYGRRPEQSYGSGYGGRTETESEYGSGGGGRTEVEYG  181

Query  702  sygrseesegygrssYDRPSYGRSNDEEE-YRKPSYGRSNDEEE-YRKPSYGRSNDEEE-  532
                S            +PSYGRS ++EE YRKPSYGRS ++EE YRKPSYGRS ++EE 
Sbjct  182  RRPESGYGGRSETEYERKPSYGRSEEQEEGYRKPSYGRSEEQEEGYRKPSYGRSEEQEEG  241

Query  531  YRKPSYGRSSDEDE-YRKPSYGRSNDEE-EYRKPSYQRRNDDDDESY  397
            YRKPSYGRS +E+E YRKPSYGRS +EE  YRKPSY  R++D  ESY
Sbjct  242  YRKPSYGRSEEEEEGYRKPSYGRSEEEEGSYRKPSYG-RSEDQVESY  287


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 79/134 (59%), Gaps = 24/134 (18%)
 Frame = -2

Query  780  YGRRNESESEYGSGRKPSYGREEDrpsygrseesegygrssYDRPSYGRSNDE-EEYRKP  604
            YGR  E E  Y   RKPSYGR E+     R             +PSYGRS D+ E Y KP
Sbjct  247  YGRSEEEEEGY---RKPSYGRSEEEEGSYR-------------KPSYGRSEDQVESYIKP  290

Query  603  SYGRSNDEEE--YRKPSYGRSNDEEE--YRKPSYGRSS--DEDEYRKPSYGRSNDEE-EY  445
            SYGRS ++EE  YRKPSYGRS ++EE  YRKPSYGR +  D+DE R+   G  +DEE  Y
Sbjct  291  SYGRSEEQEEGSYRKPSYGRSEEQEEGSYRKPSYGRGNDDDDDEQRRNRSGSGDDEEGSY  350

Query  444  RKPSYQRRNDDDDE  403
             +  Y   + D+DE
Sbjct  351  GRKKYGDNDSDEDE  364



>gb|AAN60241.1| unknown [Arabidopsis thaliana]
Length=381

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 113/183 (62%), Gaps = 31/183 (17%)
 Frame = -2

Query  798  SEYGSGYGRRNESESEYGSGRKPSYGREEDrpsygrseesegygrssYD--RPSYGRSND  625
            S  GSGYG R+ESE E    RKPSYGR E++    R               +PSYGRS +
Sbjct  176  SGLGSGYGGRSESEYE----RKPSYGRSEEQEEGYRKPSYGRSEEQEEGYRKPSYGRSEE  231

Query  624  EEE-YRKPSYGRSNDEEE--YRKPSYGRSNDEEE--YRKPSYGRSSDEDE----------  490
            +EE YRKPSYGRS +E+E  YRKPSYGRS ++EE  YRKPSYGRS D+ E          
Sbjct  232  QEEGYRKPSYGRSEEEQEEGYRKPSYGRSEEQEEGSYRKPSYGRSDDQVESYIKPSYGRS  291

Query  489  -------YRKPSYGRSNDEEE--YRK-PSYQRRNDDDDESYGrrqrrddddddDSYGRKK  340
                   YRKPSYGRS ++EE  YRK PSY R NDDDD+   R +    DD++ SYGRKK
Sbjct  292  EEQEEGSYRKPSYGRSEEQEEGSYRKQPSYGRGNDDDDDEQRRNRSGSGDDEEGSYGRKK  351

Query  339  YGG  331
            YGG
Sbjct  352  YGG  354


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 89/141 (63%), Gaps = 25/141 (18%)
 Frame = -2

Query  792  YGSGYGRRNESESEYGSG----RKPSYGREEDrpsygrseesegygrssYDRPSYGRSND  625
            YGSGYG R E+ESEYGSG     +  YGR  +                      YG  ++
Sbjct  144  YGSGYGGRTETESEYGSGGGGRTEVEYGRRPESGLGS----------------GYGGRSE  187

Query  624  EEEYRKPSYGRSNDEEE-YRKPSYGRSNDEEE-YRKPSYGRSSDEDE-YRKPSYGRSNDE  454
             E  RKPSYGRS ++EE YRKPSYGRS ++EE YRKPSYGRS +++E YRKPSYGRS +E
Sbjct  188  SEYERKPSYGRSEEQEEGYRKPSYGRSEEQEEGYRKPSYGRSEEQEEGYRKPSYGRSEEE  247

Query  453  EE--YRKPSYQRRNDDDDESY  397
            +E  YRKPSY R  + ++ SY
Sbjct  248  QEEGYRKPSYGRSEEQEEGSY  268


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 77/137 (56%), Gaps = 30/137 (22%)
 Frame = -2

Query  780  YGRRNESESEYGSGRKPSYGREEDrpsygrseesegygrssYD----RPSYGRSNDE-EE  616
            YGR  E E  Y   RKPSYGR E+    G  + S G      +    +PSYGRS+D+ E 
Sbjct  226  YGRSEEQEEGY---RKPSYGRSEEEQEEGYRKPSYGRSEEQEEGSYRKPSYGRSDDQVES  282

Query  615  YRKPSYGRSNDEEE--YRKPSYGRSNDEEE--YRK-PSYGRSSDEDE-------------  490
            Y KPSYGRS ++EE  YRKPSYGRS ++EE  YRK PSYGR +D+D+             
Sbjct  283  YIKPSYGRSEEQEEGSYRKPSYGRSEEQEEGSYRKQPSYGRGNDDDDDEQRRNRSGSGDD  342

Query  489  ----YRKPSYGRSNDEE  451
                Y +  YG ++ +E
Sbjct  343  EEGSYGRKKYGGNDSDE  359



>ref|NP_568565.2| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9FKA5.1|Y5957_ARATH RecName: Full=Uncharacterized protein At5g39570 [Arabidopsis 
thaliana]
 dbj|BAB08888.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL24188.1| AT5g39570/MIJ24_40 [Arabidopsis thaliana]
 gb|AAN18065.1| At5g39570/MIJ24_40 [Arabidopsis thaliana]
 gb|AED94448.1| uncharacterized protein AT5G39570 [Arabidopsis thaliana]
Length=381

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 113/183 (62%), Gaps = 31/183 (17%)
 Frame = -2

Query  798  SEYGSGYGRRNESESEYGSGRKPSYGREEDrpsygrseesegygrssYD--RPSYGRSND  625
            S  GSGYG R+ESE E    RKPSYGR E++    R               +PSYGRS +
Sbjct  176  SGLGSGYGGRSESEYE----RKPSYGRSEEQEEGYRKPSYGRSEEQEEGYRKPSYGRSEE  231

Query  624  EEE-YRKPSYGRSNDEEE--YRKPSYGRSNDEEE--YRKPSYGRSSDEDE----------  490
            +EE YRKPSYGRS +E+E  YRKPSYGRS ++EE  YRKPSYGRS D+ E          
Sbjct  232  QEEGYRKPSYGRSEEEQEEGYRKPSYGRSEEQEEGSYRKPSYGRSDDQVESYIKPSYGRS  291

Query  489  -------YRKPSYGRSNDEEE--YRK-PSYQRRNDDDDESYGrrqrrddddddDSYGRKK  340
                   YRKPSYGRS ++EE  YRK PSY R NDDDD+   R +    DD++ SYGRKK
Sbjct  292  EEQEEGSYRKPSYGRSEEQEEGSYRKQPSYGRGNDDDDDEQRRNRSGSGDDEEGSYGRKK  351

Query  339  YGG  331
            YGG
Sbjct  352  YGG  354


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 89/141 (63%), Gaps = 25/141 (18%)
 Frame = -2

Query  792  YGSGYGRRNESESEYGSG----RKPSYGREEDrpsygrseesegygrssYDRPSYGRSND  625
            YGSGYG R E+ESEYGSG     +  YGR  +                      YG  ++
Sbjct  144  YGSGYGGRTETESEYGSGGGGRTEVEYGRRPESGLGS----------------GYGGRSE  187

Query  624  EEEYRKPSYGRSNDEEE-YRKPSYGRSNDEEE-YRKPSYGRSSDEDE-YRKPSYGRSNDE  454
             E  RKPSYGRS ++EE YRKPSYGRS ++EE YRKPSYGRS +++E YRKPSYGRS +E
Sbjct  188  SEYERKPSYGRSEEQEEGYRKPSYGRSEEQEEGYRKPSYGRSEEQEEGYRKPSYGRSEEE  247

Query  453  EE--YRKPSYQRRNDDDDESY  397
            +E  YRKPSY R  + ++ SY
Sbjct  248  QEEGYRKPSYGRSEEQEEGSY  268


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 77/137 (56%), Gaps = 30/137 (22%)
 Frame = -2

Query  780  YGRRNESESEYGSGRKPSYGREEDrpsygrseesegygrssYD----RPSYGRSNDE-EE  616
            YGR  E E  Y   RKPSYGR E+    G  + S G      +    +PSYGRS+D+ E 
Sbjct  226  YGRSEEQEEGY---RKPSYGRSEEEQEEGYRKPSYGRSEEQEEGSYRKPSYGRSDDQVES  282

Query  615  YRKPSYGRSNDEEE--YRKPSYGRSNDEEE--YRK-PSYGRSSDEDE-------------  490
            Y KPSYGRS ++EE  YRKPSYGRS ++EE  YRK PSYGR +D+D+             
Sbjct  283  YIKPSYGRSEEQEEGSYRKPSYGRSEEQEEGSYRKQPSYGRGNDDDDDEQRRNRSGSGDD  342

Query  489  ----YRKPSYGRSNDEE  451
                Y +  YG ++ +E
Sbjct  343  EEGSYGRKKYGGNDSDE  359



>ref|XP_006405620.1| hypothetical protein EUTSA_v10027782mg [Eutrema salsugineum]
 gb|ESQ47073.1| hypothetical protein EUTSA_v10027782mg [Eutrema salsugineum]
Length=418

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 106/186 (57%), Gaps = 33/186 (18%)
 Frame = -2

Query  792  YGSGYGRRNESESEYGSG----------------------------RKPSYGREEDrpsy  697
            YGSGYG R E+ESEYGSG                            +KPS+G E      
Sbjct  160  YGSGYGGRTEAESEYGSGGRTEVEYGRRPESGYGGGSETGYGSGYEKKPSFGEERSEYER  219

Query  696  grseesegygrssYDRPSYGRSNDE-EEYRKPSYGRSNDEEE--YRKPSYGRSNDEEE-Y  529
              S          Y +PSYGRS ++ E Y KPSYGRS ++EE  YRKPSYGRS +EEE Y
Sbjct  220  KPSYGRSEEQEEGYRKPSYGRSEEQVESYIKPSYGRSEEQEEEGYRKPSYGRSEEEEEGY  279

Query  528  RKPSYGRSSDEDEYRKPSYGRSNDEEE-YRKPSYQRRNDDDDESYGrrqrrddddddDSY  352
            RKPSYGRS +E+ YRKPSYGRS +EEE YRKPSY R  + ++ SY +      ++  +SY
Sbjct  280  RKPSYGRSEEEEGYRKPSYGRSEEEEEGYRKPSYGRSEEQEEGSYRKPSYGRSEEQVESY  339

Query  351  GRKKYG  334
             R  YG
Sbjct  340  IRPSYG  345


 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 103/156 (66%), Gaps = 23/156 (15%)
 Frame = -2

Query  780  YGRRNESESEYGSGRKPSYGREEDrpsygrseesegygrssYDRPSYGRSNDEEEYRKPS  601
            YGR  E E E    RKPSYGR E+     R             +PSYGRS +EE YRKPS
Sbjct  253  YGRSEEQEEE--GYRKPSYGRSEEEEEGYR-------------KPSYGRSEEEEGYRKPS  297

Query  600  YGRSNDEEE-YRKPSYGRSNDEEE--YRKPSYGRSSDEDE-YRKPSYGRSNDEEE--YRK  439
            YGRS +EEE YRKPSYGRS ++EE  YRKPSYGRS ++ E Y +PSYGRS ++EE  YRK
Sbjct  298  YGRSEEEEEGYRKPSYGRSEEQEEGSYRKPSYGRSEEQVESYIRPSYGRSEEQEEEGYRK  357

Query  438  PSYQRRNDDDDESYGrrqrrddddddDSYGRKKYGG  331
            PSY R  + ++ SY  R+    DD++ SYGRKKYGG
Sbjct  358  PSYGRSEEQEEGSY--RKPSYGDDEEGSYGRKKYGG  391


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 71/130 (55%), Gaps = 30/130 (23%)
 Frame = -2

Query  780  YGRRNESESEYGSGRKPSYGREEDrpsygrseesegygrssYDRPSYGRSNDEEE--YRK  607
            YGR  E E   GS RKPSYGR E++                  RPSYGRS ++EE  YRK
Sbjct  313  YGRSEEQEE--GSYRKPSYGRSEEQVESYI-------------RPSYGRSEEQEEEGYRK  357

Query  606  PSYGRSNDEEE--YRKPSYGRSNDEEEYRKPSYGRSSDEDEYRKPSYGRSNDEEEYR-KP  436
            PSYGRS ++EE  YRKPSYG   +    RK   G  SDEDE +K          +YR K 
Sbjct  358  PSYGRSEEQEEGSYRKPSYGDDEEGSYGRKKYGGNDSDEDEEKK----------QYRYKH  407

Query  435  SYQRRNDDDD  406
             +QRR D+DD
Sbjct  408  HHQRRRDEDD  417



>ref|XP_006283825.1| hypothetical protein CARUB_v10004926mg [Capsella rubella]
 gb|EOA16723.1| hypothetical protein CARUB_v10004926mg [Capsella rubella]
Length=415

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 105/162 (65%), Gaps = 24/162 (15%)
 Frame = -2

Query  798  SEYGSGYGRRNESESEYGSGRKPSYGREEDrpsygrseesegygrssYDRPSYGRSNDEE  619
            S  GSGYG R+ESE E    RKPSYGR E++    +             +PSYGRS ++E
Sbjct  179  SGLGSGYGGRSESEYE----RKPSYGRSEEQEEGYK-------------KPSYGRSEEQE  221

Query  618  E-YRKPSYGRSNDEEE--YRKPSYGRSNDE-EEYRKPSYGRSSDEDE-YRKPSYGRSNDE  454
            E YRKPSYGRS ++EE  YRKPSYGRS ++ E Y KPSYGRS D++E YRKPSYGRS D+
Sbjct  222  EGYRKPSYGRSEEQEEGSYRKPSYGRSEEQVESYIKPSYGRSEDQEEGYRKPSYGRSEDQ  281

Query  453  EE--YRKPSYQRRNDDDDESYGrrqrrddddddDSYGRKKYG  334
            EE  YRKPSY R  D ++ SY +      ++  +SY +  YG
Sbjct  282  EEGSYRKPSYGRSEDQEEGSYRKPSYGGSEEQVESYIKPSYG  323


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 85/137 (62%), Gaps = 24/137 (18%)
 Frame = -2

Query  792  YGSGYGRRNESESEYGSG---RKPSYGREEDrpsygrseesegygrssYDRPSYGRSNDE  622
            YGSGYG R E+ESEYGSG    +  YGR  +                      YG  ++ 
Sbjct  148  YGSGYGGRTETESEYGSGGGRTEVEYGRRPESGLGS----------------GYGGRSES  191

Query  621  EEYRKPSYGRSNDEEE-YRKPSYGRSNDEEE-YRKPSYGRSSDEDE--YRKPSYGRSNDE  454
            E  RKPSYGRS ++EE Y+KPSYGRS ++EE YRKPSYGRS +++E  YRKPSYGRS ++
Sbjct  192  EYERKPSYGRSEEQEEGYKKPSYGRSEEQEEGYRKPSYGRSEEQEEGSYRKPSYGRSEEQ  251

Query  453  -EEYRKPSYQRRNDDDD  406
             E Y KPSY R  D ++
Sbjct  252  VESYIKPSYGRSEDQEE  268


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 91/157 (58%), Gaps = 35/157 (22%)
 Frame = -2

Query  780  YGRRNESESEYGSGRKPSYGREEDrpsygrseesegygrssYDRPSYGRSNDEEE--YRK  607
            YGR  + E  Y   RKPSYGR ED+                  +PSYGRS D+EE  YRK
Sbjct  260  YGRSEDQEEGY---RKPSYGRSEDQEEGSYR------------KPSYGRSEDQEEGSYRK  304

Query  606  PSYGRSNDE-EEYRKPSYGRSNDEEE--YRKPSYGRSSDEDE--YRKPSYGRSNDEEEYR  442
            PSYG S ++ E Y KPSYGRS D+EE  YRKPSYGRS +++E  YRKPSYGR ND+++  
Sbjct  305  PSYGGSEEQVESYIKPSYGRSEDQEEGSYRKPSYGRSEEQEEGSYRKPSYGRRNDDDDDN  364

Query  441  KPSYQRRNDDDDESYGrrqrrddddddDSYGRKKYGG  331
            +    R    DDE             + SYGRKKYGG
Sbjct  365  EQRRNRSGSGDDE-------------EGSYGRKKYGG  388


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 82/202 (41%), Positives = 94/202 (47%), Gaps = 91/202 (45%)
 Frame = -2

Query  780  YGRRNESESEYGSGRKPSYGREEDrpsygrseesegygrssYDRPSYGRSNDEEE-YRKP  604
            YGR  E E   GS RKPSYGR E++                  +PSYGRS D+EE YRKP
Sbjct  229  YGRSEEQEE--GSYRKPSYGRSEEQVESYI-------------KPSYGRSEDQEEGYRKP  273

Query  603  SYGRSNDEEE--YRKPSYGRSNDEEE-----------------YRKPSYGRSSDEDE--Y  487
            SYGRS D+EE  YRKPSYGRS D+EE                 Y KPSYGRS D++E  Y
Sbjct  274  SYGRSEDQEEGSYRKPSYGRSEDQEEGSYRKPSYGGSEEQVESYIKPSYGRSEDQEEGSY  333

Query  486  RKPSYGRSNDEEE--YRKPSY-----------QRRN------------------------  418
            RKPSYGRS ++EE  YRKPSY           QRRN                        
Sbjct  334  RKPSYGRSEEQEEGSYRKPSYGRRNDDDDDNEQRRNRSGSGDDEEGSYGRKKYGGNDSDD  393

Query  417  -----------------DDDDE  403
                             D+DD+
Sbjct  394  DEEKKQHRHKHHHQRRRDEDDD  415



>ref|XP_010450798.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At5g39570-like 
[Camelina sativa]
Length=407

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 100/171 (58%), Gaps = 39/171 (23%)
 Frame = -2

Query  792  YGSGYGRRNESESEYGSG-----------------------------RKPSYGREEDrps  700
            YGSGYG R E+ESEYGSG                             RKPSYGR E++  
Sbjct  148  YGSGYGGRTETESEYGSGGGRTEVEYGRRPESGLGSGYGGRSESEYERKPSYGRSEEQEE  207

Query  699  ygrseesegygrssYD--RPSYGRSNDEEE--YRKPSYGRSND-EEEYRKPSYGRSNDEE  535
              R     G         +PSYGRS D+EE  YRKPSYGRS + EE YRKPSYGRS ++E
Sbjct  208  GYRKPSYGGSEEQEGGYRKPSYGRSEDQEEGSYRKPSYGRSEEGEEGYRKPSYGRSEEQE  267

Query  534  E--YRKPSYGRSSDEDE-YRKPSYGRSNDEEE--YRKPSYQRRNDDDDESY  397
            E  YRKPSYGRS D+ E Y KPSYGRS ++EE  YRKPSY R  + ++ SY
Sbjct  268  EGSYRKPSYGRSEDQVESYIKPSYGRSEEQEEGSYRKPSYGRSEEQEEGSY  318


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 61/96 (64%), Gaps = 21/96 (22%)
 Frame = -2

Query  780  YGRRNESESEYGSGRKPSYGREEDrpsygrseesegygrssYDRPSYGRSNDEEE--YRK  607
            YGR  E E   GS RKPSYGR ED+                  +PSYGRS ++EE  YRK
Sbjct  260  YGRSEEQEE--GSYRKPSYGRSEDQVESYI-------------KPSYGRSEEQEEGSYRK  304

Query  606  PSYGRSNDEEE--YRKPSYGRSNDEEE--YRKPSYG  511
            PSYGRS ++EE  YRKPSYGRS ++EE  YRKPSYG
Sbjct  305  PSYGRSEEQEEGSYRKPSYGRSEEQEEGSYRKPSYG  340



>ref|XP_006283826.1| hypothetical protein CARUB_v10004926mg [Capsella rubella]
 gb|EOA16724.1| hypothetical protein CARUB_v10004926mg [Capsella rubella]
Length=380

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 100/160 (63%), Gaps = 42/160 (26%)
 Frame = -2

Query  798  SEYGSGYGRRNESESEYGSGRKPSYGREEDrpsygrseesegygrssYDRPSYGRSNDEE  619
            S  GSGYG R+ESE E    RKPSYGR E++    R             +PSYGRS D+E
Sbjct  179  SGLGSGYGGRSESEYE----RKPSYGRSEEQEEGYR-------------KPSYGRSEDQE  221

Query  618  E--YRKPSYGRSNDEEE--YRKPSYGRSNDEEE-YRKPSYGRSSDEDE--YRKPSYGRSN  460
            E  YRKPSYGRS D+EE  YRKPSYG S ++ E Y KPSYGRS D++E  YRKPSYGRS 
Sbjct  222  EGSYRKPSYGRSEDQEEGSYRKPSYGGSEEQVESYIKPSYGRSEDQEEGSYRKPSYGRSE  281

Query  459  DEEE--YRKPSY-----------QRRN-----DDDDESYG  394
            ++EE  YRKPSY           QRRN     DD++ SYG
Sbjct  282  EQEEGSYRKPSYGRRNDDDDDNEQRRNRSGSGDDEEGSYG  321


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 75/156 (48%), Gaps = 44/156 (28%)
 Frame = -2

Query  792  YGSGYGRRNESESEYGSGRKPSYGREEDrpsygrseesegygrssYDRPSYGRSNDEEEY  613
            YGSGYG R E+ESEYGSG                                 G   + E  
Sbjct  148  YGSGYGGRTETESEYGSG---------------------------------GGRTEVEYG  174

Query  612  RKPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSSDEDE-YRKPSYGRSNDEEE--YR  442
            R+P  G  +         YG  ++ E  RKPSYGRS +++E YRKPSYGRS D+EE  YR
Sbjct  175  RRPESGLGS--------GYGGRSESEYERKPSYGRSEEQEEGYRKPSYGRSEDQEEGSYR  226

Query  441  KPSYQRRNDDDDESYGrrqrrddddddDSYGRKKYG  334
            KPSY R  D ++ SY +      ++  +SY +  YG
Sbjct  227  KPSYGRSEDQEEGSYRKPSYGGSEEQVESYIKPSYG  262



>ref|XP_010435878.1| PREDICTED: uncharacterized protein At5g39570-like [Camelina sativa]
Length=364

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 103/172 (60%), Gaps = 41/172 (24%)
 Frame = -2

Query  783  GYGRRNESESEYGSGRKPSYGREEDrpsygrseesegygrssYDRPSYGRSNDEEE-YRK  607
            GYG R+ESE E    RKPSYGR E+                   +PSYG S D+EE YRK
Sbjct  186  GYGGRSESEYE----RKPSYGRSEEGYR----------------KPSYGGSEDQEEGYRK  225

Query  606  PSYGRSNDEEE-YRKPSYGRSND-EEEYRKPSYGRSSDEDE--YRKPSYGRSNDE-EEYR  442
            PSY RS ++EE YRKPSYGRS + EE YRKPSYGRS D++E  YRKPSYGRS D+ E Y 
Sbjct  226  PSYERSEEQEEGYRKPSYGRSEEGEEGYRKPSYGRSEDQEEGSYRKPSYGRSEDQVESYI  285

Query  441  KPSYQRRNDDDDESY---------------GrrqrrddddddDSYGRKKYGG  331
            KPSY R  D ++ SY                RR R    D++ SYGRKKYGG
Sbjct  286  KPSYGRSEDQEEGSYRKPSYGRRNDDDDDEQRRDRSGSGDEEGSYGRKKYGG  337



>ref|XP_003618539.1| hypothetical protein MTR_6g012780 [Medicago truncatula]
 gb|AES74757.1| pro-resilin, putative [Medicago truncatula]
Length=411

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 101/176 (57%), Gaps = 41/176 (23%)
 Frame = -2

Query  780  YGRRNE---SESEYGSG--------------------RKPSYGREEDrpsygrseesegy  670
            YGR+NE    ESEYGSG                    RKPSYGR ++        ++   
Sbjct  225  YGRKNEYESGESEYGSGRKKSGYGEEEGYGGGRSEYERKPSYGRSDEEEKPSYGRKTSYG  284

Query  669  grssYDRPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSSDEDE  490
                 ++PSYGRS++EE   KPSYGRS  E   RKPSYGRS+DEE   KPSYGR+  E  
Sbjct  285  RSDEEEKPSYGRSDEEE---KPSYGRSEYE---RKPSYGRSDDEE---KPSYGRTEYE--  333

Query  489  YRKPSYGRSNDEEEY---RKPSYQRRNDDDDESYGrrqrrddddddDSYGRKKYGG  331
             RKPSYGRS+DEE+    RK SY R +D++  SYG        DDD+ YGRKKYGG
Sbjct  334  -RKPSYGRSDDEEKPSYGRKTSYGRSDDEEKPSYG---SERRGDDDEGYGRKKYGG  385



>ref|XP_006283824.1| hypothetical protein CARUB_v10004926mg [Capsella rubella]
 gb|EOA16722.1| hypothetical protein CARUB_v10004926mg [Capsella rubella]
Length=384

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 89/223 (40%), Positives = 105/223 (47%), Gaps = 82/223 (37%)
 Frame = -2

Query  792  YGSGYGRRNESESEYGSG-----------------------------RKPSYGREEDrps  700
            YGSGYG R E+ESEYGSG                             RKPSYGR E++  
Sbjct  148  YGSGYGGRTETESEYGSGGGRTEVEYGRRPESGLGSGYGGRSESEYERKPSYGRSEEQEE  207

Query  699  ygrseesegygrssYD--RPSYGRSNDEEE-YRKPSYGRSNDEEE--YRKPSYGRSNDEE  535
              +               +PSYGRS D+EE YRKPSYGRS D+EE  YRKPSYGRS D+E
Sbjct  208  GYKKPSYGRSEEQEEGYRKPSYGRSEDQEEGYRKPSYGRSEDQEEGSYRKPSYGRSEDQE  267

Query  534  E---------------------------------YRKPSYGRSSDEDE--YRKPSYGRSN  460
            E                                 YRKPSYGRS +++E  YRKPSYGR N
Sbjct  268  EGSYRKPSYGGSEEQVESYIKPSYGRSEDQEEGSYRKPSYGRSEEQEEGSYRKPSYGRRN  327

Query  459  DEEEYRKPSYQRRNDDDDESYGrrqrrddddddDSYGRKKYGG  331
            D+++  +    R    DDE             + SYGRKKYGG
Sbjct  328  DDDDDNEQRRNRSGSGDDE-------------EGSYGRKKYGG  357



>ref|XP_010441070.1| PREDICTED: uncharacterized protein At5g39570-like [Camelina sativa]
Length=395

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 97/160 (61%), Gaps = 27/160 (17%)
 Frame = -2

Query  780  YGRRNESESEYGSGRKPSYGREEDrpsygrseesegygrssYD---RPSYGRSNDEEE--  616
            YGR  E E   GS RKPSYGR ED+      + S G      +   +PSYGRS D+EE  
Sbjct  226  YGRSEEQEE--GSYRKPSYGRSEDQEEGSYRKPSYGRSEEGEEGYRKPSYGRSEDQEEGS  283

Query  615  YRKPSYGRSNDE-EEYRKPSYGRSNDEEE--YRKPSYGRSSDEDE--YRKPSYGRSNDEE  451
            YRKPSYGRS D+ E Y KPSYGRS D+EE  YRKPSYGRS D++E  YRKPSYGR ND++
Sbjct  284  YRKPSYGRSEDQVESYIKPSYGRSEDQEEGSYRKPSYGRSEDQEEGSYRKPSYGRRNDDD  343

Query  450  EYRKPSYQRRNDDDDESYGrrqrrddddddDSYGRKKYGG  331
            +  +   +  + D++                SYGRKKYGG
Sbjct  344  DDEQRRDRSGSGDEE---------------GSYGRKKYGG  368


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 79/129 (61%), Gaps = 26/129 (20%)
 Frame = -2

Query  780  YGRRNESESEYGSG---RKPSYGREEDrpsygrseesegygrssYDRPSYGRSNDEEEYR  610
            YG R E+ SEYGSG    +  YGR  +                      YG  ++ E  R
Sbjct  148  YGGRTETGSEYGSGGGRTEVEYGRRPESGLGS----------------GYGGRSESEYER  191

Query  609  KPSYGRSNDEEE-YRKPSYGRSNDEEE--YRKPSYGRSSDEDE--YRKPSYGRSNDEEE-  448
            KPSYGRS ++EE YRKPSYGRS D+EE  YRKPSYGRS +++E  YRKPSYGRS D+EE 
Sbjct  192  KPSYGRSEEQEEGYRKPSYGRSEDQEEGSYRKPSYGRSEEQEEGSYRKPSYGRSEDQEEG  251

Query  447  -YRKPSYQR  424
             YRKPSY R
Sbjct  252  SYRKPSYGR  260



>gb|KEH25017.1| pro-resilin, putative [Medicago truncatula]
Length=390

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 99/174 (57%), Gaps = 41/174 (24%)
 Frame = -2

Query  780  YGRRNE---SESEYGSG--------------------RKPSYGREEDrpsygrseesegy  670
            YGR+NE    ESEYGSG                    RKPSYGR ++        ++   
Sbjct  225  YGRKNEYESGESEYGSGRKKSGYGEEEGYGGGRSEYERKPSYGRSDEEEKPSYGRKTSYG  284

Query  669  grssYDRPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSSDEDE  490
                 ++PSYGRS++EE   KPSYGRS  E   RKPSYGRS+DEE   KPSYGR+  E  
Sbjct  285  RSDEEEKPSYGRSDEEE---KPSYGRSEYE---RKPSYGRSDDEE---KPSYGRTEYE--  333

Query  489  YRKPSYGRSNDEEEY---RKPSYQRRNDDDDESYGrrqrrddddddDSYGRKKY  337
             RKPSYGRS+DEE+    RK SY R +D++  SYG        DDD+ YGRKKY
Sbjct  334  -RKPSYGRSDDEEKPSYGRKTSYGRSDDEEKPSYG---SERRGDDDEGYGRKKY  383


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 88/172 (51%), Gaps = 58/172 (34%)
 Frame = -2

Query  783  GYGRRNE---SESEYGSGRK--------------------PSYGREEDrpsygrseeseg  673
            GYGR+NE    ESEYGSGRK                    PSYGR ++        ++  
Sbjct  224  GYGRKNEYESGESEYGSGRKKSGYGEEEGYGGGRSEYERKPSYGRSDEEEKPSYGRKTSY  283

Query  672  ygrssYDRPSYGRSNDEE-------EY-RKPSYGRSNDEE-------EY-RKPSYGRSND  541
                  ++PSYGRS++EE       EY RKPSYGRS+DEE       EY RKPSYGRS+D
Sbjct  284  GRSDEEEKPSYGRSDEEEKPSYGRSEYERKPSYGRSDDEEKPSYGRTEYERKPSYGRSDD  343

Query  540  EEEY---RKPSYGRSSDEDEYRKPSYGRSNDEEEYRKPSYQRRNDDDDESYG  394
            EE+    RK SYGRS DE+   KPSYG               R  DDDE YG
Sbjct  344  EEKPSYGRKTSYGRSDDEE---KPSYG-------------SERRGDDDEGYG  379



>ref|XP_006405619.1| hypothetical protein EUTSA_v10027782mg [Eutrema salsugineum]
 gb|ESQ47072.1| hypothetical protein EUTSA_v10027782mg [Eutrema salsugineum]
Length=312

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 92/161 (57%), Gaps = 42/161 (26%)
 Frame = -2

Query  792  YGSGYGRRNESESEYGSG--RKPSYGREEDrpsygrseesegygrssYDRPSYGRSNDEE  619
            YGSGYG R E+ESEYGSG   +  YGR  +    G SE              YG   +  
Sbjct  160  YGSGYGGRTEAESEYGSGGRTEVEYGRRPESGYGGGSET------------GYGSGYE--  205

Query  618  EYRKPSYGRSNDEEEYRKPSYGRSNDEEE-YRKPSYGRSSDEDE--YRKPSYGRSNDEEE  448
              +KPS+G    E E RKPSYGRS ++EE YRKPSYGRS +++E  YRKPSYGRS ++EE
Sbjct  206  --KKPSFGEERSEYE-RKPSYGRSEEQEEGYRKPSYGRSEEQEEEGYRKPSYGRSEEQEE  262

Query  447  --YRKPSYQRRNDDDDESYGrrqrrddddddDSYGRKKYGG  331
              YRKPSY     DD+E               SYGRKKYGG
Sbjct  263  GSYRKPSY----GDDEEG--------------SYGRKKYGG  285



>ref|XP_009139903.1| PREDICTED: uncharacterized protein At5g39570 [Brassica rapa]
Length=365

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 102/162 (63%), Gaps = 41/162 (25%)
 Frame = -2

Query  786  SGYGRRNESESEYGSG--RKPSYGREEDrpsygrseesegygrssYDRPSYGRSNDEEEY  613
            SGYG R+E+E+ YGSG  +KPS+G E                          RS  E   
Sbjct  207  SGYGGRSETETGYGSGYEKKPSFGEE--------------------------RSEYE---  237

Query  612  RKPSYGRSNDEEE--YRKPSYGRSNDE-EEYRKPS-YGRSSDEDE--YRKPSYGRSNDEE  451
            RKPSYGRS D+EE  YRKPSYGRS D+ E Y KPS YGRS +E+   YRKPSYGRS ++E
Sbjct  238  RKPSYGRSEDQEEGGYRKPSYGRSEDQVESYIKPSSYGRSEEEEGGGYRKPSYGRSEEQE  297

Query  450  E--YRKPSYQRRNDDDDESYGrrqrrddddddDSYGRKKYGG  331
            E  YRKPSY RRNDDDD+    R+ R  DD++ SYGRKKYGG
Sbjct  298  EGSYRKPSYGRRNDDDDDE--ERRNRSGDDEEGSYGRKKYGG  337



>emb|CDY30254.1| BnaC04g31650D [Brassica napus]
Length=314

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 85/161 (53%), Gaps = 52/161 (32%)
 Frame = -2

Query  786  SGYGRRNESESEYGSGR-----KPSYGREEDrpsygrseesegygrssYDRPSYGRSNDE  622
            SGYG R+ESE+ YG  R     KPSYGR E+                           DE
Sbjct  169  SGYGGRSESETGYGEERSEYERKPSYGRSEE---------------------------DE  201

Query  621  EEYRKPSYGRSNDE-EEYRKPS-YGRSNDEE-EYRKPSYGRS-SDEDEYRKPSYGRSNDE  454
              YR+PSYGRS D+ E Y KPS YGRS +EE  YRKPSYGRS  DE  YR+PSYGR ND+
Sbjct  202  GGYRQPSYGRSEDQVESYIKPSSYGRSEEEEGSYRKPSYGRSEEDEGGYRQPSYGRRNDD  261

Query  453  EEYRKPSYQRRNDDDDESYGrrqrrddddddDSYGRKKYGG  331
            +       +RRN   D+  G            SYGRKKYGG
Sbjct  262  DN----DEERRNRSGDDEEG------------SYGRKKYGG  286



>gb|KJB11082.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=384

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 82/136 (60%), Gaps = 22/136 (16%)
 Frame = -2

Query  798  SEYGSGYGRRNESESEYGS--GRKPSYGREEDrpsygrseesegygrssYDRPSYGRSN-  628
            SE+GS YGR+ E   EYGS  GR+P+YG  E     G   ++E  G  S     YGR   
Sbjct  212  SEFGSEYGRKPE-HGEYGSEYGRRPNYGEPESEYGSGFGRKAEYEGGGSEYGTGYGRRTE  270

Query  627  ----------DEEEY-----RKPSYGRSNDEEE-YRKPSYGRSNDEEE-YRKPSYGRSSD  499
                       E EY     RKPSYGRS +EEE YRKPSYGRS +EEE YRKPSYGRS +
Sbjct  271  GEYGSGYGGRTETEYGSGYERKPSYGRSEEEEEGYRKPSYGRSEEEEEGYRKPSYGRSEE  330

Query  498  EDE-YRKPSYGRSNDE  454
            E E YRKPSYGRS +E
Sbjct  331  EAEGYRKPSYGRSEEE  346


 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 67/122 (55%), Gaps = 45/122 (37%)
 Frame = -2

Query  798  SEYGSGY------------GRRNESESEYGSG--RKPSYGREEDrpsygrseesegygrs  661
            SEYG+GY            G R  +E+EYGSG  RKPSYGR E+                
Sbjct  259  SEYGTGYGRRTEGEYGSGYGGR--TETEYGSGYERKPSYGRSEE----------------  300

Query  660  sYDRPSYGRSNDEEEYRKPSYGRSNDEEE-YRKPSYGRSNDEEE-YRKPSYGRSSDEDEY  487
                       +EE YRKPSYGRS +EEE YRKPSYGRS +E E YRKPSYGRS +E   
Sbjct  301  -----------EEEGYRKPSYGRSEEEEEGYRKPSYGRSEEEAEGYRKPSYGRSEEEGYG  349

Query  486  RK  481
            RK
Sbjct  350  RK  351



>ref|WP_044126747.1| hypothetical protein [Prevotella dentalis]
Length=174

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 60/122 (49%), Gaps = 4/122 (3%)
 Frame = -2

Query  780  YGRRNESESEYGSGRKPSYGREEDrpsygrseesegygrssYDRPSYGRSNDEEEYRKPS  601
            +G RN+     G   KPS+G   D+   G+        +    +PS+G  N +    KPS
Sbjct  43   WGLRNDK----GMVGKPSWGPRNDKGMVGKPSWGPRNDKGMAGKPSWGPRNAKGMVGKPS  98

Query  600  YGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSSDEDEYRKPSYGRSNDEEEYRKPSYQRR  421
            +G  N +    KPS+G  + +    KPS+G  +D+    KPS+G  ND+    KPS+  R
Sbjct  99   WGPRNAKGMVGKPSWGPLSAKGMVGKPSWGPRNDKGMVGKPSWGPQNDKGMVGKPSWGPR  158

Query  420  ND  415
            ND
Sbjct  159  ND  160


 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -2

Query  651  RPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSSDEDEYRKPSY  472
            R S+G  ND+    KPS+G  ND+    KPS+G  ND+    KPS+G  + +    KPS+
Sbjct  40   RLSWGLRNDKGMVGKPSWGPRNDKGMVGKPSWGPRNDKGMAGKPSWGPRNAKGMVGKPSW  99

Query  471  GRSNDEEEYRKPSY  430
            G  N +    KPS+
Sbjct  100  GPRNAKGMVGKPSW  113


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 48/94 (51%), Gaps = 0/94 (0%)
 Frame = -2

Query  735  KPSYGREEDrpsygrseesegygrssYDRPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSY  556
            KPS+G   D+   G+        +    +PS+G  N +    KPS+G  + +    KPS+
Sbjct  68   KPSWGPRNDKGMAGKPSWGPRNAKGMVGKPSWGPRNAKGMVGKPSWGPLSAKGMVGKPSW  127

Query  555  GRSNDEEEYRKPSYGRSSDEDEYRKPSYGRSNDE  454
            G  ND+    KPS+G  +D+    KPS+G  ND+
Sbjct  128  GPRNDKGMVGKPSWGPQNDKGMVGKPSWGPRNDK  161



>emb|CDX74447.1| BnaA04g09420D [Brassica napus]
Length=335

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 78/102 (76%), Gaps = 10/102 (10%)
 Frame = -2

Query  612  RKPSYGRSNDEEE--YRKPSYGRSNDE-EEYRKPS-YGRSSDEDE--YRKPSYGRSNDEE  451
            RKPSYGRS D+EE  YRKPSYGRS D+ E Y KPS YGRS +E+   YRKPSYGRS ++E
Sbjct  208  RKPSYGRSEDQEEGGYRKPSYGRSEDQVESYIKPSSYGRSEEEEGGGYRKPSYGRSEEQE  267

Query  450  E--YRKPSYQRRNDDDDESYGrrqrrddddddDSYGRKKYGG  331
            E  YRKPSY RRNDDDD+    R+ R  DD++ SYGRKKYGG
Sbjct  268  EGSYRKPSYGRRNDDDDDE--ERRNRSGDDEEGSYGRKKYGG  307



>ref|WP_033002123.1| hypothetical protein [Aggregatibacter actinomycetemcomitans]
Length=147

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 36/68 (53%), Gaps = 0/68 (0%)
 Frame = -2

Query  642  YGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSSDEDEYRKPSYGRS  463
            YGR   EE YRK   GR   EE YRK   GR   EE YRK   GR   E+ YRK   GR 
Sbjct  24   YGRMVSEEWYRKNGIGRMVSEEWYRKNGIGRMVSEEWYRKNGIGRMVSEEWYRKNGIGRM  83

Query  462  NDEEEYRK  439
              EE YRK
Sbjct  84   VSEEWYRK  91


 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 33/66 (50%), Gaps = 0/66 (0%)
 Frame = -2

Query  642  YGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSSDEDEYRKPSYGRS  463
             GR   EE YRK   GR   EE YRK   GR   EE YRK   GR   E+ YRK   GR 
Sbjct  38   IGRMVSEEWYRKNGIGRMVSEEWYRKNGIGRMVSEEWYRKNGIGRMVSEEWYRKNGIGRM  97

Query  462  NDEEEY  445
              EE Y
Sbjct  98   VSEEWY  103



>ref|XP_005112527.1| PREDICTED: dentin sialophosphoprotein-like [Aplysia californica]
Length=1004

 Score = 62.8 bits (151),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -3

Query  647  LAMEGPMMKRSTGNLAMEGPMMKRSTGNLAMEGPMMKRSTGNLAMEGPVMKMSTGNLAME  468
            L++E P +   +GNL++E P +   +GNL++E P +   +GNL++E P +   +GNL++E
Sbjct  301  LSIESPTVSSVSGNLSIESPTVSSVSGNLSIESPTVSSVSGNLSIESPTVSSVSGNLSIE  360

Query  467  GPMMKRSTGNLAT  429
             P +   +GNL +
Sbjct  361  SPTVSSVSGNLTS  373


 Score = 62.8 bits (151),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -3

Query  647  LAMEGPMMKRSTGNLAMEGPMMKRSTGNLAMEGPMMKRSTGNLAMEGPVMKMSTGNLAME  468
            L++E P +   +GNL++E P +   +GNL++E P +   +GNL++E P +   +GNL++E
Sbjct  287  LSIESPTVSSVSGNLSIESPTVSSVSGNLSIESPTVSSVSGNLSIESPTVSSVSGNLSIE  346

Query  467  GPMMKRSTGNLA  432
             P +   +GNL+
Sbjct  347  SPTVSSVSGNLS  358


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -3

Query  647  LAMEGPMMKRSTGNLAMEGPMMKRSTGNLAMEGPMMKRSTGNLAMEGPVMKMSTGNLAME  468
            L++E P +    GNL++E P +   +GNL++E P +   +GNL++E P +   +GNL++E
Sbjct  273  LSIESPTVSSVNGNLSIESPTVSSVSGNLSIESPTVSSVSGNLSIESPTVSSVSGNLSIE  332

Query  467  GPMMKRSTGNLA  432
             P +   +GNL+
Sbjct  333  SPTVSSVSGNLS  344


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -3

Query  611  GNLAMEGPMMKRSTGNLAMEGPMMKRSTGNLAMEGPVMKMSTGNLAMEGPMMKRSTGNLA  432
            GNL++E P +    GNL++E P +   +GNL++E P +   +GNL++E P +   +GNL+
Sbjct  271  GNLSIESPTVSSVNGNLSIESPTVSSVSGNLSIESPTVSSVSGNLSIESPTVSSVSGNLS  330



>ref|XP_009781780.1| PREDICTED: uncharacterized protein At5g39570 [Nicotiana sylvestris]
Length=332

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 84/147 (57%), Gaps = 29/147 (20%)
 Frame = -2

Query  795  EYGSGYGRRNESE---SEYGSGRKPSYGREEDrpsygrseesegygrssYDRP------S  643
            EYGSGYGR++E E   SEYGSG    YGR+ +         S    +S Y+ P       
Sbjct  173  EYGSGYGRKSEYEEPTSEYGSG----YGRKSEYEEPAPEYGSGYRRKSEYEEPRSEYGSG  228

Query  642  YGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSSDEDE----YRKPS  475
            Y R  + EEY    YGR        KPSYG+  +EE  R+PSYGRSS + E    Y +P 
Sbjct  229  YERRTESEEYGSGGYGR--------KPSYGQ--EEEGERRPSYGRSSYQTEEGEGYERPR  278

Query  474  YGRSNDEEEYRKPSYQRRNDDDDESYG  394
            YGRS  EE+YRKPSY+RR DDDDE YG
Sbjct  279  YGRS--EEDYRKPSYERRGDDDDEGYG  303


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 68/113 (60%), Gaps = 29/113 (26%)
 Frame = -2

Query  798  SEYGSGYGRRNESESEYGSG---RKPSYGREEDrpsygrseesegygrssYDRPSYGRSN  628
            SEYGSGY RR ESE EYGSG   RKPSYG+EE+                   RPSYGRS+
Sbjct  223  SEYGSGYERRTESE-EYGSGGYGRKPSYGQEEEGER----------------RPSYGRSS  265

Query  627  DEEE----YRKPSYGRSNDEEEYRKPSYGR--SNDEEEYRKPSYG-RSSDEDE  490
             + E    Y +P YGRS  EE+YRKPSY R   +D+E Y +  YG  +SD+DE
Sbjct  266  YQTEEGEGYERPRYGRS--EEDYRKPSYERRGDDDDEGYGRKKYGDDNSDDDE  316



>gb|KFK33197.1| hypothetical protein AALP_AA6G342800 [Arabis alpina]
Length=374

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 88/174 (51%), Gaps = 52/174 (30%)
 Frame = -2

Query  780  YGRRNESESEYGSG--RKPSYGREEDrpsygrseesegygrssYDRPSYGRSNDEEE-YR  610
            YGRR ESE  YGSG  +K S+G E                     +PSYGRS ++EE YR
Sbjct  202  YGRRPESEPSYGSGYEKKESFGEERSEYER---------------KPSYGRSGEQEEGYR  246

Query  609  K-PSYGRSNDEEE-YRKPS-----------------YGRSNDEEE--YRKPSYGRSSDED  493
            K  SYG S ++EE YRKPS                 YGR  +EEE  YRKPSYG   +E 
Sbjct  247  KQSSYGGSEEQEEGYRKPSSYGGSEELVESYIKPSSYGRRTEEEEGSYRKPSYGEEQEEG  306

Query  492  EYRKPSYGRSNDEEEYRKPSYQRRNDDDDESYGrrqrrddddddDSYGRKKYGG  331
             YRKPSYGR ND+++  +    R    DDE             + SYGRKKYGG
Sbjct  307  SYRKPSYGRGNDDDDDGEQRRNRSGSGDDE-------------EGSYGRKKYGG  347



>ref|XP_009608846.1| PREDICTED: uncharacterized protein At5g39570-like [Nicotiana 
tomentosiformis]
Length=356

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 85/144 (59%), Gaps = 20/144 (14%)
 Frame = -2

Query  798  SEYGSGYGRRNESE---SEYGSG--RKPSYGREEDrpsygrseesegygrssYDRPSYGR  634
            SEYGSGYGR++E E   SEYGSG  RK  Y         G   +SE    SS     Y R
Sbjct  195  SEYGSGYGRKSEYEEPTSEYGSGYGRKSEYEEPAPEYGSGYRRKSEYEEPSSEYESGYER  254

Query  633  SNDEEEYRKPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSSDEDE----YRKPSYGR  466
             N+ EEY    YGR        KPSYG+  +EE  R+PSYGRSS + E    Y +P YGR
Sbjct  255  RNESEEYGSGGYGR--------KPSYGQ--EEEGERRPSYGRSSYQTEEGEGYERPRYGR  304

Query  465  SNDEEEYRKPSYQRRNDDDDESYG  394
            S +EE+Y+KPSY+RR D+DDE YG
Sbjct  305  S-EEEDYKKPSYERRRDEDDEGYG  327



>ref|XP_004489418.1| PREDICTED: uncharacterized protein At5g39570-like isoform X2 
[Cicer arietinum]
Length=340

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 92/158 (58%), Gaps = 23/158 (15%)
 Frame = -2

Query  798  SEYGSGYGRRNESESEYGSGRKPSYGREEDrpsygrseesegygrssYDRPSYGRSNDEE  619
            SEYG GYGRRNE E+E G GRK S    E+          +       +RPSYGRS  EE
Sbjct  177  SEYGGGYGRRNEEENE-GYGRKKS----EESEYGSGYGGRKKSDYGEEERPSYGRSEYEE  231

Query  618  EYRKPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSSDEDEYRKPSYGRSNDEEEYRK  439
               KPSYGRS  EE   KPSYGRS  E    KPSYGRS  E+   KPSYGRS  EE   K
Sbjct  232  ---KPSYGRSEYEE---KPSYGRSEYE---VKPSYGRSEYEE---KPSYGRSEYEE---K  276

Query  438  PSYQRRNDDDDES--YG-rrqrrddddddDSYGRKKYG  334
            PSY R  +  +E   YG  R+ R  DDDD+ YGRKKYG
Sbjct  277  PSYGRSENVSEEGVEYGYERRERRGDDDDEGYGRKKYG  314



>ref|XP_006893704.1| PREDICTED: ellis-van Creveld syndrome protein [Elephantulus edwardii]
Length=1566

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -2

Query  651  RPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSSDEDEYRKPSY  472
            RPS G S +++E R P+ G S +++E R+PS G S +++E R PS G S ++ E R+PS 
Sbjct  38   RPSEGPSLEKKEARHPNEGPSREKQEARRPSEGPSPEKKEARHPSEGPSPEKQEARRPSE  97

Query  471  GRSNDEEEYRKPS  433
            G S +++E R PS
Sbjct  98   GPSLEKKEARHPS  110


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = -2

Query  648  PSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSSDEDEYRKPSYG  469
            P+ G S +++E R+PS G S +++E R PS G S +++E R+PS G S ++ E R PS G
Sbjct  53   PNEGPSREKQEARRPSEGPSPEKKEARHPSEGPSPEKQEARRPSEGPSLEKKEARHPSEG  112

Query  468  RSNDEEEYRKP  436
             S ++++   P
Sbjct  113  PSGEKQQALCP  123


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  627  DEEEYRKPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSSDEDEYRKPSYGRSNDEEE  448
            ++ + R+PS G S +++E R P+ G S +++E R+PS G S ++ E R PS G S +++E
Sbjct  32   EKRQARRPSEGPSLEKKEARHPNEGPSREKQEARRPSEGPSPEKKEARHPSEGPSPEKQE  91

Query  447  YRKPS  433
             R+PS
Sbjct  92   ARRPS  96



>ref|XP_008353427.1| PREDICTED: uncharacterized protein At5g39570-like [Malus domestica]
Length=415

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 97/177 (55%), Gaps = 34/177 (19%)
 Frame = -2

Query  795  EYGSGYGRRNESES---EYGSG--RKPSYGRE----EDrpsygrseesegygrssYDRPS  643
            EY SGYGR+ E E+   E+GSG  RKPSYG E    ++ P      E  GYG     RP+
Sbjct  224  EYESGYGRKPEFEAPPAEFGSGYGRKPSYGEESGYGDEPPRKPSYGEEGGYGEEPPRRPT  283

Query  642  YGRSNDE--EEYRKPSYGRSNDEEEYRKPSYGRS-------NDEEEYRKPSYGRSSDED-  493
            YGR + E  E   +PSYGR+    E+ KP YG          DE    +PSYGR   E  
Sbjct  284  YGRPSYETPESEERPSYGRT----EFEKPGYGEEPPRRTGYGDEPPPPRPSYGRPGYEGQ  339

Query  492  ---EYRKPSYGRSNDEEEYRKP-SYQRRNDDDDESYGrrqrrddddddDSYGRKKYG  334
               EY KPSYGRS +E+EYR+P  Y+RR+DDD +S            ++ YGRKKYG
Sbjct  340  ESGEYEKPSYGRS-EEQEYRRPGGYERRSDDDSDS------ERPKYGEEXYGRKKYG  389



>ref|XP_004304279.1| PREDICTED: uncharacterized protein At5g39570 [Fragaria vesca 
subsp. vesca]
Length=390

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 93/180 (52%), Gaps = 34/180 (19%)
 Frame = -2

Query  795  EYGSGYGRRNESESEYGSGRKPSYGREEDrpsygrsee-----segygrssYDRPSYGRS  631
            E+GSGYGR+ E E   G GRKPSYG EE   S                  + ++PSYGRS
Sbjct  195  EFGSGYGRKPEFEGGPGYGRKPSYGEEESGGSSPPRRPGFGRPGGYGEEETEEKPSYGRS  254

Query  630  N--------------DEEEYRKPSYGR----SNDEEEYRKPSYGRSNDEEEYRKP--SYG  511
                           + EEY +P YGR    + + EE+ +PSYGR  +E+EYRKP  SYG
Sbjct  255  EYQEPPRRPSSYETPETEEYGRPKYGRPGYETPETEEFGRPSYGR-GEEQEYRKPKPSYG  313

Query  510  RSS-DEDEYRKPSYGRSNDEEEYRKPSYQRRNDDDDESYGrrqrrddddddDSYGRKKYG  334
            R S DED  R+     S+DE+  R+  +QRR  DD++S             + YGRKKYG
Sbjct  314  RGSDDEDSERRHQRRGSDDEDSERR--HQRRGSDDEDS-----EHRRGHGGEGYGRKKYG  366



>gb|ELU04471.1| hypothetical protein CAPTEDRAFT_211920 [Capitella teleta]
Length=231

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 40/79 (51%), Gaps = 0/79 (0%)
 Frame = +1

Query  430  VARFPVLLFIIGPSIARFPVLIFITGPSIARFPVLLFIIGPSIARFPVLLFIIGPSIARF  609
            +   PV    IGP++   PV I   GP++   PV +  IGP++   PV +  +GP++   
Sbjct  113  MCNIPVYTADIGPNMCNIPVYIADIGPNMCNIPVYIADIGPNMCNIPVYIADVGPNMCNI  172

Query  610  PVLLFIIGPSIARPIIGRS  666
            PV +  IGP++       +
Sbjct  173  PVYIADIGPNMQYECTNDN  191


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 38/73 (52%), Gaps = 0/73 (0%)
 Frame = +1

Query  430  VARFPVLLFIIGPSIARFPVLIFITGPSIARFPVLLFIIGPSIARFPVLLFIIGPSIARF  609
            +   PV +  IGP++   PV     GP++   PV    IGP++   PV +  IGP++   
Sbjct  85   MCNIPVYIADIGPNMCNIPVYTADVGPNMCNIPVYTADIGPNMCNIPVYIADIGPNMCNI  144

Query  610  PVLLFIIGPSIAR  648
            PV +  IGP++  
Sbjct  145  PVYIADIGPNMCN  157


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 0/73 (0%)
 Frame = +1

Query  430  VARFPVLLFIIGPSIARFPVLIFITGPSIARFPVLLFIIGPSIARFPVLLFIIGPSIARF  609
            +   PV    +GP++   PV     GP++   PV +  IGP++   PV +  IGP++   
Sbjct  99   MCNIPVYTADVGPNMCNIPVYTADIGPNMCNIPVYIADIGPNMCNIPVYIADIGPNMCNI  158

Query  610  PVLLFIIGPSIAR  648
            PV +  +GP++  
Sbjct  159  PVYIADVGPNMCN  171


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 36/73 (49%), Gaps = 0/73 (0%)
 Frame = +1

Query  430  VARFPVLLFIIGPSIARFPVLIFITGPSIARFPVLLFIIGPSIARFPVLLFIIGPSIARF  609
            +   PV +  IGP++   PV     GP++   PV    IGP++   PV    +GP++   
Sbjct  1    MCNIPVYIANIGPNMCNIPVYTADIGPNMCNIPVYTADIGPNMCNIPVYTAYVGPNMCNI  60

Query  610  PVLLFIIGPSIAR  648
            PV    IGP++  
Sbjct  61   PVYTADIGPNMCN  73



>ref|XP_004232206.1| PREDICTED: uncharacterized protein At5g39570 [Solanum lycopersicum]
Length=362

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 63/106 (59%), Gaps = 34/106 (32%)
 Frame = -2

Query  798  SEYGSGYGRRNESESEYGSG---RKPSYGREEDrpsygrseesegygrssYDRPSYGRSN  628
            SEYGSGYGRRNESE EYGSG   RKPSYG+EE                   +RPSYGR  
Sbjct  256  SEYGSGYGRRNESE-EYGSGGYGRKPSYGQEEG------------------ERPSYGR--  294

Query  627  DEEEYRKPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSSDEDE  490
                   PSY ++ + E Y +P YGRS  EE+YRKPSY R  D+DE
Sbjct  295  -------PSY-QAEEGEGYERPHYGRS--EEDYRKPSYERRGDDDE  330



>ref|XP_008341598.1| PREDICTED: uncharacterized protein At5g39570 [Malus domestica]
Length=415

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 96/177 (54%), Gaps = 34/177 (19%)
 Frame = -2

Query  795  EYGSGYGRRNESES---EYGSG--RKPSYGRE----EDrpsygrseesegygrssYDRPS  643
            EY SGYGR+ E E+   E+GSG  RKPSYG E    ++ P      E  GYG     RP+
Sbjct  224  EYESGYGRKPEFEAPPAEFGSGYGRKPSYGEESGYGDEPPRKPSYGEEGGYGEEPPRRPT  283

Query  642  YGRSNDE--EEYRKPSYGRSNDEEEYRKPSYGRS-------NDEEEYRKPSYGRSSDED-  493
            YGR + E  E   +PSYGR+    E+ KP YG          DE    +PSYGR   E  
Sbjct  284  YGRPSYETPESEERPSYGRT----EFEKPGYGEEPPRRTGYGDEPPPPRPSYGRPGYEGX  339

Query  492  ---EYRKPSYGRSNDEEEYRKP-SYQRRNDDDDESYGrrqrrddddddDSYGRKKYG  334
               EY KPSYGRS +E+EYR+P  Y+RR+ DD +S            ++ YGRKKYG
Sbjct  340  ESGEYEKPSYGRS-EEQEYRRPGGYERRSXDDSDS------ERPKYGEEXYGRKKYG  389



>ref|XP_006338424.1| PREDICTED: uncharacterized protein At5g39570-like [Solanum tuberosum]
Length=355

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 64/106 (60%), Gaps = 33/106 (31%)
 Frame = -2

Query  798  SEYGSGYGRRNESESEYGSG---RKPSYGREEDrpsygrseesegygrssYDRPSYGRSN  628
            SEYGSGYGR+NESE EYGSG   RKPSYG+EE                   +RPSYGR  
Sbjct  248  SEYGSGYGRKNESE-EYGSGGYGRKPSYGQEEG------------------ERPSYGR--  286

Query  627  DEEEYRKPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSSDEDE  490
                   PSY ++ + E Y +P YGRS +EE+Y+KPSY R  D+DE
Sbjct  287  -------PSY-QAEEGEGYERPHYGRS-EEEDYKKPSYERRGDDDE  323



>gb|KJB11090.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=388

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 55/100 (55%), Gaps = 40/100 (40%)
 Frame = -2

Query  798  SEYGSGYGRRNE----------SESEYGSG--RKPSYGREEDrpsygrseesegygrssY  655
            SEYG+GYGRR E          +E+EYGSG  RKPSYGR E+                  
Sbjct  259  SEYGTGYGRRTEGEYGSGYGGRTETEYGSGYERKPSYGRSEE------------------  300

Query  654  DRPSYGRSNDEEEYRKPSYGRSNDEEE-YRKPSYGRSNDE  538
                     +EE YRKPSYGRS +EEE YRKPSYGRS +E
Sbjct  301  ---------EEEGYRKPSYGRSEEEEEGYRKPSYGRSEEE  331


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 72/124 (58%), Gaps = 13/124 (10%)
 Frame = -2

Query  798  SEYGSGYGRRNESESEYGS--GRKPSYGREEDrpsygrseesegygrssYDRPSYGRSND  625
            SE+GS YGR+ E   EYGS  GR+P+YG  E     G   ++E  G  S     YGR  +
Sbjct  212  SEFGSEYGRKPE-HGEYGSEYGRRPNYGEPESEYGSGFGRKAEYEGGGSEYGTGYGRRTE  270

Query  624  EEEYRKPSYGRSNDEEEY-----RKPSYGRSNDEEE-YRKPSYGRSSDEDE-YRKPSYGR  466
             E            E EY     RKPSYGRS +EEE YRKPSYGRS +E+E YRKPSYGR
Sbjct  271  GEYGSG---YGGRTETEYGSGYERKPSYGRSEEEEEGYRKPSYGRSEEEEEGYRKPSYGR  327

Query  465  SNDE  454
            S +E
Sbjct  328  SEEE  331



>ref|XP_004489417.1| PREDICTED: uncharacterized protein At5g39570-like isoform X1 
[Cicer arietinum]
Length=367

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 66/117 (56%), Gaps = 31/117 (26%)
 Frame = -2

Query  798  SEYGSGYGRRNESESEYGSGRKPSYGREEDrpsygrseesegygrssYDRPSYGRSNDEE  619
            SEYGSGYG R +S+  YG   +PSYGR E                   ++PSYGRS  EE
Sbjct  229  SEYGSGYGGRKKSD--YGEEERPSYGRSE-----------------YEEKPSYGRSEYEE  269

Query  618  EYRKPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSSDEDEYRKPSYGRSNDEEE  448
               KPSYGRS  E    KPSYGRS  EE   KPSYGRS  E+   KPSYGRS +  E
Sbjct  270  ---KPSYGRSEYE---VKPSYGRSEYEE---KPSYGRSEYEE---KPSYGRSENVSE  314



>emb|CDX95231.1| BnaC09g16390D [Brassica napus]
Length=287

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 69/121 (57%), Gaps = 40/121 (33%)
 Frame = -2

Query  798  SEYG----SGYGRRNESESEYGSG--RKPSYGREEDrpsygrseesegygrssYDRPSYG  637
            +EYG    SGYG R+E+E+ YGSG  +KPS+G E                          
Sbjct  120  AEYGRRPESGYGGRSETETGYGSGYEKKPSFGEE--------------------------  153

Query  636  RSNDEEEYRKPSYGRSNDEEE-YRKPSYGRSNDEEE-YRKP-SYGRSSDEDE--YRKPSY  472
            RS  E   RKPSYGRS +EE  YRKPSYGRS D+ E Y KP SY RS +++E  YRKPSY
Sbjct  154  RSEYE---RKPSYGRSGEEEGGYRKPSYGRSEDQVESYIKPTSYERSEEQEEGSYRKPSY  210

Query  471  G  469
            G
Sbjct  211  G  211



>emb|CDP02257.1| unnamed protein product [Coffea canephora]
Length=379

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 78/121 (64%), Gaps = 20/121 (17%)
 Frame = -2

Query  798  SEYGSGYGRRN---ESESEYGSG-------------RKPSYGREEDrpsygrseesegyg  667
            SEYGSGYGR++   E  SEYGSG                 +GR+ +RPSY   E    YG
Sbjct  240  SEYGSGYGRKSGYEEPTSEYGSGYARKTSYGEEESGGYGGFGRKPERPSYESQESEGRYG  299

Query  666  rssYDRPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYG-RSNDEEEYRKPSY-GRSSDED  493
             SSY+RPSYGRS +EEEYRKPSYGRS +E EYRKPSYG R +D+E Y +  Y G  SD+D
Sbjct  300  GSSYERPSYGRS-EEEEYRKPSYGRS-EEGEYRKPSYGSRDDDDEGYGRKKYGGEGSDDD  357

Query  492  E  490
            E
Sbjct  358  E  358



>ref|XP_010552803.1| PREDICTED: uncharacterized protein At5g39570 [Tarenaya hassleriana]
Length=415

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 52/87 (60%), Gaps = 21/87 (24%)
 Frame = -2

Query  798  SEYGSGYGRRNESESEYGSG--RKPSYGREEDrpsygrseesegygrssYDRPSYGRSND  625
            SEYGSGYG R  +ESEYGSG  RKPSYG  E                    RPSYGR  +
Sbjct  283  SEYGSGYGGR--TESEYGSGYERKPSYGEGE--------------RTEYGSRPSYGRHEE  326

Query  624  EEE-YRKPSYGRSN--DEEEYRKPSYG  553
            +EE Y+KPSYG  N  DEE YRKPSYG
Sbjct  327  QEEGYKKPSYGSRNDDDEEGYRKPSYG  353



>ref|XP_009045296.1| hypothetical protein LOTGIDRAFT_156394 [Lottia gigantea]
 gb|ESP03814.1| hypothetical protein LOTGIDRAFT_156394 [Lottia gigantea]
Length=149

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -2

Query  624  EEEYRKPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSSDEDEYRKPSYGRSNDEEEY  445
            EEE +K SY R   EEE +K +Y R   EEE +K SY R + E+  +K +Y R+  EEE 
Sbjct  27   EEELQKNSYRRRTTEEELQKKNYRRRTIEEELQKNSYRRRTTEELLQKKNYRRTLTEEEL  86

Query  444  RKPSYQRRNDDDD  406
            +K +Y+ R  +++
Sbjct  87   QKKNYRIRITEEE  99



>ref|XP_007215367.1| hypothetical protein PRUPE_ppa005604mg [Prunus persica]
 gb|EMJ16566.1| hypothetical protein PRUPE_ppa005604mg [Prunus persica]
Length=452

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 88/171 (51%), Gaps = 41/171 (24%)
 Frame = -2

Query  798  SEYGSGYGRRNESESE---YGSG------------------RKPSYGR---EEDrpsygr  691
            SE+GSGYGR+ E E+    +GSG                  RKPSYGR   E        
Sbjct  235  SEHGSGYGRKPEFEAPGAGFGSGYERKPSYGEEPGYGDEPPRKPSYGRPSYETSESEERT  294

Query  690  seesegygrssYDRPSYGRSN-------DEEEYRKPSYGRSN--DEEEYRKPSYGRSN--  544
              ES GYG++ ++RP YG            E   +PSYGR    DE    +PSYGR    
Sbjct  295  KYESSGYGKTEFERPGYGEEPRRRPSYEIPESEERPSYGRPGYGDEPPPPRPSYGRPGYG  354

Query  543  DEEEYRKPSYGRSSDE----DEYRKPSYGRSNDEEEYRKP-SYQRRNDDDD  406
            DE    +PSYGR S E     EY KPSYGRS +E+EYR+P  Y+RR DDD+
Sbjct  355  DEPPPPRPSYGRPSYEGEESAEYEKPSYGRS-EEQEYRRPGGYERRGDDDE  404



>ref|XP_011098657.1| PREDICTED: uncharacterized protein At5g39570-like [Sesamum indicum]
Length=335

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 91/194 (47%), Gaps = 56/194 (29%)
 Frame = -2

Query  798  SEYGSGYGRRNESESEYGS--GRKPSYGREEDrpsygrseesegygrssYDRPSYGRSND  625
            SEYGS YGR+ E E  YGS  GRKP Y R +         + E    SS     YGR ++
Sbjct  131  SEYGSEYGRKPEYEQSYGSGYGRKPEYERPDSEYGSEYGRKPEYERPSSEYGSGYGRKSE  190

Query  624  EEEY---------RKP-----------SYGRSNDEEEYRKPSYGRSN-------------  544
             +E          RKP           SYGR  + EE+    YGR +             
Sbjct  191  YQEPTSEYSSGYGRKPESEYGGSEYGSSYGRKPESEEFGSGGYGRKSGYGEEESGGGYGY  250

Query  543  ---DEEEYRKPSYGRSSDEDE-YRKPSYGRSNDEEEYRKPSYQRRNDDDDESYGrrqrrd  376
               +E E  KPSYGR + E E Y +PSYGRS +EE+YRKPSY+RR+DDD           
Sbjct  251  GRRNEYEEEKPSYGRPTYETEGYERPSYGRS-EEEDYRKPSYERRDDDD-----------  298

Query  375  dddddDSYGRKKYG  334
                   YGRKKYG
Sbjct  299  -----SGYGRKKYG  307



>ref|XP_008230802.1| PREDICTED: uncharacterized protein At5g39570 [Prunus mume]
Length=468

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 57/94 (61%), Gaps = 12/94 (13%)
 Frame = -2

Query  654  DRPSYGRSN--DEEEYRKPSYGRSN--DEEEYRKPSYGRSN--DEEEYRKPSYGRSSDE-  496
            +RPSYGR    DE    +PSYG     DE+   +PSYG     DE    +PSYGR S E 
Sbjct  328  ERPSYGRPGYGDEPPPPRPSYGSPGYGDEQPPPRPSYGTPGYGDEPPPPRPSYGRPSYEG  387

Query  495  ---DEYRKPSYGRSNDEEEYRKP-SYQRRNDDDD  406
                EY KPSYGRS +E+EYR+P  Y+RR DDD+
Sbjct  388  EESAEYEKPSYGRS-EEQEYRRPGGYERRGDDDE  420



>ref|XP_010258396.1| PREDICTED: uncharacterized protein At5g39570-like isoform X1 
[Nelumbo nucifera]
Length=365

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 60/89 (67%), Gaps = 17/89 (19%)
 Frame = -2

Query  651  RPSYGRSNDEEEYRKPSYGRSNDEEEYRKPSYGRSN----DEEEYRKPSYGRSSDEDE--  490
            RPSYGR  +EEEYRKPSY R  +E+EYR+P+YG+ +    +E+EYR+P+Y + S E +  
Sbjct  158  RPSYGR-QEEEEYRKPSYER-QEEDEYRRPTYGKPSYERQEEDEYRRPTYEKPSYERQEE  215

Query  489  -------YRKPSYGRSNDEEEYRKPSYQR  424
                   Y KPS  R   EEEYR+P+Y++
Sbjct  216  EEYRRPTYEKPSCERQ--EEEYRRPTYEK  242



>gb|KHG07281.1| hypothetical protein F383_34041 [Gossypium arboreum]
Length=420

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 2/41 (5%)
 Frame = -2

Query  570  RKPSYGRSNDEEE-YRKPSYGRSSDEDE-YRKPSYGRSNDE  454
            RKPSYGRS +EEE YRKPSYGRS +E+E YRKPSYGRS +E
Sbjct  342  RKPSYGRSEEEEEGYRKPSYGRSEEEEEGYRKPSYGRSEEE  382



>ref|XP_010088125.1| hypothetical protein L484_013569 [Morus notabilis]
 gb|EXB31937.1| hypothetical protein L484_013569 [Morus notabilis]
Length=395

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 85/178 (48%), Gaps = 62/178 (35%)
 Frame = -2

Query  795  EYGSGYGRRNESES---EYGSG--RKPSYGREEDrpsygrseesegygrssYDRPSYG--  637
            E+GSGYGRR E ES   EYGSG  R+PS             E     G++ Y+RPSYG  
Sbjct  183  EHGSGYGRRTEYESSQGEYGSGYGRRPS----------YGEEGGGYGGKTEYERPSYGDE  232

Query  636  -----------------RSNDEEEYRKPSYGRSN-------------------DEEEYRK  565
                                +E EY +PSYG                      +E EY +
Sbjct  233  PPPPRRPSYGEEEGGGYGGRNESEYERPSYGEEPPPPRRPSYGEEEGGGYGGRNESEYER  292

Query  564  PSYGRSNDEEEYRKPSYGRSS----DEDEYRKPSYGRSNDEEEYRKPSYQRRNDDDDE  403
            PSYG    EE  R+PSYGR      +   Y +PSYGRS +EE+YRKPSY+RR  DD+E
Sbjct  293  PSYG----EEPPRRPSYGRQESGEYERPAYERPSYGRS-EEEDYRKPSYERRRKDDEE  345



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1641823912876