BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6927

Length=664
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ENO08615.1|  enterobactin synthase subunit F                         420   5e-146   Escherichia coli O157:H43 str. T22
gb|EIQ77162.1|  enterobactin synthase component F domain protein        414   4e-142   Shigella flexneri 1235-66
ref|WP_042108385.1|  enterobactin synthase subunit F                    415   9e-142   
ref|WP_044818035.1|  enterobactin synthase subunit F                    416   1e-141   
ref|WP_045178246.1|  enterobactin synthase subunit F                    408   3e-141   
ref|WP_044718481.1|  enterobactin synthase subunit F                    409   7e-138   
ref|WP_032107509.1|  enterobactin synthase subunit F                    409   1e-137   
ref|WP_044702104.1|  enterobactin synthase subunit F                    417   1e-137   
ref|WP_032234678.1|  enterobactin synthase subunit F                    417   2e-137   
ref|WP_042106474.1|  enterobactin synthase subunit F                    413   2e-137   
ref|WP_042967465.1|  enterobactin synthase subunit F                    416   2e-137   
ref|WP_020241343.1|  enterobactin synthase subunit F                    410   5e-137   
gb|EHW79821.1|  amino acid adenylation domain protein                   417   2e-136   Escherichia coli DEC10C
ref|WP_042005445.1|  enterobactin synthase subunit F                    416   2e-136   Escherichia coli [E. coli]
gb|AHF25994.1|  enterobactin synthetase component F                     417   2e-136   uncultured bacterium Contigcl_1559
ref|WP_042964922.1|  enterobactin synthase subunit F                    416   2e-136   Escherichia coli [E. coli]
gb|KDW56564.1|  amino acid adenylation domain protein                   416   4e-136   Escherichia coli 2-005-03_S3_C1
ref|WP_000077723.1|  enterobactin synthase subunit F                    416   6e-136   Escherichia coli [E. coli]
emb|CDL28835.1|  Enterobactin synthetase component F, serine acti...    417   7e-136   Escherichia coli ISC7
ref|WP_044698557.1|  enterobactin synthase subunit F                    417   1e-135   
gb|EGJ91570.1|  syringomycin synthetase                                 414   1e-135   Shigella flexneri 2747-71
ref|WP_042076351.1|  enterobactin synthase subunit F                    409   1e-135   
ref|WP_033812370.1|  enterobactin synthase subunit F                    408   2e-135   
gb|EFK45522.1|  enterobactin synthetase component F                     417   4e-135   Escherichia coli MS 119-7
ref|WP_042046769.1|  enterobactin synthase subunit F                    413   4e-135   Escherichia coli [E. coli]
ref|WP_000077763.1|  enterobactin synthase subunit F                    412   4e-135   Escherichia coli [E. coli]
ref|WP_042024603.1|  enterobactin synthase subunit F                    412   5e-135   Escherichia coli [E. coli]
ref|WP_042095916.1|  enterobactin synthase subunit F                    412   7e-135   Escherichia coli [E. coli]
ref|WP_031935251.1|  enterobactin synthase subunit F                    414   9e-135   
ref|WP_032166970.1|  enterobactin synthase subunit F                    418   9e-135   Escherichia coli [E. coli]
gb|KKB14604.1|  enterobactin synthase subunit F                         417   2e-134   Escherichia coli [E. coli]
ref|WP_033811575.1|  enterobactin synthase subunit F                    409   2e-134   
ref|WP_042037002.1|  enterobactin synthase subunit F                    408   3e-134   
gb|ERF96962.1|  enterobactin synthase subunit F                         417   3e-134   Escherichia coli O104:H21 str. CFSAN002237
ref|WP_042108069.1|  enterobactin synthase subunit F                    410   3e-134   Escherichia coli [E. coli]
ref|WP_042111299.1|  enterobactin synthase subunit F                    408   4e-134   Escherichia coli [E. coli]
ref|WP_042101800.1|  enterobactin synthase subunit F                    407   6e-134   
ref|WP_000293283.1|  enterobactin synthase subunit F                    417   9e-134   Escherichia coli [E. coli]
ref|WP_033553747.1|  enterobactin synthase subunit F                    418   1e-133   Escherichia coli [E. coli]
gb|KKB18726.1|  enterobactin synthase subunit F                         417   2e-133   Escherichia coli [E. coli]
ref|WP_032342524.1|  enterobactin synthase subunit F                    418   2e-133   Escherichia coli [E. coli]
ref|WP_001529595.1|  enterobactin synthase component F                  418   2e-133   Escherichia coli [E. coli]
ref|WP_001404770.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_039000066.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
gb|KHH47098.1|  enterobactin synthase subunit F                         417   2e-133   Escherichia coli [E. coli]
ref|WP_021545476.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_038348837.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_032182234.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_042082439.1|  enterobactin synthase subunit F                    408   2e-133   Escherichia coli [E. coli]
ref|WP_032242536.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_032305579.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
gb|ABV05016.1|  enterobactin synthetase component F                     417   2e-133   Escherichia coli HS
ref|WP_001723224.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_001704863.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_032291889.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_001425261.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_001415847.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_040080108.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_032227753.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_000077804.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_000077794.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_040091780.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_032084145.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_032200887.1|  enterobactin synthase subunit F                    417   2e-133   Enterobacteriaceae
ref|WP_000077809.1|  enterobactin synthase subunit F                    417   2e-133   Enterobacteriaceae
ref|WP_001511566.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_001455962.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_001393888.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_001706161.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_000077796.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_001575535.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_042966057.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_032298296.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_032198801.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_020240111.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_016236952.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_016246944.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_001654096.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_001673297.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_001543560.1|  enterobactin synthase component F                  417   2e-133   Enterobacteriaceae
ref|WP_001515014.1|  enterobactin synthase component F                  417   2e-133   Enterobacteriaceae
ref|WP_000077795.1|  MULTISPECIES: enterobactin synthase subunit F      417   2e-133   Enterobacteriaceae
ref|WP_023352386.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_001689379.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_001688498.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_001687288.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_001686199.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_000077791.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_000077806.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_044864064.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_041124048.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_033803493.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
gb|KGM73081.1|  amino acid adenylation domain protein                   417   2e-133   Escherichia coli [E. coli]
ref|WP_032227765.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_032190677.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_032223272.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_032179722.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_023486883.1|  Enterobactin synthetase component F, serine ...    417   2e-133   Escherichia coli [E. coli]
ref|WP_021558872.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_001645051.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_001635901.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_001396895.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_004091361.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_000077798.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_020239765.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_044789794.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_044066875.1|  enterobactin synthase subunit F                    417   2e-133   Enterobacteriaceae
gb|KHH51516.1|  enterobactin synthase subunit F                         417   2e-133   Escherichia coli [E. coli]
gb|KGT12016.1|  enterobactin synthase subunit F                         417   2e-133   Escherichia coli [E. coli]
ref|WP_032246478.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_032255593.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_032239310.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_032237954.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_033873198.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_025693512.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_032280049.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_032229674.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_032234405.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_001652871.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_003999838.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_001564507.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_001549051.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_000077805.1|  MULTISPECIES: enterobactin synthase component F    417   2e-133   Proteobacteria [purple bacteria]
ref|WP_000077807.1|  MULTISPECIES: enterobactin synthase component F    417   2e-133   Enterobacteriaceae
ref|WP_000077789.1|  enterobactin synthase subunit F                    417   2e-133   Enterobacteriaceae
ref|WP_000077797.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_001509666.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
ref|WP_040083755.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_032265287.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_032177019.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_042027706.1|  enterobactin synthase subunit F                    408   2e-133   Escherichia coli [E. coli]
ref|WP_001408565.1|  enterobactin synthase component F                  417   2e-133   Escherichia coli [E. coli]
gb|AIL39370.1|  EntF                                                    412   2e-133   Shigella flexneri Shi06HN006
ref|WP_042026495.1|  enterobactin synthase subunit F                    408   2e-133   
ref|WP_032254487.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_000077790.1|  enterobactin synthase subunit F                    417   2e-133   Escherichia coli [E. coli]
ref|WP_024255944.1|  enterobactin synthase subunit F                    407   2e-133   Escherichia coli [E. coli]
gb|EJZ68170.1|  amino acid adenylation domain protein                   409   2e-133   Shigella flexneri 1485-80
ref|WP_000077700.1|  enterobactin synthase subunit F                    417   3e-133   Enterobacteriaceae
ref|WP_001684700.1|  enterobactin synthase component F                  417   3e-133   Escherichia coli [E. coli]
gb|EID66327.1|  enterobactin synthase multienzyme complex compone...    417   3e-133   Escherichia coli W26
ref|WP_003984316.1|  enterobactin synthase component F                  417   3e-133   Escherichia coli [E. coli]
gb|AAB40785.1|  enterobactin synthetase component F                     418   3e-133   Escherichia coli [E. coli]
ref|WP_032270518.1|  enterobactin synthase component F                  417   3e-133   Escherichia coli [E. coli]
ref|WP_000077711.1|  enterobactin synthase subunit F                    417   3e-133   Escherichia coli [E. coli]
ref|WP_001594863.1|  enterobactin synthase component F                  417   3e-133   Escherichia coli [E. coli]
gb|EIQ47903.1|  enterobactin synthase component F                       417   3e-133   Shigella sonnei 3233-85
ref|WP_039022601.1|  enterobactin synthase subunit F                    417   3e-133   Escherichia coli [E. coli]
ref|WP_032281067.1|  enterobactin synthase subunit F                    417   3e-133   Escherichia coli [E. coli]
ref|WP_000077738.1|  enterobactin synthase subunit F                    417   3e-133   Escherichia coli [E. coli]
ref|WP_000077764.1|  enterobactin synthase subunit F                    412   3e-133   Escherichia coli [E. coli]
ref|WP_001732667.1|  enterobactin synthase component F                  417   3e-133   Escherichia coli [E. coli]
ref|WP_000077695.1|  enterobactin synthase subunit F                    417   3e-133   Escherichia coli [E. coli]
ref|WP_001597671.1|  enterobactin synthase component F                  417   3e-133   Escherichia coli [E. coli]
ref|WP_000077697.1|  enterobactin synthase subunit F                    417   3e-133   Escherichia coli [E. coli]
ref|WP_000077705.1|  enterobactin synthase subunit F                    417   3e-133   Escherichia coli [E. coli]
ref|WP_044803841.1|  enterobactin synthase subunit F                    417   3e-133   Escherichia coli [E. coli]
ref|WP_040062417.1|  enterobactin synthase subunit F                    417   3e-133   Escherichia coli [E. coli]
ref|WP_032211846.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_000077722.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_001460599.1|  enterobactin synthase component F                  417   4e-133   Escherichia coli [E. coli]
ref|WP_000077703.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_042630951.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_044722765.1|  enterobactin synthase subunit F                    417   4e-133   Enterobacteriaceae
ref|WP_032254784.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_032273434.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_032209989.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_000077734.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_032286356.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_001464218.1|  enterobactin synthase component F                  417   4e-133   Escherichia coli [E. coli]
ref|WP_044860581.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_032178325.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_033815956.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_000077679.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_033800940.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_001465213.1|  enterobactin synthase component F                  417   4e-133   Escherichia coli [E. coli]
ref|WP_000077702.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_000077724.1|  enterobactin synthase subunit F                    417   4e-133   Enterobacteriaceae
ref|WP_001669591.1|  enterobactin synthase component F                  417   4e-133   Escherichia coli [E. coli]
ref|WP_001494979.1|  enterobactin synthase component F                  417   4e-133   Escherichia coli [E. coli]
ref|WP_001372096.1|  enterobactin synthase component F                  417   4e-133   Enterobacteriaceae
ref|WP_044782256.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_033803869.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_001553051.1|  enterobactin synthase component F                  417   4e-133   Escherichia coli [E. coli]
ref|WP_001480267.1|  enterobactin synthase component F                  417   4e-133   Escherichia coli [E. coli]
ref|WP_001473919.1|  enterobactin synthase component F                  417   4e-133   Escherichia coli [E. coli]
ref|WP_021534198.1|  enterobactin synthase component F                  417   4e-133   Escherichia coli [E. coli]
ref|WP_000077696.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_001774360.1|  enterobactin synthase component F                  417   4e-133   Escherichia coli [E. coli]
ref|WP_000077801.1|  enterobactin synthase subunit F                    417   4e-133   Enterobacteriaceae
ref|WP_000077792.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_032286041.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_032309029.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_000077710.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_000077683.1|  enterobactin synthase subunit F                    417   4e-133   Shigella
ref|WP_000077684.1|  enterobactin synthase subunit F                    417   4e-133   Shigella sonnei
ref|WP_038977237.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_032186192.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_032317168.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_001557911.1|  enterobactin synthase component F                  417   4e-133   Escherichia coli [E. coli]
ref|WP_000077704.1|  enterobactin synthase subunit F                    417   4e-133   Escherichia coli [E. coli]
ref|WP_045154210.1|  enterobactin synthase subunit F                    408   4e-133   Escherichia coli [E. coli]
ref|WP_021526232.1|  enterobactin synthase component F                  416   4e-133   Escherichia coli [E. coli]
ref|WP_001391150.1|  enterobactin synthase component F                  416   4e-133   Escherichia coli [E. coli]
ref|WP_001512509.1|  enterobactin synthase component F                  416   4e-133   Escherichia coli [E. coli]
ref|WP_000077692.1|  enterobactin synthase subunit F                    416   4e-133   Escherichia coli [E. coli]
ref|WP_032267678.1|  enterobactin synthase subunit F                    416   4e-133   Escherichia coli [E. coli]
ref|WP_032217671.1|  enterobactin synthase subunit F                    416   4e-133   Escherichia coli [E. coli]
ref|WP_032358686.1|  enterobactin synthase subunit F                    416   4e-133   Escherichia coli [E. coli]
ref|WP_001462290.1|  enterobactin synthase component F                  416   4e-133   Escherichia coli [E. coli]
ref|WP_001402088.1|  enterobactin synthase component F                  416   4e-133   Enterobacteriaceae
ref|WP_000077681.1|  enterobactin synthase subunit F                    416   4e-133   Escherichia coli [E. coli]
ref|WP_032284652.1|  enterobactin synthase subunit F                    416   5e-133   Escherichia coli [E. coli]
ref|WP_000077715.1|  enterobactin synthase subunit F                    416   5e-133   Escherichia coli [E. coli]
ref|WP_001571365.1|  enterobactin synthase component F                  416   5e-133   Escherichia coli [E. coli]
ref|WP_032241553.1|  enterobactin synthase subunit F                    416   5e-133   Escherichia coli [E. coli]
ref|WP_042049032.1|  enterobactin synthase subunit F                    416   5e-133   Escherichia coli [E. coli]
ref|WP_001566157.1|  enterobactin synthase component F                  416   5e-133   Escherichia coli [E. coli]
ref|WP_001483390.1|  enterobactin synthase component F                  416   5e-133   Escherichia coli [E. coli]
ref|WP_000077728.1|  enterobactin synthase subunit F                    416   5e-133   Escherichia coli [E. coli]
ref|WP_000077727.1|  enterobactin synthase subunit F                    416   5e-133   Enterobacteriaceae
ref|WP_045172294.1|  enterobactin synthase subunit F                    416   5e-133   Escherichia coli [E. coli]
ref|WP_032197801.1|  enterobactin synthase subunit F                    416   5e-133   Escherichia coli [E. coli]
ref|WP_032191425.1|  enterobactin synthase subunit F                    416   5e-133   Escherichia coli [E. coli]
ref|WP_001477998.1|  enterobactin synthase component F                  416   5e-133   Escherichia coli [E. coli]
ref|WP_001657877.1|  enterobactin synthase component F                  416   5e-133   Escherichia coli [E. coli]
ref|WP_000077803.1|  enterobactin synthase subunit F                    416   5e-133   Escherichia coli [E. coli]
ref|WP_001475099.1|  enterobactin synthase component F                  416   5e-133   Escherichia coli [E. coli]
ref|WP_001680686.1|  enterobactin synthase component F                  416   5e-133   Escherichia coli [E. coli]
ref|WP_032185811.1|  enterobactin synthase subunit F                    416   5e-133   Escherichia coli [E. coli]
ref|WP_000077706.1|  enterobactin synthase subunit F                    416   5e-133   Escherichia coli [E. coli]
ref|WP_040089779.1|  enterobactin synthase subunit F                    416   5e-133   Escherichia coli [E. coli]
ref|WP_000077725.1|  enterobactin synthase subunit F                    416   5e-133   Escherichia coli [E. coli]
ref|WP_023143102.1|  enterobactin synthetase component F                416   5e-133   Escherichia coli [E. coli]
ref|WP_021578403.1|  enterobactin synthase component F                  416   5e-133   Escherichia coli [E. coli]
ref|WP_001665237.1|  enterobactin synthase component F                  416   5e-133   Escherichia coli [E. coli]
ref|WP_001471195.1|  enterobactin synthase component F                  416   5e-133   Escherichia coli [E. coli]
ref|WP_000077709.1|  enterobactin synthase subunit F                    416   5e-133   Escherichia coli [E. coli]
ref|WP_000077707.1|  enterobactin synthase subunit F                    416   5e-133   Escherichia coli [E. coli]
ref|WP_000077708.1|  enterobactin synthase subunit F                    416   5e-133   Enterobacteriaceae
ref|WP_024243596.1|  enterobactin synthase subunit F                    416   5e-133   Escherichia coli [E. coli]
ref|WP_001548293.1|  enterobactin synthase component F                  416   5e-133   Escherichia coli [E. coli]
ref|WP_000077682.1|  enterobactin synthase subunit F                    416   5e-133   Escherichia coli [E. coli]
ref|WP_032216627.1|  enterobactin synthase subunit F                    416   5e-133   Escherichia coli [E. coli]
ref|WP_001716284.1|  enterobactin synthase component F                  416   5e-133   Escherichia coli [E. coli]
ref|WP_001668457.1|  enterobactin synthase component F                  416   5e-133   Escherichia coli [E. coli]
ref|WP_001763921.1|  enterobactin synthase component F                  416   5e-133   Escherichia coli [E. coli]
ref|WP_001615965.1|  enterobactin synthase component F                  416   5e-133   Escherichia coli [E. coli]
ref|WP_024254631.1|  enterobactin synthase subunit F                    407   5e-133   Escherichia coli [E. coli]
ref|WP_044167456.1|  enterobactin synthase subunit F                    417   5e-133   
ref|WP_000077701.1|  enterobactin synthase subunit F                    416   6e-133   Escherichia coli [E. coli]
ref|WP_000077721.1|  enterobactin synthase subunit F                    416   6e-133   Escherichia coli [E. coli]
ref|WP_003963786.1|  enterobactin synthase component F                  416   6e-133   Escherichia coli [E. coli]
ref|WP_032251301.1|  enterobactin synthase subunit F                    416   6e-133   Escherichia coli [E. coli]
ref|WP_032259535.1|  enterobactin synthase subunit F                    416   6e-133   Escherichia coli [E. coli]
ref|WP_000077699.1|  enterobactin synthase subunit F                    416   6e-133   Escherichia coli [E. coli]
ref|WP_032252246.1|  enterobactin synthase subunit F                    416   6e-133   Escherichia coli [E. coli]
ref|WP_023156495.1|  enterobactin synthetase component F                416   6e-133   Escherichia coli [E. coli]
ref|WP_001704429.1|  enterobactin synthase component F                  416   6e-133   Escherichia coli [E. coli]
ref|WP_000077712.1|  enterobactin synthase subunit F                    416   6e-133   Escherichia coli [E. coli]
ref|WP_000077729.1|  enterobactin synthase subunit F                    416   6e-133   Escherichia coli [E. coli]
ref|WP_039022161.1|  enterobactin synthase subunit F                    416   6e-133   Enterobacteriaceae
ref|WP_025650483.1|  enterobactin synthase subunit F                    416   6e-133   Escherichia coli [E. coli]
ref|WP_000077698.1|  enterobactin synthase subunit F                    416   6e-133   Escherichia coli [E. coli]
ref|WP_029488645.1|  enterobactin synthase subunit F                    416   6e-133   Enterobacteriaceae
ref|WP_032204125.1|  enterobactin synthase subunit F                    416   6e-133   Escherichia coli [E. coli]
ref|WP_023486464.1|  Enterobactin synthetase component F, serine ...    416   6e-133   Escherichia coli [E. coli]
ref|WP_016244372.1|  enterobactin synthase component F                  416   6e-133   Escherichia coli [E. coli]
ref|WP_001501113.1|  enterobactin synthase component F                  416   6e-133   Escherichia coli [E. coli]
ref|WP_001499505.1|  enterobactin synthase component F                  416   6e-133   Escherichia coli [E. coli]
ref|WP_000077719.1|  enterobactin synthase subunit F                    416   6e-133   Escherichia coli [E. coli]
ref|WP_000077678.1|  enterobactin synthase subunit F                    416   6e-133   Escherichia coli [E. coli]
ref|WP_024226869.1|  enterobactin synthase subunit F                    416   6e-133   Escherichia coli [E. coli]
ref|WP_039060971.1|  enterobactin synthase subunit F                    416   6e-133   Shigella flexneri
ref|WP_033817360.1|  enterobactin synthase subunit F                    416   6e-133   Escherichia coli [E. coli]
ref|WP_021502839.1|  amino acid adenylation domain protein              408   6e-133   Escherichia coli [E. coli]
ref|WP_032225782.1|  enterobactin synthase subunit F                    416   6e-133   Escherichia coli [E. coli]
gb|ADB98044.1|  EntF                                                    417   7e-133   Escherichia coli [E. coli]
ref|WP_024249744.1|  enterobactin synthase component F                  416   8e-133   Enterobacteriaceae
ref|WP_032230893.1|  enterobactin synthase subunit F                    416   8e-133   
ref|WP_032277972.1|  enterobactin synthase subunit F                    416   9e-133   
ref|WP_032205794.1|  enterobactin synthase subunit F                    416   9e-133   
emb|CDL48982.1|  Enterobactin synthetase component F, serine acti...    409   1e-132   
ref|WP_042090918.1|  enterobactin synthase subunit F                    409   1e-132   
ref|WP_001454722.1|  enterobactin synthase component F                  415   2e-132   
ref|WP_001569560.1|  enterobactin synthase component F                  415   2e-132   
ref|WP_032291269.1|  enterobactin synthase subunit F                    415   2e-132   
ref|WP_001430116.1|  enterobactin synthase component F                  415   2e-132   
gb|EDV88040.1|  enterobactin synthetase component F                     415   2e-132   
ref|WP_032240122.1|  enterobactin synthase subunit F                    415   2e-132   
ref|WP_021568673.1|  enterobactin synthase component F                  415   2e-132   
ref|WP_001741338.1|  enterobactin synthase component F                  415   2e-132   
ref|WP_001639241.1|  enterobactin synthase component F                  415   2e-132   
ref|WP_001646795.1|  enterobactin synthase component F                  415   2e-132   
ref|WP_001468215.1|  enterobactin synthase component F                  415   2e-132   
ref|WP_001734955.1|  enterobactin synthase component F                  415   2e-132   
ref|WP_032257115.1|  enterobactin synthase subunit F                    415   2e-132   
ref|WP_001648547.1|  enterobactin synthase component F                  415   2e-132   
ref|WP_028985406.1|  enterobactin synthase subunit F                    415   2e-132   
ref|WP_042099638.1|  enterobactin synthase subunit F                    415   2e-132   
ref|WP_032215219.1|  enterobactin synthase subunit F                    415   2e-132   
ref|WP_001655226.1|  enterobactin synthase component F                  414   2e-132   
gb|AAA92015.1|  enterobactin                                            414   2e-132   
ref|WP_024229081.1|  enterobactin synthase subunit F                    414   2e-132   
ref|WP_032302026.1|  enterobactin synthase subunit F                    414   3e-132   
ref|WP_000077808.1|  enterobactin synthase subunit F                    414   3e-132   
ref|WP_044689189.1|  enterobactin synthase subunit F                    408   3e-132   
ref|WP_032329276.1|  enterobactin synthase subunit F                    398   3e-132   
ref|WP_016230858.1|  enterobactin synthase component F                  414   4e-132   
ref|WP_000077741.1|  enterobactin synthase component F                  414   4e-132   
ref|WP_044810774.1|  enterobactin synthase subunit F                    409   4e-132   
ref|WP_000077739.1|  enterobactin synthase subunit F                    414   4e-132   
ref|WP_001666376.1|  enterobactin synthase component F                  414   4e-132   
gb|KGA00448.1|  amino acid adenylation domain protein                   414   4e-132   
ref|WP_000077742.1|  enterobactin synthase subunit F                    414   4e-132   
ref|WP_001532397.1|  enterobactin synthase component F                  414   4e-132   
ref|WP_001721169.1|  enterobactin synthase component F                  414   4e-132   
ref|WP_001492831.1|  enterobactin synthase component F                  414   4e-132   
ref|WP_021562102.1|  enterobactin synthase component F                  414   5e-132   
ref|WP_033548623.1|  enterobactin synthase subunit F                    414   5e-132   
ref|WP_001556853.1|  enterobactin synthase component F                  414   5e-132   
ref|WP_001538439.1|  enterobactin synthase component F                  414   5e-132   
ref|WP_000077743.1|  enterobactin synthase subunit F                    414   5e-132   
ref|WP_001700499.1|  enterobactin synthase component F                  414   5e-132   
ref|WP_042067083.1|  enterobactin synthase subunit F                    414   5e-132   
ref|WP_023151199.1|  enterobactin synthetase component F                414   5e-132   
ref|WP_034166783.1|  enterobactin synthase subunit F                    414   6e-132   
ref|WP_001497422.1|  enterobactin synthase component F                  414   6e-132   
ref|WP_001712620.1|  enterobactin synthase component F                  414   6e-132   
ref|WP_001702911.1|  enterobactin synthase component F                  414   6e-132   
ref|WP_042018768.1|  enterobactin synthase subunit F                    414   6e-132   
ref|WP_032336462.1|  enterobactin synthase subunit F                    413   6e-132   
ref|WP_032361567.1|  enterobactin synthase subunit F                    413   7e-132   
gb|KGI51187.1|  Enterobactin synthetase component F, serine activ...    413   7e-132   
ref|WP_016233918.1|  enterobactin synthase component F                  413   7e-132   
ref|WP_000077720.1|  enterobactin synthase subunit F                    413   7e-132   
ref|WP_000077771.1|  enterobactin synthase subunit F                    413   7e-132   
ref|WP_000077762.1|  enterobactin synthase subunit F                    413   8e-132   
ref|WP_000077694.1|  enterobactin synthase subunit F                    413   9e-132   
ref|WP_024705454.1|  enterobactin synthase subunit F                    413   9e-132   
ref|WP_025745334.1|  enterobactin synthase subunit F                    413   9e-132   
ref|WP_021580574.1|  enterobactin synthase component F                  413   9e-132   
ref|WP_016239201.1|  enterobactin synthase component F                  413   9e-132   
ref|WP_033544878.1|  enterobactin synthase subunit F                    413   9e-132   
ref|WP_042052970.1|  enterobactin synthase subunit F                    413   1e-131   
ref|WP_001682690.1|  enterobactin synthase component F                  413   1e-131   
ref|WP_032217905.1|  enterobactin synthase subunit F                    413   1e-131   
ref|WP_024232035.1|  enterobactin synthase subunit F                    413   1e-131   
ref|WP_001596659.1|  enterobactin synthase component F                  413   1e-131   
ref|WP_000077680.1|  enterobactin synthase subunit F                    413   1e-131   
ref|WP_000077766.1|  enterobactin synthase subunit F                    413   1e-131   
ref|WP_020231898.1|  enterobactin synthase subunit F                    413   1e-131   
ref|WP_021515830.1|  enterobactin synthase component F                  413   1e-131   
ref|WP_001514123.1|  enterobactin synthase component F                  413   1e-131   
ref|WP_042091298.1|  enterobactin synthase subunit F                    413   1e-131   
ref|WP_000077714.1|  enterobactin synthase subunit F                    413   1e-131   
ref|WP_000077802.1|  enterobactin synthase subunit F                    413   1e-131   
ref|WP_039065858.1|  enterobactin synthase subunit F                    412   1e-131   
ref|WP_025715261.1|  enterobactin synthase subunit F                    412   1e-131   
ref|WP_023352669.1|  enterobactin synthase component F                  413   1e-131   
ref|WP_021532015.1|  enterobactin synthase component F                  413   1e-131   
ref|WP_000077765.1|  MULTISPECIES: enterobactin synthase subunit F      413   1e-131   
ref|WP_024242224.1|  enterobactin synthase subunit F                    413   1e-131   
ref|WP_001621290.1|  enterobactin synthase component F                  413   1e-131   
ref|WP_024704901.1|  enterobactin synthase subunit F                    412   1e-131   
ref|WP_001552550.1|  enterobactin synthase component F                  413   1e-131   
ref|WP_000077768.1|  enterobactin synthase subunit F                    413   1e-131   
ref|WP_044806137.1|  enterobactin synthase subunit F                    412   1e-131   
ref|WP_021546034.1|  enterobactin synthase component F                  412   1e-131   
ref|WP_000077740.1|  enterobactin synthase component F                  412   1e-131   
ref|WP_001632709.1|  enterobactin synthase component F                  412   2e-131   
ref|WP_001620479.1|  enterobactin synthase component F                  412   2e-131   
ref|WP_003910061.1|  enterobactin synthase component F                  412   2e-131   
gb|ABJ00007.1|  enterobactin synthase multienzyme complex compone...    413   2e-131   
gb|KFH78632.1|  enterobactin synthase subunit F                         412   2e-131   
ref|WP_001616612.1|  enterobactin synthase component F                  412   2e-131   
ref|WP_000077713.1|  enterobactin synthase subunit F                    412   2e-131   
ref|WP_003903310.1|  enterobactin synthase component F                  412   2e-131   
ref|WP_001615908.1|  enterobactin synthase component F                  412   2e-131   
ref|WP_003919476.1|  enterobactin synthase component F                  412   3e-131   
ref|WP_042099224.1|  enterobactin synthase subunit F                    412   3e-131   
ref|WP_021560761.1|  enterobactin synthase component F                  412   3e-131   
ref|WP_021520574.1|  enterobactin synthase component F                  412   3e-131   
ref|WP_024247751.1|  enterobactin synthase subunit F                    411   4e-131   
ref|WP_001567612.1|  enterobactin synthase component F                  411   4e-131   
ref|WP_021531116.1|  enterobactin synthase component F                  411   4e-131   
ref|WP_042093613.1|  enterobactin synthase subunit F                    411   4e-131   
ref|WP_021540821.1|  enterobactin synthase component F                  411   4e-131   
ref|WP_000077769.1|  enterobactin synthase subunit F                    411   4e-131   
ref|WP_021574258.1|  enterobactin synthase component F                  411   4e-131   
gb|EKI31890.1|  enterobactin synthetase component F                     411   4e-131   
ref|WP_016159124.1|  MULTISPECIES: enterobactin synthase component F    411   5e-131   
ref|WP_042022446.1|  enterobactin synthase subunit F                    411   5e-131   
ref|WP_001667423.1|  enterobactin synthase component F                  411   5e-131   
ref|WP_000077772.1|  enterobactin synthase subunit F                    411   5e-131   
gb|ETJ22459.1|  hypothetical protein Q609_ECAC01633G0001                401   5e-131   
ref|WP_021574503.1|  enterobactin synthase component F                  411   5e-131   
ref|WP_000077677.1|  enterobactin synthase subunit F                    411   5e-131   
ref|WP_032247976.1|  enterobactin synthase subunit F                    411   6e-131   
ref|WP_001765771.1|  enterobactin synthase component F                  411   6e-131   
ref|WP_001729664.1|  enterobactin synthase component F                  411   6e-131   
ref|WP_033546440.1|  enterobactin synthase subunit F                    411   6e-131   
ref|WP_033554947.1|  enterobactin synthase subunit F                    411   6e-131   
ref|WP_032170885.1|  enterobactin synthase subunit F                    411   6e-131   
ref|WP_001764327.1|  enterobactin synthase component F                  410   7e-131   
ref|WP_000077761.1|  enterobactin synthase subunit F                    410   7e-131   
ref|WP_000077782.1|  enterobactin synthase subunit F                    410   7e-131   
ref|WP_032332339.1|  enterobactin synthase subunit F                    407   8e-131   
ref|WP_024225684.1|  enterobactin synthase subunit F                    410   8e-131   
ref|WP_032102129.1|  enterobactin synthase subunit F                    408   9e-131   
ref|WP_000077750.1|  enterobactin synthase subunit F                    410   9e-131   
ref|WP_000077751.1|  enterobactin synthase subunit F                    410   9e-131   
ref|WP_021556577.1|  enterobactin synthase component F                  410   1e-130   
ref|WP_000077788.1|  enterobactin synthase subunit F                    410   1e-130   
ref|WP_023307743.1|  enterobactin synthase component F                  410   1e-130   
ref|WP_044188624.1|  enterobactin synthase subunit F                    410   1e-130   
ref|WP_000077780.1|  enterobactin synthase subunit F                    410   1e-130   
ref|WP_000077744.1|  enterobactin synthase subunit F                    410   1e-130   
ref|WP_021577121.1|  enterobactin synthase component F                  410   1e-130   
emb|CCJ43051.1|  ATP-dependent serine activating enzyme                 410   1e-130   
ref|WP_044726386.1|  enterobactin synthase subunit F                    409   2e-130   
ref|WP_038988707.1|  enterobactin synthase subunit F                    410   2e-130   
ref|WP_000077756.1|  enterobactin synthase subunit F                    410   2e-130   
ref|WP_001561615.1|  enterobactin synthase component F                  410   2e-130   
ref|WP_001591660.1|  enterobactin synthase component F                  409   2e-130   
ref|WP_044063597.1|  enterobactin synthase subunit F                    409   2e-130   
ref|WP_001357850.1|  enterobactin synthase subunit F                    409   2e-130   
ref|WP_001614188.1|  enterobactin synthase component F                  409   2e-130   
ref|WP_003914986.1|  enterobactin synthase component F                  409   2e-130   
ref|WP_042091167.1|  enterobactin synthase subunit F                    409   2e-130   
ref|WP_000077753.1|  enterobactin synthase subunit F                    409   2e-130   
ref|WP_042009705.1|  enterobactin synthase subunit F                    409   2e-130   
ref|WP_021523805.1|  enterobactin synthase component F                  409   2e-130   
ref|WP_021515471.1|  enterobactin synthase component F                  409   2e-130   
ref|WP_028132299.1|  enterobactin synthase subunit F                    409   2e-130   
ref|WP_001558782.1|  enterobactin synthase component F                  409   3e-130   
ref|WP_000081329.1|  enterobactin synthase subunit F                    409   3e-130   
ref|WP_001524250.1|  enterobactin synthase component F                  409   3e-130   
ref|WP_042056322.1|  enterobactin synthase subunit F                    409   3e-130   
gb|END35122.1|  enterobactin synthase component F                       407   3e-130   
ref|WP_042114393.1|  enterobactin synthase subunit F                    409   3e-130   
ref|WP_032292716.1|  enterobactin synthase subunit F                    409   3e-130   
ref|WP_000077767.1|  enterobactin synthase subunit F                    409   3e-130   
ref|WP_001545435.1|  enterobactin synthase component F                  409   3e-130   
ref|WP_033807662.1|  enterobactin synthase subunit F                    409   3e-130   
ref|WP_042028051.1|  enterobactin synthase subunit F                    409   3e-130   
ref|WP_021549095.1|  enterobactin synthase component F                  409   3e-130   
ref|WP_044694826.1|  enterobactin synthase subunit F                    409   3e-130   
ref|WP_044076817.1|  enterobactin synthase subunit F                    409   4e-130   
ref|WP_000077735.1|  enterobactin synthase subunit F                    409   4e-130   
ref|WP_021550401.1|  enterobactin synthase component F                  409   4e-130   
ref|WP_000077758.1|  enterobactin synthase subunit F                    409   4e-130   
ref|WP_023156859.1|  enterobactin synthetase component F                409   4e-130   
ref|WP_000077690.1|  MULTISPECIES: enterobactin synthase subunit F      409   4e-130   
ref|WP_042098509.1|  enterobactin synthase subunit F                    409   4e-130   
ref|WP_044706080.1|  enterobactin synthase subunit F                    409   4e-130   
gb|EIN63514.1|  enterobactin synthetase component F                     408   5e-130   
ref|WP_033871911.1|  enterobactin synthase subunit F                    408   5e-130   
ref|WP_032269791.1|  enterobactin synthase subunit F                    408   5e-130   
ref|WP_039060963.1|  enterobactin synthase subunit F                    408   5e-130   
ref|WP_039059028.1|  enterobactin synthase subunit F                    408   5e-130   
ref|WP_000077787.1|  enterobactin synthase subunit F                    408   5e-130   
gb|AER83236.1|  enterobactin synthase subunit F                         409   5e-130   
ref|WP_042098437.1|  enterobactin synthase subunit F                    408   5e-130   
gb|EHV28879.1|  amino acid adenylation domain protein                   408   5e-130   
ref|WP_039060038.1|  MULTISPECIES: enterobactin synthase subunit F      408   6e-130   
ref|WP_000077775.1|  enterobactin synthase subunit F                    408   6e-130   
ref|WP_000077777.1|  MULTISPECIES: enterobactin synthase subunit F      408   6e-130   
ref|WP_042964066.1|  enterobactin synthase subunit F                    408   6e-130   
ref|WP_044806706.1|  enterobactin synthase subunit F                    408   6e-130   
ref|WP_000077785.1|  enterobactin synthase subunit F                    408   6e-130   
ref|WP_032328746.1|  enterobactin synthase subunit F                    408   6e-130   
ref|WP_000077717.1|  enterobactin synthase subunit F                    408   6e-130   
ref|WP_033810477.1|  enterobactin synthase subunit F                    408   6e-130   
ref|WP_032357872.1|  enterobactin synthase subunit F                    408   6e-130   
ref|WP_044866041.1|  enterobactin synthase subunit F                    408   6e-130   
gb|EKH34588.1|  enterobactin synthetase component F                     408   6e-130   
ref|WP_000077747.1|  MULTISPECIES: enterobactin synthase subunit F      408   6e-130   
ref|WP_000077778.1|  enterobactin synthase subunit F                    408   6e-130   
ref|WP_032168409.1|  enterobactin synthase subunit F                    408   6e-130   
ref|WP_000077800.1|  enterobactin synthase subunit F                    408   7e-130   
ref|WP_032220423.1|  enterobactin synthase subunit F                    408   7e-130   
ref|WP_001489361.1|  enterobactin synthase component F                  408   7e-130   
ref|WP_001507008.1|  enterobactin synthase component F                  408   7e-130   
ref|WP_000077693.1|  enterobactin synthase subunit F                    408   7e-130   
ref|WP_033813877.1|  enterobactin synthase subunit F                    408   7e-130   
ref|WP_039064596.1|  enterobactin synthase subunit F                    408   7e-130   
ref|WP_001484387.1|  enterobactin synthase component F                  408   7e-130   
ref|WP_038341493.1|  enterobactin synthase subunit F                    408   7e-130   
ref|WP_000077779.1|  enterobactin synthase subunit F                    408   7e-130   
gb|KHI35575.1|  enterobactin synthase subunit F                         408   7e-130   
ref|WP_000077786.1|  enterobactin synthase subunit F                    408   7e-130   
ref|WP_029305353.1|  enterobactin synthase subunit F                    408   7e-130   
ref|WP_024234830.1|  enterobactin synthase subunit F                    408   7e-130   
ref|WP_001624832.1|  enterobactin synthase component F                  408   7e-130   
ref|WP_032310918.1|  enterobactin synthase component F                  408   7e-130   
ref|WP_024256261.1|  enterobactin synthase subunit F                    408   7e-130   
ref|WP_024251299.1|  enterobactin synthase subunit F                    408   7e-130   
ref|WP_001582445.1|  enterobactin synthase component F                  408   7e-130   
ref|WP_001361260.1|  enterobactin synthase component F                  408   7e-130   



>gb|ENO08615.1| enterobactin synthase subunit F [Escherichia coli O157:H43 str. 
T22]
Length=258

 Score =   420 bits (1079),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  34   DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  93

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  94   YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  153

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  154  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  213

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  214  TSGSTGRPKGVMVGQTAIVNRLLWMQ  239



>gb|EIQ77162.1| enterobactin synthase component F domain protein, partial [Shigella 
flexneri 1235-66]
Length=365

 Score =   414 bits (1064),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 202/205 (99%), Positives = 204/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  161  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  220

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREM EQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  221  YREMHEQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  280

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLT+LCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  281  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTNLCYNAPLTPQGSAPLQLSQPHHTAYIIF  340

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWM  620
            TSGSTGRPKGVMVGQTAIVNRLLWM
Sbjct  341  TSGSTGRPKGVMVGQTAIVNRLLWM  365



>ref|WP_042108385.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=416

 Score =   415 bits (1066),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  122  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  181

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  182  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  241

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRF DVP+LTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  242  RLKMMLEDARPSLLITTDDQLPRFVDVPDLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  301

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  302  TSGSTGRPKGVMVGQTAIVNRLLWMQ  327



>ref|WP_044818035.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=456

 Score =   416 bits (1069),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  13   DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  72

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  73   YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  132

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  133  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  192

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  193  TSGSTGRPKGVMVGQTAIVNRLLWMQ  218



>ref|WP_045178246.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=268

 Score =   408 bits (1049),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 199/206 (97%), Positives = 203/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARY FS
Sbjct  34   DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYQFS  93

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRE GVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  94   YREMREQVVALANLLREHGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  153

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRF+DVP+LT+LCYNAPLTPQGSAPLQ SQPHHTAYIIF
Sbjct  154  RLKMMLEDARPSLLITTDDQLPRFADVPDLTNLCYNAPLTPQGSAPLQFSQPHHTAYIIF  213

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  214  TSGSTGRPKGVMVGQTAIVNRLLWMQ  239



>ref|WP_044718481.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=513

 Score =   409 bits (1050),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 200/206 (97%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQ+EIPETTLSALVAEQAAKTPDAPALADARY FS
Sbjct  130  DPALLCGDVDIMLPGEYAQLAQINATQIEIPETTLSALVAEQAAKTPDAPALADARYQFS  189

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  190  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  249

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRF+DVP+LT LCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  250  RLKMMLEDARPSLLITTDDQLPRFADVPDLTRLCYNAPLTPQGSAPLQLSQPHHTAYIIF  309

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  310  TSGSTGRPKGVMVGQTAIVNRLLWMQ  335



>ref|WP_032107509.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=536

 Score =   409 bits (1051),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 200/206 (97%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARY FS
Sbjct  261  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYQFS  320

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRE GVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  321  YREMREQVVALANLLREHGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  380

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRF+DVP+LT+LCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  381  RLKMMLEDARPSLLITTDDQLPRFADVPDLTNLCYNAPLTPQGSAPLQLSQPHHTAYIIF  440

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  441  TSGSTGRPKGVMVGQTAIVNRLLWMQ  466



>ref|WP_044702104.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=788

 Score =   417 bits (1071),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  412  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  471

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  472  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  531

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  532  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  591

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  592  TSGSTGRPKGVMVGQTAIVNRLLWMQ  617



>ref|WP_032234678.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=805

 Score =   417 bits (1071),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_042106474.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=684

 Score =   413 bits (1062),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DP+LLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARY FS
Sbjct  423  DPSLLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYQFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSD+PNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDIPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_042967465.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=804

 Score =   416 bits (1070),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_020241343.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=642

 Score =   410 bits (1055),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 201/206 (98%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEY QLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYVQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVE GAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVETGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRF+DVP+LTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFADVPDLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>gb|EHW79821.1| amino acid adenylation domain protein [Escherichia coli DEC10C]
Length=904

 Score =   417 bits (1072),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  34   DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  93

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  94   YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  153

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  154  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  213

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  214  TSGSTGRPKGVMVGQTAIVNRLLWMQ  239



>ref|WP_042005445.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=871

 Score =   416 bits (1069),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>gb|AHF25994.1| enterobactin synthetase component F, partial [uncultured bacterium 
Contigcl_1559]
Length=921

 Score =   417 bits (1072),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_042964922.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=876

 Score =   416 bits (1069),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>gb|KDW56564.1| amino acid adenylation domain protein [Escherichia coli 2-005-03_S3_C1]
Length=892

 Score =   416 bits (1068),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077723.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=919

 Score =   416 bits (1069),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>emb|CDL28835.1| Enterobactin synthetase component F, serine activating enzyme 
[Escherichia coli ISC7]
Length=976

 Score =   417 bits (1072),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  104  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  163

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  164  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  223

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  224  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  283

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  284  TSGSTGRPKGVMVGQTAIVNRLLWMQ  309



>ref|WP_044698557.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=985

 Score =   417 bits (1072),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>gb|EGJ91570.1| syringomycin synthetase [Shigella flexneri 2747-71]
Length=888

 Score =   414 bits (1064),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/206 (99%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  34   DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  93

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREM EQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  94   YREMHEQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  153

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLT+LCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  154  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTNLCYNAPLTPQGSAPLQLSQPHHTAYIIF  213

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  214  TSGSTGRPKGVMVGQTAIVNRLLWMQ  239



>ref|WP_042076351.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=715

 Score =   409 bits (1052),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 200/205 (98%), Positives = 203/205 (99%), Gaps = 0/205 (0%)
 Frame = +3

Query  9    PALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFSY  188
            P+LLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARY FSY
Sbjct  424  PSLLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYQFSY  483

Query  189  REMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDDR  368
            REMREQVVALANLLRER VKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDDR
Sbjct  484  REMREQVVALANLLRERSVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDDR  543

Query  369  LKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIFT  548
            LKMMLEDARPSLLITTDDQLPRFSD+PNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIFT
Sbjct  544  LKMMLEDARPSLLITTDDQLPRFSDIPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIFT  603

Query  549  SGSTGRPKGVMVGQTAIVNRLLWMQ  623
            SGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  604  SGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_033812370.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=687

 Score =   408 bits (1048),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/206 (97%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADA Y FS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADAHYQFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRF+DVP+LT+LCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFADVPDLTNLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>gb|EFK45522.1| enterobactin synthetase component F [Escherichia coli MS 119-7]
Length=1042

 Score =   417 bits (1071),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_042046769.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=879

 Score =   413 bits (1061),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DP+LLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARY FS
Sbjct  423  DPSLLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYQFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSD+PNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDIPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077763.1| enterobactin synthase subunit F, partial [Escherichia coli]
 gb|ELL39702.1| enterobactin synthase subunit F, partial [Escherichia coli J96]
Length=873

 Score =   412 bits (1060),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DP+LLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARY FS
Sbjct  423  DPSLLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYQFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSD+PNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDIPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_042024603.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=884

 Score =   412 bits (1060),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DP+LLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARY FS
Sbjct  423  DPSLLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYQFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSD+PNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDIPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_042095916.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=886

 Score =   412 bits (1059),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DP+LLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARY FS
Sbjct  423  DPSLLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYQFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSD+PNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDIPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_031935251.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=958

 Score =   414 bits (1063),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DP+LLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARY FS
Sbjct  88   DPSLLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYQFS  147

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  148  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  207

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSD+PNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  208  RLKMMLEDARPSLLITTDDQLPRFSDIPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  267

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  268  TSGSTGRPKGVMVGQTAIVNRLLWMQ  293



>ref|WP_032166970.1| enterobactin synthase subunit F, partial [Escherichia coli]
 gb|KDP17263.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=1137

 Score =   418 bits (1074),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  267  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  326

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  327  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  386

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  387  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  446

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  447  TSGSTGRPKGVMVGQTAIVNRLLWMQ  472



>gb|KKB14604.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=1125

 Score =   417 bits (1071),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_033811575.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=802

 Score =   409 bits (1050),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 200/206 (97%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQ+EIPETTLSALVAEQAAKTPDAPALADARY FS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQIEIPETTLSALVAEQAAKTPDAPALADARYQFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRF+DVP+LT LCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFADVPDLTRLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_042037002.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=800

 Score =   408 bits (1049),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 201/206 (98%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPAL DARY FS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALVDARYQFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLT+LCYNAPLTPQGSAPLQLSQPH+TAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTNLCYNAPLTPQGSAPLQLSQPHNTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>gb|ERF96962.1| enterobactin synthase subunit F, partial [Escherichia coli O104:H21 
str. CFSAN002237]
Length=1155

 Score =   417 bits (1072),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  285  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  344

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  345  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  404

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  405  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  464

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  465  TSGSTGRPKGVMVGQTAIVNRLLWMQ  490



>ref|WP_042108069.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=875

 Score =   410 bits (1054),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 201/206 (98%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DP+LLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARY FS
Sbjct  423  DPSLLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYQFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSD+PNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDIPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQ AIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQQAIVNRLLWMQ  628



>ref|WP_042111299.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=800

 Score =   408 bits (1048),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 200/206 (97%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADA Y FS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADAHYQFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRF+DVP+LT+LCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFADVPDLTNLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_042101800.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=798

 Score =   407 bits (1047),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 199/206 (97%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQ+EIPETTLSALVAEQAAKTPDAPALADARY FS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQIEIPETTLSALVAEQAAKTPDAPALADARYQFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRF+DVP+LT LCYNAPLTPQGSAPL+LSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFADVPDLTRLCYNAPLTPQGSAPLKLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000293283.1| enterobactin synthase subunit F, partial [Escherichia coli]
 gb|EIL24163.1| enterobactin synthase subunit F, partial [Escherichia coli O111:H8 
str. CVM9574]
Length=1204

 Score =   417 bits (1071),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  334  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  393

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  394  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  453

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  454  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  513

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  514  TSGSTGRPKGVMVGQTAIVNRLLWMQ  539



>ref|WP_033553747.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   418 bits (1074),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>gb|KKB18726.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=1241

 Score =   417 bits (1071),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032342524.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KEO28045.1| enterobactin synthase component F [Escherichia coli 5-366-08_S4_C1]
Length=1293

 Score =   418 bits (1074),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001529595.1| enterobactin synthase component F [Escherichia coli]
 gb|END99373.1| enterobactin synthase component F [Escherichia coli P0301904.3]
 gb|KDU36836.1| enterobactin synthase component F [Escherichia coli 3-373-03_S1_C3]
Length=1293

 Score =   418 bits (1074),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001404770.1| enterobactin synthase component F [Escherichia coli]
 gb|ENB15660.1| enterobactin synthase component F [Escherichia coli 2875150]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_039000066.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>gb|KHH47098.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_021545476.1| enterobactin synthase component F [Escherichia coli]
 gb|EQV15357.1| enterobactin synthase component F [Escherichia coli HVH 221 (4-3136817)]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_038348837.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032182234.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KDZ01130.1| enterobactin synthase component F [Escherichia coli 2-474-04_S1_C2]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_042082439.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=868

 Score =   408 bits (1049),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 200/206 (97%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            +P+LLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARY FS
Sbjct  423  NPSLLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYQFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSD+PNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDIPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQ AIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQQAIVNRLLWMQ  628



>ref|WP_032242536.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KEL23299.1| enterobactin synthase component F [Escherichia coli 3-373-03_S4_C3]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032305579.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KEL05378.1| enterobactin synthase component F [Escherichia coli 4-203-08_S4_C2]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>gb|ABV05016.1| enterobactin synthetase component F [Escherichia coli HS]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001723224.1| enterobactin synthase component F [Escherichia coli]
 gb|EMW37318.1| enterobactin synthase component F [Escherichia coli 2785200]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001704863.1| enterobactin synthase component F [Escherichia coli]
 gb|EMV64196.1| enterobactin synthase component F [Escherichia coli 2872000]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032291889.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KEN28206.1| enterobactin synthase component F [Escherichia coli 8-415-05_S1_C1]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001425261.1| enterobactin synthase component F [Escherichia coli]
 gb|ENB51047.1| enterobactin synthase component F [Escherichia coli P0298942.11]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001415847.1| enterobactin synthase component F [Escherichia coli]
 gb|ENB30554.1| enterobactin synthase component F [Escherichia coli BCE030_MS-09]
 gb|KDT48538.1| enterobactin synthase component F [Escherichia coli 3-105-05_S3_C2]
 gb|KEK98033.1| enterobactin synthase component F [Escherichia coli 4-203-08_S1_C3]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_040080108.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIH18370.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032227753.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EZK23827.1| enterobactin synthase component F [Escherichia coli 1-176-05_S1_C2]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077804.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EGB34602.1| AMP-binding enzyme [Escherichia coli E1520]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077794.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EFQ02449.1| enterobactin synthetase component F [Escherichia coli 1827-70]
 gb|EQQ29479.1| enterobactin synthase component F [Escherichia coli HVH 91 (4-4638751)]
 gb|EST74482.1| enterobactin synthase subunit F [Escherichia coli ECA-0157]
 gb|EYB45873.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KEP11552.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_040091780.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIG57253.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032084145.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032200887.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EZJ44226.1| enterobactin synthase component F [Escherichia coli 1-250-04_S4_C2]
 gb|EZJ57125.1| enterobactin synthase component F [Escherichia coli 1-250-04_S4_C1]
 gb|KDX93628.1| enterobactin synthase component F [Escherichia coli 2-316-03_S3_C1]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077809.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EDX39703.1| enterobactin synthetase component F [Escherichia coli 101-1]
 emb|CAQ31059.1| apo-serine activating enzyme [Escherichia coli BL21(DE3)]
 gb|ACT30076.1| amino acid adenylation domain protein [Escherichia coli 'BL21-Gold(DE3)pLysS 
AG']
 gb|ACT38239.1| enterobactin synthase multienzyme complex component, ATP-dependent 
[Escherichia coli B str. REL606]
 gb|ACT42432.1| enterobactin synthase multienzyme complex component, ATP-dependent 
[Escherichia coli BL21(DE3)]
 gb|EFK24147.1| enterobactin synthetase component F [Escherichia coli MS 187-1]
 gb|EGB58804.1| AMP-binding enzyme [Escherichia coli H489]
 emb|CCQ00718.1| Enterobactin synthetase component F, serine activating enzyme 
[Escherichia coli O5:K4(L):H4 str. ATCC 23502]
 gb|EMW37080.1| enterobactin synthase component F [Escherichia coli 2845350]
 gb|ENA22148.1| enterobactin synthase component F [Escherichia coli P0298942.1]
 gb|ENB02565.1| enterobactin synthase component F [Escherichia coli 2862600]
 gb|ENB45004.1| enterobactin synthase component F [Escherichia coli P0298942.10]
 gb|ENB70048.1| enterobactin synthase component F [Escherichia coli P0298942.2]
 gb|ENB83413.1| enterobactin synthase component F [Escherichia coli P0298942.8]
 gb|ENB87459.1| enterobactin synthase component F [Escherichia coli P0298942.9]
 gb|END46530.1| enterobactin synthase component F [Escherichia coli 2733950]
 gb|ENG87640.1| enterobactin synthase component F [Escherichia coli P0298942.12]
 gb|EQV45962.1| enterobactin synthase component F [Escherichia coli KOEGE 40 
(102a)]
 gb|ERB09526.1| enterobactin synthase component F [Escherichia coli KOEGE 7 (16a)]
 emb|CDK74517.1| Enterobactin synthetase component F, serine activating enzyme 
[Klebsiella pneumoniae IS22]
 gb|KDX85220.1| enterobactin synthase component F [Escherichia coli 2-222-05_S4_C2]
 gb|KEO19586.1| enterobactin synthase component F [Escherichia coli 2-222-05_S4_C3]
 gb|AJF75924.1| enterobactin synthase subunit F [Escherichia coli]
 gb|AJH09480.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001511566.1| enterobactin synthase component F [Escherichia coli]
 gb|END74590.1| enterobactin synthase component F [Escherichia coli P0298942.4]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001455962.1| enterobactin synthase component F [Escherichia coli]
 gb|ENB81492.1| enterobactin synthase component F [Escherichia coli P0298942.7]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001393888.1| enterobactin synthase component F [Escherichia coli]
 gb|ENA83580.1| enterobactin synthase component F [Escherichia coli 2730450]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001706161.1| enterobactin synthase component F [Escherichia coli]
 gb|EMV64810.1| enterobactin synthase component F [Escherichia coli 2871950]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077796.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EKI42820.1| enterobactin synthetase component F [Escherichia coli 3006]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001575535.1| enterobactin synthase component F [Escherichia coli]
 gb|ELF41039.1| enterobactin synthase component F [Escherichia coli KTE171]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_042966057.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHI87978.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIG81240.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032298296.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KEL64510.1| enterobactin synthase component F [Escherichia coli 5-172-05_S1_C3]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032198801.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KDX86180.1| enterobactin synthase component F [Escherichia coli 2-222-05_S3_C3]
 gb|KEN89638.1| enterobactin synthase component F [Escherichia coli 2-222-05_S3_C1]
 gb|KEO03207.1| enterobactin synthase component F [Escherichia coli 2-222-05_S3_C2]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_020240111.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_016236952.1| enterobactin synthase component F [Escherichia coli]
 gb|EOX00541.1| enterobactin synthase component F [Escherichia coli KTE41]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_016246944.1| enterobactin synthase component F [Escherichia coli]
 gb|EOW22712.1| enterobactin synthase component F [Escherichia coli KTE108]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001654096.1| enterobactin synthase component F [Escherichia coli]
 gb|ENG29249.1| enterobactin synthase component F [Escherichia coli P0305260.8]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001673297.1| enterobactin synthase component F [Escherichia coli]
 gb|ELI44804.1| enterobactin synthase component F [Escherichia coli KTE120]
 gb|EOV29314.1| enterobactin synthase component F [Escherichia coli KTE198]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001543560.1| enterobactin synthase component F [Escherichia coli]
 gb|ELD31531.1| enterobactin synthase component F [Escherichia coli KTE212]
 gb|ELF11110.1| enterobactin synthase component F [Escherichia coli KTE119]
 gb|ELJ61126.1| enterobactin synthase component F [Escherichia coli KTE232]
 gb|EQY68267.1| enterobactin synthase component F [Escherichia coli UMEA 3240-1]
 gb|EQY92554.1| enterobactin synthase component F [Escherichia coli UMEA 3314-1]
 gb|EQZ70295.1| enterobactin synthase component F [Escherichia coli UMEA 3682-1]
 gb|AHM28588.1| enterobactin synthase subunit F [Escherichia coli]
 gb|AHM35515.1| enterobactin synthase subunit F [Escherichia coli]
 gb|AHM40112.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHH83956.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001515014.1| enterobactin synthase component F [Escherichia coli]
 gb|ELC11675.1| enterobactin synthase component F [Escherichia coli KTE10]
 gb|ESK11900.1| enterobactin synthase component F [Escherichia coli HVH 50 (4-2593475)]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077795.1| MULTISPECIES: enterobactin synthase subunit F [Enterobacteriaceae]
 gb|EFJ95726.1| enterobactin synthetase component F [Escherichia coli MS 115-1]
 gb|EOV64929.1| enterobactin synthase component F [Escherichia coli KTE64]
 gb|EOW09991.1| enterobactin synthase component F [Escherichia coli KTE100]
 gb|EOW27019.1| enterobactin synthase component F [Escherichia coli KTE107]
 gb|ESL43086.1| enterobactin synthase component F [Escherichia coli BIDMC 37]
 gb|KEN15507.1| enterobactin synthase component F [Escherichia coli 7-233-03_S4_C2]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_023352386.1| enterobactin synthase component F [Escherichia coli]
 gb|ESP48353.1| enterobactin synthase component F [Escherichia coli HVH 152 (4-3447545)]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001689379.1| enterobactin synthase component F [Escherichia coli]
 gb|EMV00588.1| enterobactin synthase component F [Escherichia coli MP021017.3]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001688498.1| enterobactin synthase component F [Escherichia coli]
 gb|EMU98861.1| enterobactin synthase component F [Escherichia coli MP021017.4]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001687288.1| enterobactin synthase component F [Escherichia coli]
 gb|EMU87934.1| enterobactin synthase component F [Escherichia coli MP021017.5]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001686199.1| enterobactin synthase component F [Escherichia coli]
 gb|EMU85841.1| enterobactin synthase component F [Escherichia coli MP021017.6]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077791.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EII65333.1| enterobactin synthetase component F [Escherichia coli 2.4168]
 gb|EKK48607.1| enterobactin synthetase component F [Escherichia coli 8.0566]
 gb|EKK49138.1| enterobactin synthase component F [Escherichia coli 8.0569]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077806.1| enterobactin synthase component F [Escherichia coli]
 gb|AFG39450.1| Enterobactin synthetase component F [Escherichia coli P12b]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_044864064.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_041124048.1| enterobactin synthase subunit F [Escherichia coli]
 gb|AJF55327.1| enterobactin synthase multienzyme complex component, ATP-dependent 
[Escherichia coli 1303]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_033803493.1| enterobactin synthase component F [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>gb|KGM73081.1| amino acid adenylation domain protein [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032227765.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KEM89767.1| enterobactin synthase component F [Escherichia coli 6-537-08_S4_C1]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032190677.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KDZ17317.1| enterobactin synthase component F [Escherichia coli 2-474-04_S3_C3]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032223272.1| enterobactin synthase component F [Escherichia coli]
 gb|KDU29396.1| enterobactin synthase component F [Escherichia coli 3-373-03_S4_C2]
 gb|KEL63418.1| enterobactin synthase component F [Escherichia coli 5-172-05_S4_C3]
 gb|KEL99894.1| enterobactin synthase component F [Escherichia coli 6-175-07_S4_C1]
 gb|KEM72244.1| enterobactin synthase component F [Escherichia coli 6-319-05_S4_C3]
 gb|KEN08158.1| enterobactin synthase component F [Escherichia coli 7-233-03_S3_C3]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032179722.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KDA76417.1| enterobactin synthase component F [Escherichia coli 2-011-08_S3_C2]
 gb|KDU62005.1| enterobactin synthase component F [Escherichia coli 4-203-08_S4_C3]
 gb|KDW77579.1| enterobactin synthase component F [Escherichia coli 2-005-03_S4_C1]
 gb|KDY89017.1| enterobactin synthase component F [Escherichia coli 2-474-04_S3_C1]
 gb|KDY97085.1| enterobactin synthase component F [Escherichia coli 2-474-04_S3_C2]
 gb|KDZ66967.1| enterobactin synthase component F [Escherichia coli 3-073-06_S3_C2]
 gb|KDZ67580.1| enterobactin synthase component F [Escherichia coli 3-073-06_S3_C1]
 gb|KEL07361.1| enterobactin synthase component F [Escherichia coli 4-203-08_S3_C1]
 gb|KEL54270.1| enterobactin synthase component F [Escherichia coli 5-172-05_S3_C1]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_023486883.1| Enterobactin synthetase component F, serine activating enzyme 
[Escherichia coli]
 gb|ESS88964.1| Enterobactin synthetase component F, serine activating enzyme 
[Escherichia coli CE549]
 gb|KGP21231.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KGT26961.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KGT29655.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_021558872.1| enterobactin synthase component F [Escherichia coli]
 gb|ERB15641.1| enterobactin synthase component F [Escherichia coli UMEA 3150-1]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001645051.1| enterobactin synthase component F [Escherichia coli]
 gb|ENG06435.1| enterobactin synthase component F [Escherichia coli P0305260.3]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001635901.1| enterobactin synthase component F [Escherichia coli]
 gb|ENF78946.1| enterobactin synthase component F [Escherichia coli P0305260.10]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001396895.1| enterobactin synthase component F [Escherichia coli]
 gb|ENA85348.1| enterobactin synthase component F [Escherichia coli 2741950]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_004091361.1| enterobactin synthase component F [Escherichia coli]
 gb|EMZ74792.1| enterobactin synthase component F [Escherichia coli 2846750]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077798.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EKJ81749.1| AMP-binding enzyme [Escherichia coli AD30]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_020239765.1| enterobactin synthase subunit F [Escherichia coli]
Length=1294

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_044789794.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_044066875.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>gb|KHH51516.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHH58897.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>gb|KGT12016.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032246478.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KDZ80813.1| enterobactin synthase component F [Escherichia coli 3-105-05_S1_C3]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032255593.1| enterobactin synthase component F [Escherichia coli]
 gb|KDX44698.1| enterobactin synthase component F [Escherichia coli 2-177-06_S3_C2]
 gb|KEO15597.1| enterobactin synthase component F [Escherichia coli 2-177-06_S3_C3]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032239310.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KDU51683.1| enterobactin synthase component F [Escherichia coli 3-373-03_S4_C1]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032237954.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KDT28692.1| enterobactin synthase component F [Escherichia coli 3-105-05_S1_C1]
 gb|KDU49176.1| enterobactin synthase component F [Escherichia coli 3-475-03_S4_C2]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_033873198.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KDT05598.1| enterobactin synthase component F [Escherichia coli 2-011-08_S1_C3]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_025693512.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHI13979.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIG74772.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032280049.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EZJ76800.1| enterobactin synthase component F [Escherichia coli 1-392-07_S3_C3]
 gb|KDW49358.1| enterobactin synthase component F [Escherichia coli 1-392-07_S3_C2]
 gb|KDW96651.1| enterobactin synthase component F [Escherichia coli 1-392-07_S3_C1]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032229674.1| enterobactin synthase component F [Escherichia coli]
 gb|EYE14680.1| enterobactin synthase component F [Escherichia coli 1-110-08_S3_C3]
 gb|EYE17828.1| enterobactin synthase component F [Escherichia coli 1-110-08_S3_C1]
 gb|EYE28862.1| enterobactin synthase component F [Escherichia coli 1-110-08_S3_C2]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032234405.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EYD92003.1| enterobactin synthase component F [Escherichia coli 1-176-05_S3_C1]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001652871.1| enterobactin synthase component F [Escherichia coli]
 gb|ENG22242.1| enterobactin synthase component F [Escherichia coli P0305260.7]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_003999838.1| enterobactin synthase component F [Escherichia coli]
 gb|EMW63580.1| enterobactin synthase component F [Escherichia coli 2762100]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001564507.1| enterobactin synthase component F [Escherichia coli]
 gb|ELE65633.1| enterobactin synthase component F [Escherichia coli KTE77]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001549051.1| enterobactin synthase component F [Escherichia coli]
 gb|ELD73148.1| enterobactin synthase component F [Escherichia coli KTE234]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077805.1| MULTISPECIES: enterobactin synthase component F [Escherichia]
 ref|NP_415118.1| enterobactin synthase multienzyme complex component, ATP-dependent 
[Escherichia coli str. K-12 substr. MG1655]
 ref|YP_001729487.1| enterobactin synthase subunit F [Escherichia coli str. K-12 substr. 
DH10B]
 ref|YP_001729588.1| enterobactin synthase subunit F [Escherichia coli str. K-12 substr. 
DH10B]
 ref|YP_488875.1| enterobactin synthase multienzyme complex component, ATP-dependent 
[Escherichia coli str. K-12 substr. W3110]
 sp|P11454.3|ENTF_ECOLI RecName: Full=Enterobactin synthase component F; AltName: Full=Enterochelin 
synthase F; AltName: Full=Serine-activating enzyme; 
AltName: Full=Seryl-AMP ligase [Escherichia coli K-12]
 gb|AAC73687.1| enterobactin synthase multienzyme complex component, ATP-dependent 
[Escherichia coli str. K-12 substr. MG1655]
 dbj|BAE76341.1| enterobactin synthase multienzyme complex component, ATP-dependent 
[Escherichia coli str. K12 substr. W3110] [Escherichia 
coli str. K-12 substr. W3110]
 gb|ACB01709.1| enterobactin synthase multienzyme complex component F, ATP-dependent 
[Escherichia coli str. K-12 substr. DH10B]
 gb|ACB01810.1| enterobactin synthase multienzyme complex component F, ATP-dependent 
[Escherichia coli str. K-12 substr. DH10B]
 gb|ACR63036.1| enterobactin synthase multienzyme complex component, ATP-dependent 
[Escherichia coli BW2952]
 gb|ACX40668.1| amino acid adenylation domain protein [Escherichia coli DH1]
 gb|EFJ64005.1| enterobactin synthetase component F [Escherichia coli MS 175-1]
 gb|EFK13261.1| enterobactin synthetase component F [Escherichia coli MS 116-1]
 emb|CBJ00122.1| enterobactin synthetase component F [Escherichia coli ETEC H10407]
 dbj|BAJ42412.1| enterobactin synthase subunit F [Escherichia coli DH1]
 gb|EGB39159.1| AMP-binding enzyme [Escherichia coli E482]
 gb|EGB67336.1| AMP-binding enzyme [Escherichia coli TA007]
 gb|AEE55263.1| enterobactin synthetase component EntF [Escherichia coli UMNK88]
 gb|AEJ55215.1| enterobactin synthetase component F [Escherichia coli UMNF18]
 gb|EGU26003.1| enterobactin synthase subunit F [Escherichia coli XH140A]
 gb|EGV46934.1| enterobactin synthase subunit F [Escherichia coli XH001]
 gb|EGW98185.1| enterobactin synthetase component F [Escherichia coli STEC_EH250]
 gb|EGX12741.1| enterobactin synthetase component F [Escherichia coli G58-1]
 gb|EGX20519.1| enterobactin synthetase component F [Escherichia coli STEC_S1191]
 dbj|BAL37750.1| enterobactin synthase multienzyme complex component, ATP-dependent 
[Escherichia coli str. K-12 substr. MDS42]
 gb|EHV66436.1| enterobactin synthase component F [Escherichia coli DEC6C]
 gb|EHV76259.1| enterobactin synthase component F [Escherichia coli DEC6D]
 gb|EHV79300.1| amino acid adenylation domain protein [Escherichia coli DEC6E]
 gb|EHV99851.1| amino acid adenylation domain protein [Escherichia coli DEC7B]
 gb|EIE36043.1| AMP-binding enzyme [Escherichia coli J53]
 gb|EIF16719.1| enterobactin synthase subunit F [Escherichia coli O32:H37 str. 
P4]
 gb|EIG49634.1| enterobactin synthase component F [Escherichia coli H730]
 gb|EII47996.1| enterobactin synthetase component F [Escherichia coli 2.3916]
 gb|EII78743.1| enterobactin synthetase component F [Escherichia coli 3.2303]
 gb|EIJ05472.1| enterobactin synthetase component F [Escherichia coli B41]
 gb|EKI23557.1| enterobactin synthetase component F [Escherichia coli TW15901]
 gb|EKI30542.1| enterobactin synthetase component F [Escherichia coli TW00353]
 gb|ELC63993.1| enterobactin synthase component F [Escherichia coli KTE44]
 gb|ELE04721.1| enterobactin synthase component F [Escherichia coli KTE51]
 gb|ELE12918.1| enterobactin synthase component F [Escherichia coli KTE56]
 gb|ELF01862.1| enterobactin synthase component F [Escherichia coli KTE111]
 gb|ELF22026.1| enterobactin synthase component F [Escherichia coli KTE156]
 gb|ELF26744.1| enterobactin synthase component F [Escherichia coli KTE161]
 gb|ELF77518.1| enterobactin synthase component F [Escherichia coli KTE42]
 gb|ELG96444.1| enterobactin synthase component F [Escherichia coli KTE154]
 gb|ELH50139.1| enterobactin synthase component F [Escherichia coli KTE197]
 emb|CCP98583.1| Enterobactin synthetase component F, serine activating enzyme 
[Escherichia coli O10:K5(L):H4 str. ATCC 23506]
 gb|EMD14611.1| enterobactin synthase subunit F [Escherichia coli S17]
 gb|EMR97884.1| enterobactin synthase multienzyme complex component, ATP-dependent 
[Escherichia coli ONT:H33 str. C48/93]
 gb|EMV47410.1| enterobactin synthase component F [Escherichia coli BCE019_MS-13]
 gb|EMX26606.1| enterobactin synthase component F [Escherichia coli MP021566.1]
 gb|EMX32470.1| enterobactin synthase component F [Escherichia coli MP021561.2]
 gb|EMZ88108.1| enterobactin synthase component F [Escherichia coli 2722950]
 gb|EMZ95517.1| enterobactin synthase component F [Escherichia coli P0305260.1]
 gb|ENA07655.1| enterobactin synthase component F [Escherichia coli P0299438.2]
 gb|ENA24835.1| enterobactin synthase component F [Escherichia coli 201600.1]
 gb|ENA34593.1| enterobactin synthase component F [Escherichia coli BCE007_MS-11]
 gb|ENA56657.1| enterobactin synthase component F [Escherichia coli 2726950]
 gb|ENB24845.1| enterobactin synthase component F [Escherichia coli BCE011_MS-01]
 gb|ENB40456.1| enterobactin synthase component F [Escherichia coli BCE032_MS-12]
 gb|ENB90095.1| enterobactin synthase component F [Escherichia coli P0299438.10]
 gb|ENC07391.1| enterobactin synthase component F [Escherichia coli P0299438.4]
 gb|END60157.1| enterobactin synthase component F [Escherichia coli BCE006_MS-23]
 gb|ENE12378.1| enterobactin synthase component F [Escherichia coli P0305260.2]
 gb|ENF87358.1| enterobactin synthase component F [Escherichia coli P0305260.11]
 gb|ENF93770.1| enterobactin synthase component F [Escherichia coli P0305260.13]
 gb|ENF99496.1| enterobactin synthase component F [Escherichia coli P0305260.15]
 gb|ENG21984.1| enterobactin synthase component F [Escherichia coli P0305260.6]
 gb|EOU70220.1| enterobactin synthase component F [Escherichia coli KTE14]
 gb|EOV15306.1| enterobactin synthase component F [Escherichia coli KTE40]
 gb|EOV54950.1| enterobactin synthase component F [Escherichia coli KTE61]
 gb|EOV83298.1| enterobactin synthase component F [Escherichia coli KTE71]
 gb|EOW62125.1| enterobactin synthase component F [Escherichia coli KTE155]
 gb|EQS85052.1| enterobactin synthase component F [Escherichia coli HVH 164 (4-5953081)]
 gb|EQU64668.1| enterobactin synthase component F [Escherichia coli HVH 209 (4-3062651)]
 gb|EQW98065.1| enterobactin synthase component F [Escherichia coli UMEA 3139-1]
 gb|EQX59770.1| enterobactin synthase component F [Escherichia coli UMEA 3174-1]
 gb|EQX69286.1| enterobactin synthase component F [Escherichia coli UMEA 3180-1]
 gb|EQX87669.1| enterobactin synthase component F [Escherichia coli UMEA 3199-1]
 gb|EQY83460.1| enterobactin synthase component F [Escherichia coli UMEA 3317-1]
 gb|EQZ04327.1| enterobactin synthase component F [Escherichia coli UMEA 3318-1]
 gb|EQZ04777.1| enterobactin synthase component F [Escherichia coli UMEA 3329-1]
 gb|EQZ43173.1| enterobactin synthase component F [Escherichia coli UMEA 3592-1]
 gb|EQZ45960.1| enterobactin synthase component F [Escherichia coli UMEA 3609-1]
 gb|ERA22346.1| enterobactin synthase component F [Escherichia coli UMEA 3889-1]
 gb|ERB04922.1| enterobactin synthase component F [Escherichia coli KOEGE 3 (4a)]
 gb|ERB23855.1| enterobactin synthase component F [Escherichia coli UMEA 3151-1]
 gb|ERB32343.1| enterobactin synthase component F [Escherichia coli UMEA 3271-1]
 gb|AGX32725.1| enterobactin synthase multienzyme complex component, ATP-dependent 
[synthetic Escherichia coli C321.deltaA]
 gb|ESE04129.1| enterobactin synthetase component F [Escherichia coli 908658]
 gb|ESL25859.1| enterobactin synthase component F [Escherichia coli BIDMC 39]
 gb|ESP49454.1| enterobactin synthase component F [Escherichia coli UMEA 3148-1]
 emb|CDJ71047.1| enterobactin synthase subunit F [Escherichia coli str. K-12 substr. 
MC4100]
 gb|EST60505.1| enterobactin synthase subunit F [Escherichia coli ECC-Z]
 gb|EST77552.1| enterobactin synthase subunit F [Escherichia coli ECA-727]
 emb|CDK81369.1| Enterobactin synthetase component F, serine activating enzyme 
[Escherichia coli IS25]
 gb|ETS24473.1| enterobactin synthase subunit F [Escherichia coli O6:H16:CFA/II 
str. B2C]
 gb|EYD90367.1| enterobactin synthase component F [Escherichia coli 1-176-05_S1_C1]
 gb|EYE05090.1| enterobactin synthase component F [Escherichia coli 1-110-08_S4_C3]
 gb|EYE06106.1| enterobactin synthase component F [Escherichia coli 1-110-08_S4_C2]
 gb|EYV89874.1| enterobactin synthase subunit F [Escherichia coli O6:H16 str. 
99-3165]
 gb|EZA32101.1| enterobactin synthase subunit F [Escherichia coli O103:H11 str. 
04-3023]
 gb|EZA70201.1| enterobactin synthase subunit F [Escherichia coli O6:H16 str. 
F5656C1]
 gb|EZA70628.1| enterobactin synthase subunit F [Escherichia coli O157:H16 str. 
98-3133]
 gb|EZJ29366.1| enterobactin synthase component F [Escherichia coli 1-176-05_S4_C3]
 gb|EZJ74178.1| enterobactin synthase component F [Escherichia coli 1-176-05_S4_C1]
 gb|EZK09875.1| enterobactin synthase component F [Escherichia coli 1-176-05_S1_C3]
 gb|KDA86177.1| enterobactin synthase component F [Escherichia coli 2-011-08_S3_C3]
 gb|KDA91326.1| enterobactin synthase component F [Escherichia coli 1-176-05_S4_C2]
 emb|CDP72454.1| Amino acid adenylation domain protein [Escherichia coli]
 gb|KDT03307.1| enterobactin synthase component F [Escherichia coli 2-011-08_S3_C1]
 gb|KDT22574.1| enterobactin synthase component F [Escherichia coli 2-052-05_S3_C1]
 gb|KDT36566.1| enterobactin synthase component F [Escherichia coli 3-105-05_S3_C1]
 gb|KDT53546.1| enterobactin synthase component F [Escherichia coli 3-105-05_S4_C3]
 gb|KDT68995.1| enterobactin synthase component F [Escherichia coli 3-373-03_S3_C1]
 gb|KDT72743.1| enterobactin synthase component F [Escherichia coli 3-373-03_S3_C3]
 gb|KDT77907.1| enterobactin synthase component F [Escherichia coli 3-373-03_S1_C2]
 gb|KDU08950.1| enterobactin synthase component F [Escherichia coli 3-373-03_S3_C2]
 gb|KDU37402.1| enterobactin synthase component F [Escherichia coli 3-073-06_S4_C1]
 gb|KDU44628.1| enterobactin synthase component F [Escherichia coli 3-373-03_S1_C1]
 gb|KDU60933.1| enterobactin synthase component F [Escherichia coli 4-203-08_S1_C1]
 gb|KDV88010.1| enterobactin synthase component F [Escherichia coli 2-052-05_S3_C3]
 gb|KDV91864.1| enterobactin synthase component F [Escherichia coli 2-052-05_S4_C3]
 gb|KDW11412.1| enterobactin synthase component F [Escherichia coli 2-156-04_S3_C3]
 gb|KDW49416.1| enterobactin synthase component F [Escherichia coli 2-210-07_S1_C3]
 gb|KDW93074.1| enterobactin synthase component F [Escherichia coli 2-210-07_S1_C2]
 gb|KDX55071.1| enterobactin synthase component F [Escherichia coli 2-210-07_S3_C1]
 gb|KDY20370.1| enterobactin synthase component F [Escherichia coli 2-316-03_S4_C2]
 gb|KDY39533.1| enterobactin synthase component F [Escherichia coli 2-427-07_S4_C1]
 gb|KDY50199.1| enterobactin synthase component F [Escherichia coli 2-460-02_S3_C1]
 gb|KDY57806.1| enterobactin synthase component F [Escherichia coli 2-460-02_S3_C2]
 gb|KDY58685.1| enterobactin synthase component F [Escherichia coli 2-460-02_S3_C3]
 gb|KDY79536.1| enterobactin synthase component F [Escherichia coli 2-474-04_S1_C1]
 gb|KDZ82776.1| enterobactin synthase component F [Escherichia coli 3-105-05_S1_C2]
 gb|KDZ84956.1| enterobactin synthase component F [Escherichia coli 3-073-06_S4_C3]
 gb|KEK91776.1| enterobactin synthase component F [Escherichia coli 4-203-08_S3_C3]
 gb|KEK92486.1| enterobactin synthase component F [Escherichia coli 4-203-08_S1_C2]
 gb|KEL06149.1| enterobactin synthase component F [Escherichia coli 4-203-08_S3_C2]
 gb|KEL24309.1| enterobactin synthase component F [Escherichia coli 5-172-05_S4_C2]
 gb|KEL33855.1| enterobactin synthase component F [Escherichia coli 5-366-08_S4_C2]
 gb|KEL37221.1| enterobactin synthase component F [Escherichia coli 5-172-05_S4_C1]
 gb|KEM11737.1| enterobactin synthase component F [Escherichia coli 6-175-07_S4_C2]
 gb|KEM40068.1| enterobactin synthase component F [Escherichia coli 6-319-05_S4_C2]
 gb|KEM47206.1| enterobactin synthase component F [Escherichia coli 6-175-07_S4_C3]
 gb|KEM66711.1| enterobactin synthase component F [Escherichia coli 7-233-03_S1_C2]
 gb|KEM78044.1| enterobactin synthase component F [Escherichia coli 7-233-03_S3_C1]
 gb|KEN06758.1| enterobactin synthase component F [Escherichia coli 7-233-03_S1_C3]
 gb|KEN29509.1| enterobactin synthase component F [Escherichia coli 7-233-03_S3_C2]
 gb|KEN47369.1| enterobactin synthase component F [Escherichia coli 7-233-03_S4_C1]
 gb|KEN60119.1| enterobactin synthase component F [Escherichia coli 7-233-03_S4_C3]
 gb|KEN62678.1| enterobactin synthase component F [Escherichia coli 6-537-08_S4_C2]
 gb|KEN79640.1| enterobactin synthase component F [Escherichia coli 2-052-05_S3_C2]
 gb|AIF35957.1| enterobactin synthase subunit F [Escherichia coli KLY]
 emb|CDU39645.1| Amino acid adenylation domain protein [Escherichia coli]
 gb|KFF40106.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KFF51996.1| enterobactin synthase subunit F [Escherichia coli]
 emb|CEE06953.1| enterobactin synthase component F [Escherichia coli]
 gb|AIN31077.1| enterobactin synthase multienzyme complex component, ATP-dependent 
[Escherichia coli BW25113]
 gb|KGA87328.1| enterobactin synthase subunit F [Escherichia coli]
 emb|CDY55903.1| apo-serine activating enzyme [Escherichia coli]
 emb|CDZ19454.1| apo-serine activating enzyme [Escherichia coli]
 gb|KGL67939.1| enterobactin synthase subunit F [Escherichia coli NCTC 50110]
 gb|KGM64039.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KGM68427.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KGM77973.1| Enterobactin synthetase [Escherichia coli]
 gb|KGM80682.1| Enterobactin synthetase [Escherichia coli]
 gb|KGP09429.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KGP12374.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KGP39101.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KGT07327.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KGT20691.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KGT23759.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHD39874.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHD47310.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHD57232.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHD59551.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHH67509.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHH92975.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHH93992.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHI18832.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHI54515.1| enterobactin synthase subunit F [Escherichia coli]
 gb|AIZ31106.1| enterobactin synthase multienzyme complex component, ATP-dependent 
[Escherichia coli ER2796]
 gb|AIZ54431.1| enterobactin synthase multienzyme complex component, ATP-dependent 
[Escherichia coli K-12]
 gb|AIZ92269.1| enterobactin synthase subunit F [Escherichia coli str. K-12 substr. 
MG1655]
 gb|AJB50751.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIG38061.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIG70180.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIH01329.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIZ63373.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIZ67270.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIZ79932.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIZ85821.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIZ86693.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIZ87666.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIZ98100.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KJA00243.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KJA05175.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KJD89972.1| enterobactin synthase subunit F [Escherichia coli]
 gb|AKA89542.1| enterobactin synthase component F [Escherichia coli VR50]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077807.1| MULTISPECIES: enterobactin synthase component F [Escherichia]
 gb|EJZ49340.1| enterobactin synthase component F [Escherichia sp. 1_1_43]
 gb|EOW18034.1| enterobactin synthase component F [Escherichia coli KTE103]
 gb|EQY32226.1| enterobactin synthase component F [Escherichia coli UMEA 3212-1]
 gb|EZA80748.1| enterobactin synthase subunit F [Escherichia coli O25:NM str. 
E2539C1]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077789.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EFK88254.1| enterobactin synthetase component F [Escherichia coli MS 146-1]
 gb|ELE74213.1| enterobactin synthase component F [Escherichia coli KTE81]
 gb|KDT92465.1| enterobactin synthase component F [Escherichia coli 3-105-05_S4_C1]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077797.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EFI86315.1| enterobactin synthetase component F [Escherichia coli MS 196-1]
 gb|EOW50174.1| enterobactin synthase component F [Escherichia coli KTE130]
 gb|EOW50648.1| enterobactin synthase component F [Escherichia coli KTE132]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001509666.1| enterobactin synthase component F [Escherichia coli]
 gb|END74809.1| enterobactin synthase component F [Escherichia coli P0298942.3]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_040083755.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIG44307.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032265287.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KDZ21577.1| enterobactin synthase component F [Escherichia coli 3-020-07_S1_C1]
 gb|KDZ25844.1| enterobactin synthase component F [Escherichia coli 3-020-07_S1_C2]
 gb|KDZ31491.1| enterobactin synthase component F [Escherichia coli 3-020-07_S1_C3]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032177019.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KDW09780.1| enterobactin synthase component F [Escherichia coli 2-156-04_S1_C3]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_042027706.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=880

 Score =   408 bits (1049),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 200/206 (97%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQ+EIPETTLSALVAEQAAKTPDAPALADARY FS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQIEIPETTLSALVAEQAAKTPDAPALADARYQFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRF+DVP+LT LCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFADVPDLTRLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001408565.1| enterobactin synthase component F [Escherichia coli]
 gb|EMV02218.1| enterobactin synthase component F [Escherichia coli MP021017.2]
 gb|EMV09780.1| enterobactin synthase component F [Escherichia coli MP021017.10]
 gb|EMV14004.1| enterobactin synthase component F [Escherichia coli MP021017.11]
 gb|EMV29282.1| enterobactin synthase component F [Escherichia coli MP021017.12]
 gb|EMX42003.1| enterobactin synthase component F [Escherichia coli MP021017.1]
 gb|ENA18946.1| enterobactin synthase component F [Escherichia coli BCE008_MS-13]
 gb|ENB20924.1| enterobactin synthase component F [Escherichia coli BCE008_MS-01]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>gb|AIL39370.1| EntF [Shigella flexneri Shi06HN006]
Length=1053

 Score =   412 bits (1060),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  199  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  258

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREM EQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  259  YREMHEQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  318

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLT+LCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  319  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTNLCYNAPLTPQGSAPLQLSQPHHTAYIIF  378

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLW+Q
Sbjct  379  TSGSTGRPKGVMVGQTAIVNRLLWIQ  404



>ref|WP_042026495.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=882

 Score =   408 bits (1049),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 200/206 (97%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQ+EIPETTLSALVAEQAAKTPDAPALADARY FS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQIEIPETTLSALVAEQAAKTPDAPALADARYQFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRF+DVP+LT LCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFADVPDLTRLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032254487.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KDT61263.1| enterobactin synthase component F [Escherichia coli 3-267-03_S3_C1]
Length=1293

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077790.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EGI10103.1| enterobactin synthetase component F (Enterochelinsynthase F) 
(Serine-activating enzyme) (Seryl-AMP ligase) [Escherichia coli 
H736]
Length=1293

 Score =   417 bits (1072),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_024255944.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=856

 Score =   407 bits (1047),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 200/206 (97%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARY FS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYQFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRE GVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLREHGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRF+DVP+LT+LCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFADVPDLTNLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>gb|EJZ68170.1| amino acid adenylation domain protein [Shigella flexneri 1485-80]
Length=904

 Score =   409 bits (1050),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 200/206 (97%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARY FS
Sbjct  34   DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYQFS  93

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  94   YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  153

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRF+DVP+LT+LCYNAPL PQGSAPLQLSQPHHTAYIIF
Sbjct  154  RLKMMLEDARPSLLITTDDQLPRFADVPDLTNLCYNAPLKPQGSAPLQLSQPHHTAYIIF  213

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  214  TSGSTGRPKGVMVGQTAIVNRLLWMQ  239



>ref|WP_000077700.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EGC10576.1| AMP-binding enzyme [Escherichia coli E1167]
 gb|EYZ57674.1| enterobactin synthase subunit F [Escherichia coli O79:H7 str. 
06-3501]
 gb|KHH27173.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHH28540.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1072),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001684700.1| enterobactin synthase component F [Escherichia coli]
 gb|EMU84290.1| enterobactin synthase component F [Escherichia coli MP021017.9]
Length=1293

 Score =   417 bits (1072),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>gb|EID66327.1| enterobactin synthase multienzyme complex component EntF, ATP-dependent 
[Escherichia coli W26]
Length=1278

 Score =   417 bits (1071),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  408  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  467

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  468  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  527

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  528  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  587

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  588  TSGSTGRPKGVMVGQTAIVNRLLWMQ  613



>ref|WP_003984316.1| enterobactin synthase component F [Escherichia coli]
 gb|EMV89926.1| enterobactin synthase component F [Escherichia coli 2861200]
Length=1293

 Score =   417 bits (1072),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>gb|AAB40785.1| enterobactin synthetase component F [Escherichia coli]
 gb|EIG71868.1| enterobactin synthase component F [Escherichia sp. 4_1_40B]
 emb|CQR80186.1| enterobactin synthase multienzyme complex component, ATP-dependent 
[Escherichia coli K-12]
Length=1339

 Score =   418 bits (1074),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  469  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  528

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  529  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  588

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  589  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  648

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  649  TSGSTGRPKGVMVGQTAIVNRLLWMQ  674



>ref|WP_032270518.1| enterobactin synthase component F [Escherichia coli]
 gb|KDZ61302.1| enterobactin synthase component F [Escherichia coli 3-073-06_S1_C2]
Length=1293

 Score =   417 bits (1072),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAI+EAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIIEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077711.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EGW96801.1| enterobactin synthetase component F [Escherichia coli STEC_DG131-3]
 gb|EYZ46216.1| enterobactin synthase subunit F [Escherichia coli O91:H14 str. 
06-3691]
 gb|EZA36985.1| enterobactin synthase subunit F [Escherichia coli O174:H8 str. 
04-3038]
 gb|EZD93827.1| enterobactin synthase subunit F [Escherichia coli O91:H14 str. 
2009C-3227]
Length=1293

 Score =   417 bits (1072),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001594863.1| enterobactin synthase component F [Escherichia coli]
 gb|ELG43704.1| enterobactin synthase component F [Escherichia coli KTE101]
Length=1293

 Score =   417 bits (1071),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>gb|EIQ47903.1| enterobactin synthase component F [Shigella sonnei 3233-85]
Length=1278

 Score =   417 bits (1071),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  408  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  467

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  468  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  527

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  528  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  587

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  588  TSGSTGRPKGVMVGQTAIVNRLLWMQ  613



>ref|WP_039022601.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHI65589.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHI72180.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1071),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032281067.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EZE41013.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
2009C-4050]
Length=1293

 Score =   417 bits (1071),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077738.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EKI54887.1| enterobactin synthetase component F [Escherichia coli N1]
 gb|KHG94648.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHJ56482.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1071),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077764.1| enterobactin synthase subunit F, partial [Escherichia coli]
 gb|EIL75582.1| enterobactin synthase subunit F, partial [Escherichia coli HM605]
Length=1076

 Score =   412 bits (1060),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 202/206 (98%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DP+LLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARY FS
Sbjct  423  DPSLLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYQFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSD+PNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDIPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001732667.1| enterobactin synthase component F [Escherichia coli]
 gb|EMW79940.1| enterobactin synthase component F [Escherichia coli 2747800]
Length=1293

 Score =   417 bits (1071),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077695.1| enterobactin synthase subunit F [Escherichia coli]
 gb|ELD24431.1| enterobactin synthase component F [Escherichia coli KTE210]
Length=1293

 Score =   417 bits (1071),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001597671.1| enterobactin synthase component F [Escherichia coli]
 gb|ELG64711.1| enterobactin synthase component F [Escherichia coli KTE135]
Length=1293

 Score =   417 bits (1071),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077697.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EGW92919.1| enterobactin synthetase component F [Escherichia coli 3030-1]
Length=1293

 Score =   417 bits (1071),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077705.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EFW72889.1| Enterobactin synthetase component F, serine activating enzyme 
[Escherichia coli EC4100B]
 gb|KIH25330.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1071),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_044803841.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1071),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_040062417.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHH65372.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIG55576.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1071),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032211846.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EYY52066.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
2010C-4966]
 gb|EYY59658.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
2010C-4824]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077722.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EHW94432.1| amino acid adenylation domain protein [Escherichia coli DEC10E]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001460599.1| enterobactin synthase component F [Escherichia coli]
 gb|ENB98443.1| enterobactin synthase component F [Escherichia coli P0299438.11]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077703.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EJK97463.1| enterobactin synthetase component F [Escherichia coli STEC_O31]
 gb|EYZ99707.1| enterobactin synthase subunit F [Escherichia coli O174:H21 str. 
03-3269]
 gb|KDV39108.1| enterobactin synthase subunit F [Escherichia coli O146:H21 str. 
2010C-3325]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_042630951.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KII10502.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_044722765.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KJW24098.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KJW42259.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KJY10018.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032254784.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KDW43947.1| enterobactin synthase component F [Escherichia coli 2-177-06_S4_C2]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032273434.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EYY99183.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
2010C-4622]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032209989.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EYY02063.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
2011C-3500]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077734.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EII10504.1| enterobactin synthetase component F [Escherichia coli 5.0959]
 gb|ETI74260.1| enterobactin synthase subunit F [Escherichia coli ATCC BAA-2219]
 gb|EYU77132.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
2010C-4254]
 gb|EYV00695.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
2010C-3840]
 gb|EYV11696.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
2010C-3609]
 gb|EYV75902.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
2009C-4659]
 gb|EYV77321.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
2009EL1412]
 gb|EYX96784.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
2011C-3537]
 gb|EYY14083.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
2011C-3216]
 gb|EYY22343.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
2011C-3108]
 gb|EYY30432.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
2011C-3072]
 gb|EYY31243.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
2010EL1058]
 gb|EYY36306.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
2010C-4989]
 gb|EYY87218.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
2010C-4732]
 gb|EYZ50726.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
06-3822]
 gb|EYZ89070.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
06-3003]
 gb|EZA09299.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
03-3227]
 gb|EZA95579.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
F6714]
 gb|EZC55003.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
K5198]
 gb|EZC58255.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
K5269]
 gb|EZE72504.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
2009C-4750]
 gb|EZE82823.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
2009EL1302]
 gb|EZE96112.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
2010C-3794]
 gb|KDV56486.1| enterobactin synthase subunit F [Escherichia coli O121:H19 str. 
2011C-3609]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032286356.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EZJ31263.1| enterobactin synthase component F [Escherichia coli 1-392-07_S4_C2]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001464218.1| enterobactin synthase component F [Escherichia coli]
 gb|ENC15261.1| enterobactin synthase component F [Escherichia coli P0299438.5]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_044860581.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032178325.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KDV88457.1| enterobactin synthase component F [Escherichia coli 2-052-05_S4_C2]
 gb|AIZ81620.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_033815956.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077679.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EIL08349.1| enterobactin synthase subunit F [Escherichia coli O103:H25 str. 
CVM9340]
 gb|EYX84272.1| enterobactin synthase subunit F [Escherichia coli O156:H25 str. 
2011C-3602]
 gb|EYZ23102.1| enterobactin synthase subunit F [Escherichia coli O103:H25 str. 
2010C-4529]
 gb|KHH97092.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_033800940.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001465213.1| enterobactin synthase component F [Escherichia coli]
 gb|ENC20816.1| enterobactin synthase component F [Escherichia coli P0299438.6]
 gb|ENC22829.1| enterobactin synthase component F [Escherichia coli P0299438.7]
 gb|ENC27344.1| enterobactin synthase component F [Escherichia coli P0299438.8]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077702.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EFE64641.1| entF [Escherichia coli B088]
 gb|KIH07980.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077724.1| enterobactin synthase subunit F [Escherichia coli]
 emb|CAQ97440.1| enterobactin synthase multienzyme complex component, ATP-dependent 
[Escherichia coli IAI1]
 gb|EIH03638.1| enterobactin synthetase component F [Escherichia coli 5.0588]
 gb|END82668.1| enterobactin synthase component F [Escherichia coli P0299483.2]
 gb|END85573.1| enterobactin synthase component F [Escherichia coli P0299483.3]
 gb|ESA63639.1| enterobactin synthetase component F [Escherichia coli 113303]
 gb|ESC92412.1| enterobactin synthetase component F [Escherichia coli 113302]
 gb|ESK09170.1| enterobactin synthase component F [Escherichia coli UMEA 3336-1]
 gb|EZJ63129.1| enterobactin synthase component F [Escherichia coli 1-182-04_S4_C1]
 gb|KHI50303.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHJ07758.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIH14256.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001669591.1| enterobactin synthase component F [Escherichia coli]
 gb|ENH47586.1| enterobactin synthase component F [Escherichia coli p0305293.5]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001494979.1| enterobactin synthase component F [Escherichia coli]
 gb|ENH24294.1| enterobactin synthase component F [Escherichia coli P0302308.12]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001372096.1| enterobactin synthase component F [Escherichia coli]
 gb|EMU65213.1| enterobactin synthase component F [Escherichia coli MP021552.7]
 gb|EMU66914.1| enterobactin synthase component F [Escherichia coli MP021552.11]
 gb|EMV24087.1| enterobactin synthase component F [Escherichia coli C-34666]
 gb|EMX43535.1| enterobactin synthase component F [Escherichia coli MP021552.8]
 gb|ENH07307.1| enterobactin synthase component F [Escherichia coli 178850]
 gb|ESD74292.1| enterobactin synthetase component F [Escherichia coli 908555]
 gb|KDG81198.1| enterobactin synthase component F [Escherichia coli UCI 53]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_044782256.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_033803869.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001553051.1| enterobactin synthase component F [Escherichia coli]
 gb|ENE14938.1| enterobactin synthase component F [Escherichia coli p0305293.14]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001480267.1| enterobactin synthase component F [Escherichia coli]
 gb|ENC75738.1| enterobactin synthase component F [Escherichia coli P0299917.6]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001473919.1| enterobactin synthase component F [Escherichia coli]
 gb|ENC42201.1| enterobactin synthase component F [Escherichia coli P0299917.10]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_021534198.1| enterobactin synthase component F [Escherichia coli]
 gb|EQS36866.1| enterobactin synthase component F [Escherichia coli HVH 147 (4-5893887)]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077696.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EHX85629.1| amino acid adenylation domain protein [Escherichia coli DEC14B]
 gb|EHX93377.1| amino acid adenylation domain protein [Escherichia coli DEC14C]
 gb|EHX96641.1| amino acid adenylation domain protein [Escherichia coli DEC14D]
 gb|ELF89612.1| enterobactin synthase component F [Escherichia coli KTE29]
 gb|EQU00779.1| enterobactin synthase component F [Escherichia coli HVH 195 (3-7155360)]
 gb|KIG28247.1| enterobactin synthase subunit F [Escherichia coli C691-71 (14b)]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001774360.1| enterobactin synthase component F [Escherichia coli]
 gb|ELJ18564.1| enterobactin synthase component F [Escherichia coli KTE163]
 gb|EOV44091.1| enterobactin synthase component F [Escherichia coli KTE221]
 gb|EQW15122.1| enterobactin synthase component F [Escherichia coli KOEGE 131 
(358a)]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077801.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EGX25076.1| enterobactin synthetase component F [Escherichia coli TX1999]
 gb|EHV81814.1| enterobactin synthase component F [Escherichia coli DEC7A]
 gb|EHV90641.1| amino acid adenylation domain protein [Escherichia coli DEC7C]
 gb|EHV95116.1| amino acid adenylation domain protein [Escherichia coli DEC7D]
 gb|EHW04916.1| enterobactin synthase component F [Escherichia coli DEC7E]
 gb|EIQ66981.1| enterobactin synthase component F [Escherichia coli EPECa12]
 emb|CCK45751.1| ATP-dependent serine activating enzyme [Escherichia coli chi7122]
 gb|ELJ29138.1| enterobactin synthase component F [Escherichia coli KTE166]
 gb|AGC86035.1| enterobactin synthase subunit F [Escherichia coli APEC O78]
 gb|EMX01428.1| enterobactin synthase component F [Escherichia coli ThroopD]
 gb|EOV38663.1| enterobactin synthase component F [Escherichia coli KTE222]
 gb|EQN71403.1| enterobactin synthase component F [Escherichia coli HVH 18 (4-8589585)]
 gb|EQO34992.1| enterobactin synthase component F [Escherichia coli HVH 33 (4-2174936)]
 gb|EQR44512.1| enterobactin synthase component F [Escherichia coli HVH 121 (4-6877826)]
 gb|EQS58330.1| enterobactin synthase component F [Escherichia coli HVH 150 (4-3258106)]
 gb|EQZ20066.1| enterobactin synthase component F [Escherichia coli UMEA 3355-1]
 gb|EZK18337.1| enterobactin synthase component F [Escherichia coli 2-005-03_S1_C3]
 gb|EZK32933.1| enterobactin synthase component F [Escherichia coli 1-182-04_S1_C1]
 gb|EZK36189.1| enterobactin synthase component F [Escherichia coli 2-005-03_S1_C2]
 gb|EZK52844.1| enterobactin synthase component F [Escherichia coli 2-005-03_S1_C1]
 gb|KDA65427.1| enterobactin synthase component F [Escherichia coli 2-052-05_S1_C1]
 gb|KDH01792.1| enterobactin synthase component F [Escherichia coli UCI 66]
 gb|KDT16695.1| enterobactin synthase component F [Escherichia coli 2-052-05_S1_C3]
 gb|KDW24953.1| enterobactin synthase component F [Escherichia coli 2-177-06_S1_C1]
 gb|KDW36829.1| enterobactin synthase component F [Escherichia coli 2-177-06_S1_C2]
 gb|KDW44285.1| enterobactin synthase component F [Escherichia coli 2-177-06_S1_C3]
 gb|KDW87237.1| enterobactin synthase component F [Escherichia coli 2-210-07_S4_C1]
 gb|KHG77330.1| enterobactin synthase subunit F [Escherichia coli]
 gb|AJE54909.1| enterobactin synthetase component F [Escherichia coli]
 gb|KIQ39278.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIQ44462.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077792.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EFJ84055.1| enterobactin synthetase component F [Escherichia coli MS 84-1]
 gb|EFK70371.1| enterobactin synthetase component F [Escherichia coli MS 124-1]
 gb|EFU35086.1| enterobactin synthetase component F [Escherichia coli MS 85-1]
 gb|EQU30535.1| enterobactin synthase component F [Escherichia coli HVH 200 (4-4449924)]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032286041.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EZJ24484.1| enterobactin synthase component F [Escherichia coli 1-182-04_S4_C3]
 gb|EZJ46518.1| enterobactin synthase component F [Escherichia coli 1-182-04_S4_C2]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032309029.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EZE29430.1| enterobactin synthase subunit F [Escherichia coli O91:NM str. 
2009C-3745]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077710.1| enterobactin synthase subunit F [Escherichia coli]
 gb|ABV17231.1| enterobactin synthetase component F [Escherichia coli O139:H28 
str. E24377A]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077683.1| enterobactin synthase subunit F [Shigella sonnei]
 gb|AAZ87305.1| ATP-dependent serine activating enzyme [Shigella sonnei Ss046]
 gb|EFZ49836.1| enterobactin synthetase component F [Shigella sonnei 53G]
 gb|EIQ47427.1| enterobactin synthase component F [Shigella sonnei 3226-85]
 gb|EIQ54652.1| amino acid adenylation domain protein [Shigella sonnei 4822-66]
 gb|KGY96098.1| enterobactin synthase subunit F [Shigella sonnei]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077684.1| enterobactin synthase subunit F [Shigella sonnei]
 gb|EJL19451.1| amino acid adenylation domain protein [Shigella sonnei str. Moseley]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_038977237.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032186192.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KDW05573.1| enterobactin synthase component F [Escherichia coli 2-156-04_S3_C1]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032317168.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EZA64474.1| enterobactin synthase subunit F [Escherichia coli O104:H21 str. 
94-3025]
 gb|AIZ86139.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001557911.1| enterobactin synthase component F [Escherichia coli]
 gb|ENE28972.1| enterobactin synthase component F [Escherichia coli P0302293.10]
 gb|ENE54713.1| enterobactin synthase component F [Escherichia coli P0302293.9]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077704.1| enterobactin synthase subunit F [Escherichia coli]
 dbj|BAI23990.1| enterobactin synthase multienzyme complex component EntF, ATP-dependent 
[Escherichia coli O26:H11 str. 11368]
 dbj|BAI34588.1| enterobactin synthase multienzyme complex component EntF, ATP-dependent 
[Escherichia coli O111:H- str. 11128]
 gb|EFZ39944.1| enterobactin synthetase component F [Escherichia coli EPECa14]
 gb|EFZ65498.1| enterobactin synthetase component F [Escherichia coli OK1180]
 gb|EGW77164.1| enterobactin synthetase component F [Escherichia coli 2534-86]
 gb|EHW14635.1| enterobactin synthase component F [Escherichia coli DEC8A]
 gb|EHW18907.1| amino acid adenylation domain protein [Escherichia coli DEC8B]
 gb|EHW24339.1| amino acid adenylation domain protein [Escherichia coli DEC8C]
 gb|EHW30223.1| amino acid adenylation domain protein [Escherichia coli DEC8D]
 gb|EHW34955.1| amino acid adenylation domain protein [Escherichia coli DEC8E]
 gb|EHW42850.1| amino acid adenylation domain protein [Escherichia coli DEC9A]
 gb|EHW44100.1| amino acid adenylation domain protein [Escherichia coli DEC9B]
 gb|EHW51538.1| amino acid adenylation domain protein [Escherichia coli DEC9C]
 gb|EHW56113.1| amino acid adenylation domain protein [Escherichia coli DEC9D]
 gb|EHW63076.1| amino acid adenylation domain protein [Escherichia coli DEC9E]
 gb|EHW68554.1| amino acid adenylation domain protein [Escherichia coli DEC10A]
 gb|EHW77161.1| amino acid adenylation domain protein [Escherichia coli DEC10B]
 gb|EHW82741.1| amino acid adenylation domain protein [Escherichia coli DEC10D]
 gb|EHX00112.1| amino acid adenylation domain protein [Escherichia coli DEC10F]
 gb|EIH79252.1| enterobactin synthetase component F [Escherichia coli 4.0522]
 gb|EIH90745.1| enterobactin synthetase component F [Escherichia coli JB1-95]
 gb|EIJ17630.1| enterobactin synthetase component F [Escherichia coli 900105 
(10e)]
 gb|EIL06278.1| enterobactin synthase subunit F [Escherichia coli O111:H11 str. 
CVM9534]
 gb|EIL16827.1| enterobactin synthase subunit F [Escherichia coli O111:H8 str. 
CVM9570]
 gb|EIL30529.1| enterobactin synthase subunit F [Escherichia coli O111:H11 str. 
CVM9545]
 gb|EIL41017.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
CVM9942]
 gb|EIL42232.1| enterobactin synthase multienzyme complex component EntF, ATP-dependent 
[Escherichia coli O26:H11 str. CVM10026]
 gb|EJE68777.1| enterobactin synthase subunit F [Escherichia coli O111:H8 str. 
CVM9602]
 gb|EJE70852.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
CVM10224]
 gb|EJE75624.1| enterobactin synthase subunit F [Escherichia coli O111:H8 str. 
CVM9634]
 gb|EJE77061.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
CVM10021]
 gb|EJE81959.1| enterobactin synthase subunit F [Escherichia coli O111:H11 str. 
CVM9553]
 gb|EJE84126.1| enterobactin synthase subunit F [Escherichia coli O111:H11 str. 
CVM9455]
 gb|EJE93859.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
CVM9952]
 gb|EKJ26732.1| enterobactin synthetase component F [Escherichia coli EC1865]
 gb|EKT98415.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
CFSAN001629]
 gb|EKT98605.1| enterobactin synthase subunit F [Escherichia coli O111:H8 str. 
CFSAN001632]
 gb|EKU00969.1| enterobactin synthase subunit F [Escherichia coli O111:H11 str. 
CFSAN001630]
 gb|ERA62138.1| enterobactin synthase subunit F [Escherichia coli 95NR1]
 gb|ERE04442.1| enterobactin synthase subunit F [Escherichia coli 95JB1]
 gb|ETD64634.1| enterobactin synthase subunit F [Escherichia coli ATCC BAA-2209]
 gb|ETI74221.1| enterobactin synthase subunit F [Escherichia coli ATCC BAA-2196]
 gb|ETJ56686.1| enterobactin synthase subunit F [Escherichia coli ATCC BAA-2193]
 gb|EYU77405.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
2010C-4221]
 gb|EYU83886.1| enterobactin synthase subunit F [Escherichia coli O26:NM str. 
2010C-4347]
 gb|EYU91218.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
2010C-4086]
 gb|EYU99144.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
2010C-3977]
 gb|EYV63309.1| enterobactin synthase subunit F [Escherichia coli O103:H11 str. 
2010C-3214]
 gb|EYW91039.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
08-4487]
 gb|EYX04661.1| enterobactin synthase subunit F [Escherichia coli O118:H16 str. 
08-3651]
 gb|EYX19314.1| enterobactin synthase subunit F [Escherichia coli O69:H11 str. 
07-4281]
 gb|EYX76695.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
2011C-3679]
 gb|EYX78152.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
2011C-3632]
 gb|EYX93019.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
2011C-3573]
 gb|EYY07801.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
2011C-3362]
 gb|EYY11912.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
2011C-3170]
 gb|EYY64780.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
2010C-4799]
 gb|EYY67173.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
2010C-4818]
 gb|EYY74049.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
2010C-4746]
 gb|EYY76379.1| enterobactin synthase subunit F [Escherichia coli O26:NM str. 
2010C-4788]
 gb|EYY86584.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
2010C-4735]
 gb|EYY97348.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
2010C-4715]
 gb|EYZ04221.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
2010C-4592]
 gb|EYZ67716.1| enterobactin synthase subunit F [Escherichia coli O118:H16 str. 
06-3612]
 gb|EYZ75198.1| enterobactin synthase subunit F [Escherichia coli O69:H11 str. 
06-3325]
 gb|EYZ87262.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
04-3211]
 gb|EYZ92237.1| enterobactin synthase subunit F [Escherichia coli O118:H16 str. 
06-3256]
 gb|EZA04644.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
03-3484]
 gb|EZA43316.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
05-3646]
 gb|EZA81374.1| enterobactin synthase subunit F [Escherichia coli O111:H8 str. 
F6627]
 gb|EZD20945.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
K6723]
 gb|EZD23833.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
K6722]
 gb|EZD29358.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
K6728]
 gb|EZD43054.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
K6890]
 gb|EZD47723.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
K6895]
 gb|EZD54180.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
K6897]
 gb|EZD55219.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
K6898]
 gb|EZD61579.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
K6904]
 gb|EZD68292.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
K6915]
 gb|EZD68688.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
K6908]
 gb|EZE05536.1| enterobactin synthase subunit F [Escherichia coli O69:H11 str. 
08-4661]
 gb|EZE25544.1| enterobactin synthase subunit F [Escherichia coli O123:H11 str. 
2009C-3307]
 gb|EZE30568.1| enterobactin synthase subunit F [Escherichia coli O69:H11 str. 
2009C-3601]
 gb|EZE38488.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
2009C-4006]
 gb|EZE48610.1| enterobactin synthase subunit F [Escherichia coli O118:H16 str. 
2009C-4446]
 gb|EZE50456.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
2009C-4052]
 gb|EZG50759.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
03-3500]
 gb|EZG52230.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
06-3464]
 gb|EZG58243.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2010C-4819]
 gb|EZG60730.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2010C-4430]
 gb|EZG74091.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2010C-4834]
 gb|EZG74211.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2010C-5028]
 gb|EZG84302.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2011C-3270]
 gb|EZG84342.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2010EL-1699]
 gb|EZG91244.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2011C-3387]
 gb|EZH03548.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2011C-3506]
 gb|EZH04311.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2011C-3282]
 gb|EZH08754.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2009C-3689]
 gb|EZH10230.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2009C-3612]
 gb|EZH15703.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2011C-3655]
 gb|EZH24458.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2009C-4826]
 gb|EZH24912.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2009C-3996]
 gb|EZH27691.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2009C-4760]
 gb|EZH38298.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2010C-3051]
 gb|EZH43026.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2010C-3472]
 gb|EZH43153.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2010C-3871]
 gb|EZH55335.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2010C-3902]
 gb|EZH55908.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2010C-4244]
 gb|EZQ28797.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
2010C-3053]
 gb|EZQ29726.1| enterobactin synthase subunit F [Escherichia coli O111:H8 str. 
2009EL-2169]
 gb|EZQ35216.1| enterobactin synthase subunit F [Escherichia coli O26:H1 str. 
2009C-4747]
 gb|EZQ37781.1| enterobactin synthase subunit F [Escherichia coli O111:H8 str. 
2009C-4126]
 gb|EZQ43047.1| enterobactin synthase subunit F [Escherichia coli O111:H8 str. 
2011C-3453]
 gb|KDM71207.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KDV13990.1| enterobactin synthase subunit F [Escherichia coli O111:NM str. 
01-3076]
 gb|KDV35187.1| enterobactin synthase subunit F [Escherichia coli O69:H11 str. 
07-3763]
 gb|KDV72436.1| enterobactin synthase subunit F [Escherichia coli O118:H16 str. 
07-4255]
 gb|KDV75769.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
2011C-3274]
 emb|CEK03639.1| enterobactin synthase multienzyme complex component, ATP-dependent 
[Escherichia coli O26:H11]
 gb|KJW55458.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KJW74360.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   417 bits (1071),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_045154210.1| enterobactin synthase subunit F, partial [Escherichia coli]
 gb|KJJ45241.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=900

 Score =   408 bits (1048),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 200/206 (97%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARY FS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYQFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRE GVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLREHGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRF+DVP+LT+LCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFADVPDLTNLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_021526232.1| enterobactin synthase component F [Escherichia coli]
 gb|EQP85462.1| enterobactin synthase component F [Escherichia coli HVH 82 (4-2209276)]
 gb|EYB46771.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KEO94610.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   416 bits (1070),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001391150.1| enterobactin synthase component F [Escherichia coli]
 gb|ENA87240.1| enterobactin synthase component F [Escherichia coli 2730350]
Length=1293

 Score =   416 bits (1070),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001512509.1| enterobactin synthase component F [Escherichia coli]
 gb|END72155.1| enterobactin synthase component F [Escherichia coli P0299483.1]
Length=1293

 Score =   416 bits (1070),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077692.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EIH43420.1| enterobactin synthetase component F [Escherichia coli 99.0741]
Length=1293

 Score =   416 bits (1070),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032267678.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KDZ72488.1| enterobactin synthase component F [Escherichia coli 3-073-06_S4_C2]
 gb|KHH16127.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIG43507.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   416 bits (1070),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032217671.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KDG60072.1| enterobactin synthase component F [Escherichia coli CHS 77]
Length=1293

 Score =   416 bits (1070),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032358686.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EZA26119.1| enterobactin synthase subunit F [Escherichia coli O28ac:NM str. 
02-3404]
Length=1293

 Score =   416 bits (1070),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001462290.1| enterobactin synthase component F [Escherichia coli]
 gb|ENC03628.1| enterobactin synthase component F [Escherichia coli P0299438.3]
Length=1293

 Score =   416 bits (1070),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001402088.1| enterobactin synthase component F [Escherichia coli]
 gb|EMW52576.1| enterobactin synthase component F [Escherichia coli 2780750]
 gb|EMX55168.1| enterobactin synthase component F [Escherichia coli MP020980.2]
 gb|ENA99484.1| enterobactin synthase component F [Escherichia coli 2864350]
 gb|END55927.1| enterobactin synthase component F [Escherichia coli MP020980.1]
 gb|KDG15464.1| enterobactin synthase component F [Escherichia coli BIDMC 74]
 gb|KHI96483.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHJ16880.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   416 bits (1070),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077681.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EFZ56358.1| enterobactin synthetase component F [Escherichia coli LT-68]
Length=1293

 Score =   416 bits (1070),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032284652.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EZJ98812.1| enterobactin synthase component F [Escherichia coli 1-182-04_S1_C3]
 gb|KDA70092.1| enterobactin synthase component F [Escherichia coli 1-182-04_S1_C2]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077715.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EJF03793.1| enterobactin synthase subunit F [Escherichia coli O26:H11 str. 
CVM10030]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001571365.1| enterobactin synthase component F [Escherichia coli]
 gb|ENE45228.1| enterobactin synthase component F [Escherichia coli P0302293.8]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032241553.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KEK81414.1| enterobactin synthase component F [Escherichia coli 3-475-03_S1_C2]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_042049032.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001566157.1| enterobactin synthase component F [Escherichia coli]
 gb|ENE32184.1| enterobactin synthase component F [Escherichia coli P0302293.4]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001483390.1| enterobactin synthase component F [Escherichia coli]
 gb|ENC86051.1| enterobactin synthase component F [Escherichia coli P0299917.9]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077728.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EGI47582.1| enterobactin synthetase component F (Enterochelinsynthase F) 
(Serine-activating enzyme) (Seryl-AMP ligase) [Escherichia coli 
H591]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077727.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EGI38044.1| enterobactin synthetase component F (Enterochelinsynthase F) 
(Serine-activating enzyme) (Seryl-AMP ligase) [Escherichia coli 
TA271]
 gb|EGW85642.1| enterobactin synthetase component F [Escherichia coli STEC_94C]
 gb|EHX82302.1| enterobactin synthase component F [Escherichia coli DEC14A]
 gb|EIG44886.1| enterobactin synthase component F [Escherichia coli B799]
 gb|EIH97817.1| enterobactin synthetase component F [Escherichia coli 96.154]
 gb|EII58104.1| enterobactin synthetase component F [Escherichia coli 3.3884]
 gb|ELC23062.1| enterobactin synthase component F [Escherichia coli KTE12]
 gb|ELG71855.1| enterobactin synthase component F [Escherichia coli KTE136]
 gb|EMV94589.1| enterobactin synthase component F [Escherichia coli 2865200]
 gb|EMX17507.1| enterobactin synthase component F [Escherichia coli P0302293.2]
 gb|ENB42689.1| enterobactin synthase component F [Escherichia coli MP021561.3]
 gb|ENC64004.1| enterobactin synthase component F [Escherichia coli P0299917.5]
 gb|ENC64364.1| enterobactin synthase component F [Escherichia coli P0299917.3]
 gb|ENC75508.1| enterobactin synthase component F [Escherichia coli P0299917.8]
 gb|ENC82515.1| enterobactin synthase component F [Escherichia coli P0299917.7]
 gb|ENE16159.1| enterobactin synthase component F [Escherichia coli P0304799.3]
 gb|ENE24806.1| enterobactin synthase component F [Escherichia coli P0302293.3]
 gb|EOU36498.1| enterobactin synthase component F [Escherichia coli KTE13]
 gb|EQV49563.1| enterobactin synthase component F [Escherichia coli KOEGE 33 
(68a)]
 gb|ESD71912.1| enterobactin synthetase component F [Escherichia coli 908541]
 gb|EYE39851.1| enterobactin synthase component F [Escherichia coli 1-110-08_S1_C2]
 gb|EZA23579.1| enterobactin synthase subunit F [Escherichia coli O113:H21 str. 
07-4224]
 gb|KDY00089.1| enterobactin synthase component F [Escherichia coli 2-316-03_S3_C2]
 gb|KDY04890.1| enterobactin synthase component F [Escherichia coli 2-316-03_S3_C3]
 gb|KDY25457.1| enterobactin synthase component F [Escherichia coli 2-427-07_S1_C2]
 gb|KDZ94066.1| enterobactin synthase component F [Escherichia coli 2-427-07_S1_C1]
 gb|KEJ65100.1| enterobactin synthase component F [Escherichia coli 3-267-03_S4_C1]
 gb|KEN73483.1| enterobactin synthase component F [Escherichia coli 1-392-07_S4_C3]
 gb|KEO03531.1| enterobactin synthase component F [Escherichia coli 1-392-07_S4_C1]
 gb|KEO34021.1| enterobactin synthase component F [Escherichia coli 2-460-02_S1_C1]
 gb|KHI60498.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHI77877.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHI85420.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHJ28838.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIG63173.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIG92335.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIO87403.1| enterobactin synthetase component F [Escherichia coli 97.0264]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_045172294.1| enterobactin synthase subunit F [Escherichia coli]
Length=1292

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  422  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  481

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  482  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  541

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  542  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  601

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  602  TSGSTGRPKGVMVGQTAIVNRLLWMQ  627



>ref|WP_032197801.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KDW97893.1| enterobactin synthase component F [Escherichia coli 2-210-07_S3_C2]
 gb|KDY87385.1| enterobactin synthase component F [Escherichia coli 2-427-07_S1_C3]
 gb|KEJ51448.1| enterobactin synthase component F [Escherichia coli 2-427-07_S4_C3]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032191425.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KEP83765.1| enterobactin synthase subunit F [Escherichia coli E1140]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001477998.1| enterobactin synthase component F [Escherichia coli]
 gb|ENC59399.1| enterobactin synthase component F [Escherichia coli P0299917.4]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001657877.1| enterobactin synthase component F [Escherichia coli]
 gb|EMV98145.1| enterobactin synthase component F [Escherichia coli 2860050]
 gb|ENG35461.1| enterobactin synthase component F [Escherichia coli p0305293.10]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077803.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EFU97117.1| enterobactin synthetase component F [Escherichia coli 3431]
 gb|KDX20369.1| enterobactin synthase component F [Escherichia coli 2-210-07_S3_C3]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 205/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAP TPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPFTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001475099.1| enterobactin synthase component F [Escherichia coli]
 gb|ENC48779.1| enterobactin synthase component F [Escherichia coli P0299917.2]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001680686.1| enterobactin synthase component F [Escherichia coli]
 gb|EMU71787.1| enterobactin synthase component F [Escherichia coli MP021552.12]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032185811.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KDZ05869.1| enterobactin synthase component F [Escherichia coli 2-474-04_S4_C2]
 gb|KDZ12328.1| enterobactin synthase component F [Escherichia coli 2-474-04_S4_C3]
 gb|KEN87514.1| enterobactin synthase component F [Escherichia coli 2-474-04_S4_C1]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077706.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EGB41220.1| AMP-binding enzyme [Escherichia coli H120]
 gb|EGW75870.1| enterobactin synthetase component F [Escherichia coli STEC_B2F1]
 gb|EIH35957.1| enterobactin synthetase component F [Escherichia coli 96.0497]
 gb|EZE65940.1| enterobactin synthase subunit F [Escherichia coli O91:H21 str. 
2009C-4646]
 gb|KDV46845.1| enterobactin synthase subunit F [Escherichia coli O91:H21 str. 
2009C-3740]
 gb|KFV37840.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHH51510.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_040089779.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHG93470.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHH16733.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIG90614.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077725.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EDV62323.1| enterobactin synthetase component F [Escherichia coli B7A]
 gb|EFO58187.1| enterobactin synthetase component F [Escherichia coli MS 145-7]
 gb|AIF61584.1| enterobactin synthetase component F [Escherichia coli B7A]
 gb|KIZ76007.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_023143102.1| enterobactin synthetase component F [Escherichia coli]
 gb|ESD17723.1| enterobactin synthetase component F [Escherichia coli 907710]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_021578403.1| enterobactin synthase component F [Escherichia coli]
 gb|ERA09724.1| enterobactin synthase component F [Escherichia coli UMEA 3805-1]
 gb|KHG81260.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001665237.1| enterobactin synthase component F [Escherichia coli]
 gb|ENG55240.1| enterobactin synthase component F [Escherichia coli p0305293.15]
 gb|ENG73386.1| enterobactin synthase component F [Escherichia coli p0305293.8]
 gb|ENH54277.1| enterobactin synthase component F [Escherichia coli p0305293.7]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001471195.1| enterobactin synthase component F [Escherichia coli]
 gb|ENA07878.1| enterobactin synthase component F [Escherichia coli P0299917.1]
 gb|ENC37000.1| enterobactin synthase component F [Escherichia coli P02997067.6]
 gb|EST66162.1| enterobactin synthase subunit F [Escherichia coli P4-96]
 gb|EST70781.1| enterobactin synthase subunit F [Escherichia coli P4-NR]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077709.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EIL80400.1| enterobactin synthase subunit F [Escherichia coli CUMT8]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077707.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EII20082.1| enterobactin synthetase component F [Escherichia coli 9.0111]
 gb|KDV61353.1| enterobactin synthase subunit F [Escherichia coli O128:H2 str. 
2011C-3317]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077708.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EFK50659.1| enterobactin synthetase component F [Escherichia coli MS 107-1]
 gb|EGU97229.1| enterobactin synthetase component F [Escherichia coli MS 79-10]
 gb|EHY04728.1| amino acid adenylation domain protein [Escherichia coli DEC15A]
 gb|EHY10541.1| amino acid adenylation domain protein [Escherichia coli DEC15B]
 gb|EHY11465.1| amino acid adenylation domain protein [Escherichia coli DEC15C]
 gb|EHY17252.1| amino acid adenylation domain protein [Escherichia coli DEC15D]
 gb|EHY20891.1| amino acid adenylation domain protein [Escherichia coli DEC15E]
 gb|ELG43811.1| enterobactin synthase component F [Escherichia coli KTE91]
 gb|ELH37307.1| enterobactin synthase component F [Escherichia coli KTE184]
 gb|ELJ84816.1| enterobactin synthase component F [Escherichia coli KTE90]
 gb|EMW56559.1| enterobactin synthase component F [Escherichia coli 2770900]
 gb|EMW71211.1| enterobactin synthase component F [Escherichia coli 2749250]
 gb|EMX72141.1| enterobactin synthase component F [Escherichia coli Envira 10/1]
 gb|EMX77694.1| enterobactin synthase component F [Escherichia coli Envira 8/11]
 gb|EMZ87848.1| enterobactin synthase component F [Escherichia coli p0305293.1]
 gb|ENA55835.1| enterobactin synthase component F [Escherichia coli 2729250]
 gb|ENB00312.1| enterobactin synthase component F [Escherichia coli 2860650]
 gb|ENB10464.1| enterobactin synthase component F [Escherichia coli 2866350]
 gb|END54713.1| enterobactin synthase component F [Escherichia coli p0305293.13]
 gb|ENG46541.1| enterobactin synthase component F [Escherichia coli p0305293.12]
 gb|ENG47456.1| enterobactin synthase component F [Escherichia coli p0305293.11]
 gb|ENG79614.1| enterobactin synthase component F [Escherichia coli p0305293.9]
 gb|ENH58333.1| enterobactin synthase component F [Escherichia coli p0305293.6]
 gb|EPH47818.1| Enterobactin synthetase component F, serine activating enzyme 
[Escherichia coli E2265]
 gb|EQW48203.1| enterobactin synthase component F [Escherichia coli UMEA 3065-1]
 gb|EQY01651.1| enterobactin synthase component F [Escherichia coli UMEA 3201-1]
 gb|ESK09716.1| enterobactin synthase component F [Escherichia coli HVH 98 (4-5799287)]
 gb|ESP10364.1| enterobactin synthase component F [Escherichia coli HVH 36 (4-5675286)]
 gb|ESV03075.1| Enterobactin synthetase component F, serine activating enzyme 
[Escherichia coli E1777]
 gb|KDF71040.1| enterobactin synthase component F [Escherichia coli BIDMC 59]
 gb|KDT97167.1| enterobactin synthase component F [Escherichia coli 3-267-03_S3_C2]
 gb|KDX65658.1| enterobactin synthase component F [Escherichia coli 2-222-05_S1_C1]
 gb|KDX74087.1| enterobactin synthase component F [Escherichia coli 2-222-05_S1_C2]
 gb|KEM16790.1| enterobactin synthase component F [Escherichia coli 6-319-05_S1_C2]
 gb|KEM35082.1| enterobactin synthase component F [Escherichia coli 6-319-05_S1_C3]
 gb|KHI33527.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHI99885.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KHO57606.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KIH06857.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_024243596.1| enterobactin synthase subunit F [Escherichia coli]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001548293.1| enterobactin synthase component F [Escherichia coli]
 gb|ELD66478.1| enterobactin synthase component F [Escherichia coli KTE233]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQV+ALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVMALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_000077682.1| enterobactin synthase subunit F [Escherichia coli]
 gb|EIL51593.1| enterobactin synthase subunit F [Escherichia coli 541-15]
 gb|KDX36746.1| enterobactin synthase component F [Escherichia coli 2-156-04_S4_C2]
 gb|KGM59900.1| Enterobactin synthetase [Escherichia coli G3/10]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_032216627.1| enterobactin synthase subunit F [Escherichia coli]
 gb|KDX82454.1| enterobactin synthase component F [Escherichia coli 2-222-05_S1_C3]
 gb|KEN09759.1| enterobactin synthase component F [Escherichia coli 6-319-05_S1_C1]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001716284.1| enterobactin synthase component F [Escherichia coli]
 gb|EMW28359.1| enterobactin synthase component F [Escherichia coli 2848050]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001668457.1| enterobactin synthase component F [Escherichia coli]
 gb|ENG68950.1| enterobactin synthase component F [Escherichia coli p0305293.4]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001763921.1| enterobactin synthase component F [Escherichia coli]
 gb|EMX93402.1| enterobactin synthase component F [Escherichia coli BCE001_MS16]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_001615965.1| enterobactin synthase component F [Escherichia coli]
 gb|ELH53715.1| enterobactin synthase component F [Escherichia coli KTE203]
Length=1293

 Score =   416 bits (1070),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_024254631.1| enterobactin synthase subunit F, partial [Escherichia coli]
Length=888

 Score =   407 bits (1047),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 200/206 (97%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARY FS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYQFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRE GVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLREHGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRF+DVP+LT+LCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFADVPDLTNLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



>ref|WP_044167456.1| enterobactin synthase subunit F [Escherichia coli]
Length=1317

 Score =   417 bits (1071),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%), Gaps = 0/206 (0%)
 Frame = +3

Query  6    DPALLCGDVDIMLPGEYAQLAQLNATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  185
            DPALLCGDVDIMLPGEYAQLAQ+NATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS
Sbjct  423  DPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLSALVAEQAAKTPDAPALADARYLFS  482

Query  186  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  365
            YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD
Sbjct  483  YREMREQVVALANLLRERGVKPGDSVAVALPRSVFLTLALHAIVEAGAAWLPLDTGYPDD  542

Query  366  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  545
            RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF
Sbjct  543  RLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLCYNAPLTPQGSAPLQLSQPHHTAYIIF  602

Query  546  TSGSTGRPKGVMVGQTAIVNRLLWMQ  623
            TSGSTGRPKGVMVGQTAIVNRLLWMQ
Sbjct  603  TSGSTGRPKGVMVGQTAIVNRLLWMQ  628



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077441081409