BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6936

Length=860
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006355077.1|  PREDICTED: putative clathrin assembly protei...    240   8e-71   Solanum tuberosum [potatoes]
ref|NP_001265941.1|  Hop-interacting protein THI028                     236   3e-69   Solanum lycopersicum
ref|XP_009777394.1|  PREDICTED: putative clathrin assembly protei...    234   7e-69   Nicotiana sylvestris
ref|XP_011070604.1|  PREDICTED: putative clathrin assembly protei...    225   3e-65   Sesamum indicum [beniseed]
ref|XP_009627948.1|  PREDICTED: putative clathrin assembly protei...    220   2e-63   Nicotiana tomentosiformis
emb|CDP00810.1|  unnamed protein product                                219   3e-63   Coffea canephora [robusta coffee]
ref|XP_010274743.1|  PREDICTED: putative clathrin assembly protei...    219   3e-63   Nelumbo nucifera [Indian lotus]
ref|XP_011023792.1|  PREDICTED: putative clathrin assembly protei...    218   1e-62   Populus euphratica
ref|XP_011023782.1|  PREDICTED: putative clathrin assembly protei...    218   1e-62   Populus euphratica
gb|EYU21032.1|  hypothetical protein MIMGU_mgv1a020579mg                217   4e-62   Erythranthe guttata [common monkey flower]
ref|XP_011463190.1|  PREDICTED: putative clathrin assembly protei...    216   8e-62   Fragaria vesca subsp. vesca
ref|XP_002311513.1|  clathrin assembly family protein                   216   1e-61   Populus trichocarpa [western balsam poplar]
ref|XP_008221433.1|  PREDICTED: putative clathrin assembly protei...    215   2e-61   Prunus mume [ume]
ref|XP_007222905.1|  hypothetical protein PRUPE_ppa003610mg             214   3e-61   Prunus persica
ref|XP_011075418.1|  PREDICTED: putative clathrin assembly protei...    211   1e-60   
ref|XP_002284689.2|  PREDICTED: putative clathrin assembly protei...    211   5e-60   Vitis vinifera
ref|XP_010654389.1|  PREDICTED: putative clathrin assembly protei...    211   6e-60   Vitis vinifera
gb|KJB60910.1|  hypothetical protein B456_009G330700                    209   8e-60   Gossypium raimondii
gb|KJB60907.1|  hypothetical protein B456_009G330700                    210   8e-60   Gossypium raimondii
gb|KJB60908.1|  hypothetical protein B456_009G330700                    210   8e-60   Gossypium raimondii
gb|EYU33129.1|  hypothetical protein MIMGU_mgv1a0037702mg               209   8e-60   Erythranthe guttata [common monkey flower]
gb|KJB60906.1|  hypothetical protein B456_009G330700                    209   1e-59   Gossypium raimondii
gb|KJB60905.1|  hypothetical protein B456_009G330700                    210   1e-59   Gossypium raimondii
ref|XP_008389195.1|  PREDICTED: putative clathrin assembly protei...    207   1e-58   Malus domestica [apple tree]
ref|XP_006448214.1|  hypothetical protein CICLE_v10014774mg             206   6e-58   Citrus clementina [clementine]
ref|XP_006469211.1|  PREDICTED: putative clathrin assembly protei...    206   6e-58   Citrus sinensis [apfelsine]
ref|XP_010265534.1|  PREDICTED: putative clathrin assembly protei...    204   2e-57   Nelumbo nucifera [Indian lotus]
ref|XP_004504573.1|  PREDICTED: putative clathrin assembly protei...    201   2e-56   Cicer arietinum [garbanzo]
ref|XP_009351512.1|  PREDICTED: putative clathrin assembly protei...    201   2e-56   Pyrus x bretschneideri [bai li]
ref|XP_008464707.1|  PREDICTED: putative clathrin assembly protei...    199   4e-55   
ref|XP_002315872.2|  hypothetical protein POPTR_0010s12020g             197   5e-55   
ref|XP_012072261.1|  PREDICTED: putative clathrin assembly protei...    197   6e-55   Jatropha curcas
ref|XP_011038608.1|  PREDICTED: putative clathrin assembly protei...    197   7e-55   Populus euphratica
ref|XP_002315925.2|  hypothetical protein POPTR_0010s12020g             197   7e-55   
ref|XP_007045208.1|  ENTH/ANTH/VHS superfamily protein                  197   1e-54   
ref|XP_004142277.1|  PREDICTED: putative clathrin assembly protei...    196   2e-54   Cucumis sativus [cucumbers]
ref|XP_010044208.1|  PREDICTED: putative clathrin assembly protei...    196   2e-54   Eucalyptus grandis [rose gum]
ref|XP_010101968.1|  Putative clathrin assembly protein                 196   3e-54   
ref|XP_002527787.1|  clathrin assembly protein, putative                196   4e-54   Ricinus communis
gb|KCW86253.1|  hypothetical protein EUGRSUZ_B02940                     194   2e-53   Eucalyptus grandis [rose gum]
ref|XP_003531146.1|  PREDICTED: putative clathrin assembly protei...    192   7e-53   Glycine max [soybeans]
gb|KHN12469.1|  Putative clathrin assembly protein                      192   8e-53   Glycine soja [wild soybean]
ref|XP_003524854.1|  PREDICTED: putative clathrin assembly protei...    192   9e-53   Glycine max [soybeans]
gb|KDO64585.1|  hypothetical protein CISIN_1g008579mg                   191   2e-52   Citrus sinensis [apfelsine]
ref|XP_007158803.1|  hypothetical protein PHAVU_002G183100g             189   1e-51   Phaseolus vulgaris [French bean]
ref|XP_010553785.1|  PREDICTED: putative clathrin assembly protei...    189   1e-51   Tarenaya hassleriana [spider flower]
gb|KHG06013.1|  hypothetical protein F383_02907                         186   8e-51   Gossypium arboreum [tree cotton]
gb|KHG06012.1|  hypothetical protein F383_02907                         187   2e-50   Gossypium arboreum [tree cotton]
ref|XP_003533950.1|  PREDICTED: putative clathrin assembly protei...    183   1e-49   Glycine max [soybeans]
gb|KHN03156.1|  Putative clathrin assembly protein                      183   1e-49   Glycine soja [wild soybean]
gb|KJB30771.1|  hypothetical protein B456_005G159800                    181   7e-49   Gossypium raimondii
gb|KJB30769.1|  hypothetical protein B456_005G159800                    181   8e-49   Gossypium raimondii
gb|KJB30768.1|  hypothetical protein B456_005G159800                    181   1e-48   Gossypium raimondii
gb|KJB78155.1|  hypothetical protein B456_012G181700                    178   3e-48   Gossypium raimondii
gb|KJB78156.1|  hypothetical protein B456_012G181700                    179   4e-48   Gossypium raimondii
gb|KJB78154.1|  hypothetical protein B456_012G181700                    179   5e-48   Gossypium raimondii
gb|KJB78157.1|  hypothetical protein B456_012G181700                    179   6e-48   Gossypium raimondii
ref|XP_007153280.1|  hypothetical protein PHAVU_003G022000g             174   2e-46   Phaseolus vulgaris [French bean]
gb|EPS70597.1|  hypothetical protein M569_04158                         172   2e-46   Genlisea aurea
ref|XP_010681909.1|  PREDICTED: putative clathrin assembly protei...    174   3e-46   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB30770.1|  hypothetical protein B456_005G159800                    173   9e-46   Gossypium raimondii
ref|XP_010527791.1|  PREDICTED: putative clathrin assembly protei...    165   4e-43   Tarenaya hassleriana [spider flower]
ref|XP_010921268.1|  PREDICTED: putative clathrin assembly protei...    159   2e-42   
ref|XP_010921261.1|  PREDICTED: putative clathrin assembly protei...    161   1e-41   
ref|XP_010921255.1|  PREDICTED: putative clathrin assembly protei...    161   1e-41   Elaeis guineensis
ref|XP_010921252.1|  PREDICTED: putative clathrin assembly protei...    161   1e-41   Elaeis guineensis
emb|CDY17459.1|  BnaC09g20780D                                          159   5e-41   Brassica napus [oilseed rape]
ref|XP_009114226.1|  PREDICTED: putative clathrin assembly protei...    159   6e-41   Brassica rapa
emb|CDY53525.1|  BnaC05g11150D                                          160   8e-41   Brassica napus [oilseed rape]
ref|XP_010924074.1|  PREDICTED: putative clathrin assembly protei...    156   7e-40   Elaeis guineensis
emb|CDY45299.1|  BnaA06g09690D                                          156   1e-39   Brassica napus [oilseed rape]
gb|AAM67368.1|  unknown                                                 151   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004969636.1|  PREDICTED: putative clathrin assembly protei...    155   2e-39   Setaria italica
ref|XP_009148877.1|  PREDICTED: putative clathrin assembly protei...    156   2e-39   Brassica rapa
ref|XP_006655551.1|  PREDICTED: putative clathrin assembly protei...    155   2e-39   Oryza brachyantha
ref|XP_010424931.1|  PREDICTED: putative clathrin assembly protei...    150   3e-39   
gb|KFK32949.1|  hypothetical protein AALP_AA6G310300                    155   4e-39   Arabis alpina [alpine rockcress]
gb|AAD12692.3|  expressed protein                                       151   4e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395874.1|  hypothetical protein EUTSA_v10003910mg             154   5e-39   Eutrema salsugineum [saltwater cress]
ref|NP_565267.1|  putative clathrin assembly protein                    152   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101331.1|  PREDICTED: putative clathrin assembly protei...    152   3e-38   Brassica rapa
emb|CDY17660.1|  BnaA06g34790D                                          152   3e-38   Brassica napus [oilseed rape]
ref|XP_002875082.1|  hypothetical protein ARALYDRAFT_904366             151   4e-38   Arabidopsis lyrata subsp. lyrata
emb|CDY36239.1|  BnaC07g20930D                                          151   5e-38   Brassica napus [oilseed rape]
gb|AFW80975.1|  hypothetical protein ZEAMMB73_079219                    149   2e-37   
ref|NP_001145773.1|  uncharacterized protein LOC100279280               149   2e-37   Zea mays [maize]
gb|AFW80976.1|  hypothetical protein ZEAMMB73_079219                    149   2e-37   
ref|XP_009418441.1|  PREDICTED: putative clathrin assembly protei...    149   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006646232.1|  PREDICTED: putative clathrin assembly protei...    149   3e-37   Oryza brachyantha
ref|XP_010496638.1|  PREDICTED: putative clathrin assembly protei...    150   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010459007.1|  PREDICTED: putative clathrin assembly protei...    150   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009396332.1|  PREDICTED: putative clathrin assembly protei...    148   4e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010476568.1|  PREDICTED: putative clathrin assembly protei...    149   4e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006306843.1|  hypothetical protein CARUB_v10008396mg             149   4e-37   Capsella rubella
emb|CDY09433.1|  BnaA02g25770D                                          147   9e-37   Brassica napus [oilseed rape]
ref|XP_009129221.1|  PREDICTED: putative clathrin assembly protei...    147   1e-36   
ref|NP_172944.1|  putative clathrin assembly protein                    148   1e-36   Arabidopsis thaliana [mouse-ear cress]
emb|CAA71879.1|  hypothetical protein 194                               147   1e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AFW78994.1|  hypothetical protein ZEAMMB73_223268                    144   1e-36   
ref|XP_008803559.1|  PREDICTED: putative clathrin assembly protei...    147   1e-36   Phoenix dactylifera
ref|XP_010424932.1|  PREDICTED: putative clathrin assembly protei...    147   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002456192.1|  hypothetical protein SORBIDRAFT_03g031930          147   1e-36   Sorghum bicolor [broomcorn]
emb|CAA71818.1|  hypothetical protein (cDNA194)                         145   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009396331.1|  PREDICTED: putative clathrin assembly protei...    147   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010513887.1|  PREDICTED: putative clathrin assembly protei...    146   2e-36   Camelina sativa [gold-of-pleasure]
ref|NP_001136989.1|  uncharacterized protein LOC100217151               146   2e-36   Zea mays [maize]
ref|XP_002441469.1|  hypothetical protein SORBIDRAFT_09g027370          146   3e-36   Sorghum bicolor [broomcorn]
ref|XP_004961341.1|  PREDICTED: putative clathrin assembly protei...    146   3e-36   Setaria italica
emb|CDY48813.1|  BnaC02g34010D                                          145   3e-36   Brassica napus [oilseed rape]
gb|EEC71324.1|  hypothetical protein OsI_03369                          145   8e-36   Oryza sativa Indica Group [Indian rice]
ref|NP_001043956.1|  Os01g0694900                                       145   8e-36   
ref|XP_006292297.1|  hypothetical protein CARUB_v10018506mg             145   8e-36   Capsella rubella
gb|KFK33381.1|  hypothetical protein AALP_AA5G005800                    144   1e-35   Arabis alpina [alpine rockcress]
ref|NP_001056232.1|  Os05g0549000                                       142   5e-35   
ref|XP_011621339.1|  PREDICTED: putative clathrin assembly protei...    141   1e-34   Amborella trichopoda
gb|EMT23238.1|  Putative clathrin assembly protein                      141   1e-34   
ref|XP_008672590.1|  PREDICTED: uncharacterized protein LOC100276...    141   1e-34   
ref|XP_008672589.1|  PREDICTED: uncharacterized protein LOC100276...    141   2e-34   Zea mays [maize]
ref|XP_008799224.1|  PREDICTED: putative clathrin assembly protei...    140   3e-34   Phoenix dactylifera
gb|EAY98914.1|  hypothetical protein OsI_20869                          140   3e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_003567959.1|  PREDICTED: putative clathrin assembly protei...    139   5e-34   Brachypodium distachyon [annual false brome]
ref|XP_006838117.1|  PREDICTED: putative clathrin assembly protei...    139   7e-34   Amborella trichopoda
ref|XP_008799223.1|  PREDICTED: putative clathrin assembly protei...    138   1e-33   Phoenix dactylifera
ref|XP_006416959.1|  hypothetical protein EUTSA_v10007171mg             137   5e-33   
emb|CDM83847.1|  unnamed protein product                                132   2e-31   Triticum aestivum [Canadian hard winter wheat]
dbj|BAK06048.1|  predicted protein                                      132   2e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA51587.1|  TPA: hypothetical protein ZEAMMB73_095588              127   1e-29   
gb|AAF79231.1|AC006917_16  F10B6.32                                     126   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003569612.1|  PREDICTED: putative clathrin assembly protei...    124   2e-28   Brachypodium distachyon [annual false brome]
gb|EYU30089.1|  hypothetical protein MIMGU_mgv1a0050551mg               116   6e-28   Erythranthe guttata [common monkey flower]
gb|EMT16298.1|  Putative clathrin assembly protein                      119   2e-26   
ref|XP_006850889.1|  PREDICTED: putative clathrin assembly protei...    117   3e-26   Amborella trichopoda
ref|XP_008811452.1|  PREDICTED: putative clathrin assembly protei...    113   1e-24   Phoenix dactylifera
ref|XP_010929366.1|  PREDICTED: putative clathrin assembly protei...    110   4e-24   
ref|XP_010929365.1|  PREDICTED: putative clathrin assembly protei...    110   6e-24   
ref|XP_010929364.1|  PREDICTED: putative clathrin assembly protei...    110   8e-24   
ref|XP_010929363.1|  PREDICTED: putative clathrin assembly protei...    110   8e-24   
ref|XP_010929362.1|  PREDICTED: putative clathrin assembly protei...    110   1e-23   
ref|XP_010913847.1|  PREDICTED: LOW QUALITY PROTEIN: putative cla...    109   3e-23   Elaeis guineensis
ref|XP_010250225.1|  PREDICTED: putative clathrin assembly protei...    107   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_009390454.1|  PREDICTED: putative clathrin assembly protei...    106   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010273537.1|  PREDICTED: putative clathrin assembly protei...    105   5e-22   Nelumbo nucifera [Indian lotus]
ref|XP_008781765.1|  PREDICTED: putative clathrin assembly protei...    105   5e-22   Phoenix dactylifera
ref|XP_004965651.1|  PREDICTED: putative clathrin assembly protei...    103   2e-21   Setaria italica
ref|XP_009408060.1|  PREDICTED: putative clathrin assembly protei...    103   2e-21   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP10454.1|  unnamed protein product                                103   3e-21   Coffea canephora [robusta coffee]
ref|XP_010057620.1|  PREDICTED: putative clathrin assembly protei...    103   4e-21   Eucalyptus grandis [rose gum]
ref|XP_007154718.1|  hypothetical protein PHAVU_003G141500g             102   5e-21   Phaseolus vulgaris [French bean]
ref|XP_008223882.1|  PREDICTED: putative clathrin assembly protei...    102   9e-21   Prunus mume [ume]
ref|XP_002269299.1|  PREDICTED: putative clathrin assembly protei...    101   1e-20   Vitis vinifera
ref|NP_001174939.1|  Os06g0661400                                     99.4    1e-20   
ref|XP_010110275.1|  Putative clathrin assembly protein                 101   2e-20   
ref|XP_002982426.1|  hypothetical protein SELMODRAFT_268581             101   2e-20   Selaginella moellendorffii
ref|XP_004297901.1|  PREDICTED: putative clathrin assembly protei...    101   2e-20   Fragaria vesca subsp. vesca
ref|XP_008391574.1|  PREDICTED: LOW QUALITY PROTEIN: putative cla...    101   2e-20   
ref|XP_003542645.1|  PREDICTED: putative clathrin assembly protei...    100   3e-20   Glycine max [soybeans]
gb|KHN03612.1|  Putative clathrin assembly protein                      100   3e-20   Glycine soja [wild soybean]
ref|XP_009403215.1|  PREDICTED: putative clathrin assembly protei...    100   4e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007013561.1|  ENTH/ANTH/VHS superfamily protein isoform 1      99.8    5e-20   
gb|EAZ37894.1|  hypothetical protein OsJ_22244                        99.8    5e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007222299.1|  hypothetical protein PRUPE_ppa003361mg           99.8    6e-20   Prunus persica
ref|XP_007201932.1|  hypothetical protein PRUPE_ppa003855mg           99.4    6e-20   Prunus persica
ref|XP_002966589.1|  hypothetical protein SELMODRAFT_230819           99.4    7e-20   
ref|XP_008242823.1|  PREDICTED: putative clathrin assembly protei...  99.4    7e-20   Prunus mume [ume]
dbj|BAD46420.1|  phosphoprotein-like                                  99.4    7e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009359933.1|  PREDICTED: putative clathrin assembly protei...  99.0    1e-19   Pyrus x bretschneideri [bai li]
ref|XP_002437410.1|  hypothetical protein SORBIDRAFT_10g026380        96.3    1e-19   
ref|XP_006656326.1|  PREDICTED: putative clathrin assembly protei...  98.6    1e-19   Oryza brachyantha
ref|XP_002324695.1|  clathrin assembly family protein                 98.2    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_011017657.1|  PREDICTED: putative clathrin assembly protei...  98.2    2e-19   Populus euphratica
ref|XP_004287277.1|  PREDICTED: putative clathrin assembly protei...  97.8    2e-19   Fragaria vesca subsp. vesca
ref|XP_003549739.1|  PREDICTED: putative clathrin assembly protei...  97.8    2e-19   Glycine max [soybeans]
gb|EYU34970.1|  hypothetical protein MIMGU_mgv1a003922mg              97.8    2e-19   Erythranthe guttata [common monkey flower]
ref|XP_006403061.1|  hypothetical protein EUTSA_v10003447mg           97.8    2e-19   
ref|XP_008794954.1|  PREDICTED: putative clathrin assembly protei...  97.8    3e-19   Phoenix dactylifera
ref|XP_007014413.1|  ENTH/ANTH/VHS superfamily protein                97.4    3e-19   
ref|XP_002453380.1|  hypothetical protein SORBIDRAFT_04g005060        97.4    3e-19   Sorghum bicolor [broomcorn]
ref|XP_008443941.1|  PREDICTED: putative clathrin assembly protei...  95.9    4e-19   
ref|XP_006597797.1|  PREDICTED: putative clathrin assembly protei...  97.1    4e-19   
gb|KJB64693.1|  hypothetical protein B456_010G060800                  95.1    5e-19   Gossypium raimondii
ref|XP_008385249.1|  PREDICTED: putative clathrin assembly protei...  96.7    5e-19   
ref|XP_008361112.1|  PREDICTED: putative clathrin assembly protei...  96.3    7e-19   
ref|XP_008443942.1|  PREDICTED: putative clathrin assembly protei...  96.3    8e-19   Cucumis melo [Oriental melon]
ref|NP_001151036.1|  clathrin assembly protein                        96.3    9e-19   
ref|XP_006586993.1|  PREDICTED: putative clathrin assembly protei...  96.3    1e-18   Glycine max [soybeans]
gb|KHN35810.1|  Putative clathrin assembly protein                    96.3    1e-18   Glycine soja [wild soybean]
ref|XP_009340644.1|  PREDICTED: putative clathrin assembly protei...  95.9    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_009340645.1|  PREDICTED: putative clathrin assembly protei...  95.9    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_010906894.1|  PREDICTED: putative clathrin assembly protei...  95.9    1e-18   
gb|KJB64695.1|  hypothetical protein B456_010G060800                  94.7    1e-18   Gossypium raimondii
ref|XP_009363972.1|  PREDICTED: putative clathrin assembly protei...  95.5    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_002285448.2|  PREDICTED: putative clathrin assembly protei...  95.5    1e-18   Vitis vinifera
ref|XP_009400569.1|  PREDICTED: putative clathrin assembly protei...  95.5    1e-18   
emb|CBI28256.3|  unnamed protein product                              95.1    2e-18   Vitis vinifera
gb|KJB53729.1|  hypothetical protein B456_009G002600                  95.1    2e-18   Gossypium raimondii
gb|KHN17630.1|  Putative clathrin assembly protein                    95.1    2e-18   Glycine soja [wild soybean]
emb|CAN83852.1|  hypothetical protein VITISV_037564                   95.5    2e-18   Vitis vinifera
gb|KJB64689.1|  hypothetical protein B456_010G060800                  95.1    2e-18   Gossypium raimondii
ref|XP_006600479.1|  PREDICTED: putative clathrin assembly protei...  95.1    2e-18   Glycine max [soybeans]
gb|KHN15336.1|  Putative clathrin assembly protein                    95.1    2e-18   Glycine soja [wild soybean]
ref|XP_004487990.1|  PREDICTED: putative clathrin assembly protei...  95.1    2e-18   Cicer arietinum [garbanzo]
ref|XP_011078406.1|  PREDICTED: putative clathrin assembly protei...  95.1    2e-18   Sesamum indicum [beniseed]
ref|XP_004487991.1|  PREDICTED: putative clathrin assembly protei...  95.1    2e-18   
gb|KJB64690.1|  hypothetical protein B456_010G060800                  94.4    3e-18   Gossypium raimondii
ref|XP_004150528.1|  PREDICTED: putative clathrin assembly protei...  94.4    3e-18   Cucumis sativus [cucumbers]
emb|CDP20659.1|  unnamed protein product                              94.4    4e-18   Coffea canephora [robusta coffee]
ref|XP_011020009.1|  PREDICTED: putative clathrin assembly protei...  94.4    4e-18   Populus euphratica
ref|XP_002308116.2|  hypothetical protein POPTR_0006s07540g           94.0    4e-18   
gb|ACN36497.1|  unknown                                               91.7    5e-18   Zea mays [maize]
ref|XP_006346667.1|  PREDICTED: putative clathrin assembly protei...  94.0    5e-18   Solanum tuberosum [potatoes]
ref|XP_009398625.1|  PREDICTED: putative clathrin assembly protei...  92.0    6e-18   
ref|XP_006372154.1|  hypothetical protein POPTR_0018s12580g           93.6    8e-18   
ref|XP_004951735.1|  PREDICTED: putative clathrin assembly protei...  93.6    8e-18   Setaria italica
emb|CDY12401.1|  BnaC08g08040D                                        93.2    9e-18   Brassica napus [oilseed rape]
ref|XP_010533128.1|  PREDICTED: putative clathrin assembly protei...  93.2    9e-18   Tarenaya hassleriana [spider flower]
ref|XP_010533127.1|  PREDICTED: putative clathrin assembly protei...  93.2    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_002324629.1|  hypothetical protein POPTR_0018s12580g           93.2    1e-17   
ref|XP_010087990.1|  Putative clathrin assembly protein               93.2    1e-17   Morus notabilis
ref|XP_011017841.1|  PREDICTED: putative clathrin assembly protei...  92.8    1e-17   Populus euphratica
ref|XP_009785618.1|  PREDICTED: putative clathrin assembly protei...  92.8    1e-17   Nicotiana sylvestris
gb|KHG16288.1|  hypothetical protein F383_00250                       92.4    1e-17   Gossypium arboreum [tree cotton]
ref|XP_009398623.1|  PREDICTED: putative clathrin assembly protei...  92.4    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW76126.1|  clathrin assembly protein                             92.4    2e-17   
ref|XP_010904605.1|  PREDICTED: putative clathrin assembly protei...  92.0    2e-17   
gb|KDO73480.1|  hypothetical protein CISIN_1g009078mg                 92.0    2e-17   Citrus sinensis [apfelsine]
ref|XP_006453089.1|  hypothetical protein CICLE_v10007931mg           92.0    2e-17   Citrus clementina [clementine]
ref|XP_010323282.1|  PREDICTED: putative clathrin assembly protei...  92.0    2e-17   Solanum lycopersicum
gb|KDO73477.1|  hypothetical protein CISIN_1g009078mg                 92.0    2e-17   Citrus sinensis [apfelsine]
ref|XP_002531947.1|  clathrin assembly protein, putative              92.0    2e-17   Ricinus communis
ref|XP_012068479.1|  PREDICTED: putative clathrin assembly protei...  88.2    3e-17   Jatropha curcas
ref|XP_011648957.1|  PREDICTED: putative clathrin assembly protei...  91.7    3e-17   Cucumis sativus [cucumbers]
ref|XP_004231715.1|  PREDICTED: putative clathrin assembly protei...  91.3    4e-17   Solanum lycopersicum
ref|XP_009614798.1|  PREDICTED: putative clathrin assembly protei...  91.3    4e-17   Nicotiana tomentosiformis
dbj|BAH20213.1|  AT5G35200                                            89.4    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008451229.1|  PREDICTED: putative clathrin assembly protei...  90.9    5e-17   Cucumis melo [Oriental melon]
ref|XP_003563341.1|  PREDICTED: putative clathrin assembly protei...  90.9    6e-17   Brachypodium distachyon [annual false brome]
gb|AFK40929.1|  unknown                                               90.5    6e-17   Lotus japonicus
ref|XP_012081185.1|  PREDICTED: putative clathrin assembly protei...  90.5    6e-17   Jatropha curcas
ref|XP_010240260.1|  PREDICTED: putative clathrin assembly protei...  90.5    7e-17   Brachypodium distachyon [annual false brome]
ref|XP_010687911.1|  PREDICTED: putative clathrin assembly protei...  90.5    8e-17   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO61895.1|  hypothetical protein CISIN_1g040258mg                 90.5    8e-17   Citrus sinensis [apfelsine]
ref|XP_003610056.1|  Phosphoprotein-like protein                      90.5    8e-17   
ref|XP_006453261.1|  hypothetical protein CICLE_v10010653mg           90.5    8e-17   Citrus clementina [clementine]
gb|AES92253.2|  clathrin assembly plant-like protein                  90.5    8e-17   Medicago truncatula
ref|NP_198370.1|  putative clathrin assembly protein                  90.1    9e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007138775.1|  hypothetical protein PHAVU_009G236300g           90.1    1e-16   Phaseolus vulgaris [French bean]
ref|XP_009108052.1|  PREDICTED: putative clathrin assembly protei...  90.1    1e-16   Brassica rapa
gb|ABR16117.1|  unknown                                               89.7    1e-16   Picea sitchensis
gb|EMT24265.1|  Putative clathrin assembly protein                    90.1    1e-16   
ref|XP_003595071.1|  hypothetical protein MTR_2g037980                90.1    1e-16   
gb|EMT06005.1|  Putative clathrin assembly protein                    89.4    2e-16   
ref|XP_007213050.1|  hypothetical protein PRUPE_ppa020397mg           86.7    2e-16   
gb|AES65322.2|  clathrin assembly plant-like protein                  89.4    2e-16   Medicago truncatula
ref|XP_002527806.1|  clathrin assembly protein, putative              89.4    2e-16   Ricinus communis
ref|XP_010536897.1|  PREDICTED: putative clathrin assembly protei...  89.0    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_009401365.1|  PREDICTED: putative clathrin assembly protei...  89.0    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010541947.1|  PREDICTED: putative clathrin assembly protei...  88.6    3e-16   Tarenaya hassleriana [spider flower]
ref|XP_006593512.1|  PREDICTED: putative clathrin assembly protei...  88.6    3e-16   Glycine max [soybeans]
gb|EMT14882.1|  Putative clathrin assembly protein                    88.2    3e-16   
ref|XP_002870422.1|  hypothetical protein ARALYDRAFT_915653           88.2    4e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_012068461.1|  PREDICTED: LOW QUALITY PROTEIN: putative cla...  88.2    4e-16   Jatropha curcas
ref|XP_002308057.2|  hypothetical protein POPTR_0006s06390g           87.8    5e-16   
ref|XP_011020196.1|  PREDICTED: putative clathrin assembly protei...  87.8    5e-16   Populus euphratica
ref|XP_011020194.1|  PREDICTED: putative clathrin assembly protei...  87.8    6e-16   Populus euphratica
gb|EAY99883.1|  hypothetical protein OsI_21879                        87.4    7e-16   Oryza sativa Indica Group [Indian rice]
ref|NP_001056950.1|  Os06g0175500                                     87.4    7e-16   
ref|XP_006358316.1|  PREDICTED: putative clathrin assembly protei...  87.0    9e-16   Solanum tuberosum [potatoes]
ref|XP_006358317.1|  PREDICTED: putative clathrin assembly protei...  86.7    1e-15   Solanum tuberosum [potatoes]
ref|XP_006845427.1|  PREDICTED: putative clathrin assembly protei...  86.7    1e-15   Amborella trichopoda
ref|XP_009595513.1|  PREDICTED: putative clathrin assembly protei...  86.7    1e-15   Nicotiana tomentosiformis
ref|XP_007155057.1|  hypothetical protein PHAVU_003G169400g           86.3    1e-15   Phaseolus vulgaris [French bean]
ref|XP_008648219.1|  PREDICTED: uncharacterized protein LOC100501...  86.3    2e-15   
ref|XP_006655844.1|  PREDICTED: putative clathrin assembly protei...  86.3    2e-15   Oryza brachyantha
ref|XP_008659222.1|  PREDICTED: putative clathrin assembly protei...  85.5    3e-15   Zea mays [maize]
ref|XP_004508453.1|  PREDICTED: putative clathrin assembly protei...  85.5    3e-15   Cicer arietinum [garbanzo]
ref|XP_002271781.2|  PREDICTED: putative clathrin assembly protei...  85.5    3e-15   Vitis vinifera
ref|XP_003609412.1|  hypothetical protein MTR_4g115420                85.5    3e-15   Medicago truncatula
ref|XP_009757132.1|  PREDICTED: putative clathrin assembly protei...  85.5    3e-15   Nicotiana sylvestris
ref|XP_009757131.1|  PREDICTED: putative clathrin assembly protei...  85.5    3e-15   Nicotiana sylvestris
ref|NP_001048425.1|  Os02g0803300                                     85.1    4e-15   
ref|XP_010545389.1|  PREDICTED: putative clathrin assembly protei...  85.1    5e-15   
ref|XP_011094096.1|  PREDICTED: putative clathrin assembly protei...  85.1    5e-15   
ref|XP_010545391.1|  PREDICTED: putative clathrin assembly protei...  84.7    5e-15   
ref|NP_001046057.1|  Os02g0175700                                     84.7    5e-15   
ref|XP_010050955.1|  PREDICTED: putative clathrin assembly protei...  84.7    6e-15   
gb|EEC72596.1|  hypothetical protein OsI_06060                        84.7    6e-15   
ref|XP_009595316.1|  PREDICTED: putative clathrin assembly protei...  84.7    6e-15   
gb|KHN22664.1|  Putative clathrin assembly protein                    84.7    6e-15   
ref|NP_001169970.1|  hypothetical protein                             84.7    6e-15   
ref|XP_009595317.1|  PREDICTED: putative clathrin assembly protei...  84.7    7e-15   
ref|XP_008644118.1|  PREDICTED: hypothetical protein isoform X1       84.3    7e-15   
ref|XP_008793594.1|  PREDICTED: putative clathrin assembly protei...  84.0    7e-15   
gb|EEC74189.1|  hypothetical protein OsI_09327                        84.3    7e-15   
gb|AAL23930.1|AF420331_1  unknown                                     83.2    8e-15   
ref|XP_006648363.1|  PREDICTED: putative clathrin assembly protei...  84.3    9e-15   
gb|KJB53994.1|  hypothetical protein B456_009G015300                  84.0    1e-14   
gb|KHG01485.1|  hypothetical protein F383_22177                       83.6    1e-14   
gb|KHG01486.1|  hypothetical protein F383_22177                       83.6    1e-14   
gb|EMT21757.1|  Putative clathrin assembly protein                    83.6    1e-14   
gb|KDO62335.1|  hypothetical protein CISIN_1g037435mg                 83.6    1e-14   
ref|XP_006453525.1|  hypothetical protein CICLE_v10010196mg           83.6    1e-14   
gb|KCW86255.1|  hypothetical protein EUGRSUZ_B02940                   83.2    1e-14   
ref|XP_006474617.1|  PREDICTED: putative clathrin assembly protei...  83.2    2e-14   
ref|XP_004964714.1|  PREDICTED: putative clathrin assembly protei...  83.2    2e-14   
ref|XP_004964715.1|  PREDICTED: putative clathrin assembly protei...  82.8    2e-14   
gb|EPS57540.1|  hypothetical protein M569_17277                       80.1    2e-14   
ref|XP_010435408.1|  PREDICTED: putative clathrin assembly protei...  82.4    3e-14   
ref|XP_010435407.1|  PREDICTED: putative clathrin assembly protei...  82.4    3e-14   
ref|XP_010440697.1|  PREDICTED: putative clathrin assembly protei...  81.6    5e-14   
ref|XP_006286251.1|  hypothetical protein CARUB_v10007821mg           81.6    5e-14   
ref|XP_009395481.1|  PREDICTED: putative clathrin assembly protei...  81.3    6e-14   
ref|XP_010314098.1|  PREDICTED: putative clathrin assembly protei...  81.3    6e-14   
ref|XP_009395478.1|  PREDICTED: putative clathrin assembly protei...  81.3    7e-14   
ref|NP_001143721.1|  uncharacterized protein LOC100276465             76.3    7e-14   
ref|XP_006344967.1|  PREDICTED: putative clathrin assembly protei...  81.3    8e-14   
ref|XP_006657301.1|  PREDICTED: putative clathrin assembly protei...  80.1    2e-13   
ref|XP_009773773.1|  PREDICTED: putative clathrin assembly protei...  80.1    2e-13   
ref|XP_008679209.1|  PREDICTED: putative clathrin assembly protei...  80.1    2e-13   
gb|EMT14615.1|  Putative clathrin assembly protein                    80.1    2e-13   
gb|KDP41089.1|  hypothetical protein JCGZ_03219                       79.3    3e-13   
emb|CBI36596.3|  unnamed protein product                              79.3    3e-13   
ref|XP_003564229.1|  PREDICTED: putative clathrin assembly protei...  79.3    3e-13   
gb|KFK29105.1|  hypothetical protein AALP_AA7G089800                  79.3    4e-13   
ref|XP_010433571.1|  PREDICTED: putative clathrin assembly protei...  79.0    4e-13   
ref|XP_004507896.1|  PREDICTED: putative clathrin assembly protei...  79.0    4e-13   
ref|XP_006648067.1|  PREDICTED: putative clathrin assembly protei...  79.0    4e-13   
ref|XP_004507895.1|  PREDICTED: putative clathrin assembly protei...  79.0    5e-13   
ref|XP_010438819.1|  PREDICTED: putative clathrin assembly protei...  78.6    6e-13   
ref|XP_010688409.1|  PREDICTED: putative clathrin assembly protei...  78.2    8e-13   
gb|EAZ38170.1|  hypothetical protein OsJ_22524                        77.8    9e-13   
ref|XP_004967244.1|  PREDICTED: putative clathrin assembly protei...  77.8    9e-13   
gb|EEC81258.1|  hypothetical protein OsI_24348                        77.8    1e-12   
dbj|BAD54001.1|  destination factor-like                              77.8    1e-12   
ref|XP_002867587.1|  hypothetical protein ARALYDRAFT_492223           77.8    1e-12   
ref|XP_004954262.1|  PREDICTED: putative clathrin assembly protei...  77.0    2e-12   
emb|CAB39659.1|  predicted protein destination factor                 77.0    2e-12   
ref|NP_194324.2|  ENTH/ANTH/VHS superfamily protein                   76.6    2e-12   
ref|XP_002452995.1|  hypothetical protein SORBIDRAFT_04g036280        76.3    3e-12   
ref|XP_004954260.1|  PREDICTED: putative clathrin assembly protei...  76.3    3e-12   
emb|CDX89382.1|  BnaA01g15110D                                        76.6    3e-12   
ref|XP_006283381.1|  hypothetical protein CARUB_v10004424mg           75.1    7e-12   
ref|XP_010448345.1|  PREDICTED: putative clathrin assembly protei...  75.1    8e-12   
emb|CDX94400.1|  BnaC01g17840D                                        73.9    2e-11   
ref|XP_009139694.1|  PREDICTED: putative clathrin assembly protei...  73.6    3e-11   
ref|XP_006413250.1|  hypothetical protein EUTSA_v10024721mg           72.8    4e-11   
ref|XP_006413249.1|  hypothetical protein EUTSA_v10024721mg           72.8    4e-11   
gb|KFK27275.1|  hypothetical protein AALP_AA8G360900                  72.8    5e-11   
ref|XP_002533433.1|  clathrin assembly protein, putative              72.4    6e-11   
gb|EYU18219.1|  hypothetical protein MIMGU_mgv1a003551mg              70.9    2e-10   
ref|XP_006279508.1|  hypothetical protein CARUB_v10027557mg           70.5    2e-10   
ref|XP_002864505.1|  predicted protein                                70.5    3e-10   
ref|XP_012071593.1|  PREDICTED: putative clathrin assembly protei...  69.7    4e-10   
ref|XP_009120244.1|  PREDICTED: putative clathrin assembly protei...  69.7    5e-10   
emb|CDY38276.1|  BnaA10g11240D                                        69.7    5e-10   
ref|XP_009126852.1|  PREDICTED: putative clathrin assembly protei...  69.7    5e-10   
ref|XP_006401230.1|  hypothetical protein EUTSA_v10013043mg           69.7    5e-10   
emb|CDY52732.1|  BnaC09g53320D                                        69.7    5e-10   
gb|EPS68909.1|  hypothetical protein M569_05859                       69.3    5e-10   
ref|XP_010483224.1|  PREDICTED: putative clathrin assembly protei...  69.3    6e-10   
ref|XP_010451872.1|  PREDICTED: putative clathrin assembly protei...  69.3    7e-10   
ref|NP_200530.1|  putative clathrin assembly protein                  69.3    8e-10   
ref|XP_010241584.1|  PREDICTED: putative clathrin assembly protei...  68.6    1e-09   
ref|XP_007013936.1|  Clathrin assembly protein, putative              67.8    2e-09   
gb|EYU38747.1|  hypothetical protein MIMGU_mgv1a003095mg              67.4    3e-09   
gb|KDP41088.1|  hypothetical protein JCGZ_03218                       65.1    4e-09   
ref|XP_010443398.1|  PREDICTED: putative clathrin assembly protei...  67.0    4e-09   
ref|XP_001755297.1|  predicted protein                                65.9    8e-09   
ref|XP_010927972.1|  PREDICTED: putative clathrin assembly protei...  64.7    3e-08   
ref|XP_010459008.1|  PREDICTED: putative clathrin assembly protei...  63.9    4e-08   
ref|XP_011077728.1|  PREDICTED: putative clathrin assembly protei...  61.2    3e-07   
ref|XP_003609375.1|  epsin N-terminal homology (ENTH) domain-cont...  59.7    1e-06   
gb|AES91572.2|  clathrin assembly plant-like protein, putative        59.7    1e-06   
ref|XP_006350141.1|  PREDICTED: putative clathrin assembly protei...  58.2    3e-06   
ref|XP_002324642.2|  hypothetical protein POPTR_0018s12830g           57.8    5e-06   
ref|XP_008223645.1|  PREDICTED: putative clathrin assembly protei...  57.8    5e-06   
ref|XP_004252088.1|  PREDICTED: putative clathrin assembly protei...  57.4    7e-06   
ref|XP_009351158.1|  PREDICTED: putative clathrin assembly protei...  57.4    7e-06   
ref|XP_011017801.1|  PREDICTED: probable clathrin assembly protei...  57.4    7e-06   
ref|XP_009786917.1|  PREDICTED: putative clathrin assembly protei...  57.4    8e-06   
ref|XP_009600707.1|  PREDICTED: putative clathrin assembly protei...  56.2    2e-05   
ref|XP_011017806.1|  PREDICTED: probable clathrin assembly protei...  56.2    2e-05   
ref|XP_011017802.1|  PREDICTED: probable clathrin assembly protei...  55.8    2e-05   
ref|XP_011017805.1|  PREDICTED: probable clathrin assembly protei...  55.8    2e-05   
ref|XP_003570337.1|  PREDICTED: putative clathrin assembly protei...  55.1    3e-05   
ref|XP_012081218.1|  PREDICTED: putative clathrin assembly protei...  54.7    5e-05   
ref|XP_004508474.1|  PREDICTED: putative clathrin assembly protei...  54.3    6e-05   
gb|KJB64692.1|  hypothetical protein B456_010G060800                  53.9    9e-05   
ref|XP_011471067.1|  PREDICTED: putative clathrin assembly protei...  53.9    1e-04   
ref|XP_011020010.1|  PREDICTED: putative clathrin assembly protei...  53.1    2e-04   
ref|XP_003541475.1|  PREDICTED: probable clathrin assembly protei...  53.1    2e-04   
emb|CDP10437.1|  unnamed protein product                              53.1    2e-04   
ref|XP_006475889.1|  PREDICTED: probable clathrin assembly protei...  53.1    2e-04   
ref|XP_006450877.1|  hypothetical protein CICLE_v10007747mg           53.1    2e-04   
ref|XP_004288787.1|  PREDICTED: putative clathrin assembly protei...  52.8    2e-04   
ref|XP_002983358.1|  hypothetical protein SELMODRAFT_234210           52.8    2e-04   
ref|XP_007203766.1|  hypothetical protein PRUPE_ppa003005mg           52.4    3e-04   
ref|XP_010323295.1|  PREDICTED: putative clathrin assembly protei...  52.0    4e-04   
ref|XP_009595075.1|  PREDICTED: putative clathrin assembly protei...  52.0    4e-04   
ref|XP_012072850.1|  PREDICTED: putative clathrin assembly protei...  51.6    5e-04   
gb|KHN22116.1|  Putative clathrin assembly protein                    51.2    7e-04   
ref|XP_002437533.1|  hypothetical protein SORBIDRAFT_10g028860        51.2    8e-04   
emb|CDY71126.1|  BnaAnng36220D                                        50.4    0.001   



>ref|XP_006355077.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Solanum tuberosum]
Length=563

 Score =   240 bits (612),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 157/211 (74%), Gaps = 17/211 (8%)
 Frame = -2

Query  835  EDVAVSTTEIPAPVPPVK---FETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT---S  674
            +D  VSTTE P+P  P      E+DDLLGLNAPT   SAIE+SNALALAIVPSG T   S
Sbjct  357  DDAVVSTTETPSPPMPPPPSSLESDDLLGLNAPTGYASAIEDSNALALAIVPSGTTPFDS  416

Query  673  ETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYG  494
               QPKDFDPTGWELALV+TP ++LS  QERQLAGG+DSLTLNSLYDEGAYRASQ+PVYG
Sbjct  417  NPAQPKDFDPTGWELALVTTPSSDLSAAQERQLAGGMDSLTLNSLYDEGAYRASQRPVYG  476

Query  493  APAPNPFEVADPFAMSNAIAAPPSVQLAPMPQP--NPFGPFHPAAAAYP-PQNPLMVGPH  323
            APAPNPFEVADPFAMS  +A PPSVQ+A +PQ   NPFGPF P   AYP PQNP+M  PH
Sbjct  477  APAPNPFEVADPFAMSTTMAPPPSVQMAAVPQHQMNPFGPFEP---AYPQPQNPMM-NPH  532

Query  322  NPFGDTgfgafpanngaaagAHQQNTNPFGS  230
            NPFGD       +       AH Q TNPFGS
Sbjct  533  NPFGDA----GFSAFPTNHVAHPQTTNPFGS  559



>ref|NP_001265941.1| Hop-interacting protein THI028 [Solanum lycopersicum]
 ref|XP_010319119.1| PREDICTED: hop-interacting protein THI028 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69791.1| Hop-interacting protein THI028 [Solanum lycopersicum]
Length=563

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 156/211 (74%), Gaps = 17/211 (8%)
 Frame = -2

Query  835  EDVAVSTTE---IPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT---S  674
            +D  VSTTE    P P PP   E+DDLLGLNAP+   SAIE+SNALALAIVPSG T   S
Sbjct  357  DDAVVSTTEAPSPPMPPPPSSLESDDLLGLNAPSGYASAIEDSNALALAIVPSGTTPFDS  416

Query  673  ETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYG  494
               QPKDFDPTGWELALV+TP ++LS  QERQLAGGLDSLTLNSLYDEGAYRASQ+PVYG
Sbjct  417  NPAQPKDFDPTGWELALVTTPSSDLSAAQERQLAGGLDSLTLNSLYDEGAYRASQRPVYG  476

Query  493  APAPNPFEVADPFAMSNAIAAPPSVQLAPMPQP--NPFGPFHPAAAAYP-PQNPLMVGPH  323
            APAPNPFEVADPFAMS  +  PPSVQ+A +PQ   NPFGPF P   AYP PQNP M+ PH
Sbjct  477  APAPNPFEVADPFAMSTTMPPPPSVQMAAVPQHQMNPFGPFEP---AYPQPQNP-MLNPH  532

Query  322  NPFGDTgfgafpanngaaagAHQQNTNPFGS  230
            NPFGD       +       AH Q TNPFGS
Sbjct  533  NPFGDA----GFSAFPTNHVAHPQTTNPFGS  559



>ref|XP_009777394.1| PREDICTED: putative clathrin assembly protein At2g01600 [Nicotiana 
sylvestris]
Length=562

 Score =   234 bits (598),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 153/212 (72%), Gaps = 17/212 (8%)
 Frame = -2

Query  838  AEDVAVSTTEIPAPVPPV---KFETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT---  677
            ++D  VST+E PAP         ETDDLLGLN PT   SAIEESNALALAIVPSG T   
Sbjct  355  SDDTVVSTSEAPAPPVQPPPSSLETDDLLGLNTPTGYASAIEESNALALAIVPSGTTPFD  414

Query  676  SETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVY  497
            S   QPKDFDPTGWELALV+TP ++LS   ERQLAGGLDSLTLNSLYDEGAYRASQQPVY
Sbjct  415  SNPAQPKDFDPTGWELALVTTPSSDLSAAHERQLAGGLDSLTLNSLYDEGAYRASQQPVY  474

Query  496  GAPAPNPFEVADPFAMSNAIAAPPSVQ--LAPMPQPNPFGPFHPAAAAYP-PQNPLMVGP  326
            G PAPNPFEVADPF MS+ +  PPSVQ  +AP  Q NPFGPF P   AYP PQNP+M  P
Sbjct  475  GQPAPNPFEVADPFVMSSTMPPPPSVQMAMAPQHQMNPFGPFQP---AYPQPQNPMM-NP  530

Query  325  HNPFGDTgfgafpanngaaagAHQQNTNPFGS  230
            HNPFGD       +   A   AH Q TNPFGS
Sbjct  531  HNPFGDA----GFSAFPANNVAHPQTTNPFGS  558



>ref|XP_011070604.1| PREDICTED: putative clathrin assembly protein At2g01600 [Sesamum 
indicum]
Length=564

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 154/210 (73%), Gaps = 11/210 (5%)
 Frame = -2

Query  838  AEDVAVSTTEI--PAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT---S  674
            +++VA+ST E   P P PP   +TDDLLGLN  T D SAIEE+NALALAIVPSG T   S
Sbjct  355  SDEVAISTAETAPPVPPPPTNLDTDDLLGLNVTTQDASAIEETNALALAIVPSGTTPFDS  414

Query  673  ETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYG  494
            +  Q KDFDPTGWELALV+TP TNLS+ QERQLAGGLDSLTLNSLYDEGAYRASQQPVYG
Sbjct  415  DAPQVKDFDPTGWELALVTTPSTNLSSVQERQLAGGLDSLTLNSLYDEGAYRASQQPVYG  474

Query  493  APAPNPFEVADPFAMSNAIAAPPSVQLAPMPQP--NPFGPFHPAAAAYPPQNPLMVGPHN  320
            APAPNPFEV+DPFA+SN +  PP+VQ+A M QP  NPF PF PA      Q  L++ P N
Sbjct  475  APAPNPFEVSDPFAISNNVPPPPTVQMAAMTQPQNNPFAPFQPAYPPPQQQQHLLMSPQN  534

Query  319  PFGDTgfgafpanngaaagAHQQNTNPFGS  230
            PFGD           AA  AH Q TNPFGS
Sbjct  535  PFGDA----GFGAFPAAPAAHPQTTNPFGS  560



>ref|XP_009627948.1| PREDICTED: putative clathrin assembly protein At2g01600 [Nicotiana 
tomentosiformis]
Length=562

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 147/209 (70%), Gaps = 11/209 (5%)
 Frame = -2

Query  838  AEDVAVSTTEIPAPVPPVK---FETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT---  677
            ++D  VSTTE PAP         ETDDLLGLN PT   SAIEESNALALAIVPSG T   
Sbjct  355  SDDTVVSTTEAPAPPVQPPPSILETDDLLGLNTPTGYASAIEESNALALAIVPSGTTPFD  414

Query  676  SETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVY  497
            S   QPKDFDPTGWELALV+TP ++LS  QERQLAGGLDSLTLNSLYDEGAYRASQQPVY
Sbjct  415  SNPAQPKDFDPTGWELALVTTPSSDLSAAQERQLAGGLDSLTLNSLYDEGAYRASQQPVY  474

Query  496  GAPAPNPFEVADPFAMSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPHNP  317
            G PAPNPFEVADPFAMS+ +   PSVQ+A +PQ +   PF P    YP     M+ PHNP
Sbjct  475  GQPAPNPFEVADPFAMSSTMPPLPSVQMAMVPQ-HQMNPFGPFQPPYPQPQNPMMNPHNP  533

Query  316  FGDTgfgafpanngaaagAHQQNTNPFGS  230
            FGD       +   A   AH Q TNPFGS
Sbjct  534  FGDA----GFSAFPANNVAHPQTTNPFGS  558



>emb|CDP00810.1| unnamed protein product [Coffea canephora]
Length=558

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 133/188 (71%), Gaps = 7/188 (4%)
 Frame = -2

Query  784  KFETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT-SETVQPKDFDPTGWELALVSTPG  608
            K   DDLLGLNA + D SAIEESNALALAIVPSG T S +   KDFDPTGWELALV+TP 
Sbjct  371  KLHPDDLLGLNAISPDASAIEESNALALAIVPSGTTDSSSASIKDFDPTGWELALVTTPS  430

Query  607  TNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAAP  428
            +NLS+ QERQLAGGLD+LTLNSLYD+GAYRASQQP+YG PAPNPFEV DPFA+SN I  P
Sbjct  431  SNLSSSQERQLAGGLDTLTLNSLYDDGAYRASQQPMYGVPAPNPFEVHDPFAVSNNIPPP  490

Query  427  PSVQLAPMPQP--NPFGPFHPAAAAYPPQNPLMVGPHNPFGDTgfgafpanngaaagAHQ  254
             SVQ+  MPQP  NPFGPF P       Q   M+   NPFGD             +  H 
Sbjct  491  HSVQMGAMPQPQANPFGPFQPVYPQNQQQQHYMMSQQNPFGDA----GFTAFPVNSVGHP  546

Query  253  QNTNPFGS  230
            Q TNPFGS
Sbjct  547  QTTNPFGS  554



>ref|XP_010274743.1| PREDICTED: putative clathrin assembly protein At2g01600 [Nelumbo 
nucifera]
Length=564

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 148/214 (69%), Gaps = 18/214 (8%)
 Frame = -2

Query  838  AEDVAVSTTEIPA-PVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSE---  671
            ++DVA S T++ A P PP   +T DLLGLNA   D SAIEESNALALAIVPS + S    
Sbjct  354  SDDVASSNTDVAAVPPPPDFLDTGDLLGLNATNPDASAIEESNALALAIVPSTSISSHDN  413

Query  670  -TVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYG  494
             TVQ KD DPTGWELALV+TP +N+S+  ERQLAGGLD+LTLNSLYD+GAYRA+QQPVYG
Sbjct  414  GTVQAKDIDPTGWELALVTTPSSNISSVTERQLAGGLDTLTLNSLYDDGAYRAAQQPVYG  473

Query  493  APAPNPFEVADPFAMSNAIAAPPSVQLAPMP--QPNPFGPFHPAAAAYPPQNP----LMV  332
            APAPNPFEV DPFAMSN +A PP+VQ+A M   Q NPF  +      YP Q      LM+
Sbjct  474  APAPNPFEVQDPFAMSNNVAPPPAVQIAAMAQQQSNPFAHYQ---LNYPQQQQQQQHLMM  530

Query  331  GPHNPFGDTgfgafpanngaaagAHQQNTNPFGS  230
            GP NPFGDT               H QN NPFGS
Sbjct  531  GPSNPFGDT----GFGAFPVNPVLHTQNNNPFGS  560



>ref|XP_011023792.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X2 [Populus euphratica]
Length=562

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 145/215 (67%), Gaps = 16/215 (7%)
 Frame = -2

Query  838  AEDVAVSTTEIPAPVPPV----KFETDDLLGLNAPTSDVSAIEESNALALAIVPSGA---  680
            ++DVAVS  EI  PVP        +T DLLGL+  T + S IEESNALALAIVPS +   
Sbjct  348  SDDVAVSNVEIAPPVPTTAPQNSIDTGDLLGLDYGTPNASTIEESNALALAIVPSESDVA  407

Query  679  ---TSETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQ  509
                S   Q KDFDPTGWELALVSTP +N+S   ERQLAGGLDSLTLNSLYDEGAYRA++
Sbjct  408  PTFNSVAGQAKDFDPTGWELALVSTPSSNISATNERQLAGGLDSLTLNSLYDEGAYRAAR  467

Query  508  QPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPMPQP--NPFGPFHPAAAAYPPQNPLM  335
            QPVYGAPAPNPFE  DPFA+SN+IAAPPSVQ+A M Q   NPFGP+ P       Q  +M
Sbjct  468  QPVYGAPAPNPFETQDPFALSNSIAAPPSVQMAAMTQQPHNPFGPYQPTYPQPQHQQNMM  527

Query  334  VGPHNPFGDTgfgafpanngaaagAHQQNTNPFGS  230
            +   NPFGDT          A   AH Q  NPFGS
Sbjct  528  MSHANPFGDT----GFGAFHAHPMAHPQTNNPFGS  558



>ref|XP_011023782.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X1 [Populus euphratica]
Length=563

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 145/215 (67%), Gaps = 16/215 (7%)
 Frame = -2

Query  838  AEDVAVSTTEIPAPVPPV----KFETDDLLGLNAPTSDVSAIEESNALALAIVPSGA---  680
            ++DVAVS  EI  PVP        +T DLLGL+  T + S IEESNALALAIVPS +   
Sbjct  349  SDDVAVSNVEIAPPVPTTAPQNSIDTGDLLGLDYGTPNASTIEESNALALAIVPSESDVA  408

Query  679  ---TSETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQ  509
                S   Q KDFDPTGWELALVSTP +N+S   ERQLAGGLDSLTLNSLYDEGAYRA++
Sbjct  409  PTFNSVAGQAKDFDPTGWELALVSTPSSNISATNERQLAGGLDSLTLNSLYDEGAYRAAR  468

Query  508  QPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPMPQP--NPFGPFHPAAAAYPPQNPLM  335
            QPVYGAPAPNPFE  DPFA+SN+IAAPPSVQ+A M Q   NPFGP+ P       Q  +M
Sbjct  469  QPVYGAPAPNPFETQDPFALSNSIAAPPSVQMAAMTQQPHNPFGPYQPTYPQPQHQQNMM  528

Query  334  VGPHNPFGDTgfgafpanngaaagAHQQNTNPFGS  230
            +   NPFGDT          A   AH Q  NPFGS
Sbjct  529  MSHANPFGDT----GFGAFHAHPMAHPQTNNPFGS  559



>gb|EYU21032.1| hypothetical protein MIMGU_mgv1a020579mg [Erythranthe guttata]
Length=565

 Score =   217 bits (552),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 129/177 (73%), Gaps = 9/177 (5%)
 Frame = -2

Query  808  IPAPVPP---VKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT--SETVQPKDFDP  644
            + A VPP       TDDLLGLN  T   S IEE NALALAIVPSG T  S++ Q   FDP
Sbjct  367  VEAAVPPPHPTNLGTDDLLGLNVTTEAASVIEERNALALAIVPSGTTTFSDSSQANKFDP  426

Query  643  TGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVA  464
            TGWELALV+ P  NLS+ QERQLAGGLD+LTL SLYDEGAYRASQ+PVYGAP PNPFEV+
Sbjct  427  TGWELALVTAPSANLSSVQERQLAGGLDTLTLESLYDEGAYRASQRPVYGAPTPNPFEVS  486

Query  463  DPFAMSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYP----PQNPLMVGPHNPFGDT  305
            DPFAMSN +  PPSVQ+A M Q NPFGPF    ++YP     Q    +GPHNPFGD+
Sbjct  487  DPFAMSNNVPMPPSVQMATMQQNNPFGPFQQQPSSYPHQSQQQQHFQMGPHNPFGDS  543



>ref|XP_011463190.1| PREDICTED: putative clathrin assembly protein At2g01600 [Fragaria 
vesca subsp. vesca]
Length=557

 Score =   216 bits (550),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 136/187 (73%), Gaps = 14/187 (7%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVPS-GATSETVQPKDFDPTGWELALVSTPGTNL  599
            T DLLGL+  T D SAIEESNALALAIVPS  A +  VQ KDFDP+GWELALV TP TN+
Sbjct  376  TGDLLGLDFTTGDASAIEESNALALAIVPSETAPTFNVQSKDFDPSGWELALVETPSTNI  435

Query  598  STPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSV  419
            S+  +RQLAGGLDSLTLNSLYDEG YRASQQPVYG PAPNPFEV DPFA+SN +AAPP+V
Sbjct  436  SSANDRQLAGGLDSLTLNSLYDEGQYRASQQPVYGQPAPNPFEVQDPFALSNNVAAPPAV  495

Query  418  QLAPMP--QPNPFGPFHPAAAAYPPQNPLMVG-PHNPFGDTgfgafpanngaaagAHQ-Q  251
            Q+A M   Q NPFGPF P     PPQ  +M+G   NPFGDT              AHQ Q
Sbjct  496  QMAAMAQQQSNPFGPFQPTYQ--PPQQNMMMGATSNPFGDT-------TGFGTFPAHQPQ  546

Query  250  NTNPFGS  230
             +NPFGS
Sbjct  547  TSNPFGS  553



>ref|XP_002311513.1| clathrin assembly family protein [Populus trichocarpa]
 gb|EEE88880.1| clathrin assembly family protein [Populus trichocarpa]
Length=562

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 145/215 (67%), Gaps = 16/215 (7%)
 Frame = -2

Query  838  AEDVAVSTTEIPAPVPPV----KFETDDLLGLNAPTSDVSAIEESNALALAIVPSGA---  680
            ++DVAVS  EI  PVP        +T DLLGL+  T + S IEESNALALAIVPS +   
Sbjct  348  SDDVAVSNVEIAPPVPTTAPQNSIDTGDLLGLDYGTPNASTIEESNALALAIVPSESDVA  407

Query  679  ---TSETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQ  509
                S   Q KDFDPTGWELALV+TP +N+S   ERQLAGGLDSLTLNSLYDEGAYRA++
Sbjct  408  PTFNSVAGQAKDFDPTGWELALVTTPSSNISATNERQLAGGLDSLTLNSLYDEGAYRAAR  467

Query  508  QPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPMPQP--NPFGPFHPAAAAYPPQNPLM  335
            +PVYGAPAPNPFE+ DPFA+SN+IAAPPSVQ+A M Q   NPFGP+ P       Q  +M
Sbjct  468  RPVYGAPAPNPFEIQDPFALSNSIAAPPSVQMAAMTQQPHNPFGPYQPTYPQPQHQQNMM  527

Query  334  VGPHNPFGDTgfgafpanngaaagAHQQNTNPFGS  230
            +   NPFGD           A   AH Q  NPFGS
Sbjct  528  MSHANPFGDA----GFGAFHAHPMAHPQTNNPFGS  558



>ref|XP_008221433.1| PREDICTED: putative clathrin assembly protein At2g01600 [Prunus 
mume]
Length=562

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 141/191 (74%), Gaps = 13/191 (7%)
 Frame = -2

Query  778  ETDDLLGLNAPTSDVSAIEESNALALAIVPSGA------TSETVQPKDFDPTGWELALVS  617
            +T DLLGL+   +DVS +EE NALALAIV S         S  VQPKDFDPTGWELALV+
Sbjct  373  DTGDLLGLDYTAADVSVMEERNALALAIVSSETDAAPTFNSSAVQPKDFDPTGWELALVT  432

Query  616  TPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAI  437
            TP  N+S+  ERQLAGGLDSLTLNSLYDEGAYRA+QQPVYGAPAPNPFEV DPFA+SN +
Sbjct  433  TPSNNISSVNERQLAGGLDSLTLNSLYDEGAYRAAQQPVYGAPAPNPFEVQDPFALSNNV  492

Query  436  AAPPSVQLAPMP--QPNPFGPFHPAAAAYPPQNPLMVGPHNPFGDTgfgafpanngaaag  263
            A PP VQ+A M   Q NPFGPF P     P Q  +M+GP NPFGDTGFGAFPA+  A   
Sbjct  493  APPPGVQMAAMAQQQSNPFGPFQPTYQ--PQQQNVMMGPTNPFGDTGFGAFPAHPPAPH-  549

Query  262  AHQQNTNPFGS  230
               Q +NPFGS
Sbjct  550  --PQTSNPFGS  558



>ref|XP_007222905.1| hypothetical protein PRUPE_ppa003610mg [Prunus persica]
 gb|EMJ24104.1| hypothetical protein PRUPE_ppa003610mg [Prunus persica]
Length=562

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 140/191 (73%), Gaps = 13/191 (7%)
 Frame = -2

Query  778  ETDDLLGLNAPTSDVSAIEESNALALAIVPSGA------TSETVQPKDFDPTGWELALVS  617
            +T DLLGL+   SDVS +EE NALALAIV S         S  VQPKDFDPTGWELALV+
Sbjct  373  DTGDLLGLDYTASDVSVMEERNALALAIVSSETDAAPTFNSSAVQPKDFDPTGWELALVT  432

Query  616  TPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAI  437
            TP  N+S+  ERQLAGGLDSLTLNSLYDEGAYRA+QQPVYGAPAPNPFEV DPFA+SN +
Sbjct  433  TPSNNISSVNERQLAGGLDSLTLNSLYDEGAYRAAQQPVYGAPAPNPFEVQDPFALSNNV  492

Query  436  AAPPSVQLAPMP--QPNPFGPFHPAAAAYPPQNPLMVGPHNPFGDTgfgafpanngaaag  263
            A PP VQ+A M   Q NPFG F P     P Q  +M+GP NPFGDTGFGAFPA+  A   
Sbjct  493  APPPGVQMAAMAQQQSNPFGSFQPTYQ--PQQQNVMMGPTNPFGDTGFGAFPAHPPAPH-  549

Query  262  AHQQNTNPFGS  230
               Q +NPFGS
Sbjct  550  --PQTSNPFGS  558



>ref|XP_011075418.1| PREDICTED: putative clathrin assembly protein At2g01600 [Sesamum 
indicum]
Length=507

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 138/206 (67%), Gaps = 13/206 (6%)
 Frame = -2

Query  826  AVSTTE--IPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT---SETVQ  662
            AVST E  +P P PP    TDDLLGLN  T D S IEESN LALAIVPS  T   S   Q
Sbjct  304  AVSTAEAAVPQP-PPANLYTDDLLGLNWTTQDASVIEESNTLALAIVPSETTPFESNVSQ  362

Query  661  PKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAP  482
            P +FDPTGWELALV+TP  NLS+ QE+QL GGLDSLTL SLYDEGAYRASQQP+YGAPAP
Sbjct  363  P-NFDPTGWELALVTTPSINLSSVQEKQLVGGLDSLTLESLYDEGAYRASQQPIYGAPAP  421

Query  481  NPFEVADPFAMSNAIAAPPSVQLAPMPQP--NPFGPFHPAAAAYPPQNPLMVGPHNPFGD  308
            NPFEV DPFAMS+ +A PP+VQ   + Q   NPF PF PA      Q  L++GP NPFGD
Sbjct  422  NPFEVGDPFAMSDTVAMPPAVQTVAVSQHQNNPFAPFQPAYPQAQQQQQLLMGPQNPFGD  481

Query  307  TgfgafpanngaaagAHQQNTNPFGS  230
                            H Q TNPFGS
Sbjct  482  A----GFVAFPVEPSVHPQTTNPFGS  503



>ref|XP_002284689.2| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X2 [Vitis vinifera]
 emb|CBI26868.3| unnamed protein product [Vitis vinifera]
Length=567

 Score =   211 bits (538),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 149/216 (69%), Gaps = 16/216 (7%)
 Frame = -2

Query  838  AEDVAVSTTEI---PAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT---  677
            +E+V VS+ E+   P P+PP   +  DLLG+N    D SAIEESNALALAIVPSG+    
Sbjct  351  SENVEVSSVEVAHPPPPLPPNNLDDGDLLGINVVAHDASAIEESNALALAIVPSGSAAAP  410

Query  676  ---SETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQ  506
               S   Q KDFDPTGWELALV+TP +N+S+  ERQLAGGLD+LTL SLYDEGAYRA+QQ
Sbjct  411  TFDSGAFQAKDFDPTGWELALVTTPSSNISSANERQLAGGLDTLTLTSLYDEGAYRAAQQ  470

Query  505  PVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPMP--QPNPFGPF--HPAAAAYPPQNPL  338
            PVYGAPAPNPFEV DPFA+SN +AAPP+VQ+A M   QPNPF P+  +        Q  L
Sbjct  471  PVYGAPAPNPFEVHDPFAVSNGVAAPPAVQMAAMAQQQPNPFAPYPTYQQQQQQQQQQHL  530

Query  337  MVGPHNPFGDTgfgafpanngaaagAHQQNTNPFGS  230
            M GP NPFGD     F A       AH QN NPFGS
Sbjct  531  MFGPPNPFGDA---GFGAFPRNTTTAHPQNNNPFGS  563



>ref|XP_010654389.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X1 [Vitis vinifera]
Length=568

 Score =   211 bits (537),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 149/217 (69%), Gaps = 17/217 (8%)
 Frame = -2

Query  838  AEDVAVSTTEI---PAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT---  677
            +E+V VS+ E+   P P+PP   +  DLLG+N    D SAIEESNALALAIVPSG+    
Sbjct  351  SENVEVSSVEVAHPPPPLPPNNLDDGDLLGINVVAHDASAIEESNALALAIVPSGSAAAA  410

Query  676  ----SETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQ  509
                S   Q KDFDPTGWELALV+TP +N+S+  ERQLAGGLD+LTL SLYDEGAYRA+Q
Sbjct  411  PTFDSGAFQAKDFDPTGWELALVTTPSSNISSANERQLAGGLDTLTLTSLYDEGAYRAAQ  470

Query  508  QPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPMP--QPNPFGPF--HPAAAAYPPQNP  341
            QPVYGAPAPNPFEV DPFA+SN +AAPP+VQ+A M   QPNPF P+  +        Q  
Sbjct  471  QPVYGAPAPNPFEVHDPFAVSNGVAAPPAVQMAAMAQQQPNPFAPYPTYQQQQQQQQQQH  530

Query  340  LMVGPHNPFGDTgfgafpanngaaagAHQQNTNPFGS  230
            LM GP NPFGD     F A       AH QN NPFGS
Sbjct  531  LMFGPPNPFGDA---GFGAFPRNTTTAHPQNNNPFGS  564



>gb|KJB60910.1| hypothetical protein B456_009G330700 [Gossypium raimondii]
Length=509

 Score =   209 bits (533),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 133/188 (71%), Gaps = 15/188 (8%)
 Frame = -2

Query  838  AEDVAVSTTEIPAPVPP---VKFETDDLLGLNAPTSDVSAIEESNALALAIVP------S  686
            A+DVAVS+ E   P PP    K +TDDLLGLN    + SAIEESNALALAIVP      S
Sbjct  296  ADDVAVSSVETAPPPPPVPQTKLDTDDLLGLNDAAPNASAIEESNALALAIVPTESGTAS  355

Query  685  GATSETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQ  506
               S   QPKDFDPTGWELALV+TP T++S P ERQLAGGLDSLTLNSLYDE AYRASQQ
Sbjct  356  AFNSSAGQPKDFDPTGWELALVTTPSTDISAPTERQLAGGLDSLTLNSLYDEAAYRASQQ  415

Query  505  PVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPM--PQPNPFGPFHPAAAAYPPQNPLMV  332
            PVYG  APNPFEV DPFA+SN IA P  VQ+A M   Q NPFG + P      PQ  L++
Sbjct  416  PVYGTAAPNPFEVQDPFAVSNNIATPTVVQMAAMGQQQNNPFGSYQPTY----PQQHLVM  471

Query  331  GPHNPFGD  308
             P NPFGD
Sbjct  472  RPSNPFGD  479



>gb|KJB60907.1| hypothetical protein B456_009G330700 [Gossypium raimondii]
Length=545

 Score =   210 bits (535),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 133/188 (71%), Gaps = 15/188 (8%)
 Frame = -2

Query  838  AEDVAVSTTEIPAPVPP---VKFETDDLLGLNAPTSDVSAIEESNALALAIVP------S  686
            A+DVAVS+ E   P PP    K +TDDLLGLN    + SAIEESNALALAIVP      S
Sbjct  332  ADDVAVSSVETAPPPPPVPQTKLDTDDLLGLNDAAPNASAIEESNALALAIVPTESGTAS  391

Query  685  GATSETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQ  506
               S   QPKDFDPTGWELALV+TP T++S P ERQLAGGLDSLTLNSLYDE AYRASQQ
Sbjct  392  AFNSSAGQPKDFDPTGWELALVTTPSTDISAPTERQLAGGLDSLTLNSLYDEAAYRASQQ  451

Query  505  PVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPM--PQPNPFGPFHPAAAAYPPQNPLMV  332
            PVYG  APNPFEV DPFA+SN IA P  VQ+A M   Q NPFG + P      PQ  L++
Sbjct  452  PVYGTAAPNPFEVQDPFAVSNNIATPTVVQMAAMGQQQNNPFGSYQPTY----PQQHLVM  507

Query  331  GPHNPFGD  308
             P NPFGD
Sbjct  508  RPSNPFGD  515



>gb|KJB60908.1| hypothetical protein B456_009G330700 [Gossypium raimondii]
Length=522

 Score =   210 bits (534),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 133/188 (71%), Gaps = 15/188 (8%)
 Frame = -2

Query  838  AEDVAVSTTEIPAPVPP---VKFETDDLLGLNAPTSDVSAIEESNALALAIVP------S  686
            A+DVAVS+ E   P PP    K +TDDLLGLN    + SAIEESNALALAIVP      S
Sbjct  309  ADDVAVSSVETAPPPPPVPQTKLDTDDLLGLNDAAPNASAIEESNALALAIVPTESGTAS  368

Query  685  GATSETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQ  506
               S   QPKDFDPTGWELALV+TP T++S P ERQLAGGLDSLTLNSLYDE AYRASQQ
Sbjct  369  AFNSSAGQPKDFDPTGWELALVTTPSTDISAPTERQLAGGLDSLTLNSLYDEAAYRASQQ  428

Query  505  PVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPM--PQPNPFGPFHPAAAAYPPQNPLMV  332
            PVYG  APNPFEV DPFA+SN IA P  VQ+A M   Q NPFG + P      PQ  L++
Sbjct  429  PVYGTAAPNPFEVQDPFAVSNNIATPTVVQMAAMGQQQNNPFGSYQPTY----PQQHLVM  484

Query  331  GPHNPFGD  308
             P NPFGD
Sbjct  485  RPSNPFGD  492



>gb|EYU33129.1| hypothetical protein MIMGU_mgv1a0037702mg, partial [Erythranthe 
guttata]
Length=479

 Score =   209 bits (531),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 129/179 (72%), Gaps = 9/179 (5%)
 Frame = -2

Query  817  TTEIPAPVP-PVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT--SETVQPKDFD  647
            T E   P P P    TDDLLGLN  T   S IEE NALALAIVPSG T  S++ Q   FD
Sbjct  280  TVEAAVPPPHPTNLGTDDLLGLNVTTEAASVIEERNALALAIVPSGTTTFSDSSQANKFD  339

Query  646  PTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEV  467
            PTGWELALV+ P  NLS+ QERQLAGGLD+LTL SLYDEGAYRASQ+PVYGAP PNPFEV
Sbjct  340  PTGWELALVTAPSANLSSVQERQLAGGLDTLTLESLYDEGAYRASQRPVYGAPTPNPFEV  399

Query  466  ADPFAMSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYP-----PQNPLMVGPHNPFGDT  305
            +DPFAMSN +  PPSVQ+A M Q NPFGPF    ++YP      Q  L +GP NPFGD+
Sbjct  400  SDPFAMSNNVPMPPSVQMATMQQNNPFGPFQ-QQSSYPHQFQQQQQHLQMGPQNPFGDS  457



>gb|KJB60906.1| hypothetical protein B456_009G330700 [Gossypium raimondii]
Length=531

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 133/188 (71%), Gaps = 15/188 (8%)
 Frame = -2

Query  838  AEDVAVSTTEIPAPVPP---VKFETDDLLGLNAPTSDVSAIEESNALALAIVP------S  686
            A+DVAVS+ E   P PP    K +TDDLLGLN    + SAIEESNALALAIVP      S
Sbjct  318  ADDVAVSSVETAPPPPPVPQTKLDTDDLLGLNDAAPNASAIEESNALALAIVPTESGTAS  377

Query  685  GATSETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQ  506
               S   QPKDFDPTGWELALV+TP T++S P ERQLAGGLDSLTLNSLYDE AYRASQQ
Sbjct  378  AFNSSAGQPKDFDPTGWELALVTTPSTDISAPTERQLAGGLDSLTLNSLYDEAAYRASQQ  437

Query  505  PVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPM--PQPNPFGPFHPAAAAYPPQNPLMV  332
            PVYG  APNPFEV DPFA+SN IA P  VQ+A M   Q NPFG + P      PQ  L++
Sbjct  438  PVYGTAAPNPFEVQDPFAVSNNIATPTVVQMAAMGQQQNNPFGSYQPTY----PQQHLVM  493

Query  331  GPHNPFGD  308
             P NPFGD
Sbjct  494  RPSNPFGD  501



>gb|KJB60905.1| hypothetical protein B456_009G330700 [Gossypium raimondii]
 gb|KJB60909.1| hypothetical protein B456_009G330700 [Gossypium raimondii]
Length=562

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 133/188 (71%), Gaps = 15/188 (8%)
 Frame = -2

Query  838  AEDVAVSTTEIPAPVPP---VKFETDDLLGLNAPTSDVSAIEESNALALAIVP------S  686
            A+DVAVS+ E   P PP    K +TDDLLGLN    + SAIEESNALALAIVP      S
Sbjct  349  ADDVAVSSVETAPPPPPVPQTKLDTDDLLGLNDAAPNASAIEESNALALAIVPTESGTAS  408

Query  685  GATSETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQ  506
               S   QPKDFDPTGWELALV+TP T++S P ERQLAGGLDSLTLNSLYDE AYRASQQ
Sbjct  409  AFNSSAGQPKDFDPTGWELALVTTPSTDISAPTERQLAGGLDSLTLNSLYDEAAYRASQQ  468

Query  505  PVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPM--PQPNPFGPFHPAAAAYPPQNPLMV  332
            PVYG  APNPFEV DPFA+SN IA P  VQ+A M   Q NPFG + P      PQ  L++
Sbjct  469  PVYGTAAPNPFEVQDPFAVSNNIATPTVVQMAAMGQQQNNPFGSYQPTY----PQQHLVM  524

Query  331  GPHNPFGD  308
             P NPFGD
Sbjct  525  RPSNPFGD  532



>ref|XP_008389195.1| PREDICTED: putative clathrin assembly protein At2g01600 [Malus 
domestica]
Length=561

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 133/190 (70%), Gaps = 13/190 (7%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVPSGA------TSETVQPKDFDPTGWELALVST  614
            T DLLGL+   +DVSAIE+ NALALAI+ S A       S   Q   FDPTGWELALVST
Sbjct  373  TGDLLGLDYSAADVSAIEDRNALALAIITSEADAAPTFNSGAAQANGFDPTGWELALVST  432

Query  613  PGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIA  434
            P T++S P ERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEV DPFA SN IA
Sbjct  433  PSTDISAPNERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVQDPFAFSNNIA  492

Query  433  APPSVQLAPMP--QPNPFGPFHPAAAAYPPQNPLMVGPHNPFGDTgfgafpanngaaagA  260
             PP+VQ+A M   Q NPFGPF P      PQ  +M+G  NPFGDT          A+   
Sbjct  493  PPPAVQIASMAQQQSNPFGPFQPTYQQ--PQPNVMMGATNPFGDT---TGFGTFPASPAP  547

Query  259  HQQNTNPFGS  230
            H Q++NPFGS
Sbjct  548  HPQSSNPFGS  557



>ref|XP_006448214.1| hypothetical protein CICLE_v10014774mg [Citrus clementina]
 gb|ESR61454.1| hypothetical protein CICLE_v10014774mg [Citrus clementina]
Length=561

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 130/193 (67%), Gaps = 14/193 (7%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPS--GATSETVQP-----KDFDPTGWELAL  623
             +T DLLGL+    D SAIEESNALALAIVPS  GAT+ T        KDFDPTGWELAL
Sbjct  370  MDTGDLLGLSHAAPDASAIEESNALALAIVPSEPGATAPTFNSGAGLTKDFDPTGWELAL  429

Query  622  VSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSN  443
            VSTP TN+S+  ERQLAGGLDSLTLNSLYDE AYRA QQP YGA APNPFEV D FAMSN
Sbjct  430  VSTPSTNISSANERQLAGGLDSLTLNSLYDEAAYRA-QQPAYGAAAPNPFEVQDIFAMSN  488

Query  442  AIAAPPSVQLAPMP--QPNPFGPFHPAAAAYPPQNPLMVGPHNPFGDTgfgafpanngaa  269
             +A PPSVQ+A M   Q NPFGPF P     P Q  LM+ P NPFGDT            
Sbjct  489  GVAPPPSVQMAAMAQQQTNPFGPFQPTYQQLPQQQHLMMNPSNPFGDT----GFGAFPLN  544

Query  268  agAHQQNTNPFGS  230
               H Q  NPFG+
Sbjct  545  PVTHPQANNPFGT  557



>ref|XP_006469211.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Citrus sinensis]
Length=561

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 130/193 (67%), Gaps = 14/193 (7%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPS--GATSETVQP-----KDFDPTGWELAL  623
             +T DLLGL+    D SAIEESNALALAIVPS  GAT+ T        KDFDPTGWELAL
Sbjct  370  MDTGDLLGLSHAAPDASAIEESNALALAIVPSEPGATAPTFNSGAGLTKDFDPTGWELAL  429

Query  622  VSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSN  443
            VSTP TN+S+  ERQLAGGLDSLTLNSLYDE AYRA QQP YGA APNPFEV D FAMSN
Sbjct  430  VSTPSTNISSANERQLAGGLDSLTLNSLYDEAAYRA-QQPAYGAAAPNPFEVQDIFAMSN  488

Query  442  AIAAPPSVQLAPMP--QPNPFGPFHPAAAAYPPQNPLMVGPHNPFGDTgfgafpanngaa  269
             +A PPSVQ+A M   Q NPFGPF P     P Q  LM+ P NPFGDT            
Sbjct  489  GVAPPPSVQMAAMAQQQTNPFGPFQPTYQQLPQQQHLMMNPSNPFGDT----GFGAFPVN  544

Query  268  agAHQQNTNPFGS  230
               H Q  NPFG+
Sbjct  545  PVTHPQANNPFGT  557



>ref|XP_010265534.1| PREDICTED: putative clathrin assembly protein At2g01600 [Nelumbo 
nucifera]
Length=559

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 143/209 (68%), Gaps = 14/209 (7%)
 Frame = -2

Query  838  AEDVAVSTTEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSE----  671
            ++DVA S T+ P   PP   +  DLLGLNA + D S IEESNALALAIVPS   +     
Sbjct  355  SDDVAPSGTDAP---PPDIVDNGDLLGLNATSPDASVIEESNALALAIVPSTDHASHDNG  411

Query  670  TVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGA  491
            TVQ KDFDP+GWELALV+TP +N+S+  ERQLAGGLD+LTLNSLYDEGAYRA+Q+PVYGA
Sbjct  412  TVQTKDFDPSGWELALVTTPSSNISSVTERQLAGGLDTLTLNSLYDEGAYRAAQKPVYGA  471

Query  490  PAPNPFEVADPFAMSNAIAAPPSVQLAPMP--QPNPFGPFHPAAAAYPPQNPLMVGPHNP  317
            P PNPFEV DPFA+SN +  PP+VQ+A M   Q NPF  + P       +N L++G  NP
Sbjct  472  PTPNPFEVQDPFALSNNVVPPPAVQMAAMSQQQSNPFIHYQPNYQPQQQRN-LIMGASNP  530

Query  316  FGDTgfgafpanngaaagAHQQNTNPFGS  230
            FGDT               H QNTNPFGS
Sbjct  531  FGDT----GFGAFPVNPALHPQNTNPFGS  555



>ref|XP_004504573.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Cicer arietinum]
Length=564

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 131/191 (69%), Gaps = 11/191 (6%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVP------SGATSETVQPKDFDPTGWELALV  620
            FET DLLGLN    + S+IEE NALALAIVP      S   S   Q KDFDPTGWELALV
Sbjct  374  FETGDLLGLNDLEPNASSIEERNALALAIVPTETGTASAFNSSAAQTKDFDPTGWELALV  433

Query  619  STPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNA  440
            STP T++S+  ERQLAGGLDSLTLNSLYDEGAYRA+QQPVYG PAPNPFEV DPFA+S++
Sbjct  434  STPSTDISSVNERQLAGGLDSLTLNSLYDEGAYRAAQQPVYGTPAPNPFEVHDPFAISSS  493

Query  439  IAAPPSVQLAPM-PQPNPFGPFHPAAAAYPPQNPLMVGPHNPFGDTgfgafpanngaaag  263
            IA   +VQ+A M  Q NPFGP+    A    Q  +++ P NPF D+          A   
Sbjct  494  IAPSAAVQMAAMQQQANPFGPYQQFQAQPQQQQHMLMNPANPFADS----GFGAFHATPV  549

Query  262  AHQQNTNPFGS  230
            +H QN NPFGS
Sbjct  550  SHPQNNNPFGS  560



>ref|XP_009351512.1| PREDICTED: putative clathrin assembly protein At2g01600 [Pyrus 
x bretschneideri]
Length=563

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 129/190 (68%), Gaps = 13/190 (7%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVPSGA------TSETVQPKDFDPTGWELALVST  614
            T DLLGL+   +DVSAIE+ NALALAI+ S A       S   Q   FDPTGWELALV+T
Sbjct  375  TGDLLGLDYSAADVSAIEDRNALALAIITSEADAAPTFNSSAAQTNGFDPTGWELALVTT  434

Query  613  PGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIA  434
            P T++S P ERQLAGGLDSLTLNSLYDEGAYRASQQPVYG+PAPNPFEV DPFA SN +A
Sbjct  435  PSTDISAPNERQLAGGLDSLTLNSLYDEGAYRASQQPVYGSPAPNPFEVQDPFAFSNNVA  494

Query  433  APPSVQLAPMP--QPNPFGPFHPAAAAYPPQNPLMVGPHNPFGDTgfgafpanngaaagA  260
             PP VQ+A M   Q NPFG F P      PQ  +M+G  NPFGDT          A    
Sbjct  495  PPPGVQMAAMSQQQSNPFGHFQPTYQQ--PQPNVMMGATNPFGDT---TGFGAFPANPAP  549

Query  259  HQQNTNPFGS  230
            H Q +NPFGS
Sbjct  550  HPQTSNPFGS  559



>ref|XP_008464707.1| PREDICTED: putative clathrin assembly protein At2g01600 [Cucumis 
melo]
Length=657

 Score =   199 bits (507),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 122/166 (73%), Gaps = 10/166 (6%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT------SETVQPKDFDPTGWELALV  620
             ET DLLGL+  T++VSAIEE NALALAIVPSG T      S      DFDPTGWELALV
Sbjct  466  LETGDLLGLSLATTEVSAIEERNALALAIVPSGDTEAPTFHSNGAHANDFDPTGWELALV  525

Query  619  STPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNA  440
            +TP TNLST  ERQLAGGLD+LTL+SLYDEGAYRAS QPVYG PAPNPFEV DPFA SNA
Sbjct  526  TTPSTNLSTANERQLAGGLDTLTLDSLYDEGAYRASLQPVYGKPAPNPFEVQDPFAYSNA  585

Query  439  IAAPPSVQLAPM--PQPNPFGPFHPAAAAYPPQNPLMVGPHNPFGD  308
            IA PPSVQ+AP+  PQ NPFGP          Q P  + P NPFGD
Sbjct  586  IAPPPSVQMAPLAQPQANPFGP--FQPTFPQQQQPFTMDPTNPFGD  629



>ref|XP_002315872.2| hypothetical protein POPTR_0010s12020g [Populus trichocarpa]
 gb|EEF02043.2| hypothetical protein POPTR_0010s12020g [Populus trichocarpa]
Length=549

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 142/215 (66%), Gaps = 20/215 (9%)
 Frame = -2

Query  838  AEDVAVSTTEIPAPV----PPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT--  677
            ++DVAVS  EI  P     P    +T DLLGLN    D S+IEESNALALAI+PS +   
Sbjct  339  SDDVAVSNVEIAPPASTAPPQNSVDTGDLLGLNYAAPDASSIEESNALALAIIPSESNAA  398

Query  676  ----SETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQ  509
                S   Q KDFDPTGWELALV+TP +N+S   ERQLAGGLDSLTL+SLY EGAYRA+Q
Sbjct  399  PTFNSAAGQAKDFDPTGWELALVTTPSSNISATNERQLAGGLDSLTLDSLYHEGAYRAAQ  458

Query  508  QPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPMPQP--NPFGPFHPAAAAYPPQNPLM  335
            QPVYGAPAPNPFEV DPFA+SN+IA PPSVQ+A M Q   NPF P+ P       Q+ +M
Sbjct  459  QPVYGAPAPNPFEVQDPFALSNSIAPPPSVQMAAMAQQPHNPFSPYQPPYPQPQQQH-VM  517

Query  334  VGPHNPFGDTgfgafpanngaaagAHQQNTNPFGS  230
                NPFGDT           A  AH +  NPFGS
Sbjct  518  TSHANPFGDT-------TGFGAFPAHPETNNPFGS  545



>ref|XP_012072261.1| PREDICTED: putative clathrin assembly protein At2g01600 [Jatropha 
curcas]
 gb|KDP38084.1| hypothetical protein JCGZ_04727 [Jatropha curcas]
Length=564

 Score =   197 bits (502),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 134/189 (71%), Gaps = 13/189 (7%)
 Frame = -2

Query  835  EDVAVSTTEIPAPVPPV----KFETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT---  677
            +DVA+S  EI  P PP     K +T DLLGL+    D SAIEESNALALAI+P+      
Sbjct  351  DDVAISNVEIAPPTPPTPPQNKMDTGDLLGLDYAAPDASAIEESNALALAIIPTEQNAAP  410

Query  676  ---SETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQ  506
               S   Q KDFDPTGWELALV+TP TN+S+  ERQLAGGLDSLTLNSLYD+ AYRA+QQ
Sbjct  411  TFNSGAGQAKDFDPTGWELALVTTPSTNISSVNERQLAGGLDSLTLNSLYDDAAYRAAQQ  470

Query  505  PVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPMPQ--PNPFGPFHPAAAAYPPQNPLMV  332
            PVYGAPAPNPFEV DPFAMSN IA    VQ+A M Q   NPFGP+ PA      Q+ LM 
Sbjct  471  PVYGAPAPNPFEVQDPFAMSNGIAPSAGVQMAAMAQQASNPFGPYQPAYPQPQQQHLLM-  529

Query  331  GPHNPFGDT  305
            GP NPFGDT
Sbjct  530  GPTNPFGDT  538



>ref|XP_011038608.1| PREDICTED: putative clathrin assembly protein At2g01600 [Populus 
euphratica]
Length=558

 Score =   197 bits (501),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 142/215 (66%), Gaps = 20/215 (9%)
 Frame = -2

Query  838  AEDVAVSTTEIPAPV----PPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT--  677
            ++DVAVS  EI  P     P    +T DLLGLN    D S+IEESNALALAI+PS +   
Sbjct  348  SDDVAVSNVEIAPPASTTPPQNSVDTGDLLGLNYAAPDASSIEESNALALAIIPSESNAA  407

Query  676  ----SETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQ  509
                S   Q KDFDPTGWELALVSTP +N+S   ERQLAGGLDSLTL+SLY EGAYRA+Q
Sbjct  408  PTFNSAAGQAKDFDPTGWELALVSTPSSNISATNERQLAGGLDSLTLDSLYHEGAYRAAQ  467

Query  508  QPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPMPQP--NPFGPFHPAAAAYPPQNPLM  335
            QPVYGAPAPNPFEV DPF +SN+IA PPSVQ+A M Q   NPF P+ P       Q+ +M
Sbjct  468  QPVYGAPAPNPFEVQDPFVLSNSIAPPPSVQMAAMAQQPHNPFSPYQPPYPQPQQQH-VM  526

Query  334  VGPHNPFGDTgfgafpanngaaagAHQQNTNPFGS  230
            +   NPFGDT           A  AH +  NPFGS
Sbjct  527  MSHANPFGDT-------TGFGAFPAHPETNNPFGS  554



>ref|XP_002315925.2| hypothetical protein POPTR_0010s12020g [Populus trichocarpa]
 gb|EEF02096.2| hypothetical protein POPTR_0010s12020g [Populus trichocarpa]
Length=555

 Score =   197 bits (501),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 142/215 (66%), Gaps = 20/215 (9%)
 Frame = -2

Query  838  AEDVAVSTTEIPAPV----PPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT--  677
            ++DVAVS  EI  P     P    +T DLLGLN    D S+IEESNALALAI+PS +   
Sbjct  345  SDDVAVSNVEIAPPASTAPPQNSVDTGDLLGLNYAAPDASSIEESNALALAIIPSESNAA  404

Query  676  ----SETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQ  509
                S   Q KDFDPTGWELALV+TP +N+S   ERQLAGGLDSLTL+SLY EGAYRA+Q
Sbjct  405  PTFNSAAGQAKDFDPTGWELALVTTPSSNISATNERQLAGGLDSLTLDSLYHEGAYRAAQ  464

Query  508  QPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPMPQP--NPFGPFHPAAAAYPPQNPLM  335
            QPVYGAPAPNPFEV DPFA+SN+IA PPSVQ+A M Q   NPF P+ P       Q+ +M
Sbjct  465  QPVYGAPAPNPFEVQDPFALSNSIAPPPSVQMAAMAQQPHNPFSPYQPPYPQPQQQH-VM  523

Query  334  VGPHNPFGDTgfgafpanngaaagAHQQNTNPFGS  230
                NPFGDT           A  AH +  NPFGS
Sbjct  524  TSHANPFGDT-------TGFGAFPAHPETNNPFGS  551



>ref|XP_007045208.1| ENTH/ANTH/VHS superfamily protein [Theobroma cacao]
 gb|EOY01040.1| ENTH/ANTH/VHS superfamily protein [Theobroma cacao]
Length=565

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 131/188 (70%), Gaps = 11/188 (6%)
 Frame = -2

Query  838  AEDVAVSTTEIPAPVPPV---KFETDDLLGLNAPTSDVSAIEESNALALAIVPS----GA  680
            A+D+AVS  E     PP      +  DLL L+    D  AIEESNALALAIVP+    G 
Sbjct  349  ADDIAVSGVETVPVPPPPPQNNADGGDLLDLSYSAPDALAIEESNALALAIVPTEPGTGP  408

Query  679  T--SETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQ  506
            T  S T QPKDFDPTGWELALV+TP +++S   +RQLAGGLDSLTLNSLYDE AYRASQQ
Sbjct  409  TFNSTTGQPKDFDPTGWELALVTTPSSDISAVNDRQLAGGLDSLTLNSLYDEAAYRASQQ  468

Query  505  PVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPM--PQPNPFGPFHPAAAAYPPQNPLMV  332
            PVYGAPAPNPFEV DPFAMSN IA   +VQ+A M  PQ NPFGP+ P       Q  +M+
Sbjct  469  PVYGAPAPNPFEVQDPFAMSNNIAPARAVQMAAMAQPQSNPFGPYQPTYQQPLQQQHMMM  528

Query  331  GPHNPFGD  308
             P NPFGD
Sbjct  529  SPSNPFGD  536



>ref|XP_004142277.1| PREDICTED: putative clathrin assembly protein At2g01600 [Cucumis 
sativus]
 gb|KGN49630.1| hypothetical protein Csa_5G033480 [Cucumis sativus]
Length=566

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 122/167 (73%), Gaps = 10/167 (6%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT------SETVQPKDFDPTGWELALV  620
             ET DLLGL+  T++VSAIEE NALALAIVPSG T      S   Q  DFDPTGWELALV
Sbjct  375  LETGDLLGLSLATTEVSAIEERNALALAIVPSGDTEAPTFHSNGAQANDFDPTGWELALV  434

Query  619  STPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNA  440
            +TP TNLS+  ERQLAGGLD+L L+SLYDEGAYRAS QPVYG PAPNPFEV DPFA SNA
Sbjct  435  TTPSTNLSSANERQLAGGLDTLILDSLYDEGAYRASLQPVYGKPAPNPFEVQDPFAYSNA  494

Query  439  IAAPPSVQLAPM--PQPNPFGPFHPAAAAYPPQNPLMVGPHNPFGDT  305
            IA PPSVQ+AP+   Q NPFGPF P          +   P NPFGD+
Sbjct  495  IAPPPSVQMAPLAQQQANPFGPFQPTFPQQQQPFTM--DPTNPFGDS  539



>ref|XP_010044208.1| PREDICTED: putative clathrin assembly protein At2g01600 [Eucalyptus 
grandis]
 gb|KCW86254.1| hypothetical protein EUGRSUZ_B02940 [Eucalyptus grandis]
Length=568

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 131/191 (69%), Gaps = 17/191 (9%)
 Frame = -2

Query  829  VAVSTTEIPAPVPPV------KFETDDLLGLNAPTSDVSAIEESNALALAIVPS--GATS  674
            VA ST E+ A  PP         +T DLLGL     D S+IEE NALALAIVPS  GA S
Sbjct  351  VAASTVEVAAADPPPPPPPQNNLDTGDLLGLGFDAPDASSIEEKNALALAIVPSEPGAAS  410

Query  673  ET-----VQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQ  509
                    Q KDF+PTGWELALVSTP TN+S   ERQLAGGLD+LTL+SLYDEGAYRASQ
Sbjct  411  SAFGSGATQSKDFNPTGWELALVSTPSTNISAANERQLAGGLDTLTLHSLYDEGAYRASQ  470

Query  508  QPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPM--PQPNPFGPFHPAAAAYPPQNP--  341
            QPVYGAPAPNPFEV DPFAMSN IA PPSVQ+A +   Q NPFGP+ P            
Sbjct  471  QPVYGAPAPNPFEVQDPFAMSNGIAPPPSVQMAAINQQQTNPFGPYQPTYPPQQQLPQQH  530

Query  340  LMVGPHNPFGD  308
            LM+GP NPFGD
Sbjct  531  LMMGPTNPFGD  541



>ref|XP_010101968.1| Putative clathrin assembly protein [Morus notabilis]
 gb|EXB90892.1| Putative clathrin assembly protein [Morus notabilis]
Length=584

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 129/195 (66%), Gaps = 15/195 (8%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT------SETVQPKDFDPTGWELALV  620
             +T DLLGL+    DVSAIEE NALALAIVPS         S  ++ KDFDPTGWELALV
Sbjct  390  IDTGDLLGLSYDVPDVSAIEERNALALAIVPSETNAAPTFNSSAIEAKDFDPTGWELALV  449

Query  619  STPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNA  440
            STP TN+STP +RQLAGGLDSLTLNSLYDE AYRASQQPVYGAPAPNPFEV DPFAMSN 
Sbjct  450  STPSTNISTPTDRQLAGGLDSLTLNSLYDEAAYRASQQPVYGAPAPNPFEVQDPFAMSNG  509

Query  439  IAAPPSV--QLAPMPQPNPFGPFHPAAAAYPPQNP---LMVGPHNPFGDTgfgafpanng  275
            +A PP V        Q NPFGP+ P         P   L++ P NPFGD           
Sbjct  510  VAPPPPVQMAALAQQQANPFGPYQPTFQPQMQPQPQQHLLMSPANPFGDA----GFGAFP  565

Query  274  aaagAHQQNTNPFGS  230
            A  G HQQ  NPFGS
Sbjct  566  ANPGPHQQQKNPFGS  580



>ref|XP_002527787.1| clathrin assembly protein, putative [Ricinus communis]
 gb|EEF34597.1| clathrin assembly protein, putative [Ricinus communis]
Length=567

 Score =   196 bits (497),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 144/222 (65%), Gaps = 27/222 (12%)
 Frame = -2

Query  838  AEDVAVSTTEIPAPVPPV----KFETDDLLGLNAPTSDVSA---IEESNALALAIVP---  689
            +EDVA++  E+  P PP       +T DLLGLN  + DVSA   IEE NALALAIVP   
Sbjct  350  SEDVAIANAEVAPPTPPTPPQNNMDTGDLLGLNYASPDVSAASAIEERNALALAIVPLEQ  409

Query  688  -------SGATSETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDE  530
                   SGA     QPKDFDPTGWELALV+TP  N+S+  +RQLAGGLD+LTLNSLYD+
Sbjct  410  DAAPTFNSGAG----QPKDFDPTGWELALVTTPSANISSVNDRQLAGGLDTLTLNSLYDD  465

Query  529  GAYRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPMPQ--PNPFGPFHPAAAAY  356
             AYRA+QQPVYGAPAPNPFEV DPFAMSN+IA P +VQ+A M Q  PNPFGP+ P     
Sbjct  466  VAYRAAQQPVYGAPAPNPFEVHDPFAMSNSIAPPSAVQMAAMTQQPPNPFGPYQPTYPQP  525

Query  355  PPQNPLMVGPHNPFGDTgfgafpanngaaagAHQQNTNPFGS  230
              Q  LM+ P NPFGD                H  + NPFGS
Sbjct  526  QQQQHLMMSPANPFGDA----GFGTFPVNTVTHPHSNNPFGS  563



>gb|KCW86253.1| hypothetical protein EUGRSUZ_B02940 [Eucalyptus grandis]
Length=574

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 131/197 (66%), Gaps = 23/197 (12%)
 Frame = -2

Query  829  VAVSTTEIPA------PVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPS------  686
            VA ST E+ A      P P    +T DLLGL     D S+IEE NALALAIVPS      
Sbjct  351  VAASTVEVAAADPPPPPPPQNNLDTGDLLGLGFDAPDASSIEEKNALALAIVPSEPVWRV  410

Query  685  --GATSET-----VQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEG  527
              GA S        Q KDF+PTGWELALVSTP TN+S   ERQLAGGLD+LTL+SLYDEG
Sbjct  411  VTGAASSAFGSGATQSKDFNPTGWELALVSTPSTNISAANERQLAGGLDTLTLHSLYDEG  470

Query  526  AYRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPM--PQPNPFGPFHPAAAAYP  353
            AYRASQQPVYGAPAPNPFEV DPFAMSN IA PPSVQ+A +   Q NPFGP+ P      
Sbjct  471  AYRASQQPVYGAPAPNPFEVQDPFAMSNGIAPPPSVQMAAINQQQTNPFGPYQPTYPPQQ  530

Query  352  PQNP--LMVGPHNPFGD  308
                  LM+GP NPFGD
Sbjct  531  QLPQQHLMMGPTNPFGD  547



>ref|XP_003531146.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
isoform 1 [Glycine max]
Length=568

 Score =   192 bits (488),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 133/195 (68%), Gaps = 15/195 (8%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPS--GATS----ETVQPKDFDPTGWELALV  620
            FET DLLGLN    D S+IEE NALALAIVP+  G TS       Q KDFDPTGWELALV
Sbjct  374  FETGDLLGLNDTAPDASSIEERNALALAIVPTETGTTSAFNTTAAQTKDFDPTGWELALV  433

Query  619  STPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNA  440
            STP T++S   ERQLAGGLDSLTLNSLYDE AYR SQQPVYGAPAPNPFE+ DPFA+S++
Sbjct  434  STPSTDISAANERQLAGGLDSLTLNSLYDEAAYR-SQQPVYGAPAPNPFEMQDPFALSSS  492

Query  439  IAAPPSVQLAPM-PQPNPFGPF----HPAAAAYPPQNPLMVGPHNPFGDTgfgafpanng  275
            I  PP+VQLA M  Q NPFGP+     P       Q+ +++ P NPFGD     F A   
Sbjct  493  IPPPPAVQLAAMQQQANPFGPYQQPFQPQPQPQQQQHHMLMNPANPFGDA---GFGAFPA  549

Query  274  aaagAHQQNTNPFGS  230
                 H QN NPFGS
Sbjct  550  PNPAPHPQNNNPFGS  564



>gb|KHN12469.1| Putative clathrin assembly protein [Glycine soja]
Length=568

 Score =   192 bits (488),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 133/195 (68%), Gaps = 15/195 (8%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPS--GATS----ETVQPKDFDPTGWELALV  620
            FET DLLGLN    D S+IEE NALALAIVP+  G TS       Q KDFDPTGWELALV
Sbjct  374  FETGDLLGLNDTAPDASSIEERNALALAIVPTETGTTSAFNTTAAQTKDFDPTGWELALV  433

Query  619  STPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNA  440
            STP T++S   ERQLAGGLDSLTLNSLYDE AYR SQQPVYGAPAPNPFE+ DPFA+S++
Sbjct  434  STPSTDISAANERQLAGGLDSLTLNSLYDEAAYR-SQQPVYGAPAPNPFEMQDPFALSSS  492

Query  439  IAAPPSVQLAPM-PQPNPFGPF----HPAAAAYPPQNPLMVGPHNPFGDTgfgafpanng  275
            I  PP+VQLA M  Q NPFGP+     P       Q+ +++ P NPFGD     F A   
Sbjct  493  IPPPPAVQLAAMQQQANPFGPYQQPFQPQPQPQQQQHHMLMNPANPFGDA---GFGAFPA  549

Query  274  aaagAHQQNTNPFGS  230
                 H QN NPFGS
Sbjct  550  PNPAPHPQNNNPFGS  564



>ref|XP_003524854.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
isoform 1 [Glycine max]
 gb|KHN46088.1| Putative clathrin assembly protein [Glycine soja]
Length=569

 Score =   192 bits (487),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 134/195 (69%), Gaps = 14/195 (7%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPS--GATS----ETVQPKDFDPTGWELALV  620
            FET DLLGLN    D S+IEE NALALAIVP+  GATS       Q KDFDPTGWELALV
Sbjct  374  FETGDLLGLNDTAPDASSIEERNALALAIVPTETGATSAFNSTASQTKDFDPTGWELALV  433

Query  619  STPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNA  440
            STP T++S   ERQLAGGLDSLTLNSLYDE AYR++QQPVYGAPAPNPFEV DPFA+S++
Sbjct  434  STPSTDISAANERQLAGGLDSLTLNSLYDEAAYRSAQQPVYGAPAPNPFEVQDPFALSSS  493

Query  439  IAAPPSVQLAPM-PQPNPFGPF----HPAAAAYPPQNPLMVGPHNPFGDTgfgafpanng  275
            I  PP+VQ+A M  Q NPFG +     P       Q  +++ P NPFGD     F A   
Sbjct  494  IPPPPAVQMAAMQQQANPFGSYQQPFQPQPQLQQQQQLMLMNPANPFGDA---GFGAFPA  550

Query  274  aaagAHQQNTNPFGS  230
            +    H QN NPFGS
Sbjct  551  SNPVPHPQNNNPFGS  565



>gb|KDO64585.1| hypothetical protein CISIN_1g008579mg [Citrus sinensis]
Length=561

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 130/193 (67%), Gaps = 14/193 (7%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPS--GATSETVQP-----KDFDPTGWELAL  623
             +T DLLGL+    D SAIEESNALALAIVPS  GAT+ T        KDFDPTGWELAL
Sbjct  370  MDTGDLLGLSHAAPDASAIEESNALALAIVPSEPGATAPTFNSGAGLTKDFDPTGWELAL  429

Query  622  VSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSN  443
            VSTP TN+S+  ERQLAGGLDSLTLNSLYDE AYRA QQP YGA APNPF+V D FAMSN
Sbjct  430  VSTPSTNISSANERQLAGGLDSLTLNSLYDEAAYRA-QQPAYGAAAPNPFDVQDIFAMSN  488

Query  442  AIAAPPSVQLAPMP--QPNPFGPFHPAAAAYPPQNPLMVGPHNPFGDTgfgafpanngaa  269
             +A PPSVQ+A M   Q NPFGPF P     P Q  LM+ P NPFGDT            
Sbjct  489  GVAPPPSVQMAAMAQQQTNPFGPFQPTYQQPPQQQHLMMNPSNPFGDT----GFGAFPVN  544

Query  268  agAHQQNTNPFGS  230
               H Q  NPFG+
Sbjct  545  PVTHPQANNPFGT  557



>ref|XP_007158803.1| hypothetical protein PHAVU_002G183100g [Phaseolus vulgaris]
 gb|ESW30797.1| hypothetical protein PHAVU_002G183100g [Phaseolus vulgaris]
Length=563

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 120/167 (72%), Gaps = 9/167 (5%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVP------SGATSETVQPKDFDPTGWELALV  620
            FET DLLGLN    D S IEE NALALAIVP      S   S + Q KDFDPTGWELALV
Sbjct  372  FETGDLLGLNDNAPDASLIEERNALALAIVPTEIGTTSAFNSTSAQTKDFDPTGWELALV  431

Query  619  STPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNA  440
            STP T++S   ERQLAGGLDSLTLNSLYDE AYR+SQQP YGAPAPNPFEV DPFA+SN+
Sbjct  432  STPSTDISAANERQLAGGLDSLTLNSLYDEAAYRSSQQPQYGAPAPNPFEVHDPFALSNS  491

Query  439  IAAPPSVQLAPM-PQPNPFGPFHPAAAAYPPQNP--LMVGPHNPFGD  308
            +  PP+VQ+A M  Q NPFGP+ P      P     +++ P NPFGD
Sbjct  492  VPPPPAVQMAAMHHQANPFGPYQPFQPQSQPPQQQHMLMNPANPFGD  538



>ref|XP_010553785.1| PREDICTED: putative clathrin assembly protein At2g01600 [Tarenaya 
hassleriana]
Length=578

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 127/186 (68%), Gaps = 21/186 (11%)
 Frame = -2

Query  811  EIPAPVPPVK--------FETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQP-  659
            E+P P PP           +TDDLLGLN+   D S IE+ NALALAIVP+   + +    
Sbjct  356  EVPQPTPPPHSAEPSQNIIDTDDLLGLNSAVPDASVIEDQNALALAIVPTNGDNSSSASG  415

Query  658  ----KDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGA  491
                KDFDPTGWELALV+T  T++S   ERQLAGGLD+LTLNSLYDEGAYRASQ+PVYGA
Sbjct  416  FNPAKDFDPTGWELALVTTSSTDISAATERQLAGGLDTLTLNSLYDEGAYRASQRPVYGA  475

Query  490  PAPNPFEVADPFAMSNAIAAPPSVQLAPMP--QP---NPFGPFHPAAAAYPPQNPLMVGP  326
            PAPNPFEV DPFA+SN I  PPSVQL+ +   QP   NPFGP+ P       Q+ L+  P
Sbjct  476  PAPNPFEVQDPFALSNGIPPPPSVQLSAVTAQQPAANNPFGPYQPPTYT---QHQLVPSP  532

Query  325  HNPFGD  308
             NPFGD
Sbjct  533  TNPFGD  538



>gb|KHG06013.1| hypothetical protein F383_02907 [Gossypium arboreum]
 gb|KHG17498.1| hypothetical protein F383_05122 [Gossypium arboreum]
Length=561

 Score =   186 bits (473),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 132/197 (67%), Gaps = 13/197 (7%)
 Frame = -2

Query  793  PPVKFETDDLLGLNAPTSDVSAIEESNALALAIVP--SGA----TSETVQPKDFDPTGWE  632
            P    +T DLLGLN    D  AIE+ NALALAIVP  SG     +S   Q KDFDPTGWE
Sbjct  365  PQTNIDTGDLLGLNYSAPDAFAIEQINALALAIVPIDSGTAPTYSSAAGQSKDFDPTGWE  424

Query  631  LALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGA-PAPNPFEVADPF  455
            LALV+TP T++S   ERQLAGGLDSLTLNSLYDE AYRASQQPVYG+  APNPFEV DPF
Sbjct  425  LALVTTPSTDISAAAERQLAGGLDSLTLNSLYDEAAYRASQQPVYGSTTAPNPFEVQDPF  484

Query  454  AMSNAIAAPPSVQLAPMPQP--NPFGPFHPAAAAYPPQNPLMVGPHNPFGDTgfgafpan  281
            AMSN+IA P +VQ++ M QP  NPF  + P    Y  Q+  +    NPFGD GFG FP N
Sbjct  485  AMSNSIATPIAVQMSGMTQPQNNPFDAYQP----YQQQHLTIPSASNPFGDAGFGTFPVN  540

Query  280  ngaaagAHQQNTNPFGS  230
              A       N NPFGS
Sbjct  541  QTAVIAQPHANNNPFGS  557



>gb|KHG06012.1| hypothetical protein F383_02907 [Gossypium arboreum]
Length=693

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 132/197 (67%), Gaps = 13/197 (7%)
 Frame = -2

Query  793  PPVKFETDDLLGLNAPTSDVSAIEESNALALAIVP--SGA----TSETVQPKDFDPTGWE  632
            P    +T DLLGLN    D  AIE+ NALALAIVP  SG     +S   Q KDFDPTGWE
Sbjct  497  PQTNIDTGDLLGLNYSAPDAFAIEQINALALAIVPIDSGTAPTYSSAAGQSKDFDPTGWE  556

Query  631  LALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGA-PAPNPFEVADPF  455
            LALV+TP T++S   ERQLAGGLDSLTLNSLYDE AYRASQQPVYG+  APNPFEV DPF
Sbjct  557  LALVTTPSTDISAAAERQLAGGLDSLTLNSLYDEAAYRASQQPVYGSTTAPNPFEVQDPF  616

Query  454  AMSNAIAAPPSVQLAPMPQP--NPFGPFHPAAAAYPPQNPLMVGPHNPFGDTgfgafpan  281
            AMSN+IA P +VQ++ M QP  NPF  + P    Y  Q+  +    NPFGD GFG FP N
Sbjct  617  AMSNSIATPIAVQMSGMTQPQNNPFDAYQP----YQQQHLTIPSASNPFGDAGFGTFPVN  672

Query  280  ngaaagAHQQNTNPFGS  230
              A       N NPFGS
Sbjct  673  QTAVIAQPHANNNPFGS  689



>ref|XP_003533950.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Glycine max]
Length=554

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 133/208 (64%), Gaps = 14/208 (7%)
 Frame = -2

Query  832  DVAVSTTEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIV--PSGAT---SET  668
            D  VS +E   P     FET DLLGLN  T D S IEE NALALAIV   +G+T   S  
Sbjct  350  DDIVSNSEPAPPQSRNNFETGDLLGLNDSTPDASLIEERNALALAIVSTETGSTALDSSG  409

Query  667  VQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAP  488
             Q +DFDPT WE+ALVSTP TN+S+  ERQLAGGL+SLTL+SLYDEGAYR++QQPVY  P
Sbjct  410  AQARDFDPTEWEIALVSTPSTNISSVNERQLAGGLNSLTLSSLYDEGAYRSAQQPVYVVP  469

Query  487  APNPFEVADPFAMSNAIAAPPSVQLAPMPQP--NPFGPFHPAAAAYPPQNPLMVGPHNPF  314
            APNPFEV DPFA+S++I    +VQ+A + Q   NPF  + P     P Q  +++ P NPF
Sbjct  470  APNPFEVQDPFALSSSIPPTSTVQMAAIAQQHINPFLHYQPYQ---PLQQHMLMNPANPF  526

Query  313  GDTgfgafpanngaaagAHQQNTNPFGS  230
            GD               +H  N NPFGS
Sbjct  527  GDA----GYGAFPVNPVSHPHNKNPFGS  550



>gb|KHN03156.1| Putative clathrin assembly protein [Glycine soja]
Length=554

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 133/208 (64%), Gaps = 14/208 (7%)
 Frame = -2

Query  832  DVAVSTTEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIV--PSGAT---SET  668
            D  VS +E   P     FET DLLGLN  T D S IEE NALALAIV   +G+T   S  
Sbjct  350  DDIVSNSEPAPPQSRNNFETGDLLGLNDSTPDASLIEERNALALAIVSTETGSTALDSSG  409

Query  667  VQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAP  488
             Q +DFDPT WE+ALVSTP TN+S+  ERQLAGGL+SLTL+SLYDEGAYR++QQPVY  P
Sbjct  410  AQARDFDPTEWEIALVSTPSTNISSVNERQLAGGLNSLTLSSLYDEGAYRSAQQPVYVVP  469

Query  487  APNPFEVADPFAMSNAIAAPPSVQLAPMPQP--NPFGPFHPAAAAYPPQNPLMVGPHNPF  314
            APNPFEV DPFA+S++I    +VQ+A + Q   NPF  + P     P Q  +++ P NPF
Sbjct  470  APNPFEVQDPFALSSSIPPTSTVQMAAIAQQHINPFLHYQPYQ---PLQQHMLMNPANPF  526

Query  313  GDTgfgafpanngaaagAHQQNTNPFGS  230
            GD               +H  N NPFGS
Sbjct  527  GDA----GYGAFPVNPVSHPHNKNPFGS  550



>gb|KJB30771.1| hypothetical protein B456_005G159800 [Gossypium raimondii]
Length=539

 Score =   181 bits (459),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 115/168 (68%), Gaps = 10/168 (6%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVP------SGATSETVQPKDFDPTGWELALV  620
             +T DLLGLN    D SAIEESNALALAIVP      S   S   QP +FDPTGWELALV
Sbjct  345  MDTGDLLGLNYSAPDASAIEESNALALAIVPTESGTASTFNSSAGQPVEFDPTGWELALV  404

Query  619  STPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNA  440
            +TP T++S P +RQLAGGLDSLTLNSLYDE AYRA Q P YG PAPNPF+  DPFAMSN 
Sbjct  405  TTPSTDISAPTDRQLAGGLDSLTLNSLYDEAAYRA-QHPAYGTPAPNPFDAQDPFAMSNN  463

Query  439  IAAPPSVQLAPMPQP--NPFG-PFHPAAAAYPPQNPLMVGPHNPFGDT  305
            +A PP+VQ+A M Q   NPFG            Q  LM+ P NPFGDT
Sbjct  464  VAPPPAVQMAAMAQQQNNPFGAYQPAYQQPQQQQQQLMMSPSNPFGDT  511



>gb|KJB30769.1| hypothetical protein B456_005G159800 [Gossypium raimondii]
Length=526

 Score =   181 bits (458),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 115/168 (68%), Gaps = 10/168 (6%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVP------SGATSETVQPKDFDPTGWELALV  620
             +T DLLGLN    D SAIEESNALALAIVP      S   S   QP +FDPTGWELALV
Sbjct  332  MDTGDLLGLNYSAPDASAIEESNALALAIVPTESGTASTFNSSAGQPVEFDPTGWELALV  391

Query  619  STPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNA  440
            +TP T++S P +RQLAGGLDSLTLNSLYDE AYRA Q P YG PAPNPF+  DPFAMSN 
Sbjct  392  TTPSTDISAPTDRQLAGGLDSLTLNSLYDEAAYRA-QHPAYGTPAPNPFDAQDPFAMSNN  450

Query  439  IAAPPSVQLAPMPQP--NPFG-PFHPAAAAYPPQNPLMVGPHNPFGDT  305
            +A PP+VQ+A M Q   NPFG            Q  LM+ P NPFGDT
Sbjct  451  VAPPPAVQMAAMAQQQNNPFGAYQPAYQQPQQQQQQLMMSPSNPFGDT  498



>gb|KJB30768.1| hypothetical protein B456_005G159800 [Gossypium raimondii]
Length=566

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 115/168 (68%), Gaps = 10/168 (6%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVP------SGATSETVQPKDFDPTGWELALV  620
             +T DLLGLN    D SAIEESNALALAIVP      S   S   QP +FDPTGWELALV
Sbjct  372  MDTGDLLGLNYSAPDASAIEESNALALAIVPTESGTASTFNSSAGQPVEFDPTGWELALV  431

Query  619  STPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNA  440
            +TP T++S P +RQLAGGLDSLTLNSLYDE AYRA Q P YG PAPNPF+  DPFAMSN 
Sbjct  432  TTPSTDISAPTDRQLAGGLDSLTLNSLYDEAAYRA-QHPAYGTPAPNPFDAQDPFAMSNN  490

Query  439  IAAPPSVQLAPMPQP--NPFG-PFHPAAAAYPPQNPLMVGPHNPFGDT  305
            +A PP+VQ+A M Q   NPFG            Q  LM+ P NPFGDT
Sbjct  491  VAPPPAVQMAAMAQQQNNPFGAYQPAYQQPQQQQQQLMMSPSNPFGDT  538



>gb|KJB78155.1| hypothetical protein B456_012G181700 [Gossypium raimondii]
Length=500

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 134/209 (64%), Gaps = 13/209 (6%)
 Frame = -2

Query  829  VAVSTTEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVP--SGA----TSET  668
            V VST E   P       T DLLGL+    D  AI++ N LALAIVP  SG     +S  
Sbjct  292  VVVSTVETAPPPTQTNIATGDLLGLSYSAPDAFAIKQINTLALAIVPIDSGTAPTYSSGA  351

Query  667  VQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGA-  491
             QPKDFDPTGWELALV+TP T++S   ERQLAGGLDSLT NSLYDE A RASQQPVYG+ 
Sbjct  352  GQPKDFDPTGWELALVTTPSTDISAAAERQLAGGLDSLTFNSLYDEAANRASQQPVYGST  411

Query  490  PAPNPFEVADPFAMSNAIAAPPSVQLAPMPQP--NPFGPFHPAAAAYPPQNPLMVGPHNP  317
             APNPFEV DPFAMSN+IA P +VQ++ M QP  NPF  + P    Y  Q+  +    NP
Sbjct  412  TAPNPFEVHDPFAMSNSIAPPIAVQMSGMAQPQNNPFDAYQP----YQQQHLTIPSASNP  467

Query  316  FGDTgfgafpanngaaagAHQQNTNPFGS  230
            FGD GFG FP N  A       N NPFGS
Sbjct  468  FGDAGFGTFPVNQTAVIAQPHANNNPFGS  496



>gb|KJB78156.1| hypothetical protein B456_012G181700 [Gossypium raimondii]
Length=561

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 134/209 (64%), Gaps = 13/209 (6%)
 Frame = -2

Query  829  VAVSTTEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVP--SGA----TSET  668
            V VST E   P       T DLLGL+    D  AI++ N LALAIVP  SG     +S  
Sbjct  353  VVVSTVETAPPPTQTNIATGDLLGLSYSAPDAFAIKQINTLALAIVPIDSGTAPTYSSGA  412

Query  667  VQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGA-  491
             QPKDFDPTGWELALV+TP T++S   ERQLAGGLDSLT NSLYDE A RASQQPVYG+ 
Sbjct  413  GQPKDFDPTGWELALVTTPSTDISAAAERQLAGGLDSLTFNSLYDEAANRASQQPVYGST  472

Query  490  PAPNPFEVADPFAMSNAIAAPPSVQLAPMPQP--NPFGPFHPAAAAYPPQNPLMVGPHNP  317
             APNPFEV DPFAMSN+IA P +VQ++ M QP  NPF  + P    Y  Q+  +    NP
Sbjct  473  TAPNPFEVHDPFAMSNSIAPPIAVQMSGMAQPQNNPFDAYQP----YQQQHLTIPSASNP  528

Query  316  FGDTgfgafpanngaaagAHQQNTNPFGS  230
            FGD GFG FP N  A       N NPFGS
Sbjct  529  FGDAGFGTFPVNQTAVIAQPHANNNPFGS  557



>gb|KJB78154.1| hypothetical protein B456_012G181700 [Gossypium raimondii]
Length=560

 Score =   179 bits (453),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 134/209 (64%), Gaps = 13/209 (6%)
 Frame = -2

Query  829  VAVSTTEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVP--SGA----TSET  668
            V VST E   P       T DLLGL+    D  AI++ N LALAIVP  SG     +S  
Sbjct  352  VVVSTVETAPPPTQTNIATGDLLGLSYSAPDAFAIKQINTLALAIVPIDSGTAPTYSSGA  411

Query  667  VQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGA-  491
             QPKDFDPTGWELALV+TP T++S   ERQLAGGLDSLT NSLYDE A RASQQPVYG+ 
Sbjct  412  GQPKDFDPTGWELALVTTPSTDISAAAERQLAGGLDSLTFNSLYDEAANRASQQPVYGST  471

Query  490  PAPNPFEVADPFAMSNAIAAPPSVQLAPMPQP--NPFGPFHPAAAAYPPQNPLMVGPHNP  317
             APNPFEV DPFAMSN+IA P +VQ++ M QP  NPF  + P    Y  Q+  +    NP
Sbjct  472  TAPNPFEVHDPFAMSNSIAPPIAVQMSGMAQPQNNPFDAYQP----YQQQHLTIPSASNP  527

Query  316  FGDTgfgafpanngaaagAHQQNTNPFGS  230
            FGD GFG FP N  A       N NPFGS
Sbjct  528  FGDAGFGTFPVNQTAVIAQPHANNNPFGS  556



>gb|KJB78157.1| hypothetical protein B456_012G181700 [Gossypium raimondii]
Length=561

 Score =   179 bits (453),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 134/209 (64%), Gaps = 13/209 (6%)
 Frame = -2

Query  829  VAVSTTEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVP--SGA----TSET  668
            V VST E   P       T DLLGL+    D  AI++ N LALAIVP  SG     +S  
Sbjct  353  VVVSTVETAPPPTQTNIATGDLLGLSYSAPDAFAIKQINTLALAIVPIDSGTAPTYSSGA  412

Query  667  VQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGA-  491
             QPKDFDPTGWELALV+TP T++S   ERQLAGGLDSLT NSLYDE A RASQQPVYG+ 
Sbjct  413  GQPKDFDPTGWELALVTTPSTDISAAAERQLAGGLDSLTFNSLYDEAANRASQQPVYGST  472

Query  490  PAPNPFEVADPFAMSNAIAAPPSVQLAPMPQP--NPFGPFHPAAAAYPPQNPLMVGPHNP  317
             APNPFEV DPFAMSN+IA P +VQ++ M QP  NPF  + P    Y  Q+  +    NP
Sbjct  473  TAPNPFEVHDPFAMSNSIAPPIAVQMSGMAQPQNNPFDAYQP----YQQQHLTIPSASNP  528

Query  316  FGDTgfgafpanngaaagAHQQNTNPFGS  230
            FGD GFG FP N  A       N NPFGS
Sbjct  529  FGDAGFGTFPVNQTAVIAQPHANNNPFGS  557



>ref|XP_007153280.1| hypothetical protein PHAVU_003G022000g [Phaseolus vulgaris]
 gb|ESW25274.1| hypothetical protein PHAVU_003G022000g [Phaseolus vulgaris]
Length=552

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 125/206 (61%), Gaps = 11/206 (5%)
 Frame = -2

Query  832  DVAVSTTEIPAPVPPVK--FETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQP  659
            D  VS +E+ AP PP    FET DLLGLN  TSD S IEE NA ALAIVP+   S     
Sbjct  349  DDVVSNSEL-APPPPSHNYFETGDLLGLNDSTSDASFIEERNAHALAIVPTEIDSRADPA  407

Query  658  KDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPN  479
            +D DPTGWELALVSTP T +S   ERQLAG L SLTLNS+YD GAYR  QQP +G PAPN
Sbjct  408  RDLDPTGWELALVSTPSTTVSPVNERQLAGRLSSLTLNSIYDPGAYRYVQQPAFGVPAPN  467

Query  478  PFEVADPFAMSNAIAAPPSVQLAPMPQP---NPFGPFHPAAAAYPPQNPLMVGPHNPFGD  308
            PFEV  PF +S +   PP+VQ+A + Q    +PFG + P     P Q  +++ P NPF D
Sbjct  468  PFEVQHPFGLSTSFPRPPNVQMATISQEHIHHPFGHYQPYQHQ-PLQQHMLMSPANPFED  526

Query  307  TgfgafpanngaaagAHQQNTNPFGS  230
                           +H  N NPFGS
Sbjct  527  A----GYGAFPVHPVSHPHNNNPFGS  548



>gb|EPS70597.1| hypothetical protein M569_04158, partial [Genlisea aurea]
Length=429

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 119/165 (72%), Gaps = 10/165 (6%)
 Frame = -2

Query  772  DDLLGLNAPTSDVSAIEESNALALAIVPSGATSETV-QPKDFDPTGWELALVSTPGTNLS  596
            DDLLGLNA +++  AIEE+NALALAIVPSG++S    Q KDFDPTGWELALVSTP TNLS
Sbjct  245  DDLLGLNAVSNEAFAIEEANALALAIVPSGSSSNGSSQVKDFDPTGWELALVSTPSTNLS  304

Query  595  TP--QERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPS  422
            +   QE+QLAGGLDSLTLNSLYDEGAYRASQ PVYG+PAPNPF + DPFA+SN I    +
Sbjct  305  SSSVQEKQLAGGLDSLTLNSLYDEGAYRASQIPVYGSPAPNPFMINDPFAVSNRIPTTAT  364

Query  421  VQLAPMPQ-PNPFGPFH----PAAAAYPPQNPLMVGPH--NPFGD  308
                 M Q  NPF  F     P+    PP N   +G H  NPFGD
Sbjct  365  PPPPLMQQNNNPFAAFQSPPPPSYHPLPPHNRPFIGHHHQNPFGD  409



>ref|XP_010681909.1| PREDICTED: putative clathrin assembly protein At2g01600 [Beta 
vulgaris subsp. vulgaris]
Length=567

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 126/193 (65%), Gaps = 21/193 (11%)
 Frame = -2

Query  838  AEDVAVSTTEIPA----PVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPS---GA  680
            ++D++ S    PA    P P +  ++ DLLGLN  T   SAIEESNALALAIVPS    +
Sbjct  353  SDDLSSSAEAAPAVASVPPPAMNIDSGDLLGLNDATPVASAIEESNALALAIVPSEDSAS  412

Query  679  TSE--TVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQ  506
            TS   T   K+FDP GWELALV+TP  ++S+  ERQLAGGLDSL LNSLYDE AYRA+QQ
Sbjct  413  TSNYGTASAKEFDPNGWELALVTTPSNDISSHTERQLAGGLDSLILNSLYDEAAYRANQQ  472

Query  505  PVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPMPQ---PNPFG----PFHPAAAAYPPQ  347
            PVYGAPA NPFEV DPF MSN  A   +VQ+  M Q    NPFG    PFH  +     Q
Sbjct  473  PVYGAPAHNPFEVQDPFGMSNNFAPSAAVQMNSMTQQPPANPFGAYQAPFHAQS-----Q  527

Query  346  NPLMVGPHNPFGD  308
             P+ VG  NPF D
Sbjct  528  PPVGVGAPNPFTD  540



>gb|KJB30770.1| hypothetical protein B456_005G159800 [Gossypium raimondii]
Length=592

 Score =   173 bits (438),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 110/161 (68%), Gaps = 10/161 (6%)
 Frame = -2

Query  760  GLNAPTSDVSAIEESNALALAIVP------SGATSETVQPKDFDPTGWELALVSTPGTNL  599
            GLN    D SAIEESNALALAIVP      S   S   QP +FDPTGWELALV+TP T++
Sbjct  405  GLNYSAPDASAIEESNALALAIVPTESGTASTFNSSAGQPVEFDPTGWELALVTTPSTDI  464

Query  598  STPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSV  419
            S P +RQLAGGLDSLTLNSLYDE AYRA Q P YG PAPNPF+  DPFAMSN +A PP+V
Sbjct  465  SAPTDRQLAGGLDSLTLNSLYDEAAYRA-QHPAYGTPAPNPFDAQDPFAMSNNVAPPPAV  523

Query  418  QLAPMPQP--NPFG-PFHPAAAAYPPQNPLMVGPHNPFGDT  305
            Q+A M Q   NPFG            Q  LM+ P NPFGDT
Sbjct  524  QMAAMAQQQNNPFGAYQPAYQQPQQQQQQLMMSPSNPFGDT  564



>ref|XP_010527791.1| PREDICTED: putative clathrin assembly protein At2g01600 [Tarenaya 
hassleriana]
Length=572

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 111/163 (68%), Gaps = 22/163 (13%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVP-----SGATSETVQPKDFDPTGWELALVS  617
             +TDDLLGL++   D S IE+ NALALAIVP     S  TS   Q K+FDPTGWELALV+
Sbjct  374  IDTDDLLGLSSAAPDASVIEDQNALALAIVPTDGNNSSTTSGYGQVKEFDPTGWELALVT  433

Query  616  TPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAI  437
            TP  ++S   ERQLAGGLD+LTLNSLY+EGAYRA QQP YGAPAPNPFEV DPFA++N +
Sbjct  434  TPTPDISAATERQLAGGLDTLTLNSLYEEGAYRAGQQPAYGAPAPNPFEVQDPFALAN-V  492

Query  436  AAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPHNPFGD  308
            A  P+V        NPF P+ P    Y P       P NPFGD
Sbjct  493  APAPAVN-------NPFAPYQP---IYAPT------PTNPFGD  519



>ref|XP_010921268.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X4 [Elaeis guineensis]
 ref|XP_010921278.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X4 [Elaeis guineensis]
 ref|XP_010921284.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X4 [Elaeis guineensis]
Length=310

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 129/209 (62%), Gaps = 16/209 (8%)
 Frame = -2

Query  820  STTEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT----SETVQPKD  653
            S  E+ +P   V  +T DLLGLN    D SAIEESNALALAIVPSG T    S   Q K 
Sbjct  107  SNVEVASPRTAVTEDTGDLLGLNETNPDASAIEESNALALAIVPSGDTTSIDSGMTQEKG  166

Query  652  FDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPF  473
            FDP+GWELALV+TP +  S+  E  L GG D LTL+SLYDE AYR  QQ  YGAPAPNPF
Sbjct  167  FDPSGWELALVTTPSSTNSSMVESHLGGGFDKLTLDSLYDEAAYRRQQQQFYGAPAPNPF  226

Query  472  EVADPFAMSNAIAAPPSVQLAPMPQPNPFG------PFHPAAAAYPPQNPLMVGPHNPFG  311
              ADPFAMSN + APP+VQ A M Q           P +P A   P Q+ ++    NPFG
Sbjct  227  LSADPFAMSNRVTAPPAVQTAAMAQQQQQQQMSMMVPSNPFAQPIPQQHMVVGAASNPFG  286

Query  310  DTgfgafpanngaaagAHQQNTNPFGSLL  224
            D G GAFPANN       Q  TNPFG+ L
Sbjct  287  DVGVGAFPANNP------QHQTNPFGTQL  309



>ref|XP_010921261.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X3 [Elaeis guineensis]
Length=533

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 129/209 (62%), Gaps = 16/209 (8%)
 Frame = -2

Query  820  STTEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT----SETVQPKD  653
            S  E+ +P   V  +T DLLGLN    D SAIEESNALALAIVPSG T    S   Q K 
Sbjct  330  SNVEVASPRTAVTEDTGDLLGLNETNPDASAIEESNALALAIVPSGDTTSIDSGMTQEKG  389

Query  652  FDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPF  473
            FDP+GWELALV+TP +  S+  E  L GG D LTL+SLYDE AYR  QQ  YGAPAPNPF
Sbjct  390  FDPSGWELALVTTPSSTNSSMVESHLGGGFDKLTLDSLYDEAAYRRQQQQFYGAPAPNPF  449

Query  472  EVADPFAMSNAIAAPPSVQLAPMPQPNPFG------PFHPAAAAYPPQNPLMVGPHNPFG  311
              ADPFAMSN + APP+VQ A M Q           P +P A   P Q+ ++    NPFG
Sbjct  450  LSADPFAMSNRVTAPPAVQTAAMAQQQQQQQMSMMVPSNPFAQPIPQQHMVVGAASNPFG  509

Query  310  DTgfgafpanngaaagAHQQNTNPFGSLL  224
            D G GAFPANN       Q  TNPFG+ L
Sbjct  510  DVGVGAFPANNP------QHQTNPFGTQL  532



>ref|XP_010921255.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X2 [Elaeis guineensis]
Length=558

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 129/209 (62%), Gaps = 16/209 (8%)
 Frame = -2

Query  820  STTEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT----SETVQPKD  653
            S  E+ +P   V  +T DLLGLN    D SAIEESNALALAIVPSG T    S   Q K 
Sbjct  355  SNVEVASPRTAVTEDTGDLLGLNETNPDASAIEESNALALAIVPSGDTTSIDSGMTQEKG  414

Query  652  FDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPF  473
            FDP+GWELALV+TP +  S+  E  L GG D LTL+SLYDE AYR  QQ  YGAPAPNPF
Sbjct  415  FDPSGWELALVTTPSSTNSSMVESHLGGGFDKLTLDSLYDEAAYRRQQQQFYGAPAPNPF  474

Query  472  EVADPFAMSNAIAAPPSVQLAPMPQPNPFG------PFHPAAAAYPPQNPLMVGPHNPFG  311
              ADPFAMSN + APP+VQ A M Q           P +P A   P Q+ ++    NPFG
Sbjct  475  LSADPFAMSNRVTAPPAVQTAAMAQQQQQQQMSMMVPSNPFAQPIPQQHMVVGAASNPFG  534

Query  310  DTgfgafpanngaaagAHQQNTNPFGSLL  224
            D G GAFPANN       Q  TNPFG+ L
Sbjct  535  DVGVGAFPANNP------QHQTNPFGTQL  557



>ref|XP_010921252.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X1 [Elaeis guineensis]
Length=560

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 129/209 (62%), Gaps = 16/209 (8%)
 Frame = -2

Query  820  STTEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT----SETVQPKD  653
            S  E+ +P   V  +T DLLGLN    D SAIEESNALALAIVPSG T    S   Q K 
Sbjct  357  SNVEVASPRTAVTEDTGDLLGLNETNPDASAIEESNALALAIVPSGDTTSIDSGMTQEKG  416

Query  652  FDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPF  473
            FDP+GWELALV+TP +  S+  E  L GG D LTL+SLYDE AYR  QQ  YGAPAPNPF
Sbjct  417  FDPSGWELALVTTPSSTNSSMVESHLGGGFDKLTLDSLYDEAAYRRQQQQFYGAPAPNPF  476

Query  472  EVADPFAMSNAIAAPPSVQLAPMPQPNPFG------PFHPAAAAYPPQNPLMVGPHNPFG  311
              ADPFAMSN + APP+VQ A M Q           P +P A   P Q+ ++    NPFG
Sbjct  477  LSADPFAMSNRVTAPPAVQTAAMAQQQQQQQMSMMVPSNPFAQPIPQQHMVVGAASNPFG  536

Query  310  DTgfgafpanngaaagAHQQNTNPFGSLL  224
            D G GAFPANN       Q  TNPFG+ L
Sbjct  537  DVGVGAFPANNP------QHQTNPFGTQL  559



>emb|CDY17459.1| BnaC09g20780D [Brassica napus]
Length=570

 Score =   159 bits (403),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 111/173 (64%), Gaps = 25/173 (14%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPS----GATSETVQPKDFDPTGWELALVST  614
             +TDDLLGLN    D SAIE+ NALALAI+ +     +T  + Q  D+DPTGWELALV+T
Sbjct  375  IDTDDLLGLNTAAPDASAIEDQNALALAIISTDGGNASTPRSFQANDYDPTGWELALVTT  434

Query  613  PGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIA  434
            P  ++S   +RQLAGGLD+LTLNSLYD+GAY ASQ+PVYGAPAPNPFEV DPFA SN   
Sbjct  435  PSNDISAATDRQLAGGLDTLTLNSLYDDGAYIASQRPVYGAPAPNPFEVHDPFATSNGTL  494

Query  433  AP--PSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVG---------PHNPFGD  308
             P  P+V        NPFG + P    +  Q   +VG           NPFGD
Sbjct  495  PPQQPAVN-------NPFGAYQPTYGQHQLQ---LVGAPNAQANNNSSNPFGD  537



>ref|XP_009114226.1| PREDICTED: putative clathrin assembly protein At2g01600 [Brassica 
rapa]
 emb|CDY04095.1| BnaA09g18730D [Brassica napus]
Length=571

 Score =   159 bits (403),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 100/140 (71%), Gaps = 8/140 (6%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSET---VQPKDFDPTGWELALVSTP  611
             +TDDLLGLN    D SAIE+ NALALAI+ +   S T    Q  D+DPTGWELALV+TP
Sbjct  377  IDTDDLLGLNTSAPDASAIEDQNALALAIISNDGNSSTPRSFQANDYDPTGWELALVTTP  436

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAA  431
              ++S   +RQLAGGLD+LTLNSLYD+GAY ASQ+PVYGAPAPNPFEV DPFA SN    
Sbjct  437  SNDISAATDRQLAGGLDTLTLNSLYDDGAYIASQRPVYGAPAPNPFEVHDPFATSN--GT  494

Query  430  PPSVQLAPMPQPNPFGPFHP  371
            PP  Q A     NPFG + P
Sbjct  495  PPPQQPAV---NNPFGAYQP  511



>emb|CDY53525.1| BnaC05g11150D [Brassica napus]
Length=697

 Score =   160 bits (404),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 112/170 (66%), Gaps = 13/170 (8%)
 Frame = -2

Query  802  APVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETV---QPKDFDPTGWE  632
            A  P    +TDDLLGLN    D   I + NALALA+V +   S      Q +D DP+GWE
Sbjct  362  AETPQNLIDTDDLLGLNNDAPDPLEILDQNALALALVSTDVESSFFDLGQARDSDPSGWE  421

Query  631  LALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFA  452
            LALV+TP +++S   ERQLAGGLD+LTLNSLYD+ AYRA+QQP YGAPAPNPFEV DPFA
Sbjct  422  LALVTTPSSDISATTERQLAGGLDTLTLNSLYDDVAYRAAQQPAYGAPAPNPFEVQDPFA  481

Query  451  MSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPH--NPFGD  308
             SN+++AP +       + NPFGP+ PA      Q  L V P   NPFGD
Sbjct  482  FSNSVSAPSA-------ESNPFGPYQPAYQQQQQQE-LQVAPGAANPFGD  523



>ref|XP_010924074.1| PREDICTED: putative clathrin assembly protein At2g01600 [Elaeis 
guineensis]
Length=562

 Score =   156 bits (394),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 132/220 (60%), Gaps = 34/220 (15%)
 Frame = -2

Query  820  STTEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSET----VQPKD  653
            S  E+ +P   V  +  DLLGLN    D SAIEESNALALAIVPS  T+ +    VQ K 
Sbjct  355  SNVEVASPHKAVTEDAGDLLGLNETNPDASAIEESNALALAIVPSDYTTSSGSGMVQEKG  414

Query  652  FDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYR------ASQQPVYGA  491
            FDP+GWELALV+TP    S+  E QL GG D LTL+SLYDE AYR        QQ  YGA
Sbjct  415  FDPSGWELALVTTPSNTNSSMVESQLGGGFDKLTLDSLYDEAAYRQGQQQQQQQQQFYGA  474

Query  490  PAPNPFEVADPFAMSNAIAAPPSVQLAP----------MPQPNPFGPFHPAAAAYPPQNP  341
            PAPNPF  ADPF MSN +AAPPSVQ+A           M  PNPF  F P      PQ  
Sbjct  475  PAPNPFLSADPFMMSNQVAAPPSVQMAAMAQQQQQMPLMAPPNPF--FQPV-----PQQH  527

Query  340  LMVG-PHNPFGDTgfgafpanngaaagAHQQNTNPFGSLL  224
            + +G   NPFGD GFGAFPANN       Q  +NPFGS L
Sbjct  528  MGIGAAQNPFGDVGFGAFPANNT------QHQSNPFGSQL  561



>emb|CDY45299.1| BnaA06g09690D [Brassica napus]
Length=688

 Score =   156 bits (395),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 110/171 (64%), Gaps = 13/171 (8%)
 Frame = -2

Query  802  APVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETV---QPKDFDPTGWE  632
            A  P    +TDDLLGLN    D   I + NALALA+V +   S      Q +D DP+GWE
Sbjct  362  AETPQNLIDTDDLLGLNNDAPDPLEILDQNALALALVSTDVESSFFDLGQVRDSDPSGWE  421

Query  631  LALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFA  452
            LALV+TP +++S   ERQLAGGLD+LTLNSLYD+  YRA+QQP YGAPAPNPFEV DPF 
Sbjct  422  LALVTTPSSDISATTERQLAGGLDTLTLNSLYDDVTYRAAQQPAYGAPAPNPFEVQDPFG  481

Query  451  MSNAIAAPPSVQLAPMPQPNPFGPFHPA-AAAYPPQNPLMVGPH--NPFGD  308
             SN+++AP +       + NPFGP+ PA       Q  L V P   NPFGD
Sbjct  482  FSNSVSAPSA-------ESNPFGPYQPAYQQQQQQQQELQVAPGAANPFGD  525



>gb|AAM67368.1| unknown [Arabidopsis thaliana]
Length=306

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 105/166 (63%), Gaps = 12/166 (7%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPSGA---TSETVQPKDFDPTGWELALVSTP  611
             +TDDLLGLN    D S IE+ NALALAIV + A   T    QP ++DPTGWELALV+ P
Sbjct  109  IDTDDLLGLNTGAPDTSVIEDQNALALAIVSTDADPPTPHFGQPNNYDPTGWELALVTAP  168

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAA  431
             +++S   ER+LAGGLD+LTL+SLYD+GAY  SQ+PVYGAPAPNPF   DPFA SN  A 
Sbjct  169  SSDISASTERKLAGGLDTLTLSSLYDDGAYITSQRPVYGAPAPNPFASHDPFASSNGTAP  228

Query  430  PPSVQLAPMPQPNPFGPF-----HPAAAAYPPQNPLMVGPHNPFGD  308
            PP  Q       NPFG +     H     Y  Q+       NPFGD
Sbjct  229  PPQQQAV----NNPFGAYQQTYQHQPQPTYQHQSNPPTNNSNPFGD  270



>ref|XP_004969636.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Setaria italica]
Length=565

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 118/187 (63%), Gaps = 22/187 (12%)
 Frame = -2

Query  820  STTEIPAPVP-PVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGA-----TSETVQP  659
            ST+EI +P P P   +T DLLGL+ P  +VS IEESNALALAI+P+G      ++ T Q 
Sbjct  360  STSEIASPPPKPEIADTGDLLGLSDPNPNVSVIEESNALALAIMPTGVDNSTTSTATQQD  419

Query  658  KDFDPTGWELALVSTPGTNLS-TPQERQLAGGLDSLTLNSLYDEGAYR-ASQQPVYGAPA  485
            K FDPTGWELALV+TP TN +    E  L GG D LTL+SLYD+G YR   QQ +YG+  
Sbjct  420  KGFDPTGWELALVATPSTNTNPLAMESSLGGGFDKLTLDSLYDDGTYRQMQQQQLYGSAP  479

Query  484  PNPFEVADPFAMSNAIAAPPSVQLAPMPQP--------NPFGPFHPAAAAYPPQNPLMVG  329
            PNPF  +DPFAMSN +A+PPSVQ+A M Q         NPFGP         PQ+  M  
Sbjct  480  PNPFMASDPFAMSNQVASPPSVQMAAMAQQPHPLMIEANPFGP------PLQPQHAGMAP  533

Query  328  PHNPFGD  308
              NPF D
Sbjct  534  AANPFLD  540



>ref|XP_009148877.1| PREDICTED: putative clathrin assembly protein At1g14910 [Brassica 
rapa]
Length=766

 Score =   156 bits (395),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 110/170 (65%), Gaps = 13/170 (8%)
 Frame = -2

Query  802  APVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETV---QPKDFDPTGWE  632
            A  P    +TDDLLGLN    D   I + NALALA+V +   S      Q +D DP+GWE
Sbjct  363  AETPQNLIDTDDLLGLNNDAPDPLEILDQNALALALVSTDVESSFFDLGQVRDSDPSGWE  422

Query  631  LALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFA  452
            LALV+TP +++S   ERQLAGGLD+LTLNSLYD+  YRA+QQP YGAPAPNPFEV DPF 
Sbjct  423  LALVTTPSSDISATTERQLAGGLDTLTLNSLYDDVTYRAAQQPAYGAPAPNPFEVQDPFG  482

Query  451  MSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPH--NPFGD  308
             SN+++AP +       + NPFGP+ PA      Q  L V P   NPFGD
Sbjct  483  FSNSVSAPSA-------ESNPFGPYQPAYQQQQQQE-LQVAPGAANPFGD  524



>ref|XP_006655551.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Oryza brachyantha]
Length=566

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 109/177 (62%), Gaps = 28/177 (16%)
 Frame = -2

Query  778  ETDDLLGLNAPTSDVSAIEESNALALAIVPSGA-----TSETVQPKDFDPTGWELALVST  614
            +T DLLGLN P   VSAIEESNALALAIVP+ A     ++ T Q K FDPTGWELALV+T
Sbjct  375  DTGDLLGLNDPNPSVSAIEESNALALAIVPTDAGASTSSTATWQDKGFDPTGWELALVTT  434

Query  613  PGTNLSTPQERQLAGGLDSLTLNSLYDEGAYR-ASQQPVYGAPAPNPFEVADPFAMSNAI  437
            P    S+  + QL GG D L L+SLYD+G YR   QQP+YG+ APNPF   DPFAMSN I
Sbjct  435  PSNTNSSVADSQLGGGFDKLILDSLYDQGDYRQRQQQPLYGSSAPNPFMSNDPFAMSNQI  494

Query  436  AAPPSVQLAPMPQP----------NPFGPFHPAAAAYPPQNPLMVG---PHNPFGDT  305
            A PPSVQ+A M Q           NPFG         PP  P  VG     NPF D+
Sbjct  495  APPPSVQMAAMSQQHQQIPTMMQANPFG---------PPMQPQHVGMGPATNPFLDS  542



>ref|XP_010424931.1| PREDICTED: putative clathrin assembly protein At2g01600 [Camelina 
sativa]
Length=284

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 99/146 (68%), Gaps = 6/146 (4%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSET---VQPKDFDPTGWELALVSTP  611
             +TDDLLGLN+   D S IE+ NALALAI+ + A   T    Q  D+DPTGWELALV+ P
Sbjct  85   IDTDDLLGLNSAAPDASVIEDQNALALAIISTDANPSTPGFGQANDYDPTGWELALVTAP  144

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAA  431
             +++S   ER+LAGGLD+LTL+SLYD+GAY ASQ+PVYGAPAPNPF   DPFA SN    
Sbjct  145  SSDISAATERKLAGGLDTLTLSSLYDDGAYIASQRPVYGAPAPNPFASHDPFASSNGTTP  204

Query  430  PPSVQLAPMPQPNPFGPFHPAAAAYP  353
            PP  Q A     NPFG + P     P
Sbjct  205  PPQQQPAVN---NPFGAYQPTYQHQP  227



>gb|KFK32949.1| hypothetical protein AALP_AA6G310300 [Arabis alpina]
Length=705

 Score =   155 bits (392),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 104/162 (64%), Gaps = 12/162 (7%)
 Frame = -2

Query  778  ETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETV---QPKDFDPTGWELALVSTPG  608
            +TDDLLGLN    D  AI + NALALA+V +   S T    Q  D DP+GWELALV+TP 
Sbjct  380  DTDDLLGLNNDAPDPLAILDQNALALALVSADVDSSTFGFGQANDLDPSGWELALVTTPS  439

Query  607  TNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAAP  428
             ++S   ERQLAGGLD+LTLNSLYD+GAYRA+QQP YGAP PNPFEV DPF  SN++  P
Sbjct  440  DDISAATERQLAGGLDTLTLNSLYDDGAYRAAQQPAYGAPTPNPFEVQDPFTFSNSV--P  497

Query  427  PSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPH--NPFGD  308
            P     P    NPFG + P       Q    V P   NPFGD
Sbjct  498  P-----PSAASNPFGSYQPTFQQQQEQPHQEVAPTAANPFGD  534



>gb|AAD12692.3| expressed protein [Arabidopsis thaliana]
Length=348

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 105/166 (63%), Gaps = 12/166 (7%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPSGA---TSETVQPKDFDPTGWELALVSTP  611
             +TDDL GLN    D S IE+ NALALAIV + A   T    QP ++DPTGWELALV+ P
Sbjct  151  IDTDDLWGLNTGAPDTSVIEDQNALALAIVSTDADPPTPHFGQPNNYDPTGWELALVTAP  210

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAA  431
             +++S   ER+LAGGLD+LTL+SLYD+GAY ASQ+PVYGAPAPNPF   DPFA SN  A 
Sbjct  211  SSDISASTERKLAGGLDTLTLSSLYDDGAYIASQRPVYGAPAPNPFASHDPFASSNGTAP  270

Query  430  PPSVQLAPMPQPNPFGPF-----HPAAAAYPPQNPLMVGPHNPFGD  308
            PP  Q       NPFG +     H     Y  Q+       NPFGD
Sbjct  271  PPQQQAV----NNPFGAYQQTYQHQPQPTYQHQSNPPTNNSNPFGD  312



>ref|XP_006395874.1| hypothetical protein EUTSA_v10003910mg [Eutrema salsugineum]
 gb|ESQ33160.1| hypothetical protein EUTSA_v10003910mg [Eutrema salsugineum]
Length=571

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 100/140 (71%), Gaps = 12/140 (9%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPSG---ATSETVQPKDFDPTGWELALVSTP  611
             +TDDLLGLN    D SAIE  NALALAI+P+    +T    Q  D+DP+GWELALV+TP
Sbjct  374  IDTDDLLGLNTAGPDASAIENQNALALAIIPTDGNPSTPRFGQANDYDPSGWELALVTTP  433

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAA  431
              ++S   +RQLAGGLD+LTLNSLYD+GAY ASQ+PVYGAPAPNPFEV DPFA SN+   
Sbjct  434  SNDISAATDRQLAGGLDTLTLNSLYDDGAYIASQRPVYGAPAPNPFEVQDPFASSNSTPT  493

Query  430  P--PSVQLAPMPQPNPFGPF  377
            P  P+V        NPFG +
Sbjct  494  PQQPAVN-------NPFGAY  506



>ref|NP_565267.1| putative clathrin assembly protein [Arabidopsis thaliana]
 sp|Q8LBH2.2|CAP8_ARATH RecName: Full=Putative clathrin assembly protein At2g01600 [Arabidopsis 
thaliana]
 gb|AAL11587.1|AF424593_1 At2g01600/F2I9.22 [Arabidopsis thaliana]
 gb|AAM15059.1| expressed protein [Arabidopsis thaliana]
 gb|AAM20138.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91762.1| unknown protein [Arabidopsis thaliana]
 gb|AEC05472.1| putative clathrin assembly protein [Arabidopsis thaliana]
Length=571

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 105/166 (63%), Gaps = 12/166 (7%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPSGA---TSETVQPKDFDPTGWELALVSTP  611
             +TDDL GLN    D S IE+ NALALAIV + A   T    QP ++DPTGWELALV+ P
Sbjct  374  IDTDDLWGLNTGAPDTSVIEDQNALALAIVSTDADPPTPHFGQPNNYDPTGWELALVTAP  433

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAA  431
             +++S   ER+LAGGLD+LTL+SLYD+GAY ASQ+PVYGAPAPNPF   DPFA SN  A 
Sbjct  434  SSDISASTERKLAGGLDTLTLSSLYDDGAYIASQRPVYGAPAPNPFASHDPFASSNGTAP  493

Query  430  PPSVQLAPMPQPNPFGPF-----HPAAAAYPPQNPLMVGPHNPFGD  308
            PP  Q       NPFG +     H     Y  Q+       NPFGD
Sbjct  494  PPQQQAV----NNPFGAYQQTYQHQPQPTYQHQSNPPTNNSNPFGD  535



>ref|XP_009101331.1| PREDICTED: putative clathrin assembly protein At2g01600 [Brassica 
rapa]
Length=571

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 98/136 (72%), Gaps = 8/136 (6%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPSGA---TSETVQPKDFDPTGWELALVSTP  611
             +TDDLLGLN    D SAIEE NALALA++P+     T    Q  ++DP+GWELALV+TP
Sbjct  376  IDTDDLLGLNTAAPDASAIEEQNALALAVIPTDGNPPTPRFGQTNNYDPSGWELALVTTP  435

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAA  431
              ++S   +RQLAGGLD+LTLNSLYD+GAY ASQ+PVYGAPAPNPFEV DPFA SN    
Sbjct  436  SNDISAATDRQLAGGLDTLTLNSLYDDGAYIASQRPVYGAPAPNPFEVHDPFATSN--RT  493

Query  430  PPSVQLAPMPQPNPFG  383
            PP  Q A     NPFG
Sbjct  494  PPPQQPAV---SNPFG  506



>emb|CDY17660.1| BnaA06g34790D [Brassica napus]
Length=571

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 99/136 (73%), Gaps = 8/136 (6%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPSGA---TSETVQPKDFDPTGWELALVSTP  611
             +TDDLLGLN    D SAIEE NALALA++P+     T    Q  ++DP+GWELALV+TP
Sbjct  376  IDTDDLLGLNTAAPDASAIEEQNALALAVIPTDGNPPTPSFGQTNNYDPSGWELALVTTP  435

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAA  431
              ++S   +RQLAGGLD+LTLNSLYD+GAY ASQ+PVYGAPAPNPFEV DPFA SN  + 
Sbjct  436  SNDISAATDRQLAGGLDTLTLNSLYDDGAYIASQRPVYGAPAPNPFEVHDPFATSN--ST  493

Query  430  PPSVQLAPMPQPNPFG  383
            PP  Q A     NPFG
Sbjct  494  PPPQQPAV---SNPFG  506



>ref|XP_002875082.1| hypothetical protein ARALYDRAFT_904366 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51341.1| hypothetical protein ARALYDRAFT_904366 [Arabidopsis lyrata subsp. 
lyrata]
Length=562

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 104/164 (63%), Gaps = 16/164 (10%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSET---VQPKDFDPTGWELALVSTP  611
             + DDLLGLN    D S IE+ NALALAI+ + A   T    Q  D+DPTGWELALV+ P
Sbjct  373  IDNDDLLGLNTSAPDASVIEDQNALALAIISTDANPSTPRFGQANDYDPTGWELALVTAP  432

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAA  431
             +++S   ER+LAGGLD+LTL+SLYD+GAY ASQ+PVYGAPAPNPF   DPFA SN    
Sbjct  433  SSDISAATERKLAGGLDTLTLSSLYDDGAYIASQRPVYGAPAPNPFASHDPFASSNGTTP  492

Query  430  PPSVQLAPMPQP---NPFGPFHPAAAAYPPQNPLMVGPHNPFGD  308
            PP        QP   NPFG + P    Y  Q+       NPFGD
Sbjct  493  PPQ-------QPAVNNPFGAYQP---TYQHQSNPPTNNSNPFGD  526



>emb|CDY36239.1| BnaC07g20930D [Brassica napus]
Length=571

 Score =   151 bits (381),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 99/138 (72%), Gaps = 12/138 (9%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPSGA---TSETVQPKDFDPTGWELALVSTP  611
             +TDDLLGLN    D SAIE+ NALALA++P+     T    Q  ++DP+GWELALV+TP
Sbjct  376  IDTDDLLGLNTAAPDASAIEDQNALALAVIPTDGNPPTPRFGQTNNYDPSGWELALVTTP  435

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAA  431
              ++S   +RQLAGGLD+LTLNSLYD+GAY ASQ+PVYGAPAPNPFEV DPFA SN+   
Sbjct  436  SNDISAATDRQLAGGLDTLTLNSLYDDGAYIASQRPVYGAPAPNPFEVHDPFATSNSTLP  495

Query  430  P--PSVQLAPMPQPNPFG  383
            P  P+V        NPFG
Sbjct  496  PQQPAVS-------NPFG  506



>gb|AFW80975.1| hypothetical protein ZEAMMB73_079219 [Zea mays]
Length=568

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 123/213 (58%), Gaps = 29/213 (14%)
 Frame = -2

Query  817  TTEIPAPVPPVKF-ETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSET----VQPKD  653
             TE+ +P P  +  +T DLLGL+     VSAIEESNALALAIVP+   S T     Q K 
Sbjct  364  VTEVVSPPPKAEVPDTGDLLGLDDTNPAVSAIEESNALALAIVPTDGASTTGNTAFQDKG  423

Query  652  FDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAY-RASQQPVYGAPAPNP  476
            FDPTGWELALV+ P    S+    QL GGLD L L SLYD+GAY +  QQ +YG+ APNP
Sbjct  424  FDPTGWELALVTAPSNTTSSTSVGQLGGGLDKLILESLYDDGAYRQRQQQQLYGSAAPNP  483

Query  475  FEVADPFAMSNAIAAPPSVQLAPMP----------QPNPFG-PFHPAAAAYPPQNPLMVG  329
            F   DPFAMSN +A PPSVQ+A M           QPNPFG P HP  +  P  N     
Sbjct  484  FMANDPFAMSNQVAPPPSVQMAAMSQQHQQIPTMMQPNPFGPPMHPQVSMAPATN-----  538

Query  328  PHNPFGDTgfgafpanngaaagAHQQNTNPFGS  230
              NPF D           AA   HQQ+ NPFGS
Sbjct  539  --NPFLDA----GFGAFPAANNGHQQH-NPFGS  564



>ref|NP_001145773.1| uncharacterized protein LOC100279280 [Zea mays]
 gb|ACL52564.1| unknown [Zea mays]
Length=564

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 123/213 (58%), Gaps = 29/213 (14%)
 Frame = -2

Query  817  TTEIPAPVPPVKF-ETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSET----VQPKD  653
             TE+ +P P  +  +T DLLGL+     VSAIEESNALALAIVP+   S T     Q K 
Sbjct  360  VTEVVSPPPKAEVPDTGDLLGLDDTNPAVSAIEESNALALAIVPTDGASTTGNTAFQDKG  419

Query  652  FDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAY-RASQQPVYGAPAPNP  476
            FDPTGWELALV+ P    S+    QL GGLD L L SLYD+GAY +  QQ +YG+ APNP
Sbjct  420  FDPTGWELALVTAPSNTTSSTSVGQLGGGLDKLILESLYDDGAYRQRQQQQLYGSAAPNP  479

Query  475  FEVADPFAMSNAIAAPPSVQLAPMP----------QPNPFG-PFHPAAAAYPPQNPLMVG  329
            F   DPFAMSN +A PPSVQ+A M           QPNPFG P HP  +  P  N     
Sbjct  480  FMANDPFAMSNQVAPPPSVQMAAMSQQHQQIPTMMQPNPFGPPMHPQVSMAPATN-----  534

Query  328  PHNPFGDTgfgafpanngaaagAHQQNTNPFGS  230
              NPF D           AA   HQQ+ NPFGS
Sbjct  535  --NPFLDA----GFGAFPAANNGHQQH-NPFGS  560



>gb|AFW80976.1| hypothetical protein ZEAMMB73_079219 [Zea mays]
Length=564

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 123/213 (58%), Gaps = 29/213 (14%)
 Frame = -2

Query  817  TTEIPAPVPPVKF-ETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSET----VQPKD  653
             TE+ +P P  +  +T DLLGL+     VSAIEESNALALAIVP+   S T     Q K 
Sbjct  360  VTEVVSPPPKAEVPDTGDLLGLDDTNPAVSAIEESNALALAIVPTDGASTTGNTAFQDKG  419

Query  652  FDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAY-RASQQPVYGAPAPNP  476
            FDPTGWELALV+ P    S+    QL GGLD L L SLYD+GAY +  QQ +YG+ APNP
Sbjct  420  FDPTGWELALVTAPSNTTSSTSVGQLGGGLDKLILESLYDDGAYRQRQQQQLYGSAAPNP  479

Query  475  FEVADPFAMSNAIAAPPSVQLAPMP----------QPNPFG-PFHPAAAAYPPQNPLMVG  329
            F   DPFAMSN +A PPSVQ+A M           QPNPFG P HP  +  P  N     
Sbjct  480  FMANDPFAMSNQVAPPPSVQMAAMSQQHQQIPTMMQPNPFGPPMHPQVSMAPATN-----  534

Query  328  PHNPFGDTgfgafpanngaaagAHQQNTNPFGS  230
              NPF D           AA   HQQ+ NPFGS
Sbjct  535  --NPFLDA----GFGAFPAANNGHQQH-NPFGS  560



>ref|XP_009418441.1| PREDICTED: putative clathrin assembly protein At2g01600 [Musa 
acuminata subsp. malaccensis]
Length=560

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 103/141 (73%), Gaps = 7/141 (5%)
 Frame = -2

Query  820  STTEIPAPVPPVKFE---TDDLLGLNAPTSDVSAIEESNALALAIVPS--GATSETVQPK  656
            STTE+ +  P +K +   T DLLGLN   S+V+AIEE+NA+ALAIVP+     S TVQ K
Sbjct  355  STTEVVSSPPTLKADSSDTGDLLGLNETNSNVAAIEETNAMALAIVPASFATDSSTVQDK  414

Query  655  DFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYR--ASQQPVYGAPAP  482
            +FDPTGWELALV+TP +N +T  E +LAGG D LTL+SLYDE AYR    QQ  YGAP P
Sbjct  415  EFDPTGWELALVTTPSSNNATVVESKLAGGFDKLTLDSLYDEAAYRQQQQQQQYYGAPPP  474

Query  481  NPFEVADPFAMSNAIAAPPSV  419
            NPF  ADPF +SN +AAPP+V
Sbjct  475  NPFMAADPFTVSNQVAAPPAV  495



>ref|XP_006646232.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Oryza brachyantha]
Length=574

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 114/180 (63%), Gaps = 24/180 (13%)
 Frame = -2

Query  820  STTEIPAPVPPVKF-ETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSET-----VQP  659
            S+ E+ +P P V+  +T DLLGL+ PT  VSAIEESNALALAI+P+G  + T     VQ 
Sbjct  364  SSAEVVSPPPKVEVVDTGDLLGLSDPTPSVSAIEESNALALAIIPTGGDTSTSGTTTVQD  423

Query  658  KDFDPTGWELALVSTPGTNL-STPQERQLAGGLDSLTLNSLYDEGAYRASQQP---VYGA  491
            K FDPTGWELALV+TP TN  S   +  L GG D LTL SLYD+G YR   Q    +YG+
Sbjct  424  KGFDPTGWELALVTTPSTNTNSLAMDSNLGGGFDKLTLESLYDDGVYRQHMQQQQQLYGS  483

Query  490  PAPNPFEVADPFAMSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPHNPFG  311
             APNPF   DPFAMSN +A PPSVQ+A M Q              P Q PLM+ P NPFG
Sbjct  484  AAPNPFMATDPFAMSNQVAPPPSVQMANMAQQ-------------PQQMPLMMQP-NPFG  529



>ref|XP_010496638.1| PREDICTED: putative clathrin assembly protein At1g14910 [Camelina 
sativa]
Length=720

 Score =   150 bits (378),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 107/170 (63%), Gaps = 12/170 (7%)
 Frame = -2

Query  802  APVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETV---QPKDFDPTGWE  632
            A  P    +TDDLLGLN    D  AI + NALALA+V +     T    Q +D D +GWE
Sbjct  369  AETPRNIIDTDDLLGLNDDAPDPLAILDQNALALALVSTDDDFSTFGFGQARDLDSSGWE  428

Query  631  LALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFA  452
            LALV+TP  ++S   ER+LAGGLD+LTLNSLYD GAY A+QQP YGAPAPNPFEV DPFA
Sbjct  429  LALVTTPSNDISAATERKLAGGLDTLTLNSLYDNGAYIAAQQPAYGAPAPNPFEVQDPFA  488

Query  451  MSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPH--NPFGD  308
            ++N++A   +         NPFGP+ P       Q  L V P   NPFGD
Sbjct  489  LTNSVAPHSAAN-------NPFGPYEPTYPQQEQQPQLEVAPSAANPFGD  531



>ref|XP_010459007.1| PREDICTED: putative clathrin assembly protein At1g14910 [Camelina 
sativa]
Length=721

 Score =   150 bits (378),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 107/170 (63%), Gaps = 12/170 (7%)
 Frame = -2

Query  802  APVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETV---QPKDFDPTGWE  632
            A  P    +TDDLLGLN    D  AI + NALALA+V +     T    Q +D D +GWE
Sbjct  369  AETPRNIIDTDDLLGLNDDAPDPLAILDQNALALALVSTDDDFSTFGFGQARDLDSSGWE  428

Query  631  LALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFA  452
            LALV+TP  ++S   ER+LAGGLD+LTLNSLYD GAY A+QQP YGAPAPNPFEV DPFA
Sbjct  429  LALVTTPSNDISAATERKLAGGLDTLTLNSLYDNGAYIAAQQPAYGAPAPNPFEVQDPFA  488

Query  451  MSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPH--NPFGD  308
            ++N++A   +         NPFGP+ P       Q  L V P   NPFGD
Sbjct  489  LTNSVAPHSAAN-------NPFGPYEPTYPQQEQQPQLEVAPSAANPFGD  531



>ref|XP_009396332.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=566

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 101/142 (71%), Gaps = 8/142 (6%)
 Frame = -2

Query  820  STTEIPAPVPPVKF---ETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT--SETVQPK  656
            ST E+ +P  PVK    +T DLLGLN   S  SAIE++NALAL+IVP+ AT  S TVQ +
Sbjct  359  STIEVASPATPVKINGSDTGDLLGLNETNSYASAIEDTNALALSIVPADATTNSGTVQDQ  418

Query  655  DFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYR---ASQQPVYGAPA  485
             FDPTGWELALV+TP +N +T  E +L GG D LTL+SLYDE AYR     QQ +YG P 
Sbjct  419  VFDPTGWELALVTTPSSNNATAVESKLGGGFDKLTLDSLYDEAAYRQQQQQQQQLYGVPP  478

Query  484  PNPFEVADPFAMSNAIAAPPSV  419
            PNPF   DPFAMSN +AAPP+V
Sbjct  479  PNPFMTTDPFAMSNQVAAPPAV  500



>ref|XP_010476568.1| PREDICTED: putative clathrin assembly protein At1g14910 [Camelina 
sativa]
Length=707

 Score =   149 bits (377),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 107/172 (62%), Gaps = 14/172 (8%)
 Frame = -2

Query  802  APVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETV---QPKDFDPTGWE  632
            A  P    +TDDLLGLN    D   I + NALALA+V +     T    Q +D D +GWE
Sbjct  369  AETPRNIIDTDDLLGLNDDAPDPLEILDQNALALALVSTDDDFSTFGFGQARDLDSSGWE  428

Query  631  LALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFA  452
            LALV+TP  ++S   ERQLAGGLD+LTLNSLYD GAY A+QQP YGAPAPNPFEV DPFA
Sbjct  429  LALVTTPSNDISAATERQLAGGLDTLTLNSLYDNGAYIAAQQPAYGAPAPNPFEVQDPFA  488

Query  451  MSNAIAAPPSVQLAPMPQPNPFGPFHPA--AAAYPPQNPLMVGPH--NPFGD  308
             SN++A P +         NPFGP+ PA        Q  L V P   NPFGD
Sbjct  489  FSNSVAPPSAAN-------NPFGPYEPAYHQEQQEQQPQLEVAPSAANPFGD  533



>ref|XP_006306843.1| hypothetical protein CARUB_v10008396mg [Capsella rubella]
 gb|EOA39741.1| hypothetical protein CARUB_v10008396mg [Capsella rubella]
Length=742

 Score =   149 bits (377),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 107/170 (63%), Gaps = 12/170 (7%)
 Frame = -2

Query  802  APVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETV---QPKDFDPTGWE  632
            A  P    +TDDLLGLN  T D   I + NALALA+V +   S T    Q +D D +GWE
Sbjct  369  AETPQNIIDTDDLLGLNDDTPDPLEILDQNALALALVSTDDDSSTFGFGQVRDLDSSGWE  428

Query  631  LALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFA  452
            LALV+TP  ++S   ERQLAGGLD+LTLNSLY++GAYRA+QQP YG PAPNPFEV D FA
Sbjct  429  LALVTTPSNDISAATERQLAGGLDTLTLNSLYEDGAYRAAQQPAYGTPAPNPFEVQDQFA  488

Query  451  MSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPH--NPFGD  308
             SN  +APP     P    NPFG + P       Q  L V P   NPFGD
Sbjct  489  FSN--SAPP-----PSDANNPFGLYQPTYHQQQQQPQLQVAPSAANPFGD  531



>emb|CDY09433.1| BnaA02g25770D [Brassica napus]
Length=577

 Score =   147 bits (372),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 108/170 (64%), Gaps = 19/170 (11%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPSG---ATSETVQPKDFDPTGWELALVSTP  611
             +TDDLLGLN+   D SAIE  NA ALAI+P+    AT       D+DP+GWELALV+TP
Sbjct  378  IDTDDLLGLNSGGPDASAIENQNARALAIIPTDDNPATPRFGHANDYDPSGWELALVTTP  437

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEV-ADPFAM-SNAI  437
              ++S   +RQL GGLD+LTLNSLYD+GAY ASQ+PVYGAPAPNPFEV  DPFA  SN I
Sbjct  438  SNDISAATDRQLGGGLDTLTLNSLYDDGAYIASQRPVYGAPAPNPFEVHHDPFAASSNGI  497

Query  436  AAP--PSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGP-----HNPFGD  308
              P  P+V        NPFG + P       Q   +  P     +NPFGD
Sbjct  498  QTPQQPAVN-------NPFGAYQPTYHHQEQQQLQLALPNPTANNNPFGD  540



>ref|XP_009129221.1| PREDICTED: putative clathrin assembly protein At2g01600 [Brassica 
rapa]
Length=577

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 108/170 (64%), Gaps = 19/170 (11%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPSG---ATSETVQPKDFDPTGWELALVSTP  611
             +TDDLLGLN+   D SAIE  NA ALAI+P+    AT       D+DP+GWELALV+TP
Sbjct  378  IDTDDLLGLNSGGPDASAIENQNARALAIIPTDDNPATPRFGHANDYDPSGWELALVTTP  437

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEV-ADPFA-MSNAI  437
              ++S   +RQL GGLD+LTLNSLYD+GAY ASQ+PVYGAPAPNPFEV  DPFA  SN I
Sbjct  438  SNDISAATDRQLGGGLDTLTLNSLYDDGAYIASQRPVYGAPAPNPFEVHHDPFASSSNGI  497

Query  436  AAP--PSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGP-----HNPFGD  308
              P  P+V        NPFG + P       Q   +  P     +NPFGD
Sbjct  498  QTPQQPAVN-------NPFGAYQPTYHHQEQQQLQLALPNPTANNNPFGD  540



>ref|NP_172944.1| putative clathrin assembly protein [Arabidopsis thaliana]
 sp|P94017.2|CAP9_ARATH RecName: Full=Putative clathrin assembly protein At1g14910 [Arabidopsis 
thaliana]
 gb|AAM20134.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29241.1| putative clathrin assembly protein [Arabidopsis thaliana]
Length=692

 Score =   148 bits (374),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 115/183 (63%), Gaps = 13/183 (7%)
 Frame = -2

Query  838  AEDVAVSTTEIPAPVPPVKF-ETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETV-  665
            +E+  +S+   P+   P  F +TDDLLGL+  T D  AI + NALALA+V +   S    
Sbjct  356  SEETQLSSQSPPSVETPQNFIDTDDLLGLHDDTPDPLAILDQNALALALVSNDVDSSPFS  415

Query  664  --QPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGA  491
              Q +D DP+GWELALV+TP  ++S   ERQLAGGLD+LTLNSLYD+GA RA+QQP YG 
Sbjct  416  FGQARDLDPSGWELALVTTPSNDISAATERQLAGGLDTLTLNSLYDDGALRAAQQPAYGV  475

Query  490  PAPNPFEVADPFAMSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPH--NP  317
            PA NPFEV D FA S++++ P +V        NPFG + P       Q  L V P   NP
Sbjct  476  PASNPFEVQDLFAFSDSVSPPSAVN-------NPFGLYEPTYHQQEQQPQLQVAPSPANP  528

Query  316  FGD  308
            FGD
Sbjct  529  FGD  531



>emb|CAA71879.1| hypothetical protein 194 [Arabidopsis thaliana]
Length=584

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 115/183 (63%), Gaps = 13/183 (7%)
 Frame = -2

Query  838  AEDVAVSTTEIPAPVPPVKF-ETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETV-  665
            +E+  +S+   P+   P  F +TDDLLGL+  T D  AI + NALALA+V +   S    
Sbjct  248  SEETQLSSQSPPSVETPQNFIDTDDLLGLHDDTPDPLAILDQNALALALVSNDVDSSPFS  307

Query  664  --QPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGA  491
              Q +D DP+GWELALV+TP  ++S   ERQLAGGLD+LTLNSLYD+GA RA+QQP YG 
Sbjct  308  FGQARDLDPSGWELALVTTPSNDISAATERQLAGGLDTLTLNSLYDDGALRAAQQPAYGV  367

Query  490  PAPNPFEVADPFAMSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPH--NP  317
            PA NPFEV D FA S++++ P +V        NPFG + P       Q  L V P   NP
Sbjct  368  PASNPFEVQDLFAFSDSVSPPSAVN-------NPFGLYEPTYHQQEQQPQLQVAPSPANP  420

Query  316  FGD  308
            FGD
Sbjct  421  FGD  423



>gb|AFW78994.1| hypothetical protein ZEAMMB73_223268 [Zea mays]
Length=315

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 122/213 (57%), Gaps = 30/213 (14%)
 Frame = -2

Query  817  TTEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSET----VQPKDF  650
             TE+ +P      +T DLLGL+ P   VSAIEESNALALAIVP+   S T     Q K F
Sbjct  112  VTEVVSPPKTEVADTGDLLGLDDPNPAVSAIEESNALALAIVPTDGASTTGNTAFQDKGF  171

Query  649  DPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAY-RASQQPVYGAPAPNPF  473
            DPTGWELALV+ P    S+    QL GG D L L+SLYD+GAY +  QQ VYG+  PNPF
Sbjct  172  DPTGWELALVTAPSNTTSSASVGQLGGGFDKLILDSLYDDGAYRQRQQQQVYGSAVPNPF  231

Query  472  EVADPFAMSNAIAAPPSVQLAPMP----------QPNPFGPFHPAAAAYPPQNPLMVGP-  326
               DPF MSN +A PPSVQ+A M           QPNPFGP        P Q  + +GP 
Sbjct  232  MTNDPFVMSNQVAPPPSVQMAAMSQQHQQIPTMMQPNPFGP--------PMQPQVGMGPA  283

Query  325  -HNPFGDTgfgafpanngaaagAHQQNTNPFGS  230
             +NPF D            A  +HQQ+ NPFGS
Sbjct  284  TNNPFLDA----GFGAFPVANNSHQQH-NPFGS  311



>ref|XP_008803559.1| PREDICTED: putative clathrin assembly protein At2g01600 [Phoenix 
dactylifera]
Length=557

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 131/214 (61%), Gaps = 27/214 (13%)
 Frame = -2

Query  820  STTEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSG----ATSETVQPKD  653
            S  E+ +P   V  +  DLLGL+      SAIEESNALALAIVPSG    + S  VQ K 
Sbjct  355  SNVEVASPHKAVTEDAGDLLGLHETNPGASAIEESNALALAIVPSGGAPSSDSGMVQEKG  414

Query  652  FDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYR-ASQQPVYGAPAPNP  476
            FDP+GWELALV+TP +N S+  E QL GG D LTL+SLYDE  YR   QQ  YGA APNP
Sbjct  415  FDPSGWELALVTTPSSNNSSMVENQLGGGFDKLTLDSLYDEATYRQQQQQQFYGASAPNP  474

Query  475  FEVADPFAMSNAIAAPPSVQLAPMPQ----------PNPFGPFHPAAAAYPPQNPLMVGP  326
            F  ADPF MSN +AAPPSVQ+A M Q          PNPF      A   P Q+ ++   
Sbjct  475  FLSADPFMMSNQVAAPPSVQMAAMAQQQQQMSMMAPPNPF------AQPIPQQHVVIGAA  528

Query  325  HNPFGDTgfgafpanngaaagAHQQNTNPFGSLL  224
             NPFGD GFGAFPANN       Q  +NPFG+ L
Sbjct  529  PNPFGDVGFGAFPANNP------QHQSNPFGTQL  556



>ref|XP_010424932.1| PREDICTED: putative clathrin assembly protein At2g01600 [Camelina 
sativa]
Length=576

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 98/148 (66%), Gaps = 6/148 (4%)
 Frame = -2

Query  787  VKFETDDLLGLNAPTSDVSAIEESNALALAIVPSG---ATSETVQPKDFDPTGWELALVS  617
            +  +TDDLLGLN+ T D S IE+ NALALAI+ +    +T    Q  D+DPTGWELALV+
Sbjct  375  IFIDTDDLLGLNSGTPDASVIEDQNALALAIISTDVNPSTPRFGQANDYDPTGWELALVT  434

Query  616  TPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAI  437
             P  ++S   ER+LAGGLD+LTL+SLYD+GAY ASQ+P YGAPAPNPF   DPFA  N  
Sbjct  435  APSRDISAATERKLAGGLDTLTLSSLYDDGAYIASQRPAYGAPAPNPFASHDPFASFNGT  494

Query  436  AAPPSVQLAPMPQPNPFGPFHPAAAAYP  353
              PP  Q A     NPFG + P     P
Sbjct  495  TPPPQQQPAV---NNPFGAYQPTYQHQP  519



>ref|XP_002456192.1| hypothetical protein SORBIDRAFT_03g031930 [Sorghum bicolor]
 gb|EES01312.1| hypothetical protein SORBIDRAFT_03g031930 [Sorghum bicolor]
Length=563

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 112/187 (60%), Gaps = 25/187 (13%)
 Frame = -2

Query  823  VSTTEIPAPVPPVKF---------ETDDLLGLNAPTSDVSAIEESNALALAIVPSGA--T  677
            +   E PAPVP  +          +T DLLGL   T  VSAIEESNALALAI+P+G   +
Sbjct  351  LQVVEEPAPVPSSQIASPPRPEIADTGDLLGLGDSTHTVSAIEESNALALAILPTGVDNS  410

Query  676  SETVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYR-ASQQPV  500
            + T Q + FDPTGWELALV+T         E  L GG D LTL+SLYD+G YR   QQ +
Sbjct  411  TTTQQDRGFDPTGWELALVTTSSNMTPLSMESNLGGGFDKLTLDSLYDDGTYRQMQQQQL  470

Query  499  YGAPAPNPFEVADPFAMSNAIAAPPSVQLAPM-PQP---------NPFGP--FHPAAAAY  356
            YG+  PNPF  +DPFA+SN +A PPSVQ+A M PQP         NPFGP   H A  A 
Sbjct  471  YGSAPPNPFMASDPFAVSNQVAPPPSVQMAAMAPQPQHLPMMIEANPFGPPQQHHAGMA-  529

Query  355  PPQNPLM  335
            P  NP +
Sbjct  530  PAANPFL  536



>emb|CAA71818.1| hypothetical protein (cDNA194) [Arabidopsis thaliana]
 emb|CAA71880.1| hypothetical protein 194, partial [Arabidopsis thaliana]
Length=413

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 115/183 (63%), Gaps = 13/183 (7%)
 Frame = -2

Query  838  AEDVAVSTTEIPAPVPPVKF-ETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETV-  665
            +E+  +S+   P+   P  F +TDDLLGL+  T D  AI + NALALA+V +   S    
Sbjct  77   SEETQLSSQSPPSVETPQNFIDTDDLLGLHDDTPDPLAILDQNALALALVSNDVDSSPFS  136

Query  664  --QPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGA  491
              Q +D DP+GWELALV+TP  ++S   ERQLAGGLD+LTLNSLYD+GA RA+QQP YG 
Sbjct  137  FGQARDLDPSGWELALVTTPSNDISAATERQLAGGLDTLTLNSLYDDGALRAAQQPAYGV  196

Query  490  PAPNPFEVADPFAMSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPH--NP  317
            PA NPFEV D FA S++++ P +V        NPFG + P       Q  L V P   NP
Sbjct  197  PASNPFEVQDLFAFSDSVSPPSAVN-------NPFGLYEPTYHQQEQQPQLQVAPSPANP  249

Query  316  FGD  308
            FGD
Sbjct  250  FGD  252



>ref|XP_009396331.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=569

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 100/145 (69%), Gaps = 11/145 (8%)
 Frame = -2

Query  820  STTEIPAPVPPVKF---ETDDLLGLNAPTSDVSAIEESNALALAIVPSG-----ATSETV  665
            ST E+ +P  PVK    +T DLLGLN   S  SAIE++NALAL+IVP+G       S TV
Sbjct  359  STIEVASPATPVKINGSDTGDLLGLNETNSYASAIEDTNALALSIVPAGMFDATTNSGTV  418

Query  664  QPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYR---ASQQPVYG  494
            Q + FDPTGWELALV+TP +N +T  E +L GG D LTL+SLYDE AYR     QQ +YG
Sbjct  419  QDQVFDPTGWELALVTTPSSNNATAVESKLGGGFDKLTLDSLYDEAAYRQQQQQQQQLYG  478

Query  493  APAPNPFEVADPFAMSNAIAAPPSV  419
             P PNPF   DPFAMSN +AAPP+V
Sbjct  479  VPPPNPFMTTDPFAMSNQVAAPPAV  503



>ref|XP_010513887.1| PREDICTED: putative clathrin assembly protein At2g01600 [Camelina 
sativa]
Length=573

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 98/148 (66%), Gaps = 6/148 (4%)
 Frame = -2

Query  787  VKFETDDLLGLNAPTSDVSAIEESNALALAIVPSG---ATSETVQPKDFDPTGWELALVS  617
            +  +TDDLLGLN+ T D S IE+ NALALAI+ +    +T    Q  D+DPTGWELALV+
Sbjct  372  IFIDTDDLLGLNSGTPDASVIEDQNALALAIISTDVNPSTPRFGQANDYDPTGWELALVT  431

Query  616  TPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAI  437
             P  ++S   ER+LAGGLD+LTL+SLYD+GAY ASQ+P YGAPAPNPF   DPFA  N  
Sbjct  432  APSRDISAATERKLAGGLDTLTLSSLYDDGAYIASQRPAYGAPAPNPFASHDPFASFNGT  491

Query  436  AAPPSVQLAPMPQPNPFGPFHPAAAAYP  353
              PP  Q A     NPFG + P     P
Sbjct  492  TPPPQQQPAV---NNPFGAYQPTYQHQP  516



>ref|NP_001136989.1| uncharacterized protein LOC100217151 [Zea mays]
 gb|ACF83027.1| unknown [Zea mays]
 gb|AFW78996.1| hypothetical protein ZEAMMB73_223268 [Zea mays]
Length=563

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 122/213 (57%), Gaps = 30/213 (14%)
 Frame = -2

Query  817  TTEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSET----VQPKDF  650
             TE+ +P      +T DLLGL+ P   VSAIEESNALALAIVP+   S T     Q K F
Sbjct  360  VTEVVSPPKTEVADTGDLLGLDDPNPAVSAIEESNALALAIVPTDGASTTGNTAFQDKGF  419

Query  649  DPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAY-RASQQPVYGAPAPNPF  473
            DPTGWELALV+ P    S+    QL GG D L L+SLYD+GAY +  QQ VYG+  PNPF
Sbjct  420  DPTGWELALVTAPSNTTSSASVGQLGGGFDKLILDSLYDDGAYRQRQQQQVYGSAVPNPF  479

Query  472  EVADPFAMSNAIAAPPSVQLAPMP----------QPNPFGPFHPAAAAYPPQNPLMVGP-  326
               DPF MSN +A PPSVQ+A M           QPNPFGP        P Q  + +GP 
Sbjct  480  MTNDPFVMSNQVAPPPSVQMAAMSQQHQQIPTMMQPNPFGP--------PMQPQVGMGPA  531

Query  325  -HNPFGDTgfgafpanngaaagAHQQNTNPFGS  230
             +NPF D            A  +HQQ+ NPFGS
Sbjct  532  TNNPFLDA----GFGAFPVANNSHQQH-NPFGS  559



>ref|XP_002441469.1| hypothetical protein SORBIDRAFT_09g027370 [Sorghum bicolor]
 gb|EES19899.1| hypothetical protein SORBIDRAFT_09g027370 [Sorghum bicolor]
Length=564

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 118/200 (59%), Gaps = 30/200 (15%)
 Frame = -2

Query  778  ETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSET----VQPKDFDPTGWELALVSTP  611
            +T DLLGL+ P   VSAIEESNALALAIVP+   S T     Q K FD TGWELALV+ P
Sbjct  374  DTGDLLGLDDPNPAVSAIEESNALALAIVPTDGASTTSNTAFQDKGFDATGWELALVTAP  433

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAY-RASQQPVYGAPAPNPFEVADPFAMSNAIA  434
                S+    QL GG D L L+SLYD+GAY +  QQ +YG+ APNPF   DPFAMSN +A
Sbjct  434  SNTTSSSSVGQLGGGFDKLILDSLYDDGAYRQRQQQQLYGSAAPNPFMTNDPFAMSNQVA  493

Query  433  APPSVQLAPMP----------QPNPFGPFHPAAAAYPPQNPLMVGP--HNPFGDTgfgaf  290
             PPSVQ+A M           QPNPFGP        P Q  + +GP  +NPF D+     
Sbjct  494  PPPSVQMAAMSQQHPQIPTMMQPNPFGP--------PMQPQMSMGPATNNPFLDS----G  541

Query  289  panngaaagAHQQNTNPFGS  230
                  A   HQQ+ NPFGS
Sbjct  542  FGAFPVANNGHQQH-NPFGS  560



>ref|XP_004961341.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Setaria italica]
Length=564

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 117/201 (58%), Gaps = 31/201 (15%)
 Frame = -2

Query  814  TEIPAPVPPVKF-ETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSET----VQPKDF  650
            TE+ +P P  +  +T DLLGLN P+   SAIEESNALALAIVP+  TS T     Q K F
Sbjct  361  TEVVSPPPKTEVPDTGDLLGLNDPSPAGSAIEESNALALAIVPTDGTSTTGNAAFQDKGF  420

Query  649  DPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAY-RASQQPVYGAPAPNPF  473
            DPTGWELALV+ P    S+    QL GG D L L+SLYD+GAY +  QQ +YG+  PNPF
Sbjct  421  DPTGWELALVTAPSNTTSSASSSQLGGGFDKLILDSLYDDGAYRQRQQQQLYGSAVPNPF  480

Query  472  EVADPFAMSNAIAAPPSVQLAPMP----------QPNPFG-PFHPAAAAYPP-QNPLM--  335
               DPFAMSN +A PPSVQ+A M           QPNPFG P  P     P   NP +  
Sbjct  481  MTNDPFAMSNQVAPPPSVQMAAMSQQHQQIPTVMQPNPFGPPMQPQMGMGPATNNPFLDA  540

Query  334  -VGP----------HNPFGDT  305
              GP          HNPFG T
Sbjct  541  GFGPFPVANNGHQQHNPFGGT  561



>emb|CDY48813.1| BnaC02g34010D [Brassica napus]
Length=583

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 97/142 (68%), Gaps = 10/142 (7%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPSG---ATSETVQPKDFDPTGWELALVSTP  611
             +TDDLLGLN+   D SAIE  NALALAI+P+    AT       D+DP+GWELALV+T 
Sbjct  379  IDTDDLLGLNSGGPDASAIENQNALALAIIPTDDNPATPRFGHANDYDPSGWELALVTTA  438

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEV-ADPFA-MSNAI  437
              ++S   +RQL GGLD+LTLNSLYD+GAY ASQ+PVYGAPAPNPFEV  DPFA  SN I
Sbjct  439  SNDISAATDRQLGGGLDTLTLNSLYDDGAYIASQRPVYGAPAPNPFEVHHDPFASSSNGI  498

Query  436  AAPPSVQLAPMPQPNPFGPFHP  371
              P    +      NPFG + P
Sbjct  499  QTPQQTAVN-----NPFGAYQP  515



>gb|EEC71324.1| hypothetical protein OsI_03369 [Oryza sativa Indica Group]
Length=568

 Score =   145 bits (365),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 109/177 (62%), Gaps = 24/177 (14%)
 Frame = -2

Query  778  ETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSET-----VQPKDFDPTGWELALVST  614
            +T DLLGL+ PT  VSAIEESNALALAI+P+G  + T     +Q K FDPTGWELALV+T
Sbjct  375  DTGDLLGLSDPTPSVSAIEESNALALAIIPTGGETSTSGTATLQDKGFDPTGWELALVTT  434

Query  613  PGTNL-STPQERQLAGGLDSLTLNSLYDEGAYRASQQP--VYGAPAPNPFEVADPFAMSN  443
            P TN  S   +  L GG D L L+SLYDEG YR   Q   +YG+ APNPF  +DPFAMSN
Sbjct  435  PSTNTNSMAMDSNLGGGFDKLILDSLYDEGTYRQQMQQQQLYGSAAPNPFMASDPFAMSN  494

Query  442  AIAAPPSVQLAP----------MPQPNPFG----PFHPAAAAYPPQNPLMVGPHNPF  314
             +A PPSVQ+A           M QPNPFG    P H   A  P  NP +     PF
Sbjct  495  QVAPPPSVQMASMTQQPQQMPMMMQPNPFGPPLQPQHAGIAQAP--NPFLDAGFGPF  549



>ref|NP_001043956.1| Os01g0694900 [Oryza sativa Japonica Group]
 dbj|BAD81807.1| clathrin assembly protein AP180 short form-like [Oryza sativa 
Japonica Group]
 dbj|BAF05870.1| Os01g0694900 [Oryza sativa Japonica Group]
 dbj|BAG88648.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55230.1| hypothetical protein OsJ_03107 [Oryza sativa Japonica Group]
Length=568

 Score =   145 bits (365),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 109/177 (62%), Gaps = 24/177 (14%)
 Frame = -2

Query  778  ETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSET-----VQPKDFDPTGWELALVST  614
            +T DLLGL+ PT  VSAIEESNALALAI+P+G  + T     +Q K FDPTGWELALV+T
Sbjct  375  DTGDLLGLSDPTPSVSAIEESNALALAIIPTGGETSTSGTATLQDKGFDPTGWELALVTT  434

Query  613  PGTNL-STPQERQLAGGLDSLTLNSLYDEGAYRASQQP--VYGAPAPNPFEVADPFAMSN  443
            P TN  S   +  L GG D L L+SLYDEG YR   Q   +YG+ APNPF  +DPFAMSN
Sbjct  435  PSTNTNSMAMDSNLGGGFDKLILDSLYDEGTYRQQMQQQQLYGSAAPNPFMASDPFAMSN  494

Query  442  AIAAPPSVQLAP----------MPQPNPFG----PFHPAAAAYPPQNPLMVGPHNPF  314
             +A PPSVQ+A           M QPNPFG    P H   A  P  NP +     PF
Sbjct  495  QVAPPPSVQMASMTQQPQQMPMMMQPNPFGPPLQPQHAGIAQAP--NPFLDAGFGPF  549



>ref|XP_006292297.1| hypothetical protein CARUB_v10018506mg [Capsella rubella]
 gb|EOA25195.1| hypothetical protein CARUB_v10018506mg [Capsella rubella]
Length=572

 Score =   145 bits (365),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 98/146 (67%), Gaps = 7/146 (5%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPSG---ATSETVQPKDFDPTGWELALVSTP  611
             +TDDLLGLN    D S IE+ NALALAI+ +    +T    +  D+DPTGWELALV+ P
Sbjct  374  IDTDDLLGLNTGAPDASVIEDQNALALAIITTDDNPSTPRFGKANDYDPTGWELALVTAP  433

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAA  431
             +++S   ER+LAGGLD+LTL+SLYD+GAY ASQ+PVYGAPAPNPF   DPFA SN    
Sbjct  434  SSDISAATERKLAGGLDTLTLSSLYDDGAYIASQRPVYGAPAPNPFASHDPFASSNG-TT  492

Query  430  PPSVQLAPMPQPNPFGPFHPAAAAYP  353
            PP  Q A     NPFG + P     P
Sbjct  493  PPHQQPAV---NNPFGAYQPTYQHQP  515



>gb|KFK33381.1| hypothetical protein AALP_AA5G005800 [Arabis alpina]
Length=572

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 98/140 (70%), Gaps = 12/140 (9%)
 Frame = -2

Query  781  FETDDLLGLNAPTSDVSAIEESNALALAIVPSGA---TSETVQPKDFDPTGWELALVSTP  611
             +T+DLLGL+    + SAIE+ NALALAI+P+     T    Q  ++DP+GWELALV+TP
Sbjct  372  IDTEDLLGLHTGAPNGSAIEDQNALALAIIPTDVNPPTPRFGQANNYDPSGWELALVTTP  431

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAA  431
              ++S   +RQLAGGLD+LTLNSLYD+GAY ASQ+PVYGAPAPNPFEV DPF  SN    
Sbjct  432  SNDISAATDRQLAGGLDTLTLNSLYDDGAYIASQRPVYGAPAPNPFEVHDPFTSSNGTTP  491

Query  430  P--PSVQLAPMPQPNPFGPF  377
            P  P+V        NPFG +
Sbjct  492  PQQPAVN-------NPFGSY  504



>ref|NP_001056232.1| Os05g0549000 [Oryza sativa Japonica Group]
 dbj|BAF18146.1| Os05g0549000 [Oryza sativa Japonica Group]
 gb|EEE64590.1| hypothetical protein OsJ_19442 [Oryza sativa Japonica Group]
Length=567

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 113/192 (59%), Gaps = 31/192 (16%)
 Frame = -2

Query  814  TEIPAPVPPVKF---ETDDLLGLNAPTSDVSAIEESNALALAIVPSGA-----TSETVQP  659
            TE  +P PP K    +T DLLGLN P   VSAIEESNALALAIVP+ A     ++ T Q 
Sbjct  361  TEAVSPPPPPKTKVADTGDLLGLNDPNPSVSAIEESNALALAIVPADAGASTSSTATWQD  420

Query  658  KDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAY-RASQQPVYGAPAP  482
            K FDPTGWELALV+TP    S+  + QL GG D L L SLYD+G Y +  QQ +YG+ AP
Sbjct  421  KGFDPTGWELALVTTPSNTNSSAADSQLGGGFDKLILESLYDQGDYRQRQQQQLYGSSAP  480

Query  481  NPFEVADPFAMSNAIAAPPSVQLAPMP----------QPNPFGPFHPAAAAYPPQNPLMV  332
            NPF   DPF MSN +A PPSVQ+A M           Q NPFG         PP  P  V
Sbjct  481  NPFMSNDPFVMSNQVAPPPSVQMAAMSQQHQQIPTMMQANPFG---------PPMQPQHV  531

Query  331  G---PHNPFGDT  305
            G     NPF D+
Sbjct  532  GMGPATNPFLDS  543



>ref|XP_011621339.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X2 [Amborella trichopoda]
Length=562

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 102/176 (58%), Gaps = 24/176 (14%)
 Frame = -2

Query  778  ETDDLLGLNAPTSDVSAIEESNALALAIVPSG----ATSETVQPKDFDPTGWELALVSTP  611
            +T DLLGLNA   D SAIEE NALALAIVPSG    + S   Q K  DPTGWELALV+T 
Sbjct  371  DTGDLLGLNATNFDASAIEEQNALALAIVPSGSDAVSDSHGAQTKGLDPTGWELALVTTA  430

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQP-VYGAPAPNPFEVADPFAMSNAIA  434
             +N     E +LAGG D LTL SLY++  YR  QQ   YGAP PNPFE  DPFA++N I 
Sbjct  431  SSNDKNLTESKLAGGFDKLTLESLYEDAVYRQQQQQFTYGAPPPNPFESHDPFAIANNIP  490

Query  433  APPSVQLAP-------------MPQPNPFGPFHPAAAAYPPQNPLMVGPHNPFGDT  305
             PPSVQ+A              M    PFG  H     +  Q     GP NPFGDT
Sbjct  491  PPPSVQMAAMAHHQQQQQMMMGMTSSGPFG--HQPNYHHQQQ----FGPSNPFGDT  540



>gb|EMT23238.1| Putative clathrin assembly protein [Aegilops tauschii]
Length=536

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 113/239 (47%), Positives = 129/239 (54%), Gaps = 57/239 (24%)
 Frame = -2

Query  799  PVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETV-----QPKDFDPTGW  635
            P  PV  +T DLLGLN P+  VSAIEESNALALAIV S A++ T      Q K FDPTGW
Sbjct  307  PTKPVVADTGDLLGLNDPSPGVSAIEESNALALAIVTSDASTSTTGSTAWQDKGFDPTGW  366

Query  634  ELALVSTPGTNLSTPQERQLAG-------------------------------GLDSLTL  548
            ELALV+ P    S+  + QL G                               GLD L L
Sbjct  367  ELALVTAPSNTNSSATDSQLVGFSTFAILFFSEDIYPVDSFGLLVTVNRSKGGGLDKLIL  426

Query  547  NSLYDEGAYRASQQP-VYGAPAPNPFEVADPFAMSNAIAAPPSV----------QLAPMP  401
            +SLYDEGAYR SQQ  +YG+ APNPF  +DPFAMSN +AAP SV          Q+  M 
Sbjct  427  DSLYDEGAYRQSQQQQLYGSSAPNPFMTSDPFAMSNHVAAPSSVQMAAMSQQQQQIPTMI  486

Query  400  QPNPFGPFHPAAAAYPPQNPLMVGPHNPFGDTgfgafpanngaaagAHQQNTNPFGSLL  224
              NPFGP  P    +P   P  V   NPF D+GFGAFPA N +     QQ  NPFG  L
Sbjct  487  HQNPFGP--PIQPQHPGAGPAAV---NPFLDSGFGAFPAANNS-----QQQANPFGGSL  535



>ref|XP_008672590.1| PREDICTED: uncharacterized protein LOC100276465 isoform X2 [Zea 
mays]
 gb|ACN29328.1| unknown [Zea mays]
 tpg|DAA57998.1| TPA: hypothetical protein ZEAMMB73_100643 [Zea mays]
Length=560

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 113/185 (61%), Gaps = 18/185 (10%)
 Frame = -2

Query  838  AEDVA-VSTTEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSG---ATSE  671
             E++A V +++I  P  P   +T DLLGL   T  V AIEES+ALALAI+P+G   +T+ 
Sbjct  350  VEEIAPVPSSQIALPPKPEIADTGDLLGLGDSTPTVLAIEESSALALAILPTGIDNSTTT  409

Query  670  TVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYR-ASQQPVYG  494
            T Q   FDPTGWELALV+T         E  L GG D LTL+SLYD+G YR   QQ +YG
Sbjct  410  TQQDSGFDPTGWELALVTTSSNATPLSMESNLGGGFDKLTLDSLYDDGTYRQMQQQQLYG  469

Query  493  APAPNPFEVADPFAMSNAIAAPPSVQLAPMP----------QPNPFGP--FHPAAAAYPP  350
            +  PNPF  +DPFA+SN +A PPSVQ+A M           +PNPFGP   H A  A P 
Sbjct  470  SAPPNPFMASDPFAVSNQVAPPPSVQMAAMAPQPQHLPMMIEPNPFGPPQQHHAGVA-PA  528

Query  349  QNPLM  335
             NP +
Sbjct  529  ANPFL  533



>ref|XP_008672589.1| PREDICTED: uncharacterized protein LOC100276465 isoform X1 [Zea 
mays]
Length=566

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 113/185 (61%), Gaps = 18/185 (10%)
 Frame = -2

Query  838  AEDVA-VSTTEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSG---ATSE  671
             E++A V +++I  P  P   +T DLLGL   T  V AIEES+ALALAI+P+G   +T+ 
Sbjct  356  VEEIAPVPSSQIALPPKPEIADTGDLLGLGDSTPTVLAIEESSALALAILPTGIDNSTTT  415

Query  670  TVQPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYR-ASQQPVYG  494
            T Q   FDPTGWELALV+T         E  L GG D LTL+SLYD+G YR   QQ +YG
Sbjct  416  TQQDSGFDPTGWELALVTTSSNATPLSMESNLGGGFDKLTLDSLYDDGTYRQMQQQQLYG  475

Query  493  APAPNPFEVADPFAMSNAIAAPPSVQLAPMP----------QPNPFGP--FHPAAAAYPP  350
            +  PNPF  +DPFA+SN +A PPSVQ+A M           +PNPFGP   H A  A P 
Sbjct  476  SAPPNPFMASDPFAVSNQVAPPPSVQMAAMAPQPQHLPMMIEPNPFGPPQQHHAGVA-PA  534

Query  349  QNPLM  335
             NP +
Sbjct  535  ANPFL  539



>ref|XP_008799224.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X2 [Phoenix dactylifera]
Length=555

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 116/207 (56%), Gaps = 16/207 (8%)
 Frame = -2

Query  820  STTEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT----SETVQPKD  653
            S  E+ +P   V  +T DLLGLN    D SAIEESNALAL IVPSG T    S   Q K 
Sbjct  355  SNVEVASPRKAVTEDTGDLLGLNETNPDASAIEESNALALTIVPSGGTISIDSGMAQEKG  414

Query  652  FDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYR--ASQQPVYGAPAPN  479
            FDP+GWELALV+TP +  S+  E Q  G  D LTL+SLYDE A R    QQ  +GAPAPN
Sbjct  415  FDPSGWELALVTTPSSTNSSMVESQSGGSFDKLTLDSLYDEAASRQIRQQQQFHGAPAPN  474

Query  478  PFEVADPFAMSNAIAAPPSVQLAPMPQPNPFG----PFHPAAAAYPPQNPLMVGPHNPFG  311
            PF    PFA SN +AAPP+VQ+A M Q         P +P A     Q+ ++    NPFG
Sbjct  475  PFLSTGPFATSNQVAAPPAVQMAAMAQQQQQMSMMVPSNPFAQPISQQHMVIGAASNPFG  534

Query  310  DTgfgafpanngaaagAHQQNTNPFGS  230
            D             A   Q  +NPFG+
Sbjct  535  DV------GFGAFPANDKQHQSNPFGT  555



>gb|EAY98914.1| hypothetical protein OsI_20869 [Oryza sativa Indica Group]
Length=567

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 112/192 (58%), Gaps = 31/192 (16%)
 Frame = -2

Query  814  TEIPAPVPPVKF---ETDDLLGLNAPTSDVSAIEESNALALAIVPSGA-----TSETVQP  659
            TE  +P PP K    +T DLLGLN P   VSAIEESNALALAIVP+ A     ++ T Q 
Sbjct  361  TEAVSPPPPPKTKVADTGDLLGLNDPNPSVSAIEESNALALAIVPADAGASTSSTATWQD  420

Query  658  KDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAY-RASQQPVYGAPAP  482
            K FDPTGWELALV+TP    S+  + QL GG D L L SLYD+G Y +  QQ +YG+ AP
Sbjct  421  KGFDPTGWELALVTTPSNTNSSAADSQLGGGFDKLILESLYDQGDYRQRQQQQLYGSSAP  480

Query  481  NPFEVADPFAMSNAIAAPPSVQLAPMP----------QPNPFGPFHPAAAAYPPQNPLMV  332
            NPF   DPF MSN +A P SVQ+A M           Q NPFG         PP  P  V
Sbjct  481  NPFMSNDPFVMSNQVAPPSSVQMAAMSQQHQQIPTMMQANPFG---------PPMQPQHV  531

Query  331  G---PHNPFGDT  305
            G     NPF D+
Sbjct  532  GMGPATNPFLDS  543



>ref|XP_003567959.1| PREDICTED: putative clathrin assembly protein At2g01600 [Brachypodium 
distachyon]
Length=567

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 122/198 (62%), Gaps = 27/198 (14%)
 Frame = -2

Query  778  ETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETV-----QPKDFDPTGWELALVST  614
            +T DLLGLN P+  VSAIEESNALALAIV S A++ T      Q K FDPTGWELALV+ 
Sbjct  376  DTGDLLGLNDPSPGVSAIEESNALALAIVTSDASTSTTSTTAWQDKGFDPTGWELALVTA  435

Query  613  PGTNLSTPQERQLAGGLDSLTLNSLYDEGAY-RASQQPVYGAPAPNPFEVADPFAMSNAI  437
            P    S+  + QL GGLD L L+SLYDEGAY +  QQ +YG+ APNPF   DPFAMSN +
Sbjct  436  PSNTNSSVADSQLGGGLDKLILDSLYDEGAYRQRQQQQLYGSSAPNPFMTNDPFAMSNQV  495

Query  436  AAPPSVQLAPMP----------QPNPFGPFHPAAAAYPPQNPLMVGPHNPFGDTgfgafp  287
            A PP VQ+A M           QPNPFGP  P    +    P+     NPF DTGFG FP
Sbjct  496  APPPLVQMAAMSQQHPQIPTMMQPNPFGP--PVQTQHAGPGPVT----NPFLDTGFGPFP  549

Query  286  anngaaagAHQQNTNPFG  233
              N +     QQ  NPFG
Sbjct  550  VANNS-----QQQANPFG  562



>ref|XP_006838117.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X1 [Amborella trichopoda]
 gb|ERN00686.1| hypothetical protein AMTR_s00106p00058730 [Amborella trichopoda]
Length=563

 Score =   139 bits (350),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 101/177 (57%), Gaps = 25/177 (14%)
 Frame = -2

Query  778  ETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT-----SETVQPKDFDPTGWELALVST  614
            +T DLLGLNA   D SAIEE NALALAIVPS  +     S   Q K  DPTGWELALV+T
Sbjct  371  DTGDLLGLNATNFDASAIEEQNALALAIVPSAGSDAVSDSHGAQTKGLDPTGWELALVTT  430

Query  613  PGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQP-VYGAPAPNPFEVADPFAMSNAI  437
              +N     E +LAGG D LTL SLY++  YR  QQ   YGAP PNPFE  DPFA++N I
Sbjct  431  ASSNDKNLTESKLAGGFDKLTLESLYEDAVYRQQQQQFTYGAPPPNPFESHDPFAIANNI  490

Query  436  AAPPSVQLAP-------------MPQPNPFGPFHPAAAAYPPQNPLMVGPHNPFGDT  305
              PPSVQ+A              M    PFG  H     +  Q     GP NPFGDT
Sbjct  491  PPPPSVQMAAMAHHQQQQQMMMGMTSSGPFG--HQPNYHHQQQ----FGPSNPFGDT  541



>ref|XP_008799223.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X1 [Phoenix dactylifera]
Length=558

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 116/210 (55%), Gaps = 19/210 (9%)
 Frame = -2

Query  820  STTEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETV-------Q  662
            S  E+ +P   V  +T DLLGLN    D SAIEESNALAL IVPSG    T+       Q
Sbjct  355  SNVEVASPRKAVTEDTGDLLGLNETNPDASAIEESNALALTIVPSGVFGGTISIDSGMAQ  414

Query  661  PKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYR--ASQQPVYGAP  488
             K FDP+GWELALV+TP +  S+  E Q  G  D LTL+SLYDE A R    QQ  +GAP
Sbjct  415  EKGFDPSGWELALVTTPSSTNSSMVESQSGGSFDKLTLDSLYDEAASRQIRQQQQFHGAP  474

Query  487  APNPFEVADPFAMSNAIAAPPSVQLAPMPQPNPFG----PFHPAAAAYPPQNPLMVGPHN  320
            APNPF    PFA SN +AAPP+VQ+A M Q         P +P A     Q+ ++    N
Sbjct  475  APNPFLSTGPFATSNQVAAPPAVQMAAMAQQQQQMSMMVPSNPFAQPISQQHMVIGAASN  534

Query  319  PFGDTgfgafpanngaaagAHQQNTNPFGS  230
            PFGD             A   Q  +NPFG+
Sbjct  535  PFGDV------GFGAFPANDKQHQSNPFGT  558



>ref|XP_006416959.1| hypothetical protein EUTSA_v10007171mg [Eutrema salsugineum]
 gb|ESQ35312.1| hypothetical protein EUTSA_v10007171mg [Eutrema salsugineum]
Length=586

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 104/171 (61%), Gaps = 19/171 (11%)
 Frame = -2

Query  802  APVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETV---QPKDFDPTGWE  632
            A  P    +TDDLLGLN    D   I + NALALA+V +   S      Q +  DP+GWE
Sbjct  369  AETPQNMIDTDDLLGLNNDAPDPLEILDQNALALALVSTDVESSMFGFGQARALDPSGWE  428

Query  631  LALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFA  452
            LALV+TP  +++   ERQLAGGLD+LTLNSLY++GA+RA+Q   YG PAPNPFE  DPFA
Sbjct  429  LALVTTPSNDITAATERQLAGGLDTLTLNSLYEDGAFRAAQP--YGDPAPNPFEAQDPFA  486

Query  451  MSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPH---NPFGD  308
             S+ +  PPS       + NPFGP+H        Q  L V P    NPFGD
Sbjct  487  FSDNV-VPPSA------ESNPFGPYHQPTY----QQHLEVAPTSAANPFGD  526



>emb|CDM83847.1| unnamed protein product [Triticum aestivum]
Length=558

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 111/194 (57%), Gaps = 28/194 (14%)
 Frame = -2

Query  823  VSTTEIPAPVPPVK-----------FETDDLLGLNAPTSDVSAIEESNALALAIVPSGA-  680
            V   E PAPVP +             +T DLLGL+ P   VSAIEESNALALAI P+G  
Sbjct  348  VRQMEEPAPVPSLTEAASSPPNTRVADTGDLLGLSDPNPSVSAIEESNALALAITPTGVN  407

Query  679  ---TSETVQPKDFDPTGWELALVSTPGTNL-STPQERQLAGGLDSLTLNSLYDEGAYRAS  512
               TS  +Q   FDPTGWELALV+T  +N  S   +  L GG D LTL+SLYD+G YR  
Sbjct  408  TSTTSTAMQDIGFDPTGWELALVTTSSSNTNSLAVDSTLGGGFDKLTLDSLYDDGTYRQM  467

Query  511  QQPV-YGAPAPNPFEVADPFAMSNAIAAPPSV------QLAPMPQPNPFG-PFHPAAAAY  356
            QQ + YGA   NPF  +DPFA+SN +A+PPSV      Q     QPNPFG P HP     
Sbjct  468  QQQLPYGAVPHNPFMASDPFAVSNQVASPPSVQMAAMAQQPQQMQPNPFGPPSHPQ----  523

Query  355  PPQNPLMVGPHNPF  314
            P  NP +     PF
Sbjct  524  PVPNPFLDAGFGPF  537



>dbj|BAK06048.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=564

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 112/185 (61%), Gaps = 16/185 (9%)
 Frame = -2

Query  820  STTEIPAPVPPVKF-ETDDLLGLNAPTSDVSAIEESNALALAIVPSGA-----TSETVQP  659
            S TE+P+  P  +  +T DLLGL+ P   VS IEESNALALAI P+G      ++ T+Q 
Sbjct  359  SLTEVPSSPPNTRVADTGDLLGLSDPNPSVSMIEESNALALAITPTGVNTSTTSTATMQD  418

Query  658  KDFDPTGWELALVSTPGTNL-STPQERQLAGGLDSLTLNSLYDEGAYRASQQPV-YGAPA  485
              FDPTGWELALV+T  ++  S   +  L GG D LTL+SLYD+G YR  QQ + YG+  
Sbjct  419  IGFDPTGWELALVTTSSSDTNSLAVDSNLGGGFDKLTLDSLYDDGTYRQMQQQLPYGSVP  478

Query  484  PNPFEVADPFAMSNAIAAPPSV------QLAPMPQPNPFG-PFHPA-AAAYPPQNPLMVG  329
             NPF  +DPFA+SN IA+PPSV      Q     QPNPFG P HP  A   P  NP +  
Sbjct  479  HNPFMASDPFAVSNQIASPPSVQMAAMAQQPQQMQPNPFGPPSHPQHAGTMPVPNPFLDA  538

Query  328  PHNPF  314
               PF
Sbjct  539  GFGPF  543



>tpg|DAA51587.1| TPA: hypothetical protein ZEAMMB73_095588 [Zea mays]
Length=533

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 83/133 (62%), Gaps = 15/133 (11%)
 Frame = -2

Query  733  SAIEESNALALAIVPSGATSET----VQPKDFDPTGWELALVSTPGTNLSTPQERQLAGG  566
             AIEESNALALAIVP+   S T     Q K FDPTGWELALV+ P    S+    QL GG
Sbjct  58   KAIEESNALALAIVPTDGASTTGNTAFQDKGFDPTGWELALVTAPSNTTSSASVGQLGGG  117

Query  565  LDSLTLNSLYDEGAY-RASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPMP----  401
             D L L+S YD+GAY +  QQ VYG+  PNPF   DPF MSN +A PPSVQ+A M     
Sbjct  118  FDKLILDSFYDDGAYRQRQQQQVYGSAMPNPFMTNDPFVMSNHVAPPPSVQMAAMSQQHQ  177

Query  400  ------QPNPFGP  380
                  QPNPFGP
Sbjct  178  QIPTMMQPNPFGP  190



>gb|AAF79231.1|AC006917_16 F10B6.32 [Arabidopsis thaliana]
Length=813

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 110/187 (59%), Gaps = 19/187 (10%)
 Frame = -2

Query  838  AEDVAVSTTEIPAPVPPVKF-ETDDLL----GLNAPTSDVSAIEESNALALAIVPSGATS  674
            +E+  +S+   P+   P  F +TDDLL    GL+  T D  AI + NALALA+V +   S
Sbjct  475  SEETQLSSQSPPSVETPQNFIDTDDLLYYTQGLHDDTPDPLAILDQNALALALVSNDVDS  534

Query  673  ETV---QPKDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQP  503
                  Q +D DP+GWELALV+TP  ++S   ERQL     +LTLNSLYD+GA RA+QQP
Sbjct  535  SPFSFGQARDLDPSGWELALVTTPSNDISAATERQLVRY--TLTLNSLYDDGALRAAQQP  592

Query  502  VYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPH  323
             YG PA NPFEV D FA S++++ P +V        NPFG + P       Q  L V P 
Sbjct  593  AYGVPASNPFEVQDLFAFSDSVSPPSAVN-------NPFGLYEPTYHQQEQQPQLQVAPS  645

Query  322  --NPFGD  308
              NPFGD
Sbjct  646  PANPFGD  652



>ref|XP_003569612.1| PREDICTED: putative clathrin assembly protein At2g01600 [Brachypodium 
distachyon]
Length=567

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 112/190 (59%), Gaps = 21/190 (11%)
 Frame = -2

Query  820  STTEIPAPVPPVKF-ETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT-----SETVQP  659
            S+TE+ +P P  +  +T DLLGL+ P   VSAIE +NALALAI+P+GA      + T+Q 
Sbjct  359  SSTEVASPPPDTRVADTGDLLGLSDPNPSVSAIEANNALALAIIPTGANTSTSTTTTIQD  418

Query  658  KDFDPTGWELALVSTPGTNLS-TPQERQLAGGLDSLTLNSLYDEGAYRAS--QQPVYGAP  488
              FDP+GWELALV+   +N +  P +  L GG D L L+SLYDEG YR +  QQP   AP
Sbjct  419  IGFDPSGWELALVTASSSNTNPLPVDSNLGGGFDKLILDSLYDEGTYRQNQQQQPYGSAP  478

Query  487  A-PNPFEVADPFAMSNAIAAPPSVQLAPMP-------QPNPFG----PFHPAAAAYPPQN  344
            A  NPF  +DPF +SN +A PPSVQ+A  P       + NPFG    P     A  P  N
Sbjct  479  AHHNPFMASDPFTVSNQVAPPPSVQMAQQPQQMAMMIEANPFGPPLQPQQTGMAPLPTAN  538

Query  343  PLMVGPHNPF  314
            P M     PF
Sbjct  539  PFMDAGFGPF  548



>gb|EYU30089.1| hypothetical protein MIMGU_mgv1a0050551mg, partial [Erythranthe 
guttata]
Length=175

 Score =   116 bits (291),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 82/128 (64%), Gaps = 23/128 (18%)
 Frame = -2

Query  658  KDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPN  479
            K F+P+GWELAL STP TNLST QERQL GGLDSL L+SLYD+GAYR + +     PAPN
Sbjct  12   KKFEPSGWELALASTPSTNLSTVQERQLGGGLDSLILDSLYDDGAYRGASK----QPAPN  67

Query  478  PFEVADPFAMSNAIAAPPSVQLAPMPQP------NPFGPFHPAAAAYPP----QNPLMVG  329
            PFEV DPFA   A+  PP   LA +P P      NPFGPF P    YP     Q    V 
Sbjct  68   PFEVNDPFA---AVPNPP---LAAVPNPPTGQTNNPFGPFEP---VYPQPEQLQQQSFVS  118

Query  328  PHNPFGDT  305
            P NPFGDT
Sbjct  119  PQNPFGDT  126



>gb|EMT16298.1| Putative clathrin assembly protein [Aegilops tauschii]
Length=657

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 99/177 (56%), Gaps = 15/177 (8%)
 Frame = -2

Query  820  STTEIPAPVPPVKF-ETDDLLGLNAPTSDVSAIEESNALALAIVPSGA-----TSETVQP  659
            S TE+ +  P  K  +T DLLGL+ P   VSAIEESNALALAI P+G      ++ T+Q 
Sbjct  411  SLTEVASSPPNTKVADTGDLLGLSDPNPSVSAIEESNALALAIAPTGVNTSTTSTATMQD  470

Query  658  KDFDPTGWELALVSTPGTNL-STPQERQLAGGLDSLTLNSLYDEGAYRASQQPV-YGAPA  485
              FDPTGWELALV+T  +N  S   +  L GG D LTL+SLYD+G YR  QQ + YG+  
Sbjct  471  IGFDPTGWELALVTTSSSNTNSLAVDSNLGGGFDKLTLDSLYDDGTYRQMQQQLPYGSVP  530

Query  484  PNPFEVADPFAMSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPHNPF  314
             NPF  +DPFA+SN       + L  +     +            Q P    PHNPF
Sbjct  531  HNPFMASDPFAVSNQGGGFDKLTLDSLYDDGTYRQMQ-------QQLPYGSVPHNPF  580



>ref|XP_006850889.1| PREDICTED: putative clathrin assembly protein At5g57200 [Amborella 
trichopoda]
 gb|ERN12470.1| hypothetical protein AMTR_s00025p00161520 [Amborella trichopoda]
Length=546

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 102/180 (57%), Gaps = 28/180 (16%)
 Frame = -2

Query  805  PAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGAT--SETVQPKDFDPTGWE  632
            P P PP   +T+DLLGLN    +  AIEESNALALAIVPS  T  SE       DP+GWE
Sbjct  365  PEPEPPA--DTEDLLGLNELNPNAVAIEESNALALAIVPSDGTKPSEGFLGNSTDPSGWE  422

Query  631  LALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFA  452
            LALV+T  +N S   E +LAGG D L L+SLYD+   R  QQ   G  A NPFE  DPFA
Sbjct  423  LALVATASSNTSHVTESKLAGGFDKLLLDSLYDDAQTRRQQQQQSGY-ANNPFESQDPFA  481

Query  451  MSNAIAAPPSV-----------QLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPHNPFGDT  305
            MS+ +A PP+V            ++P  QP           +YPPQ   M G  NPFGD+
Sbjct  482  MSHNVAPPPNVQMALMAQQQQMMMSPYQQP-----------SYPPQMQ-MGGSANPFGDS  529



>ref|XP_008811452.1| PREDICTED: putative clathrin assembly protein At5g57200 [Phoenix 
dactylifera]
Length=559

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 78/127 (61%), Gaps = 5/127 (4%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVPSGATSE-----TVQPKDFDPTGWELALVSTP  611
            T DLLGL+      + +EESNALALAI+P G  S+      +     D +GWELALV+TP
Sbjct  373  TVDLLGLDEINPVAAELEESNALALAIIPQGDDSKPSNTGGLVGSGIDSSGWELALVTTP  432

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAA  431
             +N     + +LAGG D L LNSLYD+ A R      Y   A NPF+  DPFAMSN  AA
Sbjct  433  SSNSDQLTDNKLAGGFDKLLLNSLYDDAARRQQSTGAYSGFATNPFDSQDPFAMSNNFAA  492

Query  430  PPSVQLA  410
            PP+VQ+A
Sbjct  493  PPNVQMA  499



>ref|XP_010929366.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X5 [Elaeis guineensis]
Length=459

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 79/127 (62%), Gaps = 5/127 (4%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVPSGATSE-----TVQPKDFDPTGWELALVSTP  611
            T DLLGL+      + +EESNALALAI+P G  S+      +     D +GWELALV+TP
Sbjct  275  TVDLLGLDETNHGPAELEESNALALAIIPQGDDSKPSNTGGLVGVGIDSSGWELALVTTP  334

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAA  431
             +N +   E +LAGG D L L+SLYD+ A        Y   APNPF+  DPFAMS+  AA
Sbjct  335  SSNSNQLTENKLAGGFDKLLLDSLYDDAARWQQNTGAYNGFAPNPFDSQDPFAMSHNFAA  394

Query  430  PPSVQLA  410
            PP+VQ+A
Sbjct  395  PPNVQMA  401



>ref|XP_010929365.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X4 [Elaeis guineensis]
Length=486

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 79/127 (62%), Gaps = 5/127 (4%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVPSGATSE-----TVQPKDFDPTGWELALVSTP  611
            T DLLGL+      + +EESNALALAI+P G  S+      +     D +GWELALV+TP
Sbjct  302  TVDLLGLDETNHGPAELEESNALALAIIPQGDDSKPSNTGGLVGVGIDSSGWELALVTTP  361

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAA  431
             +N +   E +LAGG D L L+SLYD+ A        Y   APNPF+  DPFAMS+  AA
Sbjct  362  SSNSNQLTENKLAGGFDKLLLDSLYDDAARWQQNTGAYNGFAPNPFDSQDPFAMSHNFAA  421

Query  430  PPSVQLA  410
            PP+VQ+A
Sbjct  422  PPNVQMA  428



>ref|XP_010929364.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X3 [Elaeis guineensis]
Length=530

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 79/127 (62%), Gaps = 5/127 (4%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVPSGATSE-----TVQPKDFDPTGWELALVSTP  611
            T DLLGL+      + +EESNALALAI+P G  S+      +     D +GWELALV+TP
Sbjct  346  TVDLLGLDETNHGPAELEESNALALAIIPQGDDSKPSNTGGLVGVGIDSSGWELALVTTP  405

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAA  431
             +N +   E +LAGG D L L+SLYD+ A        Y   APNPF+  DPFAMS+  AA
Sbjct  406  SSNSNQLTENKLAGGFDKLLLDSLYDDAARWQQNTGAYNGFAPNPFDSQDPFAMSHNFAA  465

Query  430  PPSVQLA  410
            PP+VQ+A
Sbjct  466  PPNVQMA  472



>ref|XP_010929363.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X2 [Elaeis guineensis]
Length=535

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 79/127 (62%), Gaps = 5/127 (4%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVPSGATSE-----TVQPKDFDPTGWELALVSTP  611
            T DLLGL+      + +EESNALALAI+P G  S+      +     D +GWELALV+TP
Sbjct  351  TVDLLGLDETNHGPAELEESNALALAIIPQGDDSKPSNTGGLVGVGIDSSGWELALVTTP  410

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAA  431
             +N +   E +LAGG D L L+SLYD+ A        Y   APNPF+  DPFAMS+  AA
Sbjct  411  SSNSNQLTENKLAGGFDKLLLDSLYDDAARWQQNTGAYNGFAPNPFDSQDPFAMSHNFAA  470

Query  430  PPSVQLA  410
            PP+VQ+A
Sbjct  471  PPNVQMA  477



>ref|XP_010929362.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X1 [Elaeis guineensis]
Length=557

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 79/127 (62%), Gaps = 5/127 (4%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVPSGATSE-----TVQPKDFDPTGWELALVSTP  611
            T DLLGL+      + +EESNALALAI+P G  S+      +     D +GWELALV+TP
Sbjct  373  TVDLLGLDETNHGPAELEESNALALAIIPQGDDSKPSNTGGLVGVGIDSSGWELALVTTP  432

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAA  431
             +N +   E +LAGG D L L+SLYD+ A        Y   APNPF+  DPFAMS+  AA
Sbjct  433  SSNSNQLTENKLAGGFDKLLLDSLYDDAARWQQNTGAYNGFAPNPFDSQDPFAMSHNFAA  492

Query  430  PPSVQLA  410
            PP+VQ+A
Sbjct  493  PPNVQMA  499



>ref|XP_010913847.1| PREDICTED: LOW QUALITY PROTEIN: putative clathrin assembly protein 
At5g57200 [Elaeis guineensis]
Length=561

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 98/174 (56%), Gaps = 23/174 (13%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDF-----DPTGWELALVSTP  611
            T DLLGL+      + +E+SNALALAI+  G  S+    +D      D +GWELALV+TP
Sbjct  375  TGDLLGLDEINPVAAELEQSNALALAIIQPGDDSKPTATRDLLGGGTDSSGWELALVTTP  434

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAA  431
             +N S   E +LAGG D L L+SLY++ + R  QQ   GA A NPF+  DPFAMSN+IA 
Sbjct  435  SSNTSYVVESKLAGGFDKLLLDSLYEDSSRR--QQ--IGA-AANPFDSRDPFAMSNSIAP  489

Query  430  PPSVQLAPMPQPNPFGPFHPAAA------------AYPPQNPL-MVGPHNPFGD  308
            PP+VQ+A M Q      +                 AY PQ P   +G  NPFGD
Sbjct  490  PPNVQMALMAQQQQQYYYQQQQQYYQQQQMTMVPHAYQPQYPYPQMGSANPFGD  543



>ref|XP_010250225.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nelumbo 
nucifera]
Length=549

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 88/165 (53%), Gaps = 11/165 (7%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFDP----TGWELALVSTPGTN  602
            DLLGLN P  + S +++ NALALAIVP   +S T+     +P    TGWELALV+ P +N
Sbjct  359  DLLGLNDPIPEASELDQKNALALAIVPVADSSTTIPSAAPNPMNGTTGWELALVTAPSSN  418

Query  601  LSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFE-------VADPFAMSN  443
             S     +LAGGLD LTL+SLYD+   RA+Q   Y    P P           DPF  SN
Sbjct  419  ESATAASKLAGGLDKLTLDSLYDDAIRRANQTASYNPWEPMPMTGPIMQQPAHDPFFASN  478

Query  442  AIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPHNPFGD  308
            A++APPSVQ++ M Q                  P    P NPFG+
Sbjct  479  AVSAPPSVQISAMAQQRQAFMLQQQQQQMMMMGPQQQQPLNPFGN  523



>ref|XP_009390454.1| PREDICTED: putative clathrin assembly protein At4g25940 [Musa 
acuminata subsp. malaccensis]
Length=550

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 78/126 (62%), Gaps = 4/126 (3%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDF---DPTGWELALVSTPGTNL  599
            DLLGL+      + ++E NALALAI P G +  T     F   D +GWELALV+T   N 
Sbjct  376  DLLGLDEIIPVAAELDEINALALAIPPGGDSISTATGDLFSPGDSSGWELALVTTSSNNN  435

Query  598  STPQERQLAGGLDSLTLNSLYDEGAYRASQQPV-YGAPAPNPFEVADPFAMSNAIAAPPS  422
            + P E +LAGG D L L+SLYD+ A R     V +G  A NP+E  DPFAMSN IA PP+
Sbjct  436  NQPTESKLAGGFDQLLLDSLYDDAARRLQNTAVCHGGVAANPYESMDPFAMSNYIAPPPN  495

Query  421  VQLAPM  404
            VQ+A M
Sbjct  496  VQMALM  501



>ref|XP_010273537.1| PREDICTED: putative clathrin assembly protein At5g57200 [Nelumbo 
nucifera]
Length=581

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 86/143 (60%), Gaps = 13/143 (9%)
 Frame = -2

Query  811  EIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIV-PSGATSETVQPKDF-----  650
            E+ AP P +++ T DLLGLN      + +EESNALALAI+ PSG    +   ++      
Sbjct  368  EVEAPPPLIEY-TGDLLGLNEINPKAAELEESNALALAIIDPSGLDPLSSTSRELAALGA  426

Query  649  -DPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLY-DEGAYRASQQPV----YGAP  488
             + TGWELALV+TP  N S   E +LAGG D L L+SLY D  A R  QQ V     G  
Sbjct  427  PNATGWELALVTTPSNNTSHLTESKLAGGFDRLLLDSLYEDAAARRQHQQQVAGYGVGMA  486

Query  487  APNPFEVADPFAMSNAIAAPPSV  419
            APNPF+  DPF+MSN IA P SV
Sbjct  487  APNPFDPQDPFSMSNNIAPPTSV  509



>ref|XP_008781765.1| PREDICTED: putative clathrin assembly protein At5g57200 [Phoenix 
dactylifera]
Length=565

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 83/129 (64%), Gaps = 10/129 (8%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDF-----DPTGWELALVSTP  611
            T DLLGL+      + +E+SNALALAI+  G  S+    +D      D +GWELALV+TP
Sbjct  376  TGDLLGLDEINPAAAELEQSNALALAIIEPGDGSKPTATRDLLGGGTDSSGWELALVTTP  435

Query  610  GTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVADPFAMSNAIAA  431
             +N S   E +LAGG D L L+SLY++    AS++   GA A NPF   DPFAMSN+IA 
Sbjct  436  SSNTSYVVESKLAGGFDKLLLDSLYED----ASRRQQIGADA-NPFNSRDPFAMSNSIAP  490

Query  430  PPSVQLAPM  404
            PP+VQ+A M
Sbjct  491  PPNVQMALM  499



>ref|XP_004965651.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Setaria italica]
Length=575

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 80/132 (61%), Gaps = 6/132 (5%)
 Frame = -2

Query  775  TDDLLGLNAPTS-DVSAIEESNALALAIVPSGATSETVQPKDF---DPTGWELALVSTPG  608
            T DLL L+   +  +S +EE NALALAIV  G  ++T   +D    D +GWELALV+ P 
Sbjct  374  TGDLLNLDEEVNPMISDLEERNALALAIVAPGNENKTSTSRDLFALDKSGWELALVTAPS  433

Query  607  TNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVY--GAPAPNPFEVADPFAMSNAIA  434
             + +   + QLAGG D L L+SLY++ A R     V   G  A NPFE  DPFAMSN+ A
Sbjct  434  NHTNQQMDNQLAGGFDKLLLDSLYEDEARRQQIASVTYNGTIAANPFEFNDPFAMSNSFA  493

Query  433  APPSVQLAPMPQ  398
             P +VQLA M +
Sbjct  494  PPSNVQLAMMAE  505



>ref|XP_009408060.1| PREDICTED: putative clathrin assembly protein At5g57200 [Musa 
acuminata subsp. malaccensis]
Length=570

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 74/122 (61%), Gaps = 5/122 (4%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDF---DPTGWELALVSTPGTNL  599
            DLLGL+      + +EESNALALAI+  G  ++     D    D +GWELALV+TP +N 
Sbjct  372  DLLGLDEINPAAAELEESNALALAIISPGNDTKASTAHDLFGTDSSGWELALVTTPSSNT  431

Query  598  STPQERQLAGGLDSLTLNSLYDEGAYRASQQPVY--GAPAPNPFEVADPFAMSNAIAAPP  425
            S   E QLAGG D L L SLY++ + R      Y  G    NPF+  DPFAMSN+IA PP
Sbjct  432  SHLVESQLAGGFDRLLLESLYEDSSRRQQIAAAYSGGGMDANPFDFGDPFAMSNSIAPPP  491

Query  424  SV  419
            SV
Sbjct  492  SV  493



>emb|CDP10454.1| unnamed protein product [Coffea canephora]
Length=546

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 80/139 (58%), Gaps = 24/139 (17%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD----PTGWELALVSTPGTN  602
            DLLGLN P    S ++E NA+ALAIVP G      QP         TGWELALV+ P +N
Sbjct  361  DLLGLNDPVPAASELDEKNAMALAIVPVGVAE---QPASTGLTNGTTGWELALVTAPSSN  417

Query  601  LSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVA-------------D  461
             S     +LAGGLD LTL+SLYD+   R++QQ V    + NP+E A             D
Sbjct  418  ESATTASKLAGGLDKLTLDSLYDDAIRRSNQQTV----SYNPWETAAPMGGPMMLPRAHD  473

Query  460  PFAMSNAIAAPPSVQLAPM  404
            PF  SN +AAPPSVQ+A M
Sbjct  474  PFYASNTVAAPPSVQMAAM  492



>ref|XP_010057620.1| PREDICTED: putative clathrin assembly protein At5g35200 [Eucalyptus 
grandis]
 gb|KCW74805.1| hypothetical protein EUGRSUZ_E03535 [Eucalyptus grandis]
Length=556

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 76/132 (58%), Gaps = 10/132 (8%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGAT---SETVQPKDFDPTGWELALVSTPGTNL  599
            D+LGLN P    S ++E NALALAIVP GA    S T        TGWELALV+ P +N 
Sbjct  367  DILGLNEPNPLASELDEKNALALAIVPVGAADQPSSTGFNHANGTTGWELALVTAPSSNE  426

Query  598  STPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFE-------VADPFAMSNA  440
            +     +LAGGLD LTL+SLYDEG  R+SQ   Y    P P           DPF  SNA
Sbjct  427  TASAASKLAGGLDKLTLDSLYDEGMRRSSQSSSYNPWEPAPMAGSMMQQPAHDPFFGSNA  486

Query  439  IAAPPSVQLAPM  404
            +AAP  VQ+A M
Sbjct  487  VAAPLQVQMAAM  498



>ref|XP_007154718.1| hypothetical protein PHAVU_003G141500g [Phaseolus vulgaris]
 gb|ESW26712.1| hypothetical protein PHAVU_003G141500g [Phaseolus vulgaris]
Length=569

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 93/172 (54%), Gaps = 17/172 (10%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVP-SGATSETVQPKDFDPT-GWELALVSTPGTN  602
            TDDLLGLN        +EESNALALAIVP  G  S  +   + + T GWELALV+TP T+
Sbjct  378  TDDLLGLNEINPKAQELEESNALALAIVPPGGNNSSNLALANINGTSGWELALVTTPSTH  437

Query  601  LSTPQERQLAGGLDSLTLNSLY-DEGAYRASQ--QPVYG---APAPNPF---EVADPFAM  449
             S    R++AGG D+L L+SLY DE A R  Q     YG       NPF      DPFAM
Sbjct  438  TSQAPVRKMAGGFDNLLLDSLYEDENARRQLQLRNAGYGYGDMDTHNPFNHHNQQDPFAM  497

Query  448  SNAIAAPPSVQLAPMPQPNP-----FGPFHPAAAAYPPQNPLMVGPHNPFGD  308
            SN I  P +VQ+A MPQ          P+      Y  Q P+M G  NPF D
Sbjct  498  SNNIPPPANVQMAFMPQQQQQHNMMMVPYQYPQTQYHQQMPVM-GSSNPFDD  548



>ref|XP_008223882.1| PREDICTED: putative clathrin assembly protein At5g57200 [Prunus 
mume]
Length=581

 Score =   102 bits (253),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 103/205 (50%), Gaps = 43/205 (21%)
 Frame = -2

Query  808  IPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD----PT  641
            +  P P +  +  DLLGL       + IEESNALALAIVP G  +E      F+     +
Sbjct  364  VVEPPPLISTDDTDLLGLREINPKAAEIEESNALALAIVPQG--NEQQSGASFNDLAGTS  421

Query  640  GWELALVSTPGTNLS-TPQERQLAGGLDSLTLNSLY-DEGAYRASQQPV----YGAPA-P  482
            GWELALV+TP  + S  P +++ AGG D L L+SLY DEGA R  Q       YGA +  
Sbjct  422  GWELALVTTPSNHTSQVPMDKKFAGGFDKLLLDSLYEDEGARRQIQLQNAGYGYGATSLH  481

Query  481  NPFE------VADPFAMSNAIAAPPSVQLAPM-------------------PQPNPFGPF  377
            NPFE      V DPFAMSN IA P +VQ+A M                    Q N     
Sbjct  482  NPFEQQAQHPVQDPFAMSNNIAPPTNVQMALMAQQQHQHQQILQQQNQQYQQQQNMMMVP  541

Query  376  HPAAAAYPPQNPLMV--GPHNPFGD  308
            HP  + YP Q   M   GP NPFGD
Sbjct  542  HPYYSQYPQQ---MQPPGPSNPFGD  563



>ref|XP_002269299.1| PREDICTED: putative clathrin assembly protein At5g57200 [Vitis 
vinifera]
 emb|CBI40102.3| unnamed protein product [Vitis vinifera]
Length=591

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 89/153 (58%), Gaps = 14/153 (9%)
 Frame = -2

Query  820  STTEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSG---ATSETVQPKDF  650
            +  E+ AP       T DLLGLN      + +EESNALALAI+P G   A++      DF
Sbjct  359  TKNEVEAPPLIATDTTADLLGLNEINPKAAELEESNALALAIIPPGNDPASAVNSGLGDF  418

Query  649  ---DPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRAS---QQPVYG--  494
               + +GWELALV+TP  N+S   + +LAGG + L L+SLY++ A R     Q   YG  
Sbjct  419  GGLNASGWELALVTTPSPNISQATDNKLAGGFNKLLLDSLYEDEAARMRLQQQNAGYGFG  478

Query  493  ---APAPNPFEVADPFAMSNAIAAPPSVQLAPM  404
                 APNPFE  DPF+MSN+IA   +VQ+A M
Sbjct  479  MTTQNAPNPFEANDPFSMSNSIAPSTNVQMALM  511



>ref|NP_001174939.1| Os06g0661400 [Oryza sativa Japonica Group]
 dbj|BAH93667.1| Os06g0661400 [Oryza sativa Japonica Group]
Length=342

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 80/130 (62%), Gaps = 6/130 (5%)
 Frame = -2

Query  775  TDDLLGLNAPTS-DVSAIEESNALALAIVPSGATSETVQPKDF---DPTGWELALVSTPG  608
            T DLL  +   +  ++ IEESNALALAIV  G  ++    +D    D +GWELALV+ P 
Sbjct  139  TGDLLNFDEEVNPLIANIEESNALALAIVAPGNENKASASQDLFALDKSGWELALVTAPS  198

Query  607  TNLSTPQERQLAGGLDSLTLNSLYDEGAYRA--SQQPVYGAPAPNPFEVADPFAMSNAIA  434
            T+ S P + QLAGG D L L+SLY++ A R   +     G+ A NPF+  DPFAMSN  A
Sbjct  199  THTSRPVDNQLAGGFDKLLLDSLYEDEARRQQIASATYNGSVAGNPFDPNDPFAMSNNFA  258

Query  433  APPSVQLAPM  404
             P +VQLA M
Sbjct  259  PPSNVQLAMM  268



>ref|XP_010110275.1| Putative clathrin assembly protein [Morus notabilis]
 gb|EXC25759.1| Putative clathrin assembly protein [Morus notabilis]
Length=559

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 74/129 (57%), Gaps = 7/129 (5%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFDPTGWELALVSTPGTNLSTP  590
            +LLGLN PT D   ++E NALALAIVP          +    TGWELALV+ P +N +  
Sbjct  376  NLLGLNDPTPDTKELDEKNALALAIVPITDQPSMASTQTNGTTGWELALVTAPSSNETAT  435

Query  589  QERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFE-------VADPFAMSNAIAA  431
               +LAGGLD LTL+SLYD+   R SQ   Y    P P         V DPF+ S A+AA
Sbjct  436  ATSKLAGGLDKLTLDSLYDDAIRRNSQNVSYNPWEPAPVSGHMMQQPVPDPFSASRAVAA  495

Query  430  PPSVQLAPM  404
            P SVQ+A M
Sbjct  496  PHSVQMAAM  504



>ref|XP_002982426.1| hypothetical protein SELMODRAFT_268581 [Selaginella moellendorffii]
 gb|EFJ16671.1| hypothetical protein SELMODRAFT_268581 [Selaginella moellendorffii]
Length=553

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 91/180 (51%), Gaps = 21/180 (12%)
 Frame = -2

Query  799  PVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKD------FDPTG  638
            P+    FE++DLLGL       SA++ESNALALAIVPSG T+      +         TG
Sbjct  356  PIQSSAFESNDLLGLGEMAPSPSALDESNALALAIVPSGPTANGTSESNGAWAPQSGTTG  415

Query  637  WELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPV-------YGAP--A  485
            WELALV+ P +N +     +LAGG D LTL+SLYD+   R  QQ         YG P   
Sbjct  416  WELALVTNPSSNENAVSSSRLAGGFDKLTLDSLYDDALSRRPQQQYAGGAGTSYGGPPQM  475

Query  484  PNPFEVA--DPFAMSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPHNPFG  311
             NPF+    DPF  S   A PP+VQ+A M Q                Q  +   PHNPFG
Sbjct  476  MNPFDTMNHDPFMASGKFAPPPNVQMAAMAQHQQ----ALFLQQQQQQQMMSRNPHNPFG  531



>ref|XP_004297901.1| PREDICTED: putative clathrin assembly protein At5g57200 [Fragaria 
vesca subsp. vesca]
Length=582

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 86/145 (59%), Gaps = 16/145 (11%)
 Frame = -2

Query  793  PPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSET-VQPKDFDPT-GWELALV  620
            PP   ETD LLGLN      + IEE NALALAIVP G   ++     D   T GWELALV
Sbjct  369  PPPLIETD-LLGLNEINPRAAEIEERNALALAIVPEGTAPQSGSNLNDIGGTSGWELALV  427

Query  619  STPGTNLSTPQERQLAGGLDSLTLNSLY-DEGAYRASQQPV----YGAPA-PNPFE----  470
            +TP TN     +++LAGG D L L+SLY DEGA R  Q       YGA +  NPFE    
Sbjct  428  TTPSTNTGPVVDKKLAGGFDKLLLDSLYEDEGARRHLQLQNAGYGYGATSVQNPFEQAQQ  487

Query  469  ---VADPFAMSNAIAAPPSVQLAPM  404
               V DPFAMSN+IA P +VQ+A M
Sbjct  488  QQPVLDPFAMSNSIAPPTNVQMALM  512



>ref|XP_008391574.1| PREDICTED: LOW QUALITY PROTEIN: putative clathrin assembly protein 
At5g57200 [Malus domestica]
Length=579

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 81/135 (60%), Gaps = 15/135 (11%)
 Frame = -2

Query  778  ETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSET-VQPKDFDPT-GWELALVSTPGT  605
            E  DLLGL       + IEE NALALAIVP G   ++     DF  T GWELALV+TP  
Sbjct  375  EDTDLLGLREINPKAAEIEECNALALAIVPQGNXQKSGASFNDFAGTSGWELALVTTPSN  434

Query  604  NLS-TPQERQLAGGLDSLTLNSLY-DEGAYRASQQPV----YGAPA-PNPFE------VA  464
            + S  PQ+R+LAGG D+L LNSLY DEGA R  Q       YG  +  NPFE      V 
Sbjct  435  HTSQAPQDRKLAGGFDNLLLNSLYEDEGARRQLQLQNAGYGYGTTSLQNPFEQAAQQPVQ  494

Query  463  DPFAMSNAIAAPPSV  419
            DPFAMSN+IA P +V
Sbjct  495  DPFAMSNSIAPPTNV  509



>ref|XP_003542645.1| PREDICTED: putative clathrin assembly protein At5g35200-like 
[Glycine max]
Length=546

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 91/181 (50%), Gaps = 29/181 (16%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSE--TVQPKDFDPTGWELALVSTPGTNLS  596
            DLL L  P    + +EE NALALAIVP     +   V  +    TGWELALV+ P +N S
Sbjct  362  DLLNLEDPVPAAAELEEKNALALAIVPVAVEQQPSAVSNQANGTTGWELALVTAPSSNES  421

Query  595  TPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYG----APAPNPFE--VADPFAMSNAIA  434
                 +LAGGLD LTL+SLYD+   R +Q   Y     AP  N  +  + DPF  SN +A
Sbjct  422  ATTASKLAGGLDKLTLDSLYDDALRRNNQNVSYNPWEPAPGGNMMQPTMHDPFFASNTVA  481

Query  433  APPSVQLAPMPQP---------------------NPFGPFHPAAAAYPPQNPLMVGPHNP  317
            APPSVQ+A M                        NPFG  + A A +P  + + V  +NP
Sbjct  482  APPSVQMASMSNQQQAFMYQQQQQMMMAPQQQSVNPFGNPYGATAVHPYGSGMPVQSYNP  541

Query  316  F  314
            +
Sbjct  542  Y  542



>gb|KHN03612.1| Putative clathrin assembly protein [Glycine soja]
Length=546

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 91/181 (50%), Gaps = 29/181 (16%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSE--TVQPKDFDPTGWELALVSTPGTNLS  596
            DLL L  P    + +EE NALALAIVP     +   V  +    TGWELALV+ P +N S
Sbjct  362  DLLNLEDPVPAAAELEEKNALALAIVPVAVEQQPSAVSNQANGTTGWELALVTAPSSNES  421

Query  595  TPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYG----APAPNPFE--VADPFAMSNAIA  434
                 +LAGGLD LTL+SLYD+   R +Q   Y     AP  N  +  + DPF  SN +A
Sbjct  422  ATTASKLAGGLDKLTLDSLYDDALRRNNQNVSYNPWEPAPGGNMMQPTMHDPFFASNTVA  481

Query  433  APPSVQLAPMPQP---------------------NPFGPFHPAAAAYPPQNPLMVGPHNP  317
            APPSVQ+A M                        NPFG  + A A +P  + + V  +NP
Sbjct  482  APPSVQMASMSNQQQAFMYQQQQQMMMAPQQQSVNPFGNPYGATAVHPYGSGMPVQSYNP  541

Query  316  F  314
            +
Sbjct  542  Y  542



>ref|XP_009403215.1| PREDICTED: putative clathrin assembly protein At5g35200 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009403216.1| PREDICTED: putative clathrin assembly protein At5g35200 [Musa 
acuminata subsp. malaccensis]
Length=547

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 85/149 (57%), Gaps = 24/149 (16%)
 Frame = -2

Query  814  TEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVP-----SGATSETVQPKDF  650
             ++ APV  V  +TD LLGLN  T   S ++  NA+ALAIVP     S ATS ++ P++ 
Sbjct  348  VKVEAPVSVVSEQTD-LLGLNGATPVASELDNKNAMALAIVPVDNVPSSATSSSLNPEN-  405

Query  649  DPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFE  470
              TGWELALV+TP +N S     +L GG D LTL+SLYD+   RA+Q   Y     NP+E
Sbjct  406  GTTGWELALVTTPSSNESAVTSSKLGGGFDKLTLDSLYDDAERRANQNVSY-----NPWE  460

Query  469  ------------VADPFAMSNAIAAPPSV  419
                        V DPF  SNA+AAP  V
Sbjct  461  MGRMAGPMMQPVVHDPFYASNAVAAPHFV  489



>ref|XP_007013561.1| ENTH/ANTH/VHS superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31180.1| ENTH/ANTH/VHS superfamily protein isoform 1 [Theobroma cacao]
Length=538

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 88/166 (53%), Gaps = 20/166 (12%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD-PTGWELALVSTPGTNLST  593
            DLLGLN      S ++E NALALAIVP+   +    P   +  TGWELALV+ P +N S 
Sbjct  360  DLLGLNNSVPVASELDEKNALALAIVPAEQMTSAAAPVQTNGTTGWELALVTAPSSNDSA  419

Query  592  PQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVA-------DPFAMSNAIA  434
                +LAGGLD LTL+SLYD+   R++Q   Y    P P   A       DPF  SN + 
Sbjct  420  TAASKLAGGLDKLTLDSLYDDAIRRSNQSVTYNPWEPAPMSGAMMQQPAHDPFYASNMVP  479

Query  433  APPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPH----NPFGD  308
            APPSVQ+A M         +   A    Q  +M+GP     NPFG+
Sbjct  480  APPSVQMAAMA--------NQQQAFMLQQQVMMMGPQQQASNPFGN  517



>gb|EAZ37894.1| hypothetical protein OsJ_22244 [Oryza sativa Japonica Group]
Length=531

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 80/130 (62%), Gaps = 6/130 (5%)
 Frame = -2

Query  775  TDDLLGLNAPTS-DVSAIEESNALALAIVPSGATSETVQPKDF---DPTGWELALVSTPG  608
            T DLL  +   +  ++ IEESNALALAIV  G  ++    +D    D +GWELALV+ P 
Sbjct  328  TGDLLNFDEEVNPLIANIEESNALALAIVAPGNENKASASQDLFALDKSGWELALVTAPS  387

Query  607  TNLSTPQERQLAGGLDSLTLNSLYDEGAYR--ASQQPVYGAPAPNPFEVADPFAMSNAIA  434
            T+ S P + QLAGG D L L+SLY++ A R   +     G+ A NPF+  DPFAMSN  A
Sbjct  388  THTSRPVDNQLAGGFDKLLLDSLYEDEARRQQIASATYNGSVAGNPFDPNDPFAMSNNFA  447

Query  433  APPSVQLAPM  404
             P +VQLA M
Sbjct  448  PPSNVQLAMM  457



>ref|XP_007222299.1| hypothetical protein PRUPE_ppa003361mg [Prunus persica]
 gb|EMJ23498.1| hypothetical protein PRUPE_ppa003361mg [Prunus persica]
Length=581

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 102/205 (50%), Gaps = 43/205 (21%)
 Frame = -2

Query  808  IPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD----PT  641
            +  P P +  +  DLLGL       + IEESNALALAIVP G  +E      F+     +
Sbjct  364  VVEPPPLISTDDTDLLGLREINPKAAEIEESNALALAIVPQG--NEQQSGASFNDLAGTS  421

Query  640  GWELALVSTPGTNLS-TPQERQLAGGLDSLTLNSLY-DEGAYRASQQPV----YGAPA-P  482
            GWELALV+TP  + S  P +++ AGG D L L+SLY DEGA R  Q       YGA +  
Sbjct  422  GWELALVTTPSNHTSQVPMDKKFAGGFDKLLLDSLYEDEGARRQIQLQNAGYGYGATSLH  481

Query  481  NPFE------VADPFAMSNAIAAPPSVQLAPM-------------------PQPNPFGPF  377
            NPFE      V DPFAMSN IA P +VQ+A M                    Q N     
Sbjct  482  NPFEQQAQHPVQDPFAMSNNIAPPTNVQMALMAQQQHQHQQILQQQNQQYQQQQNMMMVP  541

Query  376  HPAAAAYPPQNPLMV--GPHNPFGD  308
            HP  + YP Q   M   G  NPFGD
Sbjct  542  HPYYSQYPQQ---MQPPGSSNPFGD  563



>ref|XP_007201932.1| hypothetical protein PRUPE_ppa003855mg [Prunus persica]
 gb|EMJ03131.1| hypothetical protein PRUPE_ppa003855mg [Prunus persica]
Length=544

 Score = 99.4 bits (246),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 76/132 (58%), Gaps = 12/132 (9%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD-PTGWELALVSTPGTNLST  593
            DLLGLN P  D   ++E NA+ALAIVP      +  P   +  TGWELALV+ P +N S 
Sbjct  359  DLLGLNDPVPDTKDLDEKNAMALAIVPVSDQPPSTAPIHANGTTGWELALVTAPSSNESA  418

Query  592  PQERQLAGGLDSLTLNSLYDEGAYRASQQ---------PVYGAPAPNPFEVADPFAMSNA  440
                +LAGGLD LTL+SLYD+   R  Q          PV GA    P  V DPF  SN 
Sbjct  419  TAASKLAGGLDLLTLDSLYDDAIRRNHQNVSYNPWEPVPVAGAMMQQP--VHDPFYASNT  476

Query  439  IAAPPSVQLAPM  404
            +AAPPSVQ+A M
Sbjct  477  MAAPPSVQMAAM  488



>ref|XP_002966589.1| hypothetical protein SELMODRAFT_230819 [Selaginella moellendorffii]
 gb|EFJ32616.1| hypothetical protein SELMODRAFT_230819 [Selaginella moellendorffii]
Length=547

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 88/174 (51%), Gaps = 23/174 (13%)
 Frame = -2

Query  799  PVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFDPTGWELALV  620
            P+    FE++DLLGL       SA++ESNALALAIVPS + +          TGWELALV
Sbjct  364  PIQSSAFESNDLLGLGEMAPSPSALDESNALALAIVPSESGT----------TGWELALV  413

Query  619  STPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPV-------YGAP--APNPFEV  467
            + P +N +     +LAGG D LTL+SLYD+   R  QQ         YG P    NPF+ 
Sbjct  414  TNPSSNENAVSSSRLAGGFDKLTLDSLYDDALSRRPQQQYAGGAGTSYGGPPQMMNPFDT  473

Query  466  A--DPFAMSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPHNPFG  311
               DPF  S   A PP+VQ+A M Q                   +   PHNPFG
Sbjct  474  MNHDPFMASGKFAPPPNVQMAAMAQHQQALFLQQQQQQQQQM--MSRNPHNPFG  525



>ref|XP_008242823.1| PREDICTED: putative clathrin assembly protein At5g35200 [Prunus 
mume]
 ref|XP_008242824.1| PREDICTED: putative clathrin assembly protein At5g35200 [Prunus 
mume]
Length=544

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 76/132 (58%), Gaps = 12/132 (9%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD-PTGWELALVSTPGTNLST  593
            DLLGLN P  D   ++E NA+ALAIVP      +  P   +  TGWELALV+ P +N S 
Sbjct  359  DLLGLNDPVPDTKDLDEKNAMALAIVPVSDQPPSTAPIHANGTTGWELALVTAPSSNESA  418

Query  592  PQERQLAGGLDSLTLNSLYDEGAYRASQQ---------PVYGAPAPNPFEVADPFAMSNA  440
                +LAGGLD LTL+SLYD+   R  Q          PV GA    P  V DPF  SN 
Sbjct  419  TAASKLAGGLDLLTLDSLYDDAIRRNHQNVSYNPWEPVPVAGAMMQQP--VHDPFYASNT  476

Query  439  IAAPPSVQLAPM  404
            +AAPPSVQ+A M
Sbjct  477  MAAPPSVQMAAM  488



>dbj|BAD46420.1| phosphoprotein-like [Oryza sativa Japonica Group]
Length=577

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 80/130 (62%), Gaps = 6/130 (5%)
 Frame = -2

Query  775  TDDLLGLNAPTS-DVSAIEESNALALAIVPSGATSETVQPKDF---DPTGWELALVSTPG  608
            T DLL  +   +  ++ IEESNALALAIV  G  ++    +D    D +GWELALV+ P 
Sbjct  374  TGDLLNFDEEVNPLIANIEESNALALAIVAPGNENKASASQDLFALDKSGWELALVTAPS  433

Query  607  TNLSTPQERQLAGGLDSLTLNSLYDEGAYR--ASQQPVYGAPAPNPFEVADPFAMSNAIA  434
            T+ S P + QLAGG D L L+SLY++ A R   +     G+ A NPF+  DPFAMSN  A
Sbjct  434  THTSRPVDNQLAGGFDKLLLDSLYEDEARRQQIASATYNGSVAGNPFDPNDPFAMSNNFA  493

Query  433  APPSVQLAPM  404
             P +VQLA M
Sbjct  494  PPSNVQLAMM  503



>ref|XP_009359933.1| PREDICTED: putative clathrin assembly protein At5g57200 [Pyrus 
x bretschneideri]
Length=581

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 83/137 (61%), Gaps = 15/137 (11%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSE-TVQPKDFDPT-GWELALVSTPGTNLS  596
            DLLGL       + IEESNALALAIVP G   +      DF  T GWELALV+TP  + S
Sbjct  377  DLLGLREINPKAAEIEESNALALAIVPQGNEQKPGACFNDFAGTSGWELALVTTPSNHTS  436

Query  595  T-PQERQLAGGLDSLTLNSLY-DEGAYRASQQPV----YGAPA-PNPFE------VADPF  455
              P +R+LAGG D L L+SLY DEGA R  Q       YGA +  NPFE      V DPF
Sbjct  437  QAPIDRKLAGGFDKLLLDSLYEDEGARRQLQLQNAGYGYGATSLQNPFEQQTQQPVHDPF  496

Query  454  AMSNAIAAPPSVQLAPM  404
            A+SN++A P +VQ+A M
Sbjct  497  AVSNSVAPPTNVQMALM  513



>ref|XP_002437410.1| hypothetical protein SORBIDRAFT_10g026380 [Sorghum bicolor]
 gb|EER88777.1| hypothetical protein SORBIDRAFT_10g026380 [Sorghum bicolor]
Length=279

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 79/132 (60%), Gaps = 6/132 (5%)
 Frame = -2

Query  775  TDDLLGLNAPTS-DVSAIEESNALALAIVPSGATSETVQPKDF---DPTGWELALVSTPG  608
            T DLL L+   +  ++ +EESNALALAIV  G  ++    +D    D  GWELALV+ P 
Sbjct  74   TGDLLNLDEEVNPMIADLEESNALALAIVAPGNENKMSNSRDLFALDKAGWELALVTAPS  133

Query  607  TNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPV--YGAPAPNPFEVADPFAMSNAIA  434
             + +   + QLAGG D L L+SLY++ A R     V   G+ A NPF  +DPFA SN+ A
Sbjct  134  NHTNQQVDNQLAGGFDKLLLDSLYEDEARRQQIASVTYTGSLAANPFATSDPFATSNSFA  193

Query  433  APPSVQLAPMPQ  398
             P +VQLA M +
Sbjct  194  PPSNVQLAMMAE  205



>ref|XP_006656326.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Oryza brachyantha]
Length=575

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 84/146 (58%), Gaps = 11/146 (8%)
 Frame = -2

Query  823  VSTTEIPAPVPPVKFETDDLLGLNAPTS-DVSAIEESNALALAIVPSGATSETVQPKDF-  650
            V  TE P PV      T DLL  +      ++ IEESNALALAIV  G  ++     D  
Sbjct  363  VEETE-PVPVAT----TGDLLNFDEEVKPLIADIEESNALALAIVAPGNENKASTSHDLF  417

Query  649  --DPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYR--ASQQPVYGAPAP  482
              D +GWELALV+ P T+ S P + QLAGG D L L+SLY++ A R   +     G+ A 
Sbjct  418  ALDKSGWELALVTAPSTHTSQPVDNQLAGGFDKLLLDSLYEDEARRQQIASATYTGSLAG  477

Query  481  NPFEVADPFAMSNAIAAPPSVQLAPM  404
            NPF+  DPFAMSN  A P +VQLA M
Sbjct  478  NPFDPNDPFAMSNNFAPPSNVQLAMM  503



>ref|XP_002324695.1| clathrin assembly family protein [Populus trichocarpa]
 gb|EEF03260.1| clathrin assembly family protein [Populus trichocarpa]
Length=580

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 79/133 (59%), Gaps = 17/133 (13%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVP--------SGATSETVQPKDFDPTGWELALV  620
            T DLLGLN      + +EESNALALAIVP        S A SE  +P   + TGWELALV
Sbjct  373  TGDLLGLNEINPKAAELEESNALALAIVPPGADPLSSSNALSELGKP---NATGWELALV  429

Query  619  STPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPV-----YGAPA-PNPFEVADP  458
            +TP    S P + ++ GG D L L+SLY++ A R   Q       YGA A  NPFE  DP
Sbjct  430  TTPSNPTSQPAQNKMGGGFDRLLLDSLYEDDAARRQIQLQNAGYGYGATAMNNPFEQPDP  489

Query  457  FAMSNAIAAPPSV  419
            FAMSN+IA P +V
Sbjct  490  FAMSNSIAPPTNV  502



>ref|XP_011017657.1| PREDICTED: putative clathrin assembly protein At5g57200 [Populus 
euphratica]
Length=580

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 79/133 (59%), Gaps = 17/133 (13%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVP--------SGATSETVQPKDFDPTGWELALV  620
            T DLLGLN      + +EESNALALAIVP        S A SE  +P   + TGWELALV
Sbjct  373  TGDLLGLNEINPKAAELEESNALALAIVPPGADPLSSSKALSELGKP---NATGWELALV  429

Query  619  STPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPV-----YGAPA-PNPFEVADP  458
            +TP    S P + ++ GG D L L+SLY++ A R   Q       YGA A  NPFE  DP
Sbjct  430  TTPSNPTSQPAQNKMGGGFDRLLLDSLYEDDAARRQIQLQNAGYGYGATAMNNPFEQPDP  489

Query  457  FAMSNAIAAPPSV  419
            FAMSN+IA P +V
Sbjct  490  FAMSNSIAPPTNV  502



>ref|XP_004287277.1| PREDICTED: putative clathrin assembly protein At5g35200 [Fragaria 
vesca subsp. vesca]
Length=543

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 78/129 (60%), Gaps = 19/129 (15%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFDPTGWELALVSTPGTNLSTP  590
            DLLGLN P  D +A++E NA+ALAIVP  +   T QP+  + TGWELALV+ P +N S  
Sbjct  361  DLLGLNDPVPDTAALDEKNAMALAIVPV-SDQPTAQPQA-NGTGWELALVTAPSSNESAT  418

Query  589  QERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFE------------VADPFAMS  446
               +LAGGLD LTL+SLYD+   R +Q   Y     NP+E            + DPF  S
Sbjct  419  AASKLAGGLDLLTLDSLYDDAIRRNNQNVSY-----NPWEQGPMNGGMMQQPIHDPFYAS  473

Query  445  NAIAAPPSV  419
            N +AAPPSV
Sbjct  474  NTVAAPPSV  482



>ref|XP_003549739.1| PREDICTED: putative clathrin assembly protein At5g35200-like 
isoform X1 [Glycine max]
 ref|XP_006600736.1| PREDICTED: putative clathrin assembly protein At5g35200-like 
isoform X2 [Glycine max]
 gb|KHN15052.1| Putative clathrin assembly protein [Glycine soja]
Length=548

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 91/183 (50%), Gaps = 31/183 (17%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSE--TVQPKDFDPTGWELALVSTPGTNLS  596
            DLL L  P    + +EE NALALAIVP     +      +    TGWELALV+ P +N +
Sbjct  362  DLLNLEDPVPAAAELEEKNALALAIVPVAVEQQPSAASNQANGTTGWELALVTAPSSNET  421

Query  595  TPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYG----APAPNPFE--VADPFAMSNAIA  434
                 +LAGGLD LTL+SLYD+   R +Q   Y     AP  N  +  + DPF  SN +A
Sbjct  422  ATAASKLAGGLDKLTLDSLYDDALRRNNQNVSYNPWEPAPGGNMMQPTMHDPFFASNTVA  481

Query  433  APPSVQLAPMPQP-----------------------NPFGPFHPAAAAYPPQNPLMVGPH  323
            APPSVQ+A M                          NPFG  + AAA +P  + + V  +
Sbjct  482  APPSVQMAAMSNQQQTFMFQHQQQQQMMMPPQQQSVNPFGNPYGAAAVHPYGSGMPVQSY  541

Query  322  NPF  314
            NP+
Sbjct  542  NPY  544



>gb|EYU34970.1| hypothetical protein MIMGU_mgv1a003922mg [Erythranthe guttata]
Length=555

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 81/145 (56%), Gaps = 18/145 (12%)
 Frame = -2

Query  796  VPPVKFETD------DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFDPTGW  635
            V PVK E        DLLGLN P    S ++E N+LALAI+P+     TVQ      TGW
Sbjct  351  VEPVKVEAPASEPPPDLLGLNEPLPAASELDEKNSLALAIIPAEQPGSTVQNLKNGATGW  410

Query  634  ELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVA---  464
            ELALV+ P +  S     +LAGG D LTL+SLYD+   R +Q  V    + NP+E     
Sbjct  411  ELALVTAPSSADSATAASKLAGGFDILTLDSLYDDAIRRTNQNNV----SYNPWEQQQQT  466

Query  463  -----DPFAMSNAIAAPPSVQLAPM  404
                 DPF  SN +AAPPSVQLA M
Sbjct  467  TMMPHDPFYASNGVAAPPSVQLAAM  491



>ref|XP_006403061.1| hypothetical protein EUTSA_v10003447mg [Eutrema salsugineum]
 ref|XP_006403062.1| hypothetical protein EUTSA_v10003447mg [Eutrema salsugineum]
 gb|ESQ44514.1| hypothetical protein EUTSA_v10003447mg [Eutrema salsugineum]
 gb|ESQ44515.1| hypothetical protein EUTSA_v10003447mg [Eutrema salsugineum]
Length=543

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 78/212 (37%), Positives = 100/212 (47%), Gaps = 46/212 (22%)
 Frame = -2

Query  811  EIPAPVPPVKFETD-------DLLGLNAPTSDVSAIEESNALALAIVPSGAT--SETVQP  659
            E PA   PVK E +       DLL ++ P   VS +EE NAL LAIVP      + T+  
Sbjct  335  EKPASPEPVKVEAEKPVEKQPDLLSMDDPAPVVSELEEKNALVLAIVPVSVEPPASTIDI  394

Query  658  KDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPN  479
             + + TGWELALV+ P +N       +LAGGLD LTL+SLY E A RASQQ      + N
Sbjct  395  TNGNSTGWELALVTAPSSNEGVAANSKLAGGLDKLTLDSLY-EDAIRASQQQ---NRSHN  450

Query  478  PFE---------VADPFAMSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGP  326
            P+E         +  PF  SN +AAP SVQ+A           H         + +M+GP
Sbjct  451  PWEQYPVHNGPMMQHPFFASNGVAAPHSVQMA--------NQNHQTYVFQHQNSGIMMGP  502

Query  325  HNPFGDTgfgafpanngaaagAHQQNTNPFGS  230
              P+                   QQN N FG+
Sbjct  503  VQPY----------------QHQQQNMNRFGN  518



>ref|XP_008794954.1| PREDICTED: putative clathrin assembly protein At5g35200 [Phoenix 
dactylifera]
Length=547

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 83/152 (55%), Gaps = 35/152 (23%)
 Frame = -2

Query  811  EIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVP---------SGATSETVQP  659
            ++ APV     E  DLLGLN  + D S +E+ NALALAIVP         SG+ S     
Sbjct  349  KVEAPVS----EQTDLLGLNDTSPDTSELEKQNALALAIVPVDTVPAAAPSGSLSS----  400

Query  658  KDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPN  479
             +   TGWELAL++TP +N S     QLAGGLD LTL+SLY +   RA+Q   Y     N
Sbjct  401  -ENGTTGWELALITTPSSNESAVASSQLAGGLDRLTLDSLYADADRRANQNTSY-----N  454

Query  478  PFE------------VADPFAMSNAIAAPPSV  419
            P+E            V DPF  SNAIAAP SV
Sbjct  455  PWETTPMAGPVMQPVVHDPFYASNAIAAPHSV  486



>ref|XP_007014413.1| ENTH/ANTH/VHS superfamily protein [Theobroma cacao]
 gb|EOY32032.1| ENTH/ANTH/VHS superfamily protein [Theobroma cacao]
Length=572

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 77/137 (56%), Gaps = 11/137 (8%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFDPTGWELALVSTPGTNLS  596
            T DLLGLN        +EESNALALAIVP G  S      +   TGWELALV+TP ++ +
Sbjct  378  TRDLLGLNEINPRALELEESNALALAIVPPGTDSRNHGISEIGGTGWELALVTTPSSHTA  437

Query  595  TPQERQLAGGLDSLTLNSLY-DEGAYRASQ---------QPVYGAPAPNPFEVA-DPFAM  449
               E +LAGG D L L+SLY DE A R  Q             G   PNPF+   DPF +
Sbjct  438  PVVESKLAGGFDKLLLDSLYEDEAARRQIQLTNAGYGYGYGYEGMAVPNPFQQQHDPFML  497

Query  448  SNAIAAPPSVQLAPMPQ  398
            SN IA P +VQ+A + +
Sbjct  498  SNNIAPPTNVQMALLQE  514



>ref|XP_002453380.1| hypothetical protein SORBIDRAFT_04g005060 [Sorghum bicolor]
 gb|EES06356.1| hypothetical protein SORBIDRAFT_04g005060 [Sorghum bicolor]
Length=570

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 80/132 (61%), Gaps = 8/132 (6%)
 Frame = -2

Query  775  TDDLLGLNAPTS-DVSAIEESNALALAIVPSGATSETVQPKDFD--PTGWELALVSTPGT  605
            T DLL L+A  +  V+ +EESNALALAI+  G    +V    FD   +GWELALV+ P T
Sbjct  364  TGDLLNLDAEVNPSVAELEESNALALAIIAPGDCKASVSQSMFDVNSSGWELALVTAPST  423

Query  604  NLSTPQERQLAGGLDSLTLNSLYDEGAYR---ASQQPVYGAPAPNPFEV--ADPFAMSNA  440
            + S   +  LAGG D L L+SLY++GA R   AS        A NPF V   DPFAMS++
Sbjct  424  HTSQAVQTNLAGGFDKLLLDSLYEDGARRQQIASVTYTGSLGAANPFSVNGNDPFAMSSS  483

Query  439  IAAPPSVQLAPM  404
             A P +VQLA M
Sbjct  484  FAPPANVQLALM  495



>ref|XP_008443941.1| PREDICTED: putative clathrin assembly protein At5g35200 isoform 
X1 [Cucumis melo]
Length=433

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 77/134 (57%), Gaps = 12/134 (9%)
 Frame = -2

Query  769  DLLGLNAPTSDV-SAIEESNALALAIVPSGATSETVQPKDFD---PTGWELALVSTPGTN  602
            DLLGLN P  +V S ++E N+LALAIVP      +  P   +    TGWELALV+ P +N
Sbjct  244  DLLGLNDPVPEVTSNLDEKNSLALAIVPVADQQTSSAPSQVNGTTTTGWELALVTAPSSN  303

Query  601  LSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFE--------VADPFAMS  446
             S     +LAGGLD LTL+SLYD+   R +Q   Y    P P          + DPF  S
Sbjct  304  ESVAATSKLAGGLDLLTLDSLYDDAIRRNNQNASYNPWEPVPMHGAMMQQQPIHDPFFAS  363

Query  445  NAIAAPPSVQLAPM  404
            +A+AAP SVQ+A M
Sbjct  364  SAVAAPHSVQMAAM  377



>ref|XP_006597797.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Glycine max]
Length=595

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 77/132 (58%), Gaps = 13/132 (10%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD-PTGWELALVSTPGTNL  599
            T+DLLGLN        +EESNA+ALAIVP G     +   +FD  TGWEL+LV+TP  + 
Sbjct  381  TNDLLGLNEINPKAMELEESNAMALAIVPPGNNPNNLALSNFDGTTGWELSLVTTPSNHS  440

Query  598  STPQERQLAGGLDSLTLNSLY-DEGAYR--ASQQPVYGAPAP------NPFE---VADPF  455
            S   +R+LAGG D L L+SLY DE A R    Q   YG          NPF+     DPF
Sbjct  441  SQAPDRRLAGGFDKLLLDSLYEDENARRQLQLQNAGYGHSGTMDIQNNNPFDHYNQQDPF  500

Query  454  AMSNAIAAPPSV  419
            AMSN IA PPSV
Sbjct  501  AMSNNIAPPPSV  512



>gb|KJB64693.1| hypothetical protein B456_010G060800 [Gossypium raimondii]
Length=385

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 73/131 (56%), Gaps = 9/131 (7%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD--PTGWELALVSTPGTNLS  596
            DLLGLN P    S ++E NALALAIVP    +            TGWELALV+ P +N +
Sbjct  196  DLLGLNDPVPVASELDEKNALALAIVPVAEQTTAAAAPIPANGTTGWELALVTAPSSNEN  255

Query  595  TPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVA-------DPFAMSNAI  437
                 +LAGGLD LTL+SLYD+   R++Q   Y    P P   A       DPF  SN +
Sbjct  256  ATAASKLAGGLDKLTLDSLYDDAIRRSNQNVSYNPWEPAPMSGAMMQQPMHDPFYASNMV  315

Query  436  AAPPSVQLAPM  404
            AAP SVQ+A M
Sbjct  316  AAPHSVQIAAM  326



>ref|XP_008385249.1| PREDICTED: putative clathrin assembly protein At5g35200 [Malus 
domestica]
Length=549

 Score = 96.7 bits (239),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 85/152 (56%), Gaps = 16/152 (11%)
 Frame = -2

Query  829  VAVSTTEIPAPV--PPVKFETDDLLGLNAPTSDVSAIEESNALALAIVP-SGATSETVQP  659
            V V   ++ APV  PP      DLLGLN P  +   +++ NALALAIVP S   + T   
Sbjct  342  VKVEPVKVEAPVAEPP------DLLGLNDPVPNTKELDDKNALALAIVPVSDQPTSTAPT  395

Query  658  KDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPN  479
             +   TGWELALV+ P +N S     +LAGGLD LTL+SLYD+   R +Q   Y    P 
Sbjct  396  LENGATGWELALVTAPSSNESAVASSKLAGGLDLLTLDSLYDDAIRRNNQNVSYNPWEPA  455

Query  478  PF-------EVADPFAMSNAIAAPPSVQLAPM  404
            P        ++ DPF  SN +AAP SVQ+A M
Sbjct  456  PVNGTMMQQQLHDPFYASNGMAAPHSVQMAAM  487



>ref|XP_008361112.1| PREDICTED: putative clathrin assembly protein At5g35200 [Malus 
domestica]
 ref|XP_008361113.1| PREDICTED: putative clathrin assembly protein At5g35200 [Malus 
domestica]
Length=545

 Score = 96.3 bits (238),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 82/146 (56%), Gaps = 17/146 (12%)
 Frame = -2

Query  796  VPPVKFETD-----DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD-PTGW  635
            V PVK E       DLLGLN P  +   +++ NALALAIVP      +  P   +  TGW
Sbjct  344  VEPVKVEAPVAEPPDLLGLNDPVPNTKELDDKNALALAIVPVSDQPTSTAPTLANGATGW  403

Query  634  ELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQ---------PVYGAPAP  482
            ELALV+ P +N S     +LAGGLD LTL+SLYD+   R++Q          P+ GA   
Sbjct  404  ELALVTAPSSNESAVASSKLAGGLDLLTLDSLYDDAIRRSNQNVSHNPWEPAPMTGAMMQ  463

Query  481  NPFEVADPFAMSNAIAAPPSVQLAPM  404
             P  V DPF  SN +AAP SVQ+A M
Sbjct  464  QP--VHDPFYASNRMAAPHSVQMAAM  487



>ref|XP_008443942.1| PREDICTED: putative clathrin assembly protein At5g35200 isoform 
X2 [Cucumis melo]
Length=555

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 77/134 (57%), Gaps = 12/134 (9%)
 Frame = -2

Query  769  DLLGLNAPTSDV-SAIEESNALALAIVPSGATSETVQPKDFD---PTGWELALVSTPGTN  602
            DLLGLN P  +V S ++E N+LALAIVP      +  P   +    TGWELALV+ P +N
Sbjct  366  DLLGLNDPVPEVTSNLDEKNSLALAIVPVADQQTSSAPSQVNGTTTTGWELALVTAPSSN  425

Query  601  LSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFE--------VADPFAMS  446
             S     +LAGGLD LTL+SLYD+   R +Q   Y    P P          + DPF  S
Sbjct  426  ESVAATSKLAGGLDLLTLDSLYDDAIRRNNQNASYNPWEPVPMHGAMMQQQPIHDPFFAS  485

Query  445  NAIAAPPSVQLAPM  404
            +A+AAP SVQ+A M
Sbjct  486  SAVAAPHSVQMAAM  499



>ref|NP_001151036.1| clathrin assembly protein [Zea mays]
 gb|ACG41378.1| clathrin assembly protein [Zea mays]
Length=575

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 80/132 (61%), Gaps = 6/132 (5%)
 Frame = -2

Query  775  TDDLLGLNAPTS-DVSAIEESNALALAIVPSGATSETVQPKDF---DPTGWELALVSTPG  608
            T +LL L+   +  ++ +E SNALALAIV  G  ++    +D    D TGWELALV+ P 
Sbjct  375  TGNLLNLDEEVNPMIADLEASNALALAIVAPGNENKMATSQDLFALDKTGWELALVTAPS  434

Query  607  TNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPV--YGAPAPNPFEVADPFAMSNAIA  434
             + +   + QLAGG D L L+SLY++ A R     V   G+ A NPF+  DPFAMSN+ A
Sbjct  435  NHTNQQVDNQLAGGFDKLLLDSLYEDEARRQQIASVTYTGSTAANPFDHNDPFAMSNSFA  494

Query  433  APPSVQLAPMPQ  398
             P +VQLA M +
Sbjct  495  PPSNVQLAMMAE  506



>ref|XP_006586993.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Glycine max]
Length=596

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 91/201 (45%), Gaps = 54/201 (27%)
 Frame = -2

Query  772  DDLLGLNAPTSDVSAIEESNALALAIVPSGATS-ETVQPKDFDPT-GWELALVSTPGTNL  599
            DDLLGLN     V  +EESNA+ALAIVPSG  +   +   + D T GWEL+LV+ P  + 
Sbjct  383  DDLLGLNEINPKVMELEESNAMALAIVPSGGNNPNNLALSNIDGTIGWELSLVTAPSNHS  442

Query  598  STPQERQLAGGLDSLTLNSLY-DEGAYR--ASQQPVYGAPAP-----NPFE---VADPFA  452
            S   +R++AGG D L L+SLY DE A R    Q   YG         NPF+     DPFA
Sbjct  443  SQAPDRRMAGGFDKLLLDSLYEDENARRQLQLQNAGYGHGGTMDIHNNPFDHYNQHDPFA  502

Query  451  MSNAIAAPPSV---------------------------------QLAPMPQPNPFGPFHP  371
            MSN IA PPSV                                  + P  Q  P+  F  
Sbjct  503  MSNNIAPPPSVQMALMSQQQQQQQMVFQQQQMMYQQPQQHNNNMMMVPHQQQQPYNQF--  560

Query  370  AAAAYPPQNPLMVGPHNPFGD  308
                  P      G HNPFGD
Sbjct  561  ------PHQMQNSGSHNPFGD  575



>gb|KHN35810.1| Putative clathrin assembly protein [Glycine soja]
Length=593

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 91/201 (45%), Gaps = 54/201 (27%)
 Frame = -2

Query  772  DDLLGLNAPTSDVSAIEESNALALAIVPSGATS-ETVQPKDFDPT-GWELALVSTPGTNL  599
            DDLLGLN     V  +EESNA+ALAIVPSG  +   +   + D T GWEL+LV+ P  + 
Sbjct  380  DDLLGLNEINPKVMELEESNAMALAIVPSGGNNPNNLALSNIDGTIGWELSLVTAPSNHS  439

Query  598  STPQERQLAGGLDSLTLNSLY-DEGAYR--ASQQPVYGAPAP-----NPFE---VADPFA  452
            S   +R++AGG D L L+SLY DE A R    Q   YG         NPF+     DPFA
Sbjct  440  SQAPDRRMAGGFDKLLLDSLYEDENARRQLQLQNAGYGHGGTMDIHNNPFDHYNQHDPFA  499

Query  451  MSNAIAAPPSV---------------------------------QLAPMPQPNPFGPFHP  371
            MSN IA PPSV                                  + P  Q  P+  F  
Sbjct  500  MSNNIAPPPSVQMALMSQQQQQQQMVFQQQQMMYQQPQQHNNNMMMVPHQQQQPYNQF--  557

Query  370  AAAAYPPQNPLMVGPHNPFGD  308
                  P      G HNPFGD
Sbjct  558  ------PHQMQNSGSHNPFGD  572



>ref|XP_009340644.1| PREDICTED: putative clathrin assembly protein At5g35200 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009340659.1| PREDICTED: putative clathrin assembly protein At5g35200 [Pyrus 
x bretschneideri]
 ref|XP_009340660.1| PREDICTED: putative clathrin assembly protein At5g35200 [Pyrus 
x bretschneideri]
 ref|XP_009340661.1| PREDICTED: putative clathrin assembly protein At5g35200 [Pyrus 
x bretschneideri]
Length=544

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 78/132 (59%), Gaps = 12/132 (9%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD-PTGWELALVSTPGTNLST  593
            DLLGLN P  +   +++ NALALAIVP      ++ P   +  TGWELALV+ P +N S 
Sbjct  358  DLLGLNDPVPNTKELDDKNALALAIVPVSDQPTSMAPTLANGATGWELALVTAPSSNESA  417

Query  592  PQERQLAGGLDSLTLNSLYDEGAYRASQQ---------PVYGAPAPNPFEVADPFAMSNA  440
                +LAGGLD LTL+SLYD+   R++Q          P+ GA    P  V DPF  SN 
Sbjct  418  VASSKLAGGLDLLTLDSLYDDAIRRSNQNVSHNPWEPAPMTGAMIQQP--VHDPFYASNR  475

Query  439  IAAPPSVQLAPM  404
            +AAP SVQ+A M
Sbjct  476  MAAPHSVQMAAM  487



>ref|XP_009340645.1| PREDICTED: putative clathrin assembly protein At5g35200 isoform 
X2 [Pyrus x bretschneideri]
Length=549

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 78/132 (59%), Gaps = 12/132 (9%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD-PTGWELALVSTPGTNLST  593
            DLLGLN P  +   +++ NALALAIVP      ++ P   +  TGWELALV+ P +N S 
Sbjct  358  DLLGLNDPVPNTKELDDKNALALAIVPVSDQPTSMAPTLANGATGWELALVTAPSSNESA  417

Query  592  PQERQLAGGLDSLTLNSLYDEGAYRASQQ---------PVYGAPAPNPFEVADPFAMSNA  440
                +LAGGLD LTL+SLYD+   R++Q          P+ GA    P  V DPF  SN 
Sbjct  418  VASSKLAGGLDLLTLDSLYDDAIRRSNQNVSHNPWEPAPMTGAMIQQP--VHDPFYASNR  475

Query  439  IAAPPSVQLAPM  404
            +AAP SVQ+A M
Sbjct  476  MAAPHSVQMAAM  487



>ref|XP_010906894.1| PREDICTED: putative clathrin assembly protein At5g35200 [Elaeis 
guineensis]
Length=547

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 75/142 (53%), Gaps = 33/142 (23%)
 Frame = -2

Query  778  ETDDLLGLNAPTSDVSAIEESNALALAIVP----------SGATSETVQPKDFDPTGWEL  629
            E  DLLGLN  + D S +E  NALALAIVP           G +SE         TGWEL
Sbjct  356  EQTDLLGLNETSPDTSELENKNALALAIVPVDTVPTTAPSGGLSSEN------GTTGWEL  409

Query  628  ALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFE-------  470
            ALV+ P +N S     +L GGLD LTL+SLYD+   RA+Q   Y     NP+E       
Sbjct  410  ALVTAPSSNESAVASSKLGGGLDKLTLDSLYDDADRRANQNTSY-----NPWEMTSMAGP  464

Query  469  -----VADPFAMSNAIAAPPSV  419
                 V DPF  SNAIAAP SV
Sbjct  465  VMQPVVHDPFYASNAIAAPHSV  486



>gb|KJB64695.1| hypothetical protein B456_010G060800 [Gossypium raimondii]
Length=425

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 73/131 (56%), Gaps = 9/131 (7%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD--PTGWELALVSTPGTNLS  596
            DLLGLN P    S ++E NALALAIVP    +            TGWELALV+ P +N +
Sbjct  236  DLLGLNDPVPVASELDEKNALALAIVPVAEQTTAAAAPIPANGTTGWELALVTAPSSNEN  295

Query  595  TPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFE-------VADPFAMSNAI  437
                 +LAGGLD LTL+SLYD+   R++Q   Y    P P         + DPF  SN +
Sbjct  296  ATAASKLAGGLDKLTLDSLYDDAIRRSNQNVSYNPWEPAPMSGAMMQQPMHDPFYASNMV  355

Query  436  AAPPSVQLAPM  404
            AAP SVQ+A M
Sbjct  356  AAPHSVQIAAM  366



>ref|XP_009363972.1| PREDICTED: putative clathrin assembly protein At5g35200 [Pyrus 
x bretschneideri]
Length=548

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 80/145 (55%), Gaps = 13/145 (9%)
 Frame = -2

Query  799  PVPPVKFETD-----DLLGLNAPTSDVSAIEESNALALAIVP-SGATSETVQPKDFDPTG  638
             V PVK E       DLLGLN P  +   +++ NALALAIVP S   + T    +   TG
Sbjct  343  KVEPVKVEAPVAEPPDLLGLNDPVPNTRELDDKNALALAIVPVSDQPTSTAPTLENGATG  402

Query  637  WELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVA--  464
            WELALV+ P +N S     +LAGGLD LTL+SLYD+   R +Q   Y    P P   A  
Sbjct  403  WELALVTAPSSNESAVASSKLAGGLDLLTLDSLYDDAIRRNNQNVSYNPWEPAPVNGAMM  462

Query  463  -----DPFAMSNAIAAPPSVQLAPM  404
                 DPF  SN +AAP SVQ+A M
Sbjct  463  QQPPHDPFYASNRMAAPHSVQMAAM  487



>ref|XP_002285448.2| PREDICTED: putative clathrin assembly protein At5g35200 [Vitis 
vinifera]
 ref|XP_003633084.1| PREDICTED: putative clathrin assembly protein At5g35200 [Vitis 
vinifera]
Length=555

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 82/145 (57%), Gaps = 14/145 (10%)
 Frame = -2

Query  814  TEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD-PTG  638
             E+P   PP      DLLGL+ P  + + ++E NA+ALAIVP   T  +  P   +  TG
Sbjct  355  VEMPVVEPP------DLLGLDDPIPNTAELDEKNAMALAIVPVAETPPSAGPNPANGTTG  408

Query  637  WELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPF-----  473
            WELALV+ P +N +     +LAGGLD LTL+SLYD+   R +Q   Y    P P      
Sbjct  409  WELALVTAPSSNENATAASKLAGGLDMLTLDSLYDDAIRRNNQNVSYNPWQPVPMGGPMM  468

Query  472  --EVADPFAMSNAIAAPPSVQLAPM  404
                 DPF  SNA+AAPP+VQ+A M
Sbjct  469  QQTAHDPFFASNAVAAPPNVQMAAM  493



>ref|XP_009400569.1| PREDICTED: putative clathrin assembly protein At5g57200 [Musa 
acuminata subsp. malaccensis]
Length=585

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 75/127 (59%), Gaps = 5/127 (4%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDF---DPTGWELALVSTPGTNL  599
            DLLGL+      + +E+SNALALAI+  G  ++     D    D +GWELALV+T  +N 
Sbjct  387  DLLGLDEINPVAAELEQSNALALAIISPGDDTKPSSTHDLFGTDSSGWELALVTTASSNT  446

Query  598  STPQERQLAGGLDSLTLNSLYDEGAYRASQQPVY--GAPAPNPFEVADPFAMSNAIAAPP  425
            S   E +LAGG D L L SLY++ A        Y  G    NP +  DPFAMSN+IA PP
Sbjct  447  SQLVESKLAGGFDRLLLESLYEDSARSQQIAGAYSSGGLDANPSDYNDPFAMSNSIAPPP  506

Query  424  SVQLAPM  404
            SVQ+A M
Sbjct  507  SVQMALM  513



>emb|CBI28256.3| unnamed protein product [Vitis vinifera]
Length=505

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 82/145 (57%), Gaps = 14/145 (10%)
 Frame = -2

Query  814  TEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD-PTG  638
             E+P   PP      DLLGL+ P  + + ++E NA+ALAIVP   T  +  P   +  TG
Sbjct  355  VEMPVVEPP------DLLGLDDPIPNTAELDEKNAMALAIVPVAETPPSAGPNPANGTTG  408

Query  637  WELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPF-----  473
            WELALV+ P +N +     +LAGGLD LTL+SLYD+   R +Q   Y    P P      
Sbjct  409  WELALVTAPSSNENATAASKLAGGLDMLTLDSLYDDAIRRNNQNVSYNPWQPVPMGGPMM  468

Query  472  --EVADPFAMSNAIAAPPSVQLAPM  404
                 DPF  SNA+AAPP+VQ+A M
Sbjct  469  QQTAHDPFFASNAVAAPPNVQMAAM  493



>gb|KJB53729.1| hypothetical protein B456_009G002600 [Gossypium raimondii]
Length=564

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 96/181 (53%), Gaps = 18/181 (10%)
 Frame = -2

Query  808  IPAPVPPVKFE-TDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQP-KDFDPTGW  635
            +  P P V  + TDDLLGLN        +EESNALALAIVPSG  S T +   +   TGW
Sbjct  369  VKEPQPLVSLDSTDDLLGLNEINPRALELEESNALALAIVPSGNESTTNRGLNEISGTGW  428

Query  634  ELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPV-------YGA--PAP  482
            ELALV+ P  + + P E +L GG D L L+SLY++ A R   Q         YG+     
Sbjct  429  ELALVTAPSNHTAPPVESKLGGGFDKLLLDSLYEDDAARRQLQLKNAGYGYGYGSMDVQQ  488

Query  481  NPF---EVADPFAMSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVGPHNPFG  311
            NPF   +  DPF MSN IA P +VQ+A + Q        P    YP Q    + P NPFG
Sbjct  489  NPFHQYQHNDPFIMSNDIAPPTNVQMALLAQQQQMMMMVP--YQYPQQQN--IPPSNPFG  544

Query  310  D  308
            D
Sbjct  545  D  545



>gb|KHN17630.1| Putative clathrin assembly protein [Glycine soja]
Length=574

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 97/192 (51%), Gaps = 26/192 (14%)
 Frame = -2

Query  811  EIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVP-SGATSETVQPKDFDPT-G  638
            E  A +PP+   TDDLLGLN        +EESNALALAIVP  G  S  +   +   T G
Sbjct  364  EEEAELPPL-ISTDDLLGLNEINPKAQELEESNALALAIVPPGGHYSNNLALTNISGTSG  422

Query  637  WELALVSTPGTNLSTPQERQLAGGLDSLTLNSLY-DEGAYRASQQP-----VYGAPAPNP  476
            WELALV+TP  + S   +R++AGG D L L+SLY DE A R  Q         G    NP
Sbjct  423  WELALVTTPSNHTSQAPDRRMAGGFDKLLLDSLYEDENARRQLQLRNAGYGYEGMDTHNP  482

Query  475  FE---VADPFAMSNAIAAPPSVQLAPMPQPNP-------------FGPFHPAAAAYPPQN  344
            F+     DPFAMSN IA P +VQ+A M Q                  P+      Y  Q 
Sbjct  483  FDHYNQQDPFAMSNNIAPPANVQMAFMAQQQQQMMFQQQQQYNTMMVPYQYPQTQYNQQM  542

Query  343  PLMVGPHNPFGD  308
            P+M G  NPF D
Sbjct  543  PVM-GSANPFSD  553



>emb|CAN83852.1| hypothetical protein VITISV_037564 [Vitis vinifera]
Length=588

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 82/145 (57%), Gaps = 14/145 (10%)
 Frame = -2

Query  814  TEIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD-PTG  638
             E+P   PP      DLLGL+ P  + + ++E NA+ALAIVP   T  +  P   +  TG
Sbjct  349  VEMPVVEPP------DLLGLDDPIPNTAELDEKNAMALAIVPVAETPPSAGPNPANGTTG  402

Query  637  WELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPF-----  473
            WELALV+ P +N +     +LAGGLD LTL+SLYD+   R +Q   Y    P P      
Sbjct  403  WELALVTAPSSNENATAASKLAGGLDMLTLDSLYDDAIRRNNQNVSYNPWQPVPMGGPMM  462

Query  472  --EVADPFAMSNAIAAPPSVQLAPM  404
                 DPF  SNA+AAPP+VQ+A M
Sbjct  463  QQTAHDPFFASNAVAAPPNVQMAAM  487



>gb|KJB64689.1| hypothetical protein B456_010G060800 [Gossypium raimondii]
 gb|KJB64694.1| hypothetical protein B456_010G060800 [Gossypium raimondii]
Length=547

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 73/131 (56%), Gaps = 9/131 (7%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD--PTGWELALVSTPGTNLS  596
            DLLGLN P    S ++E NALALAIVP    +            TGWELALV+ P +N +
Sbjct  358  DLLGLNDPVPVASELDEKNALALAIVPVAEQTTAAAAPIPANGTTGWELALVTAPSSNEN  417

Query  595  TPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFE-------VADPFAMSNAI  437
                 +LAGGLD LTL+SLYD+   R++Q   Y    P P         + DPF  SN +
Sbjct  418  ATAASKLAGGLDKLTLDSLYDDAIRRSNQNVSYNPWEPAPMSGAMMQQPMHDPFYASNMV  477

Query  436  AAPPSVQLAPM  404
            AAP SVQ+A M
Sbjct  478  AAPHSVQIAAM  488



>ref|XP_006600479.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Glycine max]
Length=574

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 97/192 (51%), Gaps = 26/192 (14%)
 Frame = -2

Query  811  EIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVP-SGATSETVQPKDFDPT-G  638
            E  A +PP+   TDDLLGLN        +EESNALALAIVP  G  S  +   +   T G
Sbjct  364  EEEAELPPL-ISTDDLLGLNEINPKAQELEESNALALAIVPPGGHYSNNLALTNISGTSG  422

Query  637  WELALVSTPGTNLSTPQERQLAGGLDSLTLNSLY-DEGAYRASQQP-----VYGAPAPNP  476
            WELALV+TP  + S   +R++AGG D L L+SLY DE A R  Q         G    NP
Sbjct  423  WELALVTTPSNHTSQAPDRRMAGGFDKLLLDSLYEDENARRQLQLRNAGYGYEGMDTHNP  482

Query  475  FE---VADPFAMSNAIAAPPSVQLAPMPQPNP-------------FGPFHPAAAAYPPQN  344
            F+     DPFAMSN IA P +VQ+A M Q                  P+      Y  Q 
Sbjct  483  FDHYNQQDPFAMSNNIAPPANVQMAFMAQQQQQMMFQQQQQYNTMMVPYQYPQTQYNQQM  542

Query  343  PLMVGPHNPFGD  308
            P+M G  NPF D
Sbjct  543  PVM-GSANPFSD  553



>gb|KHN15336.1| Putative clathrin assembly protein [Glycine soja]
Length=596

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 78/133 (59%), Gaps = 14/133 (11%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVPSGATS-ETVQPKDFD-PTGWELALVSTPGTN  602
            T+DLLGLN        +EESNA+ALAIVP G  +   +   +FD  TGWEL+LV+TP  +
Sbjct  381  TNDLLGLNEINPKAMELEESNAMALAIVPPGGNNPNNLALSNFDGTTGWELSLVTTPSNH  440

Query  601  LSTPQERQLAGGLDSLTLNSLY-DEGAYRA--SQQPVYGAPAP------NPFE---VADP  458
             S   +R+LAGG D L L+SLY DE A R    Q   YG          NPF+     DP
Sbjct  441  SSQAPDRRLAGGFDKLLLDSLYEDENARRQLHLQNAGYGHSGTMDIQNNNPFDHYNQQDP  500

Query  457  FAMSNAIAAPPSV  419
            FAMSN IA PPSV
Sbjct  501  FAMSNNIAPPPSV  513



>ref|XP_004487990.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
isoform X1 [Cicer arietinum]
Length=590

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 90/192 (47%), Gaps = 37/192 (19%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVP-SGATSETVQPKDFD-PTGWELALVSTPGTN  602
            TDDLLGLN        +EESNALALAIVP  G  S  +   + D  TGWEL+LV+TP  +
Sbjct  379  TDDLLGLNEINPKAVELEESNALALAIVPPGGNNSNNLALSNIDGTTGWELSLVATPSNH  438

Query  601  LSTPQERQLAGGLDSLTLNSLY-DEGAYR--ASQQPVYGAP---APNPFE---VADPFAM  449
             S   +R++AGG D L L+SLY DE A R    Q   YG       NPF+     DPFAM
Sbjct  439  TSQATDRRMAGGFDKLLLDSLYEDENARRQLQLQNAGYGHEEMTIQNPFDHYNQHDPFAM  498

Query  448  SNAIAAPPSV-------------------------QLAPMPQPNPFGPFHPAAAAYPPQN  344
            S  IA P +V                         Q     Q     P       YP Q 
Sbjct  499  SKNIAPPSNVQMAMLAQQQQQHQMMFQQQQMMFSPQQHQYHQNMAMVPHQQPHTQYPQQL  558

Query  343  PLMVGPHNPFGD  308
             +M G HNPFGD
Sbjct  559  QIM-GAHNPFGD  569



>ref|XP_011078406.1| PREDICTED: putative clathrin assembly protein At5g35200 [Sesamum 
indicum]
Length=554

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 86/164 (52%), Gaps = 32/164 (20%)
 Frame = -2

Query  796  VPPVKFETD------DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFDP---  644
            V PVK E        DLLGL+ P    + ++E NA+ALAIVP G      QP    P   
Sbjct  352  VEPVKVEAPASESPPDLLGLHEPHPAATELDEKNAMALAIVPVGGAE---QPGSTGPNLA  408

Query  643  ---TGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPF  473
               TGWELALV+ P +N S     +LAGGLD LTL+SLYD+   R +Q   Y     NP+
Sbjct  409  NGTTGWELALVTAPSSNESAASASKLAGGLDKLTLDSLYDDAIRRNNQNVSY-----NPW  463

Query  472  EVA------------DPFAMSNAIAAPPSVQLAPMPQPNPFGPF  377
            E A            DPF  SNA+AAPP+VQ+A M       PF
Sbjct  464  EQAPMGNSMMPQIAHDPFYASNAVAAPPAVQMAAMSNQQHVYPF  507



>ref|XP_004487991.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
isoform X2 [Cicer arietinum]
Length=581

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 90/192 (47%), Gaps = 37/192 (19%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVP-SGATSETVQPKDFD-PTGWELALVSTPGTN  602
            TDDLLGLN        +EESNALALAIVP  G  S  +   + D  TGWEL+LV+TP  +
Sbjct  370  TDDLLGLNEINPKAVELEESNALALAIVPPGGNNSNNLALSNIDGTTGWELSLVATPSNH  429

Query  601  LSTPQERQLAGGLDSLTLNSLY-DEGAYR--ASQQPVYGAP---APNPFE---VADPFAM  449
             S   +R++AGG D L L+SLY DE A R    Q   YG       NPF+     DPFAM
Sbjct  430  TSQATDRRMAGGFDKLLLDSLYEDENARRQLQLQNAGYGHEEMTIQNPFDHYNQHDPFAM  489

Query  448  SNAIAAPPSV-------------------------QLAPMPQPNPFGPFHPAAAAYPPQN  344
            S  IA P +V                         Q     Q     P       YP Q 
Sbjct  490  SKNIAPPSNVQMAMLAQQQQQHQMMFQQQQMMFSPQQHQYHQNMAMVPHQQPHTQYPQQL  549

Query  343  PLMVGPHNPFGD  308
             +M G HNPFGD
Sbjct  550  QIM-GAHNPFGD  560



>gb|KJB64690.1| hypothetical protein B456_010G060800 [Gossypium raimondii]
Length=503

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 73/131 (56%), Gaps = 9/131 (7%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD--PTGWELALVSTPGTNLS  596
            DLLGLN P    S ++E NALALAIVP    +            TGWELALV+ P +N +
Sbjct  314  DLLGLNDPVPVASELDEKNALALAIVPVAEQTTAAAAPIPANGTTGWELALVTAPSSNEN  373

Query  595  TPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFE-------VADPFAMSNAI  437
                 +LAGGLD LTL+SLYD+   R++Q   Y    P P         + DPF  SN +
Sbjct  374  ATAASKLAGGLDKLTLDSLYDDAIRRSNQNVSYNPWEPAPMSGAMMQQPMHDPFYASNMV  433

Query  436  AAPPSVQLAPM  404
            AAP SVQ+A M
Sbjct  434  AAPHSVQIAAM  444



>ref|XP_004150528.1| PREDICTED: putative clathrin assembly protein At5g35200 [Cucumis 
sativus]
 ref|XP_011655361.1| PREDICTED: putative clathrin assembly protein At5g35200 [Cucumis 
sativus]
 gb|KGN65115.1| hypothetical protein Csa_1G226430 [Cucumis sativus]
Length=554

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 77/134 (57%), Gaps = 12/134 (9%)
 Frame = -2

Query  769  DLLGLNAPTSDV-SAIEESNALALAIVPSGATSETVQPKDFD---PTGWELALVSTPGTN  602
            DLLGLN P  +V S ++E N+LALAIVP      +  P   +    TGWELALV+ P +N
Sbjct  366  DLLGLNDPVPEVTSNLDEKNSLALAIVPVADQQTSSAPSQANGTTTTGWELALVTAPSSN  425

Query  601  LSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFE--------VADPFAMS  446
             S     +LAGGLD LTL+SLYD+   R +Q   Y    P P          + DPF  S
Sbjct  426  ESVAATSKLAGGLDLLTLDSLYDDAIRRNNQNVSYNPWEPVPMHGAMMQQQPMHDPFFAS  485

Query  445  NAIAAPPSVQLAPM  404
            +A+AAP SVQ+A M
Sbjct  486  SAVAAPHSVQMAAM  499



>emb|CDP20659.1| unnamed protein product [Coffea canephora]
Length=570

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 79/133 (59%), Gaps = 13/133 (10%)
 Frame = -2

Query  769  DLLGLNAPTS-DVSAIEESNALALAIVPSG---ATSETVQPKDFDPTGWELALVSTPGTN  602
            DLLGLN   +   + +EESNALALAI+  G   ++S     +    +GWELALV+ P  +
Sbjct  372  DLLGLNDEVNPKAAELEESNALALAIIQPGNDPSSSNYALTEIGQTSGWELALVAAPSNH  431

Query  601  LSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPV---------YGAPAPNPFEVADPFAM  449
             S P ER++AGG DSL L+SLY++ A R   Q           Y   A +P +  DPFAM
Sbjct  432  TSKPPERKMAGGFDSLLLDSLYEDEAARRQLQLQNAGYNAGYGYQMTAQSPLDQHDPFAM  491

Query  448  SNAIAAPPSVQLA  410
            SNAIA P +VQ+A
Sbjct  492  SNAIAPPTNVQMA  504



>ref|XP_011020009.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X1 [Populus euphratica]
Length=577

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 76/131 (58%), Gaps = 17/131 (13%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVP--------SGATSETVQPKDFDPTGWELALVST  614
            DLLGLN      + +EESNA+ALAIVP        S A SE  +P   + TGWELALV+T
Sbjct  374  DLLGLNEINPKAAELEESNAMALAIVPPGADPLSSSNALSELGKP---NATGWELALVTT  430

Query  613  PGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPV-----YGAPA-PNPFEVADPFA  452
            P    S P + ++ GG D L L+SLY++   R   Q       YGA A  NPFE  DPFA
Sbjct  431  PSNPTSQPMQSKMGGGFDRLLLDSLYEDDTARKQIQMQNAGYGYGATAVHNPFEQQDPFA  490

Query  451  MSNAIAAPPSV  419
             SN+IA P +V
Sbjct  491  TSNSIAPPTNV  501



>ref|XP_002308116.2| hypothetical protein POPTR_0006s07540g [Populus trichocarpa]
 gb|EEE91639.2| hypothetical protein POPTR_0006s07540g [Populus trichocarpa]
Length=575

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 76/131 (58%), Gaps = 17/131 (13%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVP--------SGATSETVQPKDFDPTGWELALVST  614
            DLLGLN      + +EESNA+ALAIVP        S A SE  +P   + TGWELALV+T
Sbjct  371  DLLGLNEINPKAAELEESNAMALAIVPPGADPLSSSKALSELGKP---NATGWELALVTT  427

Query  613  PGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPV-----YGAPA-PNPFEVADPFA  452
            P    S P + ++ GG D L L+SLY++   R   Q       YGA A  NPFE  DPFA
Sbjct  428  PSNPTSQPMQSKMGGGFDRLLLDSLYEDDTARKQIQMQNAGYGYGATAVHNPFEQQDPFA  487

Query  451  MSNAIAAPPSV  419
             SN+IA P +V
Sbjct  488  TSNSIAPPTNV  498



>gb|ACN36497.1| unknown [Zea mays]
Length=332

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 78/130 (60%), Gaps = 6/130 (5%)
 Frame = -2

Query  775  TDDLLGLNAPTS-DVSAIEESNALALAIVPSGATSETVQPKDF---DPTGWELALVSTPG  608
            T +LL L+   +  ++ +E SNALALAIV  G  ++    +D    D  GWELALV+ P 
Sbjct  132  TGNLLNLDEEVNPMIADLETSNALALAIVAPGNENKMPTSQDLFALDKAGWELALVTAPS  191

Query  607  TNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPV--YGAPAPNPFEVADPFAMSNAIA  434
             + +   + QLAGG D L L+SLY++ A R     V   G+ A NPF+  DPFAMSN+ A
Sbjct  192  NHTNQQVDNQLAGGFDKLLLDSLYEDEARRQQIASVTYTGSTAANPFDHNDPFAMSNSFA  251

Query  433  APPSVQLAPM  404
             P +VQLA M
Sbjct  252  PPSNVQLAMM  261



>ref|XP_006346667.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Solanum tuberosum]
Length=573

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 76/135 (56%), Gaps = 13/135 (10%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGAT--SETVQPKDFDPT-GWELALVSTPGTNL  599
            DLLGLN     ++ +EESNALALAI+  G    S + Q  +   T GWELALV+    N 
Sbjct  373  DLLGLNQVDPKIAELEESNALALAIIQPGKENPSASFQLSEIGSTSGWELALVTASSNNT  432

Query  598  STPQ-ERQLAGGLDSLTLNSLYDEGAYRASQQPV---------YGAPAPNPFEVADPFAM  449
            S    +++LAGG D L L+SLY++ A R   Q           Y  P  NPF   DPFAM
Sbjct  433  SQVAPDKKLAGGFDKLLLDSLYEDDATRRQIQLQNAGYSAGCGYEIPGQNPFNQHDPFAM  492

Query  448  SNAIAAPPSVQLAPM  404
            SN IA P +VQ+A M
Sbjct  493  SNNIAPPTNVQMAIM  507



>ref|XP_009398625.1| PREDICTED: putative clathrin assembly protein At4g25940 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=394

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 72/123 (59%), Gaps = 7/123 (6%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDF---DPTGWELALVSTPGT  605
            T DLLGLN      + +EE+NALALAI+  G  +      D    D +GWELALV+ P +
Sbjct  208  TGDLLGLNEINPAAAELEENNALALAIISPGDNTNPSTTGDLLGTDSSGWELALVTAPSS  267

Query  604  NLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPV-YGAPAPNPFEVADPFAMSNAIAAP  428
            N S   E +LAGG D L L+SLY++ A R        G    NPF   DPFAMSN+IA P
Sbjct  268  NTSHLVESKLAGGFDMLLLDSLYEDSARRQQMASADSGGLDANPF---DPFAMSNSIAPP  324

Query  427  PSV  419
            PSV
Sbjct  325  PSV  327



>ref|XP_006372154.1| hypothetical protein POPTR_0018s12580g [Populus trichocarpa]
 gb|ERP49951.1| hypothetical protein POPTR_0018s12580g [Populus trichocarpa]
Length=566

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 75/126 (60%), Gaps = 10/126 (8%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD-PTGWELALVSTPGTNLST  593
            DLLGL+ P    S ++E NALALAIVP      +  P   +  TGWELALV+ P +N ST
Sbjct  377  DLLGLDDPVPVASELDEKNALALAIVPVAEQQSSPVPTHANGTTGWELALVTAPSSNEST  436

Query  592  PQERQLAGGLDSLTLNSLYDEGAYRASQQPV-YG----APAPNPF---EVADPFAMSNAI  437
                +LAGGLD LTL+SLYD+ A R S QPV Y      P  NP     V DPF  SN +
Sbjct  437  AAASKLAGGLDKLTLDSLYDD-AIRRSNQPVSYNPWEPVPVANPMMQAAVHDPFFASNTV  495

Query  436  AAPPSV  419
            AAP SV
Sbjct  496  AAPHSV  501



>ref|XP_004951735.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Setaria italica]
Length=573

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 83/135 (61%), Gaps = 13/135 (10%)
 Frame = -2

Query  775  TDDLLGLNAPTS-DVSAIEESNALALAIVP-----SGATSETVQPKDFDPTGWELALVST  614
            T DLL L+A  +  V+ +EESNALALAIV       G+ S+ +   D + +GWELALV+ 
Sbjct  364  TGDLLNLDAEVNPLVTELEESNALALAIVAPDDQNKGSASQNL--FDVNSSGWELALVTA  421

Query  613  PGTNLSTPQERQLAGGLDSLTLNSLYDEGAYR---ASQQPVYGAPAPNPFE--VADPFAM  449
            P T+ S P +  LAGG D L L+SLY++ A R   AS        A NPFE   +DPFAM
Sbjct  422  PSTHTSQPVKTNLAGGFDKLLLDSLYEDEARRKQIASVTYTGSLGAANPFEANASDPFAM  481

Query  448  SNAIAAPPSVQLAPM  404
            S++ A P +VQLA M
Sbjct  482  SSSFAPPSNVQLALM  496



>emb|CDY12401.1| BnaC08g08040D [Brassica napus]
Length=540

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 98/188 (52%), Gaps = 40/188 (21%)
 Frame = -2

Query  802  APVPPVKFETD---------DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDF  650
            +P PPVK E +         DLL ++ P   VS ++E NALALAIVP     + V P DF
Sbjct  339  SPEPPVKAEAEAEKPVEKQPDLLSMDDPAPGVSELDEKNALALAIVPV-TVEQPVSPIDF  397

Query  649  ---DPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQ---------  506
               + +GWELALV+ P +N     + +LAGGLD LTL+SLY E A R +QQ         
Sbjct  398  TNGNSSGWELALVTAPSSNEVAAAKSKLAGGLDKLTLDSLY-EDAIRVNQQQNRSHNPWE  456

Query  505  ---PVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNP-L  338
               PV+  P  +      PF  SN ++APP VQ+A      P+G  H        QN  +
Sbjct  457  QHHPVHNGPMMH----HQPFFASNGVSAPPPVQMANQYH-QPYGFQH--------QNSGM  503

Query  337  MVGPHNPF  314
            M+GP  P+
Sbjct  504  MMGPVQPY  511



>ref|XP_010533128.1| PREDICTED: putative clathrin assembly protein At5g35200 isoform 
X2 [Tarenaya hassleriana]
Length=577

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 88/162 (54%), Gaps = 28/162 (17%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGA---TSETVQPKDFDPTGWELALVSTPGTNL  599
            DLL L+ P    + IEE NA ALAIVP  A   TS TV+  + + TGWELALV+ P +N 
Sbjct  371  DLLSLDDPAPVAAEIEEKNAFALAIVPISAEEPTSTTVRS-NGNATGWELALVTAPSSNS  429

Query  598  STPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFE-------------VADP  458
            S P   +LAGGLD LTL+SLYD+ A RAS Q      + NP++             + DP
Sbjct  430  SAPINSKLAGGLDKLTLDSLYDD-AIRASNQ----TRSYNPWDQTLVHNGSMVQPGIPDP  484

Query  457  FAMSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMV  332
            F +SN   A PSVQ++ M      G  H     Y   NP M+
Sbjct  485  FFVSNPAMARPSVQMSSM------GYHHHQGFMYHQPNPGMM  520



>ref|XP_010533127.1| PREDICTED: putative clathrin assembly protein At5g35200 isoform 
X1 [Tarenaya hassleriana]
Length=603

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 88/162 (54%), Gaps = 28/162 (17%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGA---TSETVQPKDFDPTGWELALVSTPGTNL  599
            DLL L+ P    + IEE NA ALAIVP  A   TS TV+  + + TGWELALV+ P +N 
Sbjct  397  DLLSLDDPAPVAAEIEEKNAFALAIVPISAEEPTSTTVRS-NGNATGWELALVTAPSSNS  455

Query  598  STPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFE-------------VADP  458
            S P   +LAGGLD LTL+SLYD+ A RAS Q      + NP++             + DP
Sbjct  456  SAPINSKLAGGLDKLTLDSLYDD-AIRASNQ----TRSYNPWDQTLVHNGSMVQPGIPDP  510

Query  457  FAMSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMV  332
            F +SN   A PSVQ++ M      G  H     Y   NP M+
Sbjct  511  FFVSNPAMARPSVQMSSM------GYHHHQGFMYHQPNPGMM  546



>ref|XP_002324629.1| hypothetical protein POPTR_0018s12580g [Populus trichocarpa]
 gb|EEF03194.1| hypothetical protein POPTR_0018s12580g [Populus trichocarpa]
Length=563

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 75/125 (60%), Gaps = 11/125 (9%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFDPTGWELALVSTPGTNLSTP  590
            DLLGL+ P    S ++E NALALAIVP G  +  V       TGWELALV+ P +N ST 
Sbjct  377  DLLGLDDPVPVASELDEKNALALAIVPVG--NSPVPTHANGTTGWELALVTAPSSNESTA  434

Query  589  QERQLAGGLDSLTLNSLYDEGAYRASQQPV-YG----APAPNPF---EVADPFAMSNAIA  434
               +LAGGLD LTL+SLYD+ A R S QPV Y      P  NP     V DPF  SN +A
Sbjct  435  AASKLAGGLDKLTLDSLYDD-AIRRSNQPVSYNPWEPVPVANPMMQAAVHDPFFASNTVA  493

Query  433  APPSV  419
            AP SV
Sbjct  494  APHSV  498



>ref|XP_010087990.1| Putative clathrin assembly protein [Morus notabilis]
 gb|EXB31000.1| Putative clathrin assembly protein [Morus notabilis]
Length=577

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 93/190 (49%), Gaps = 28/190 (15%)
 Frame = -2

Query  793  PPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSG----ATSETVQPKDFDPTGWELA  626
            P +  E  DLLGL       + IEESNALALAI+  G    +T++ +       +GWELA
Sbjct  372  PLISMEEPDLLGLKEVNPKAAEIEESNALALAIIQPGNNPPSTNQGLNDL-LGSSGWELA  430

Query  625  LVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRAS---QQPVY---GAPAPNPFE-V  467
            LV+ P  N S   E +LAGG + L L+SLY++ A R     Q   Y   G    NPF+  
Sbjct  431  LVTAPSNNTSHAVESKLAGGFNKLLLDSLYEDDAARRQIQLQNAGYGHGGMSVQNPFDGQ  490

Query  466  ADPFAMSNAIAAPPSVQLAPM--PQPNPFGPFHPAAAAYPPQNPL--------------M  335
             DPF MSN IA PP+VQ+A M   Q     P+       P Q+                 
Sbjct  491  QDPFMMSNNIAPPPNVQMAKMAQQQQQQQQPYQHNMIMVPHQHSPQYPQQCQYPQQHLQQ  550

Query  334  VGPHNPFGDT  305
            +G  NPFGD+
Sbjct  551  MGSSNPFGDS  560



>ref|XP_011017841.1| PREDICTED: putative clathrin assembly protein At5g35200 [Populus 
euphratica]
Length=549

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 74/126 (59%), Gaps = 10/126 (8%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD-PTGWELALVSTPGTNLST  593
            DLLGL+ P    S ++E NALALAIVP         P   +  TGWELALV+ P +N ST
Sbjct  360  DLLGLDDPVPVASELDEKNALALAIVPVAEQQSAPVPTHANGTTGWELALVTAPSSNEST  419

Query  592  PQERQLAGGLDSLTLNSLYDEGAYRASQQPV-YG----APAPNPF---EVADPFAMSNAI  437
                +LAGGLD LTL+SLYD+ A R S QPV Y      P  NP     V DPF  SN +
Sbjct  420  TAASKLAGGLDKLTLDSLYDD-AIRRSNQPVSYNPWEPVPVANPMMQTAVHDPFFASNTV  478

Query  436  AAPPSV  419
            AAP SV
Sbjct  479  AAPHSV  484



>ref|XP_009785618.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
 ref|XP_009785619.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
 ref|XP_009785620.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
 ref|XP_009785621.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
 ref|XP_009785622.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
 ref|XP_009785623.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
 ref|XP_009785625.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
 ref|XP_009785626.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
 ref|XP_009785627.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
 ref|XP_009785628.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
 ref|XP_009785629.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
Length=552

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 79/132 (60%), Gaps = 10/132 (8%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGAT---SETVQPKDFDPTGWELALVSTPGTNL  599
            DLL L+ P+  V+ ++E N+LALAIVP G++   +  V       TGWELALV  P +N 
Sbjct  363  DLLSLDDPSPAVAELDEKNSLALAIVPVGSSNPPASAVSNLTNGATGWELALVEAPSSNE  422

Query  598  STPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYG--APAPNPFEVA-----DPFAMSNA  440
            S     +LAGGLD LTL+SLYD+   + +Q   Y    PAP   ++      DPF +SN 
Sbjct  423  SATTTSKLAGGLDKLTLDSLYDDAMRQTNQNVSYNPWEPAPVASQMMPNVGYDPFYVSNM  482

Query  439  IAAPPSVQLAPM  404
            +AAP +VQ+A M
Sbjct  483  VAAPTNVQMAAM  494



>gb|KHG16288.1| hypothetical protein F383_00250 [Gossypium arboreum]
Length=547

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 74/136 (54%), Gaps = 19/136 (14%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFDP--TGWELALVSTPGTNLS  596
            DLLGLN P    S ++E NALALAIVP    +            T WELALV+ P +N +
Sbjct  358  DLLGLNDPVPVASELDEKNALALAIVPVAEQTTAAAAPIPANGNTSWELALVTAPSSNEN  417

Query  595  TPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVA------------DPFA  452
                 +LAGGLD LTL+SLYD+   R++Q   Y     NP+E A            DPF 
Sbjct  418  ATAASKLAGGLDKLTLDSLYDDAIRRSNQNVSY-----NPWEAAPMSGAMMQQPMHDPFY  472

Query  451  MSNAIAAPPSVQLAPM  404
             SN +AAP SVQ+A M
Sbjct  473  ASNMVAAPHSVQMAAM  488



>ref|XP_009398623.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009398624.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=557

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 72/123 (59%), Gaps = 7/123 (6%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDF---DPTGWELALVSTPGT  605
            T DLLGLN      + +EE+NALALAI+  G  +      D    D +GWELALV+ P +
Sbjct  371  TGDLLGLNEINPAAAELEENNALALAIISPGDNTNPSTTGDLLGTDSSGWELALVTAPSS  430

Query  604  NLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPV-YGAPAPNPFEVADPFAMSNAIAAP  428
            N S   E +LAGG D L L+SLY++ A R        G    NPF   DPFAMSN+IA P
Sbjct  431  NTSHLVESKLAGGFDMLLLDSLYEDSARRQQMASADSGGLDANPF---DPFAMSNSIAPP  487

Query  427  PSV  419
            PSV
Sbjct  488  PSV  490



>gb|AFW76126.1| clathrin assembly protein [Zea mays]
Length=575

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 79/132 (60%), Gaps = 6/132 (5%)
 Frame = -2

Query  775  TDDLLGLNAPTS-DVSAIEESNALALAIVPSGATSETVQPKDF---DPTGWELALVSTPG  608
            T +LL L+   +  ++ +E SNALALAIV  G  ++    +D    D  GWELALV+ P 
Sbjct  375  TGNLLNLDEEVNPMIADLETSNALALAIVAPGNENKMPTSQDLFALDKAGWELALVTAPS  434

Query  607  TNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPV--YGAPAPNPFEVADPFAMSNAIA  434
             + +   + QLAGG D L L+SLY++ A R     V   G+ A NPF+  DPFAMSN+ A
Sbjct  435  NHTNQQVDNQLAGGFDKLLLDSLYEDEARRQQIASVTYTGSTAANPFDHNDPFAMSNSFA  494

Query  433  APPSVQLAPMPQ  398
             P +VQLA M +
Sbjct  495  PPSNVQLAMMAE  506



>ref|XP_010904605.1| PREDICTED: putative clathrin assembly protein At5g35200 [Elaeis 
guineensis]
Length=541

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 74/190 (39%), Positives = 91/190 (48%), Gaps = 43/190 (23%)
 Frame = -2

Query  802  APVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIV----------PSGATSETVQPKD  653
            +PV   K    DLLGL+      + +EE NALAL +V           S  TSET     
Sbjct  354  SPVETAKAPVTDLLGLDDFNQGATKLEEENALALGVVGDENLLKDTNNSDLTSETT----  409

Query  652  FDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQ---QPVYGAPAP  482
               +GWELAL     +N S   E +LAGGL+ LTL+SLYD+   R +        G  AP
Sbjct  410  ---SGWELALFDARSSNRSAVAESKLAGGLNKLTLDSLYDDAIVRRTNLGGNYQMGQMAP  466

Query  481  NPFEVA----DPFAMSNAIAAPPSV-----------QLAPMPQP------NPFGPFHPAA  365
            NPFE      DPF  SNA+  P SV            + P PQP      NPFG  + A+
Sbjct  467  NPFEAVQSSQDPFYASNAVTPPASVQMAAMAQQQAYMMQPQPQPSRQDGTNPFGNPYGAS  526

Query  364  --AAYPPQNP  341
              A+YPP NP
Sbjct  527  GVASYPPHNP  536



>gb|KDO73480.1| hypothetical protein CISIN_1g009078mg [Citrus sinensis]
Length=543

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 72/135 (53%), Gaps = 19/135 (14%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFDPT------GWELALVSTPG  608
            DLLGL+ P    S ++E NALALAIVP        QP    PT      GWELALV+ P 
Sbjct  359  DLLGLDDPLPVASELDEKNALALAIVP------VEQPTSVAPTQGNGTAGWELALVTAPS  412

Query  607  TNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPF-------EVADPFAM  449
            +N +     +LAGGLD LTL+SLYD+   R SQ   Y    P P           DPF  
Sbjct  413  SNENATAASKLAGGLDKLTLDSLYDDALRRNSQNASYSTWGPQPIAGPTMQPNGHDPFYA  472

Query  448  SNAIAAPPSVQLAPM  404
            S  ++AP SVQ+A M
Sbjct  473  SGMVSAPHSVQMAAM  487



>ref|XP_006453089.1| hypothetical protein CICLE_v10007931mg [Citrus clementina]
 ref|XP_006474412.1| PREDICTED: putative clathrin assembly protein At5g35200-like 
[Citrus sinensis]
 gb|ESR66329.1| hypothetical protein CICLE_v10007931mg [Citrus clementina]
Length=544

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 72/135 (53%), Gaps = 19/135 (14%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFDPT------GWELALVSTPG  608
            DLLGL+ P    S ++E NALALAIVP        QP    PT      GWELALV+ P 
Sbjct  360  DLLGLDDPLPVASELDEKNALALAIVP------VEQPTSVAPTQGNGTAGWELALVTAPS  413

Query  607  TNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPF-------EVADPFAM  449
            +N +     +LAGGLD LTL+SLYD+   R SQ   Y    P P           DPF  
Sbjct  414  SNENATAASKLAGGLDKLTLDSLYDDALRRNSQNASYSTWGPQPIAGPTMQPNGHDPFYA  473

Query  448  SNAIAAPPSVQLAPM  404
            S  ++AP SVQ+A M
Sbjct  474  SGMVSAPHSVQMAAM  488



>ref|XP_010323282.1| PREDICTED: putative clathrin assembly protein At5g35200 [Solanum 
lycopersicum]
 ref|XP_010323283.1| PREDICTED: putative clathrin assembly protein At5g35200 [Solanum 
lycopersicum]
Length=555

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 81/135 (60%), Gaps = 10/135 (7%)
 Frame = -2

Query  778  ETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSE-TVQPKDFD--PTGWELALVSTPG  608
            ET DLL ++ P+  V+ ++E N+LALAI+P G+T+  T    +F    +GWELALV  P 
Sbjct  360  ETADLLSMDDPSPAVAELDEKNSLALAIIPVGSTNPPTSTGSNFTNGTSGWELALVEAPS  419

Query  607  TNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYG----APAPNPFEV---ADPFAM  449
            +N S     +L GGLD LTL+SLYD+   + +Q   Y     APA  P       DPF +
Sbjct  420  SNESAATASKLGGGLDKLTLDSLYDDAMRQTNQNVSYNPWEPAPAVAPMMQNVGYDPFYV  479

Query  448  SNAIAAPPSVQLAPM  404
            SN +AAP +VQ+A M
Sbjct  480  SNMVAAPTNVQMAAM  494



>gb|KDO73477.1| hypothetical protein CISIN_1g009078mg [Citrus sinensis]
 gb|KDO73478.1| hypothetical protein CISIN_1g009078mg [Citrus sinensis]
 gb|KDO73479.1| hypothetical protein CISIN_1g009078mg [Citrus sinensis]
Length=544

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 72/135 (53%), Gaps = 19/135 (14%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFDPT------GWELALVSTPG  608
            DLLGL+ P    S ++E NALALAIVP        QP    PT      GWELALV+ P 
Sbjct  360  DLLGLDDPLPVASELDEKNALALAIVP------VEQPTSVAPTQGNGTAGWELALVTAPS  413

Query  607  TNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPF-------EVADPFAM  449
            +N +     +LAGGLD LTL+SLYD+   R SQ   Y    P P           DPF  
Sbjct  414  SNENATAASKLAGGLDKLTLDSLYDDALRRNSQNASYSTWGPQPIAGPTMQPNGHDPFYA  473

Query  448  SNAIAAPPSVQLAPM  404
            S  ++AP SVQ+A M
Sbjct  474  SGMVSAPHSVQMAAM  488



>ref|XP_002531947.1| clathrin assembly protein, putative [Ricinus communis]
 gb|EEF30429.1| clathrin assembly protein, putative [Ricinus communis]
Length=548

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 77/130 (59%), Gaps = 9/130 (7%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD-PTGWELALVSTPGTNLST  593
            DLLGL+ P    S ++E NALALAIVP      T  P   +  TGWELALV+ P +N S 
Sbjct  359  DLLGLDDPVPVASQLDEKNALALAIVPVTDQPSTTFPSQANGTTGWELALVTAPSSNESA  418

Query  592  PQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAP-------APNPFEVADPFAMSNAIA  434
                +LAGGLD LTL+SLYD+ A R S QPV   P       AP      DPF  SNA+A
Sbjct  419  AAASKLAGGLDKLTLDSLYDD-AIRRSNQPVSYNPWEPAPMNAPMTQTAHDPFFASNAVA  477

Query  433  APPSVQLAPM  404
            AP SVQ+A M
Sbjct  478  APHSVQMAAM  487



>ref|XP_012068479.1| PREDICTED: putative clathrin assembly protein At4g25940 [Jatropha 
curcas]
Length=227

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 82/155 (53%), Gaps = 15/155 (10%)
 Frame = -2

Query  838  AEDVAVSTTEIPAP-VPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQ  662
            +EDV +    + +P +  V  +T DLLGL+        +EESNALALAIVP+   + +  
Sbjct  4    SEDVQLEEEVVESPQLISVYDDTGDLLGLHEINQKAIQLEESNALALAIVPTDNGNLSSS  63

Query  661  PKDF------DPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRAS---Q  509
                      + TGWELALV+ P  N S     QLAGG D L L+SLY++ + R     Q
Sbjct  64   SDALSALVGPNATGWELALVTAPSNNTSHVTGSQLAGGFDRLLLDSLYEDDSARRQLELQ  123

Query  508  QPVYG-----APAPNPFEVADPFAMSNAIAAPPSV  419
               YG         NPFE  DPFAMS+ +  PP+V
Sbjct  124  NAGYGYGGMMTMQNNPFEQHDPFAMSSNVPPPPNV  158



>ref|XP_011648957.1| PREDICTED: putative clathrin assembly protein At5g57200 [Cucumis 
sativus]
 gb|KGN61174.1| hypothetical protein Csa_2G061530 [Cucumis sativus]
Length=596

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 73/126 (58%), Gaps = 9/126 (7%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGA--TSETVQPKDFDPTGWELALVSTPGTNLS  596
            DLLGLN      + IEESNALALAI+ +G   +S      +   +GWELALV+TP  N  
Sbjct  382  DLLGLNEINPRAAEIEESNALALAIITNGNDPSSSNRALSEIGGSGWELALVTTPSNNAG  441

Query  595  TPQERQLAGGLDSLTLNSLY-DEGAYR--ASQQPVYG----APAPNPFEVADPFAMSNAI  437
               E +LAGG D L L+SLY DE A R    Q   YG        NPFE  DPF++S+ I
Sbjct  442  PSVEGKLAGGFDKLLLDSLYEDEHARRHLQLQNAGYGPYGEMMVHNPFEQHDPFSLSSNI  501

Query  436  AAPPSV  419
            A PPSV
Sbjct  502  APPPSV  507



>ref|XP_004231715.1| PREDICTED: putative clathrin assembly protein At5g57200 [Solanum 
lycopersicum]
Length=578

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 76/136 (56%), Gaps = 14/136 (10%)
 Frame = -2

Query  769  DLLGLNAPTS-DVSAIEESNALALAIVPSGAT--SETVQPKDFDPT-GWELALVSTPGTN  602
            DLLGLN      +  +EESNALALAI+  G    S + Q  +   T GWELALV+   +N
Sbjct  374  DLLGLNQVVDPKIVELEESNALALAIIQPGKENPSASFQLSEIGSTSGWELALVTASSSN  433

Query  601  LSTPQ-ERQLAGGLDSLTLNSLYDEGAYRASQQPV---------YGAPAPNPFEVADPFA  452
             S    +++LAGG D L L+SLY++ A R   Q           Y  P  NPF   DPFA
Sbjct  434  TSQVAPDKKLAGGFDKLLLDSLYEDDATRRQIQLQTAGYSAGYGYEIPGQNPFNQHDPFA  493

Query  451  MSNAIAAPPSVQLAPM  404
            MSN IA P +VQ+A M
Sbjct  494  MSNNIAPPTNVQMAIM  509



>ref|XP_009614798.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
tomentosiformis]
 ref|XP_009614799.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
tomentosiformis]
 ref|XP_009614800.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
tomentosiformis]
 ref|XP_009614801.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
tomentosiformis]
 ref|XP_009614802.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
tomentosiformis]
Length=552

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 79/132 (60%), Gaps = 10/132 (8%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGAT---SETVQPKDFDPTGWELALVSTPGTNL  599
            DLL L+ P+  V+ ++E N+LALAI+P G++   + T        TGWELALV  P +N 
Sbjct  363  DLLSLDDPSPAVAELDEKNSLALAIIPVGSSNPPASTGSNFTNGATGWELALVEAPSSNE  422

Query  598  STPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYG--APAPNPFEVA-----DPFAMSNA  440
            S     +LAGGLD LTL+SLYD+   + +Q   Y    PAP   ++      DPF +SN 
Sbjct  423  SATTASKLAGGLDKLTLDSLYDDAMRQTNQNVSYNPWEPAPAASQMMPNVGYDPFYVSNM  482

Query  439  IAAPPSVQLAPM  404
            +AAP +VQ+A M
Sbjct  483  VAAPTNVQMAAM  494



>dbj|BAH20213.1| AT5G35200 [Arabidopsis thaliana]
Length=363

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 79/149 (53%), Gaps = 16/149 (11%)
 Frame = -2

Query  811  EIPAPVPPVKFETD-------DLLGLNAPTSDVSAIEESNALALAIVPSGATS--ETVQP  659
            E PA   PVK E +       DLL ++ P   VS +EE NALALAIVP        T   
Sbjct  157  EKPASPEPVKAEAEKPVEKQPDLLSMDDPAPMVSELEEKNALALAIVPVSVEQPHSTTDF  216

Query  658  KDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQ------PVY  497
             + + TGWELALV+ P +N     + +LAGGLD LTL+SLY E A R SQQ      P  
Sbjct  217  TNGNSTGWELALVTAPSSNEGAAADSKLAGGLDKLTLDSLY-EDAIRVSQQQNRSYNPWE  275

Query  496  GAPAPNPFEVADPFAMSNAIAAPPSVQLA  410
              P  N   +  PF  SN +AAP   Q+A
Sbjct  276  QNPVHNGHMMHQPFYASNGVAAPQPFQMA  304



>ref|XP_008451229.1| PREDICTED: putative clathrin assembly protein At5g57200, partial 
[Cucumis melo]
Length=596

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 73/126 (58%), Gaps = 9/126 (7%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGA--TSETVQPKDFDPTGWELALVSTPGTNLS  596
            DLLGLN      + IEESNALALAIV +G   +S      +   +GWELALV+TP  N  
Sbjct  386  DLLGLNEINPKAAEIEESNALALAIVTNGNDPSSSNRALSEIGGSGWELALVTTPSNNTG  445

Query  595  TPQERQLAGGLDSLTLNSLY-DEGAYR--ASQQPVYG----APAPNPFEVADPFAMSNAI  437
               E +LAGG D L L+SLY DE A R    Q   YG        NPFE  DPF++S+ I
Sbjct  446  PSVEGRLAGGFDKLLLDSLYEDEHARRHLQLQNAGYGPYGEMMVQNPFEQHDPFSLSSNI  505

Query  436  AAPPSV  419
            A PP+V
Sbjct  506  APPPNV  511



>ref|XP_003563341.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X2 [Brachypodium distachyon]
Length=573

 Score = 90.9 bits (224),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 79/140 (56%), Gaps = 7/140 (5%)
 Frame = -2

Query  817  TTEIPAPVPPVKF-ETDDLLGLNAPTS-DVSAIEESNALALAIVPSGATSETVQPKDF--  650
            T E+     P  F  T DLL L+      ++ +E+SNALALAIV  G+ ++    +D   
Sbjct  359  TAELSEEDEPQSFPTTGDLLNLDEELHPMIANLEQSNALALAIVAPGSENQASTSQDLFA  418

Query  649  -DPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPV--YGAPAPN  479
             D +GWELALVS P  + S P   QLAGG D L L+SLY++ A R     V   G    N
Sbjct  419  IDKSGWELALVSAPSNHTSQPAGIQLAGGFDKLLLDSLYEDEARRHQIASVTYTGGLVAN  478

Query  478  PFEVADPFAMSNAIAAPPSV  419
            PF+  DPFAMSN+ A P +V
Sbjct  479  PFDPKDPFAMSNSFAPPSNV  498



>gb|AFK40929.1| unknown [Lotus japonicus]
Length=548

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 88/184 (48%), Gaps = 32/184 (17%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSET-VQPKDFDPTGWELALVSTPGTNLST  593
            DLL L+ P    + +EE NALALAIV       T V       TGWELALV+ P +N + 
Sbjct  361  DLLNLDDPVPAAAELEEKNALALAIVSVADQQPTAVSNHANGVTGWELALVTAPSSNENA  420

Query  592  PQERQLAGGLDSLTLNSLYDEGAYRASQQPVYG----APAPNPFE--VADPFAMSNAIAA  431
                +LAGG D LTL+SLYD+   R +Q   Y     APA    +  + DPF  SNA+AA
Sbjct  421  TTASKLAGGFDKLTLDSLYDDALRRTNQNVSYNPWEPAPAGATMQPTMHDPFFASNAMAA  480

Query  430  PPSVQLAPMPQ-------------------------PNPFGPFHPAAAAYPPQNPLMVGP  326
            P SVQ+A M                            NPFG  +  A  +P  + + V  
Sbjct  481  PHSVQMAAMSNQQQAFMYQQQQQQQQMMMMPPQQPAANPFGNAYGGATVHPYGSGMPVQS  540

Query  325  HNPF  314
            +NP+
Sbjct  541  YNPY  544



>ref|XP_012081185.1| PREDICTED: putative clathrin assembly protein At5g35200 [Jatropha 
curcas]
 gb|KDP30243.1| hypothetical protein JCGZ_17025 [Jatropha curcas]
Length=547

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 85/152 (56%), Gaps = 26/152 (17%)
 Frame = -2

Query  814  TEIPAPV--PPVKFETDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD-P  644
             E PAP+  PP      DLL L+ P    S ++E NALALAIVP      T  P   +  
Sbjct  349  VEAPAPIVDPP------DLLALDDPVPAASELDEKNALALAIVPVADQPSTTAPIQANGT  402

Query  643  TGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVA  464
            TGWELALV  P +N S     +LAGGLD LTL+SLYD+ A R S QPV    + NP+E A
Sbjct  403  TGWELALVMAPSSNESAAAASKLAGGLDKLTLDSLYDD-AIRRSNQPV----SYNPWEAA  457

Query  463  ------------DPFAMSNAIAAPPSVQLAPM  404
                        DPF  S+ +AAPPSVQ+A M
Sbjct  458  PMAGPTMQTTAHDPFFASHVVAAPPSVQMATM  489



>ref|XP_010240260.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X1 [Brachypodium distachyon]
Length=578

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 79/140 (56%), Gaps = 7/140 (5%)
 Frame = -2

Query  817  TTEIPAPVPPVKF-ETDDLLGLNAPTS-DVSAIEESNALALAIVPSGATSETVQPKDF--  650
            T E+     P  F  T DLL L+      ++ +E+SNALALAIV  G+ ++    +D   
Sbjct  364  TAELSEEDEPQSFPTTGDLLNLDEELHPMIANLEQSNALALAIVAPGSENQASTSQDLFA  423

Query  649  -DPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPV--YGAPAPN  479
             D +GWELALVS P  + S P   QLAGG D L L+SLY++ A R     V   G    N
Sbjct  424  IDKSGWELALVSAPSNHTSQPAGIQLAGGFDKLLLDSLYEDEARRHQIASVTYTGGLVAN  483

Query  478  PFEVADPFAMSNAIAAPPSV  419
            PF+  DPFAMSN+ A P +V
Sbjct  484  PFDPKDPFAMSNSFAPPSNV  503



>ref|XP_010687911.1| PREDICTED: putative clathrin assembly protein At5g35200 [Beta 
vulgaris subsp. vulgaris]
Length=553

 Score = 90.5 bits (223),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 76/140 (54%), Gaps = 18/140 (13%)
 Frame = -2

Query  769  DLLGLNAPTSDVSAIEESNALALAIVPSGATSETV-QPK-DFDPTGWELALVSTPGTNLS  596
            DLL ++ P    S +EE NALALAIVP    S T   PK     TGWELALV+ P +N S
Sbjct  360  DLLSMDDPKPVASELEEKNALALAIVPIDDLSTTTPAPKLQNGTTGWELALVTAPSSNES  419

Query  595  TPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYG-------------APAPNPFE---VA  464
            +    +LAGGLD LTL+SLYD+   R +Q   Y               P  NP     V 
Sbjct  420  SIATNKLAGGLDMLTLDSLYDDAMRRTNQTVSYNPWEPAPLTNSMMQQPVHNPMMQQPVH  479

Query  463  DPFAMSNAIAAPPSVQLAPM  404
            +P+  SNA+ AP SVQ+A M
Sbjct  480  NPYYASNAMVAPASVQMAAM  499



>gb|KDO61895.1| hypothetical protein CISIN_1g040258mg [Citrus sinensis]
Length=590

 Score = 90.5 bits (223),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 81/140 (58%), Gaps = 12/140 (9%)
 Frame = -2

Query  805  PAPVPPVKFETDDLLGLNAPTS-DVSAIEESNALALAIVPSGA--TSETVQPKDFDPTGW  635
            PAP+ P +  T DLLGLN   +   + +EESNALALAIV  G    S     K+   +GW
Sbjct  367  PAPLIPAE-ATGDLLGLNEEVNPKAAELEESNALALAIVQPGNDPLSSNRALKEISGSGW  425

Query  634  ELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRAS---QQPVY---GAPAPNPF  473
            ELALV+TP  N     + +LAGG D L L+SLY++ + R     Q   Y   G   PNPF
Sbjct  426  ELALVTTPSNNNCQVVDSKLAGGFDKLLLDSLYEDDSARRHIQLQNAGYGHAGMAVPNPF  485

Query  472  E--VADPFAMSNAIAAPPSV  419
            E    DPFA+SN+IA P +V
Sbjct  486  EHQQHDPFAVSNSIAPPTNV  505



>ref|XP_003610056.1| Phosphoprotein-like protein [Medicago truncatula]
Length=584

 Score = 90.5 bits (223),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 73/134 (54%), Gaps = 11/134 (8%)
 Frame = -2

Query  772  DDLLGLNAPTSDVSAIEESNALALAIVP-SGATSETVQPKDFD-PTGWELALVSTPGTNL  599
            DD LGLN        +E+SNALALAI+P  G  S  +   +    TGWELALV+TP  + 
Sbjct  382  DDFLGLNEINPKAQELEDSNALALAIIPPDGNNSNNLALTNITGTTGWELALVTTPSNHT  441

Query  598  STPQERQLAGGLDSLTLNSLY-DEGAYRASQQPV----YGAPAP----NPFEVADPFAMS  446
                ++ +AGG D L LNSLY DE A R  Q       YG  A     N +   DPFA+S
Sbjct  442  CQASDQNMAGGFDKLLLNSLYEDENARRQLQLQNAGYGYGGAATHNPFNSYNQHDPFAVS  501

Query  445  NAIAAPPSVQLAPM  404
            N +A P +VQ+  M
Sbjct  502  NNVALPSNVQIELM  515



>ref|XP_006453261.1| hypothetical protein CICLE_v10010653mg [Citrus clementina]
 ref|XP_006474644.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Citrus sinensis]
 gb|ESR66501.1| hypothetical protein CICLE_v10010653mg [Citrus clementina]
Length=590

 Score = 90.5 bits (223),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 81/140 (58%), Gaps = 12/140 (9%)
 Frame = -2

Query  805  PAPVPPVKFETDDLLGLNAPTS-DVSAIEESNALALAIVPSGA--TSETVQPKDFDPTGW  635
            PAP+ P +  T DLLGLN   +   + +EESNALALAIV  G    S     K+   +GW
Sbjct  367  PAPLIPAE-ATGDLLGLNEEVNPKAAELEESNALALAIVQPGNDPLSSNRALKEISGSGW  425

Query  634  ELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRAS---QQPVY---GAPAPNPF  473
            ELALV+TP  N     + +LAGG D L L+SLY++ + R     Q   Y   G   PNPF
Sbjct  426  ELALVTTPSNNNCQVVDSKLAGGFDKLLLDSLYEDDSARRHIQLQNAGYGHAGMAVPNPF  485

Query  472  E--VADPFAMSNAIAAPPSV  419
            E    DPFA+SN+IA P +V
Sbjct  486  EHQQHDPFAVSNSIAPPTNV  505



>gb|AES92253.2| clathrin assembly plant-like protein [Medicago truncatula]
Length=579

 Score = 90.5 bits (223),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 73/134 (54%), Gaps = 11/134 (8%)
 Frame = -2

Query  772  DDLLGLNAPTSDVSAIEESNALALAIVP-SGATSETVQPKDFD-PTGWELALVSTPGTNL  599
            DD LGLN        +E+SNALALAI+P  G  S  +   +    TGWELALV+TP  + 
Sbjct  377  DDFLGLNEINPKAQELEDSNALALAIIPPDGNNSNNLALTNITGTTGWELALVTTPSNHT  436

Query  598  STPQERQLAGGLDSLTLNSLY-DEGAYRASQQP-----VYGAPAPNPFEV---ADPFAMS  446
                ++ +AGG D L LNSLY DE A R  Q         GA   NPF      DPFA+S
Sbjct  437  CQASDQNMAGGFDKLLLNSLYEDENARRQLQLQNAGYGYGGAATHNPFNSYNQHDPFAVS  496

Query  445  NAIAAPPSVQLAPM  404
            N +A P +VQ+  M
Sbjct  497  NNVALPSNVQIELM  510



>ref|NP_198370.1| putative clathrin assembly protein [Arabidopsis thaliana]
 sp|Q9LHS0.1|CAP10_ARATH RecName: Full=Putative clathrin assembly protein At5g35200 [Arabidopsis 
thaliana]
 dbj|BAA98205.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL91173.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15694.1| unknown protein [Arabidopsis thaliana]
 gb|AED93944.1| putative clathrin assembly protein [Arabidopsis thaliana]
Length=544

 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 83/164 (51%), Gaps = 17/164 (10%)
 Frame = -2

Query  811  EIPAPVPPVKFETD-------DLLGLNAPTSDVSAIEESNALALAIVPSGATS--ETVQP  659
            E PA   PVK E +       DLL ++ P   VS +EE NALALAIVP        T   
Sbjct  338  EKPASPEPVKAEAEKPVEKQPDLLSMDDPAPMVSELEEKNALALAIVPVSVEQPHSTTDF  397

Query  658  KDFDPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQ------PVY  497
             + + TGWELALV+ P +N     + +LAGGLD LTL+SLY E A R SQQ      P  
Sbjct  398  TNGNSTGWELALVTAPSSNEGAAADSKLAGGLDKLTLDSLY-EDAIRVSQQQNRSYNPWE  456

Query  496  GAPAPNPFEVADPFAMSNAIAAPPSVQLAPMPQPNPFGPFHPAA  365
              P  N   +  PF  SN +AAP   Q+A       FG  H  A
Sbjct  457  QNPVHNGHMMHQPFYASNGVAAPQPFQMANQNH-QTFGYQHQNA  499



>ref|XP_007138775.1| hypothetical protein PHAVU_009G236300g [Phaseolus vulgaris]
 gb|ESW10769.1| hypothetical protein PHAVU_009G236300g [Phaseolus vulgaris]
Length=593

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 77/131 (59%), Gaps = 12/131 (9%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVPSGATS-ETVQPKDFD-PTGWELALVSTPGTN  602
            T+DLLGLN        +EE+NA+ALAIVP G ++   +   + D  TGWEL+LV+T   +
Sbjct  385  TNDLLGLNEINLKAMELEENNAMALAIVPPGGSNPNNLALSNIDGATGWELSLVTTRSNH  444

Query  601  LSTPQERQLAGGLDSLTLNSLY-DEGAYR--ASQQPVYG----APAPNPFE---VADPFA  452
             S   +R++AGG D+L L+SLY DE A R    Q   YG        NPF      DPFA
Sbjct  445  TSQTTDRRMAGGFDNLLLDSLYEDENARRQLQLQNAGYGHGGSMDIQNPFHHYNQQDPFA  504

Query  451  MSNAIAAPPSV  419
            MSN IA PP+V
Sbjct  505  MSNNIAPPPNV  515



>ref|XP_009108052.1| PREDICTED: putative clathrin assembly protein At5g35200 [Brassica 
rapa]
 ref|XP_009108053.1| PREDICTED: putative clathrin assembly protein At5g35200 [Brassica 
rapa]
Length=550

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 95/185 (51%), Gaps = 36/185 (19%)
 Frame = -2

Query  802  APVPPVKFETD-------DLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDF--  650
            +P PPVK E +       DLL ++ P   VS ++E NALALAIVP     + V   DF  
Sbjct  339  SPEPPVKAEAEKPVEKQPDLLSMDDPAPVVSELDEKNALALAIVPV-TVEQPVSTIDFTN  397

Query  649  -DPTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQ-----------  506
             + +GWELALV+ P +N       +LAGGLD LTL+SLY E A R +QQ           
Sbjct  398  GNSSGWELALVTAPSSNEVAAANSKLAGGLDKLTLDSLY-EDAIRVNQQQNRSHNPWEQH  456

Query  505  -PVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAPMPQPNPFGPFHPAAAAYPPQNPLMVG  329
             PV+  P  +      PF  SN ++APP VQ+A      P+G  H  +        +M+G
Sbjct  457  HPVHNGPMMH----HQPFFASNGVSAPPPVQMANQYH-QPYGFQHQNSG-------MMMG  504

Query  328  PHNPF  314
            P  P+
Sbjct  505  PVQPY  509



>gb|ABR16117.1| unknown [Picea sitchensis]
Length=547

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 94/182 (52%), Gaps = 31/182 (17%)
 Frame = -2

Query  811  EIPAPVPPVKFETDDLLGLNAPTSDVSAIEESNALALAIVP-----SGATSETVQPKDFD  647
            E  APV  V   T DLLG +  + D S++EE NALALAIVP     S  TS + +     
Sbjct  349  ESVAPVQTVPTVTTDLLGFDDISPDPSSLEEKNALALAIVPTTDNSSNGTSNSARDIPNG  408

Query  646  PTGWELALVSTPGTNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEV  467
             TGWELALV+T  +N S   E +LAGG D LTL+SLY++   R       G  APNPFE 
Sbjct  409  ATGWELALVTTSSSNSSVQAESKLAGGFDKLTLDSLYEDAMTRQVSSYHTGQVAPNPFEA  468

Query  466  A-------DPFAMSNAIAAPPSVQLAPMPQ-----------------PNPFGPFHPAAAA  359
            +       DPF  S  +A P +VQ+A M Q                  NPFG  +P  AA
Sbjct  469  SPMMQPGHDPFYASQKVAPPSAVQMASMAQQQQAFMAQQQMMGQQLPANPFG--NPYTAA  526

Query  358  YP  353
            YP
Sbjct  527  YP  528



>gb|EMT24265.1| Putative clathrin assembly protein [Aegilops tauschii]
Length=634

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 75/130 (58%), Gaps = 8/130 (6%)
 Frame = -2

Query  775  TDDLLGLNAPTS-DVSAIEESNALALAIVPSGATSETVQPKDF---DPTGWELALVSTPG  608
            T DLL L+   +  V  ++E NALALAIV  G  S+    +D      +GWELALV+ P 
Sbjct  416  TGDLLNLDEEVNPFVVDLDEHNALALAIVGPGDGSKASTCQDLFSGSTSGWELALVTAPS  475

Query  607  TNLSTPQERQLAGGLDSLTLNSLYDEGAYRASQQPV-YGAP---APNPFEVADPFAMSNA  440
               S P E +LAGG D + L+SLY++GA R     V Y      A NPFE  DPFAMSN+
Sbjct  476  RYTSQPIETKLAGGFDIMLLDSLYEDGARRQQIASVTYNGSLGQANNPFETNDPFAMSNS  535

Query  439  IAAPPSVQLA  410
             A P + QLA
Sbjct  536  FAPPSNAQLA  545



>ref|XP_003595071.1| hypothetical protein MTR_2g037980 [Medicago truncatula]
Length=646

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 79/193 (41%), Positives = 91/193 (47%), Gaps = 40/193 (21%)
 Frame = -2

Query  775  TDDLLGLNAPTSDVSAIEESNALALAIVPSGATSETVQPKDFD---PTGWELALVSTPGT  605
            TDDLLGLN        +EESNALALAIVP G  + +      +    TGWELALV+TP  
Sbjct  393  TDDLLGLNEINPKAVELEESNALALAIVPPGGNNNSNNLALSNIGGTTGWELALVTTPSN  452

Query  604  NLSTPQERQLAGGLDSLTLNSLY-DEGAYR--ASQQPVYG---APAPNPFE---VADPFA  452
            + S   +R +AGG D L L+SLY DE A R    Q   YG       NPF+     DPFA
Sbjct  453  HTSQAPDRAMAGGFDKLLLDSLYEDEHARRQLQLQNAGYGHEEMTVQNPFDHYNQHDPFA  512

Query  451  MSNAIAAPPSV----------------QLAPMPQPNPFGPFHPAA---------AAYPPQ  347
            MS  IA P +V                Q   M  P      H  A         A YP Q
Sbjct  513  MSQNIAPPTNVQMALLAQQQQMTFQQQQQQQMMFPQQHQQHHNMAMVPHQQQPHAQYPQQ  572

Query  346  NPLMVGPHNPFGD  308
               M+G HNPFGD
Sbjct  573  ---MMGAHNPFGD  582



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1894952386554