BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6884

Length=787
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009615544.1|  PREDICTED: CBL-interacting serine/threonine-...    488   3e-169   Nicotiana tomentosiformis
ref|XP_006364978.1|  PREDICTED: CBL-interacting serine/threonine-...    483   3e-167   Solanum tuberosum [potatoes]
ref|XP_006364979.1|  PREDICTED: CBL-interacting serine/threonine-...    480   4e-167   Solanum tuberosum [potatoes]
ref|XP_009615543.1|  PREDICTED: CBL-interacting serine/threonine-...    481   2e-166   Nicotiana tomentosiformis
ref|XP_004238031.1|  PREDICTED: CBL-interacting serine/threonine-...    480   4e-166   Solanum lycopersicum
ref|XP_009790124.1|  PREDICTED: CBL-interacting serine/threonine-...    474   7e-164   Nicotiana sylvestris
ref|XP_009790123.1|  PREDICTED: CBL-interacting serine/threonine-...    468   2e-161   Nicotiana sylvestris
ref|XP_006433759.1|  hypothetical protein CICLE_v10001147mg             462   3e-159   Citrus clementina [clementine]
ref|XP_009790122.1|  PREDICTED: CBL-interacting serine/threonine-...    462   4e-159   Nicotiana sylvestris
emb|CDP00953.1|  unnamed protein product                                461   2e-158   Coffea canephora [robusta coffee]
ref|XP_006472400.1|  PREDICTED: CBL-interacting serine/threonine-...    460   3e-158   Citrus sinensis [apfelsine]
ref|XP_007018315.1|  CBL-interacting protein kinase 8 isoform 1         458   9e-158   
ref|XP_011074289.1|  PREDICTED: CBL-interacting serine/threonine-...    457   3e-157   Sesamum indicum [beniseed]
ref|XP_009790121.1|  PREDICTED: CBL-interacting serine/threonine-...    457   8e-157   Nicotiana sylvestris
ref|XP_007018316.1|  CBL-interacting protein kinase 8 isoform 2         453   1e-155   
ref|XP_006581480.1|  PREDICTED: CBL-interacting serine/threonine-...    451   5e-155   
ref|XP_010060129.1|  PREDICTED: CBL-interacting serine/threonine-...    451   8e-155   Eucalyptus grandis [rose gum]
ref|XP_003526526.1|  PREDICTED: CBL-interacting serine/threonine-...    451   1e-154   Glycine max [soybeans]
gb|EYU36430.1|  hypothetical protein MIMGU_mgv1a006373mg                451   1e-154   Erythranthe guttata [common monkey flower]
gb|EYU36431.1|  hypothetical protein MIMGU_mgv1a006373mg                450   1e-154   Erythranthe guttata [common monkey flower]
ref|XP_003522743.1|  PREDICTED: CBL-interacting serine/threonine-...    449   4e-154   Glycine max [soybeans]
dbj|BAD95890.1|  Ser/Thr protein kinase                                 449   4e-154   Lotus japonicus
dbj|BAD95976.1|  Ser/Thr protein kinase                                 447   8e-154   Lotus japonicus
ref|XP_002527344.1|  CBL-interacting serine/threonine-protein kin...    448   1e-153   Ricinus communis
ref|XP_011016975.1|  PREDICTED: CBL-interacting serine/threonine-...    447   1e-153   Populus euphratica
ref|XP_011016974.1|  PREDICTED: CBL-interacting serine/threonine-...    448   2e-153   Populus euphratica
ref|XP_010664075.1|  PREDICTED: CBL-interacting serine/threonine-...    446   1e-152   Vitis vinifera
ref|XP_002301109.2|  hypothetical protein POPTR_0002s10970g             446   1e-152   Populus trichocarpa [western balsam poplar]
gb|KCW66680.1|  hypothetical protein EUGRSUZ_F00453                     445   1e-152   Eucalyptus grandis [rose gum]
ref|XP_010060127.1|  PREDICTED: CBL-interacting serine/threonine-...    444   5e-152   Eucalyptus grandis [rose gum]
ref|XP_012068077.1|  PREDICTED: CBL-interacting serine/threonine-...    441   1e-150   Jatropha curcas
ref|XP_007137664.1|  hypothetical protein PHAVU_009G145400g             440   1e-150   Phaseolus vulgaris [French bean]
emb|CBI19308.3|  unnamed protein product                                439   5e-150   Vitis vinifera
gb|KJB58805.1|  hypothetical protein B456_009G226900                    437   1e-149   Gossypium raimondii
ref|XP_010060128.1|  PREDICTED: CBL-interacting serine/threonine-...    438   1e-149   Eucalyptus grandis [rose gum]
ref|XP_008352723.1|  PREDICTED: CBL-interacting serine/threonine-...    438   1e-149   Malus domestica [apple tree]
gb|KJB58803.1|  hypothetical protein B456_009G226900                    437   2e-149   Gossypium raimondii
gb|KCW66679.1|  hypothetical protein EUGRSUZ_F00453                     437   4e-149   Eucalyptus grandis [rose gum]
ref|XP_010254634.1|  PREDICTED: CBL-interacting serine/threonine-...    436   1e-148   Nelumbo nucifera [Indian lotus]
ref|NP_001268130.1|  CBL-interacting serine/threonine-protein kin...    435   1e-148   Vitis vinifera
ref|XP_009366378.1|  PREDICTED: CBL-interacting serine/threonine-...    435   2e-148   Pyrus x bretschneideri [bai li]
ref|XP_008352722.1|  PREDICTED: CBL-interacting serine/threonine-...    434   3e-148   Malus domestica [apple tree]
gb|KHN09031.1|  CBL-interacting serine/threonine-protein kinase 8       436   3e-148   Glycine soja [wild soybean]
ref|XP_010104570.1|  CBL-interacting serine/threonine-protein kin...    433   4e-148   
ref|XP_007137665.1|  hypothetical protein PHAVU_009G145400g             434   5e-148   Phaseolus vulgaris [French bean]
ref|XP_009366377.1|  PREDICTED: CBL-interacting serine/threonine-...    432   3e-147   Pyrus x bretschneideri [bai li]
gb|KHG19822.1|  CBL-interacting serine/threonine-protein kinase 8       430   2e-146   Gossypium arboreum [tree cotton]
ref|XP_004490473.1|  PREDICTED: CBL-interacting serine/threonine-...    426   2e-145   
ref|XP_004490472.1|  PREDICTED: CBL-interacting serine/threonine-...    427   2e-145   Cicer arietinum [garbanzo]
gb|KJB64072.1|  hypothetical protein B456_010G032200                    426   5e-145   Gossypium raimondii
ref|XP_010520822.1|  PREDICTED: CBL-interacting serine/threonine-...    426   7e-145   Tarenaya hassleriana [spider flower]
ref|XP_008219189.1|  PREDICTED: CBL-interacting serine/threonine-...    426   9e-145   Prunus mume [ume]
ref|XP_004287407.1|  PREDICTED: CBL-interacting serine/threonine-...    424   2e-144   Fragaria vesca subsp. vesca
ref|XP_008219188.1|  PREDICTED: CBL-interacting serine/threonine-...    423   7e-144   Prunus mume [ume]
gb|AFO10125.1|  CIPK                                                    423   7e-144   Gossypium aridum
gb|AES98330.2|  CBL-interacting kinase                                  422   1e-143   Medicago truncatula
ref|XP_007141302.1|  hypothetical protein PHAVU_008G184400g             419   3e-142   Phaseolus vulgaris [French bean]
ref|XP_006575369.1|  PREDICTED: CBL-interacting serine/threonine-...    414   1e-141   
ref|XP_008378623.1|  PREDICTED: CBL-interacting serine/threonine-...    416   3e-141   
ref|XP_006575368.1|  PREDICTED: CBL-interacting serine/threonine-...    414   4e-141   
ref|XP_003519209.1|  PREDICTED: CBL-interacting serine/threonine-...    416   5e-141   Glycine max [soybeans]
ref|XP_004148410.1|  PREDICTED: CBL-interacting serine/threonine-...    416   6e-141   Cucumis sativus [cucumbers]
ref|XP_008378622.1|  PREDICTED: CBL-interacting serine/threonine-...    415   1e-140   
ref|XP_010519151.1|  PREDICTED: CBL-interacting serine/threonine-...    414   4e-140   Tarenaya hassleriana [spider flower]
ref|XP_008357566.1|  PREDICTED: CBL-interacting serine/threonine-...    414   4e-140   
ref|XP_008357565.1|  PREDICTED: CBL-interacting serine/threonine-...    412   2e-139   
ref|XP_008444962.1|  PREDICTED: CBL-interacting serine/threonine-...    409   2e-138   Cucumis melo [Oriental melon]
ref|XP_003615372.1|  CBL-interacting protein kinase                     407   3e-137   
ref|XP_011627891.1|  PREDICTED: CBL-interacting protein kinase 8 ...    405   7e-137   Amborella trichopoda
ref|XP_006856630.1|  PREDICTED: CBL-interacting protein kinase 8 ...    405   7e-137   Amborella trichopoda
ref|XP_009138030.1|  PREDICTED: CBL-interacting serine/threonine-...    404   2e-136   Brassica rapa
ref|XP_010433771.1|  PREDICTED: CBL-interacting serine/threonine-...    404   2e-136   Camelina sativa [gold-of-pleasure]
ref|XP_007227712.1|  hypothetical protein PRUPE_ppa005163mg             405   3e-136   
ref|NP_194171.1|  CBL-interacting serine/threonine-protein kinase 8     403   5e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413437.1|  hypothetical protein EUTSA_v10025204mg             402   2e-135   Eutrema salsugineum [saltwater cress]
ref|XP_009615545.1|  PREDICTED: CBL-interacting serine/threonine-...    399   5e-135   Nicotiana tomentosiformis
ref|XP_006283734.1|  hypothetical protein CARUB_v10004806mg             400   6e-135   Capsella rubella
ref|XP_010439044.1|  PREDICTED: CBL-interacting serine/threonine-...    400   8e-135   Camelina sativa [gold-of-pleasure]
ref|XP_010448567.1|  PREDICTED: CBL-interacting serine/threonine-...    400   1e-134   Camelina sativa [gold-of-pleasure]
ref|XP_002869721.1|  cbl-interacting protein kinase 8                   400   1e-134   Arabidopsis lyrata subsp. lyrata
gb|AGA37211.1|  CBL-interacting protein kinase 8.1                      400   1e-134   Brassica napus [oilseed rape]
gb|KHG16968.1|  CBL-interacting serine/threonine-protein kinase 8       398   2e-134   Gossypium arboreum [tree cotton]
ref|XP_010671031.1|  PREDICTED: CBL-interacting serine/threonine-...    398   5e-134   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY68878.1|  BnaA01g35110D                                          398   6e-134   Brassica napus [oilseed rape]
ref|XP_010924071.1|  PREDICTED: CBL-interacting protein kinase 8 ...    397   9e-134   Elaeis guineensis
ref|XP_010924072.1|  PREDICTED: CBL-interacting protein kinase 8 ...    396   3e-133   Elaeis guineensis
emb|CDY03449.1|  BnaC01g16330D                                          396   5e-133   
gb|KFK26444.1|  hypothetical protein AALP_AA8G249200                    395   1e-132   Arabis alpina [alpine rockcress]
ref|XP_010671024.1|  PREDICTED: CBL-interacting serine/threonine-...    394   1e-132   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006386453.1|  hypothetical protein POPTR_0002s10970g             392   4e-132   
gb|KHN08228.1|  CBL-interacting serine/threonine-protein kinase 8       388   2e-130   Glycine soja [wild soybean]
gb|KFK26443.1|  hypothetical protein AALP_AA8G249200                    387   7e-130   Arabis alpina [alpine rockcress]
ref|XP_009396326.1|  PREDICTED: CBL-interacting protein kinase 8 ...    387   1e-129   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010520824.1|  PREDICTED: CBL-interacting serine/threonine-...    385   3e-129   Tarenaya hassleriana [spider flower]
ref|XP_009396329.1|  PREDICTED: CBL-interacting protein kinase 8 ...    385   4e-129   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB58806.1|  hypothetical protein B456_009G226900                    382   5e-128   Gossypium raimondii
gb|ADP37977.1|  CBL-interacting protein kinase                          375   7e-128   Brassica napus [oilseed rape]
ref|XP_009790125.1|  PREDICTED: CBL-interacting serine/threonine-...    382   8e-128   Nicotiana sylvestris
gb|AFK34091.1|  unknown                                                 381   1e-127   Lotus japonicus
gb|EPS70902.1|  hypothetical protein M569_03857                         375   2e-127   Genlisea aurea
ref|NP_001043259.1|  Os01g0536000                                       373   5e-124   
ref|NP_001168497.1|  uncharacterized LOC100382276                       371   2e-123   Zea mays [maize]
gb|KHN26167.1|  CBL-interacting serine/threonine-protein kinase 8       368   1e-122   Glycine soja [wild soybean]
tpg|DAA52657.1|  TPA: LOW QUALITY PROTEIN: putative CBL-interacti...    372   3e-122   
ref|XP_007018317.1|  CBL-interacting protein kinase 8 isoform 3         365   1e-121   
ref|XP_003569165.1|  PREDICTED: CBL-interacting protein kinase 8        366   2e-121   Brachypodium distachyon [annual false brome]
ref|XP_004971907.1|  PREDICTED: CBL-interacting protein kinase 8-...    368   2e-121   
gb|ACQ83515.1|  CBL-interacting protein kinase 08                       365   4e-121   Sorghum bicolor [broomcorn]
ref|XP_006645971.1|  PREDICTED: CBL-interacting protein kinase 8-...    362   3e-120   
ref|XP_010519152.1|  PREDICTED: CBL-interacting serine/threonine-...    362   6e-120   
dbj|BAJ86807.1|  predicted protein                                      356   3e-119   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK07603.1|  predicted protein                                      357   6e-118   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AJR22392.1|  CBL-interacting protein kinase 8                        355   2e-117   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006842063.1|  PREDICTED: CBL-interacting protein kinase 24...    347   3e-114   Amborella trichopoda
ref|XP_004287304.1|  PREDICTED: CBL-interacting serine/threonine-...    345   5e-113   Fragaria vesca subsp. vesca
tpg|DAA59081.1|  TPA: putative CBL-interacting protein kinase fam...    342   2e-112   
ref|NP_001268145.1|  CBL-interacting protein kinase 09                  343   2e-112   Vitis vinifera
gb|KJB58804.1|  hypothetical protein B456_009G226900                    342   2e-112   Gossypium raimondii
gb|KJB64073.1|  hypothetical protein B456_010G032200                    342   3e-112   Gossypium raimondii
ref|XP_010656044.1|  PREDICTED: CBL-interacting protein kinase 09...    342   5e-112   Vitis vinifera
ref|XP_011622468.1|  PREDICTED: CBL-interacting serine/threonine-...    341   1e-111   
ref|XP_009791398.1|  PREDICTED: CBL-interacting serine/threonine-...    339   7e-111   Nicotiana sylvestris
gb|KEH28132.1|  CBL-interacting kinase                                  335   5e-110   Medicago truncatula
ref|XP_006475856.1|  PREDICTED: CBL-interacting serine/threonine-...    336   1e-109   Citrus sinensis [apfelsine]
ref|XP_006475857.1|  PREDICTED: CBL-interacting serine/threonine-...    333   1e-109   Citrus sinensis [apfelsine]
ref|XP_007013469.1|  Salt overly sensitive protein 2a isoform 1         335   2e-109   
gb|AHW50679.1|  calcineurin B-like interacting protein kinase           335   2e-109   Nicotiana tabacum [American tobacco]
ref|XP_002524508.1|  CBL-interacting serine/threonine-protein kin...    334   5e-109   Ricinus communis
ref|XP_010250123.1|  PREDICTED: CBL-interacting serine/threonine-...    333   1e-108   Nelumbo nucifera [Indian lotus]
ref|XP_010907282.1|  PREDICTED: CBL-interacting protein kinase 24...    333   2e-108   Elaeis guineensis
ref|XP_009607233.1|  PREDICTED: CBL-interacting serine/threonine-...    331   2e-108   
ref|XP_010907285.1|  PREDICTED: CBL-interacting protein kinase 24...    331   2e-108   
ref|XP_009607229.1|  PREDICTED: CBL-interacting serine/threonine-...    332   3e-108   Nicotiana tomentosiformis
ref|XP_003549757.1|  PREDICTED: CBL-interacting protein kinase 24...    332   4e-108   Glycine max [soybeans]
ref|XP_007155013.1|  hypothetical protein PHAVU_003G165700g             332   5e-108   Phaseolus vulgaris [French bean]
emb|CDL67726.1|  Ser/Thr protein kinase                                 330   2e-107   Arachis hypogaea [goober]
emb|CDP10420.1|  unnamed protein product                                325   2e-107   Coffea canephora [robusta coffee]
gb|KDO80230.1|  hypothetical protein CISIN_1g013421mg                   330   3e-107   Citrus sinensis [apfelsine]
ref|XP_010924073.1|  PREDICTED: CBL-interacting protein kinase 8 ...    328   5e-107   
ref|XP_007202049.1|  hypothetical protein PRUPE_ppa005741mg             329   6e-107   Prunus persica
ref|XP_008362901.1|  PREDICTED: CBL-interacting serine/threonine-...    328   1e-106   
ref|XP_009368859.1|  PREDICTED: CBL-interacting serine/threonine-...    328   1e-106   Pyrus x bretschneideri [bai li]
gb|ABK25058.1|  unknown                                                 328   1e-106   Picea sitchensis
ref|XP_009368863.1|  PREDICTED: CBL-interacting serine/threonine-...    328   2e-106   Pyrus x bretschneideri [bai li]
ref|XP_009368861.1|  PREDICTED: CBL-interacting serine/threonine-...    327   2e-106   Pyrus x bretschneideri [bai li]
gb|AIZ68215.1|  CBL-interacting protein kinase 09-like protein          327   4e-106   Ornithogalum longebracteatum [sea-onion]
ref|NP_001280754.1|  son of sevenless homolog 2                         326   6e-106   Malus domestica [apple tree]
ref|XP_011078405.1|  PREDICTED: CBL-interacting serine/threonine-...    325   1e-105   Sesamum indicum [beniseed]
gb|AES91544.2|  CBL-interacting kinase                                  325   1e-105   Medicago truncatula
dbj|BAD95978.1|  Ser/Thr protein kinase                                 325   1e-105   Lotus japonicus
ref|NP_001234210.1|  calcineurin B-like interacting protein kinase      325   2e-105   Solanum lycopersicum
ref|XP_008385538.1|  PREDICTED: CBL-interacting serine/threonine-...    325   2e-105   
gb|AES91543.2|  CBL-interacting kinase                                  325   3e-105   Medicago truncatula
ref|XP_009364020.1|  PREDICTED: CBL-interacting serine/threonine-...    324   3e-105   Pyrus x bretschneideri [bai li]
gb|AKA42979.1|  salt overly sensitive 2                                 324   6e-105   Oryza coarctata
gb|EMT11501.1|  CBL-interacting protein kinase 24                       322   1e-104   
gb|EEC80936.1|  hypothetical protein OsI_23636                          323   1e-104   Oryza sativa Indica Group [Indian rice]
gb|ACD76985.1|  CBL-interacting protein kinase 24 isoform 2             322   1e-104   Oryza sativa Japonica Group [Japonica rice]
gb|EEE65986.1|  hypothetical protein OsJ_21916                          323   2e-104   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058024.1|  Os06g0606000                                       323   2e-104   
ref|XP_003542672.1|  PREDICTED: CBL-interacting protein kinase 24...    322   2e-104   Glycine max [soybeans]
gb|AEZ51508.1|  CBL-interacting protein kinase 24                       322   3e-104   Hordeum vulgare subsp. spontaneum [wild barley]
ref|XP_008443989.1|  PREDICTED: CBL-interacting serine/threonine-...    322   3e-104   Cucumis melo [Oriental melon]
ref|XP_011659826.1|  PREDICTED: CBL-interacting serine/threonine-...    318   4e-104   Cucumis sativus [cucumbers]
ref|XP_011659824.1|  PREDICTED: CBL-interacting serine/threonine-...    320   1e-103   Cucumis sativus [cucumbers]
gb|AJR22382.1|  CBL-interacting protein kinase 24                       320   2e-103   Triticum aestivum [Canadian hard winter wheat]
ref|XP_012078803.1|  PREDICTED: CBL-interacting serine/threonine-...    320   2e-103   Jatropha curcas
ref|XP_006345226.1|  PREDICTED: CBL-interacting serine/threonine-...    320   2e-103   Solanum tuberosum [potatoes]
ref|XP_012078806.1|  PREDICTED: CBL-interacting protein kinase 24...    320   3e-103   Jatropha curcas
ref|NP_001078442.1|  CBL-interacting serine/threonine-protein kin...    318   3e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380407.1|  PREDICTED: CBL-interacting protein kinase 24       318   1e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002438654.1|  hypothetical protein SORBIDRAFT_10g023680          318   1e-102   Sorghum bicolor [broomcorn]
ref|XP_010047960.1|  PREDICTED: CBL-interacting serine/threonine-...    318   1e-102   
ref|XP_010047958.1|  PREDICTED: CBL-interacting serine/threonine-...    318   1e-102   
ref|XP_010533153.1|  PREDICTED: CBL-interacting serine/threonine-...    318   2e-102   Tarenaya hassleriana [spider flower]
ref|XP_006657117.1|  PREDICTED: CBL-interacting protein kinase 24...    317   3e-102   
ref|XP_011017773.1|  PREDICTED: CBL-interacting serine/threonine-...    314   5e-102   Populus euphratica
ref|XP_011017771.1|  PREDICTED: CBL-interacting serine/threonine-...    316   5e-102   Populus euphratica
ref|XP_002324651.1|  CBL-interacting protein kinase 24                  316   6e-102   Populus trichocarpa [western balsam poplar]
gb|AFW76400.1|  putative CBL-interacting protein kinase family pr...    314   7e-102   
gb|AFW87209.1|  putative CBL-interacting protein kinase family pr...    311   9e-102   
ref|XP_008792023.1|  PREDICTED: CBL-interacting protein kinase 24...    314   1e-101   
ref|XP_008649101.1|  PREDICTED: CBL-interacting protein kinase 24       315   2e-101   
gb|KCW79999.1|  hypothetical protein EUGRSUZ_C01333                     317   3e-101   Eucalyptus grandis [rose gum]
gb|KCW80000.1|  hypothetical protein EUGRSUZ_C01333                     317   3e-101   Eucalyptus grandis [rose gum]
ref|XP_010687974.1|  PREDICTED: CBL-interacting serine/threonine-...    315   3e-101   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008792021.1|  PREDICTED: CBL-interacting protein kinase 24...    314   3e-101   Phoenix dactylifera
ref|XP_010086583.1|  CBL-interacting serine/threonine-protein kin...    313   5e-101   
ref|XP_003563655.1|  PREDICTED: CBL-interacting protein kinase 24...    313   5e-101   Brachypodium distachyon [annual false brome]
ref|NP_001291255.1|  CBL-interacting serine/threonine-protein kin...    313   6e-101   Populus euphratica
ref|XP_004965931.1|  PREDICTED: CBL-interacting protein kinase 24...    313   7e-101   Setaria italica
ref|XP_004965932.1|  PREDICTED: CBL-interacting protein kinase 24...    313   7e-101   
ref|XP_010050019.1|  PREDICTED: CBL-interacting serine/threonine-...    313   8e-101   Eucalyptus grandis [rose gum]
ref|XP_010687975.1|  PREDICTED: CBL-interacting serine/threonine-...    313   9e-101   
gb|AGY49229.1|  CBL-interacting protein kinase 6                        313   1e-100   Physcomitrella patens
ref|NP_001132150.1|  uncharacterized LOC100193569                       312   2e-100   Zea mays [maize]
ref|XP_004490474.1|  PREDICTED: CBL-interacting serine/threonine-...    310   2e-100   
gb|KEH28131.1|  CBL-interacting kinase                                  308   1e-99    Medicago truncatula
gb|ADP37982.1|  salt overly sensitive protein 2a                        306   2e-98    Gossypium hirsutum [American cotton]
gb|KJB64757.1|  hypothetical protein B456_010G063300                    305   2e-98    Gossypium raimondii
gb|ADP37983.1|  salt overly sensitive protein 2b                        307   2e-98    Gossypium hirsutum [American cotton]
gb|KJB64749.1|  hypothetical protein B456_010G063300                    306   4e-98    Gossypium raimondii
gb|KJB64751.1|  hypothetical protein B456_010G063300                    306   4e-98    Gossypium raimondii
ref|XP_002968247.1|  hypothetical protein SELMODRAFT_267186             306   9e-98    
ref|XP_002976133.1|  hypothetical protein SELMODRAFT_175338             306   9e-98    
ref|XP_009607232.1|  PREDICTED: CBL-interacting serine/threonine-...    303   4e-97    Nicotiana tomentosiformis
ref|XP_006450913.1|  hypothetical protein CICLE_v10008418mg             302   6e-97    Citrus clementina [clementine]
ref|XP_007013472.1|  Salt overly sensitive protein 2a isoform 4         302   9e-97    
gb|AAX31387.1|  serine/threonine protein kinase                         293   1e-96    Aegiceras corniculatum
gb|KJB64758.1|  hypothetical protein B456_010G063300                    301   2e-96    Gossypium raimondii
ref|XP_002308077.2|  CBL-interacting protein kinase 24                  300   4e-96    
ref|XP_010435433.1|  PREDICTED: CBL-interacting serine/threonine-...    301   5e-96    Camelina sativa [gold-of-pleasure]
gb|ABJ91233.1|  CBL-interacting protein kinase 27                       299   2e-95    Populus trichocarpa [western balsam poplar]
ref|XP_010440713.1|  PREDICTED: CBL-interacting serine/threonine-...    299   2e-95    Camelina sativa [gold-of-pleasure]
ref|XP_002868418.1|  hypothetical protein ARALYDRAFT_915669             299   2e-95    Arabidopsis lyrata subsp. lyrata
ref|XP_006405548.1|  hypothetical protein EUTSA_v10027753mg             299   5e-95    Eutrema salsugineum [saltwater cress]
ref|XP_006283730.1|  hypothetical protein CARUB_v10004801mg             298   6e-95    
ref|XP_009396330.1|  PREDICTED: CBL-interacting protein kinase 8 ...    295   8e-95    Musa acuminata subsp. malaccensis [pisang utan]
pdb|4D28|A  Chain A, Crystal Structure Of The Kinase Domain Of Sn...    298   9e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001776382.1|  predicted protein                                  297   2e-94    
ref|XP_010450374.1|  PREDICTED: CBL-interacting serine/threonine-...    297   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_006594268.1|  PREDICTED: CBL-interacting protein kinase 24...    296   3e-94    Glycine max [soybeans]
ref|NP_198391.1|  CBL-interacting serine/threonine-protein kinase 24    296   3e-94    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001291227.1|  CBL-interacting serine/threonine-protein kin...    295   8e-94    Populus euphratica
ref|XP_011020136.1|  PREDICTED: CBL-interacting serine/threonine-...    292   5e-93    Populus euphratica
emb|CCH26589.1|  salt overly sensitive 2                                293   7e-93    Arabidopsis thaliana [mouse-ear cress]
emb|CDY36813.1|  BnaC04g32060D                                          293   7e-93    Brassica napus [oilseed rape]
ref|XP_011020135.1|  PREDICTED: CBL-interacting serine/threonine-...    292   1e-92    Populus euphratica
ref|XP_009139958.1|  PREDICTED: CBL-interacting serine/threonine-...    291   5e-92    Brassica rapa
gb|AGA37205.1|  CBL-interacting protein kinase 24.1                     291   5e-92    Brassica napus [oilseed rape]
ref|XP_009788245.1|  PREDICTED: CBL-interacting protein kinase 24...    289   8e-92    Nicotiana sylvestris
gb|EMS54161.1|  CBL-interacting protein kinase 24                       288   1e-91    Triticum urartu
ref|XP_009788220.1|  PREDICTED: CBL-interacting serine/threonine-...    290   2e-91    Nicotiana sylvestris
gb|EEC70824.1|  hypothetical protein OsI_02303                          285   2e-88    Oryza sativa Indica Group [Indian rice]
gb|EPS60358.1|  hypothetical protein M569_14444                         278   4e-88    Genlisea aurea
ref|XP_011622470.1|  PREDICTED: CBL-interacting serine/threonine-...    278   1e-87    Amborella trichopoda
gb|KHN47144.1|  CBL-interacting protein kinase 24                       279   2e-87    Glycine soja [wild soybean]
gb|EEE54746.1|  hypothetical protein OsJ_02106                          283   2e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008242780.1|  PREDICTED: CBL-interacting serine/threonine-...    273   2e-85    
ref|XP_010050650.1|  PREDICTED: CBL-interacting serine/threonine-...    270   3e-85    
ref|XP_001776846.1|  predicted protein                                  272   5e-85    
ref|XP_010907283.1|  PREDICTED: CBL-interacting protein kinase 24...    271   5e-85    Elaeis guineensis
gb|AGY49230.1|  CBL-interacting protein kinase 7                        272   6e-85    Physcomitrella patens
gb|ABR17813.1|  unknown                                                 270   6e-85    Picea sitchensis
gb|KDO80231.1|  hypothetical protein CISIN_1g013421mg                   271   8e-85    Citrus sinensis [apfelsine]
ref|XP_008337394.1|  PREDICTED: CBL-interacting serine/threonine-...    271   8e-85    
dbj|BAD95977.1|  Ser/Thr protein kinase                                 263   2e-82    Lotus japonicus
ref|XP_004508487.1|  PREDICTED: CBL-interacting serine/threonine-...    261   4e-81    
gb|AFW87208.1|  putative CBL-interacting protein kinase family pr...    258   4e-81    
ref|XP_008233068.1|  PREDICTED: CBL-interacting serine/threonine-...    259   5e-81    Prunus mume [ume]
gb|KEH36703.1|  CBL-interacting kinase                                  257   1e-80    Medicago truncatula
ref|XP_007218004.1|  hypothetical protein PRUPE_ppa005700mg             261   1e-80    Prunus persica
ref|XP_001775132.1|  predicted protein                                  260   3e-80    
gb|KEH18589.1|  CBL-interacting kinase                                  256   5e-80    Medicago truncatula
gb|ABM66448.1|  SOS2-like protein                                       259   7e-80    Brassica juncea [brown mustard]
ref|XP_008376207.1|  PREDICTED: CBL-interacting serine/threonine-...    258   1e-79    
gb|KHG25227.1|  CBL-interacting serine/threonine-protein kinase 9       254   2e-79    Gossypium arboreum [tree cotton]
gb|KEH18588.1|  CBL-interacting kinase                                  257   3e-79    Medicago truncatula
ref|XP_010054968.1|  PREDICTED: CBL-interacting serine/threonine-...    257   3e-79    Eucalyptus grandis [rose gum]
ref|XP_010054969.1|  PREDICTED: CBL-interacting serine/threonine-...    257   4e-79    
gb|KJB41610.1|  hypothetical protein B456_007G112100                    254   7e-79    Gossypium raimondii
gb|KJB64756.1|  hypothetical protein B456_010G063300                    255   1e-78    Gossypium raimondii
gb|KJB41605.1|  hypothetical protein B456_007G112100                    255   2e-78    Gossypium raimondii
gb|KJB41607.1|  hypothetical protein B456_007G112100                    255   2e-78    Gossypium raimondii
ref|XP_006598883.1|  PREDICTED: CBL-interacting serine/threonine-...    255   3e-78    Glycine max [soybeans]
ref|XP_010100670.1|  CBL-interacting serine/threonine-protein kin...    256   4e-78    
gb|KDO66335.1|  hypothetical protein CISIN_1g013407mg                   253   7e-78    Citrus sinensis [apfelsine]
emb|CBI38698.3|  unnamed protein product                                254   8e-78    Vitis vinifera
ref|XP_010661479.1|  PREDICTED: CBL-interacting protein kinase 12...    254   8e-78    Vitis vinifera
gb|KJB35621.1|  hypothetical protein B456_006G121600                    251   9e-78    Gossypium raimondii
ref|XP_006470418.1|  PREDICTED: CBL-interacting serine/threonine-...    253   1e-77    Citrus sinensis [apfelsine]
ref|XP_003528768.1|  PREDICTED: CBL-interacting serine/threonine-...    253   1e-77    Glycine max [soybeans]
ref|XP_006369413.1|  hypothetical protein POPTR_0001s23030g             251   1e-77    
ref|XP_006446408.1|  hypothetical protein CICLE_v10015272mg             253   2e-77    Citrus clementina [clementine]
ref|XP_004306623.1|  PREDICTED: CBL-interacting serine/threonine-...    253   2e-77    Fragaria vesca subsp. vesca
ref|XP_010093797.1|  CBL-interacting serine/threonine-protein kin...    253   2e-77    Morus notabilis
ref|XP_007135307.1|  hypothetical protein PHAVU_010G118300g             252   3e-77    Phaseolus vulgaris [French bean]
ref|XP_009366619.1|  PREDICTED: CBL-interacting serine/threonine-...    252   3e-77    Pyrus x bretschneideri [bai li]
ref|XP_006369414.1|  hypothetical protein POPTR_0001s23030g             252   3e-77    
gb|KJB35623.1|  hypothetical protein B456_006G121600                    251   4e-77    
gb|KJB35620.1|  hypothetical protein B456_006G121600                    251   4e-77    
ref|XP_011085229.1|  PREDICTED: CBL-interacting serine/threonine-...    253   5e-77    
ref|XP_006583208.1|  PREDICTED: CBL-interacting serine/threonine-...    251   6e-77    
gb|KJB35615.1|  hypothetical protein B456_006G121600                    251   7e-77    
ref|XP_011093006.1|  PREDICTED: CBL-interacting serine/threonine-...    253   9e-77    
ref|XP_011042034.1|  PREDICTED: CBL-interacting protein kinase 32...    250   1e-76    
ref|NP_001268179.1|  CBL-interacting protein kinase 18                  251   1e-76    
ref|XP_008231493.1|  PREDICTED: LOW QUALITY PROTEIN: CBL-interact...    251   1e-76    
ref|XP_007207461.1|  hypothetical protein PRUPE_ppa005881mg             251   1e-76    
ref|XP_004231541.1|  PREDICTED: CBL-interacting serine/threonine-...    251   1e-76    
ref|XP_010922116.1|  PREDICTED: CBL-interacting protein kinase 32...    251   1e-76    
ref|XP_010922114.1|  PREDICTED: CBL-interacting protein kinase 32...    251   1e-76    
emb|CAN70422.1|  hypothetical protein VITISV_010092                     251   1e-76    
ref|XP_009400474.1|  PREDICTED: CBL-interacting protein kinase 9        251   1e-76    
gb|KDO80232.1|  hypothetical protein CISIN_1g013421mg                   249   1e-76    
gb|KJB09583.1|  hypothetical protein B456_001G151000                    251   1e-76    
gb|KJB09582.1|  hypothetical protein B456_001G151000                    251   2e-76    
ref|XP_010922113.1|  PREDICTED: CBL-interacting protein kinase 32...    251   2e-76    
ref|XP_004231542.1|  PREDICTED: CBL-interacting serine/threonine-...    251   2e-76    
ref|XP_011042029.1|  PREDICTED: CBL-interacting protein kinase 32...    250   2e-76    
ref|XP_009610560.1|  PREDICTED: CBL-interacting serine/threonine-...    248   2e-76    
ref|XP_011080462.1|  PREDICTED: CBL-interacting serine/threonine-...    250   2e-76    
ref|XP_011080461.1|  PREDICTED: CBL-interacting serine/threonine-...    251   2e-76    
ref|XP_008370359.1|  PREDICTED: CBL-interacting serine/threonine-...    250   2e-76    
ref|XP_006361547.1|  PREDICTED: CBL-interacting serine/threonine-...    250   3e-76    
gb|ACD76983.1|  CBL-interacting protein kinase 23                       250   3e-76    
ref|XP_006361546.1|  PREDICTED: CBL-interacting serine/threonine-...    250   3e-76    
ref|XP_007051451.1|  CBL-interacting protein kinase 9                   249   4e-76    
gb|EEC81522.1|  hypothetical protein OsI_24914                          249   4e-76    
ref|XP_010907284.1|  PREDICTED: CBL-interacting protein kinase 24...    248   5e-76    
ref|XP_004510623.1|  PREDICTED: CBL-interacting serine/threonine-...    247   5e-76    
ref|XP_009768709.1|  PREDICTED: CBL-interacting serine/threonine-...    246   6e-76    
ref|XP_002989628.1|  hypothetical protein SELMODRAFT_269551             249   6e-76    
ref|XP_010251862.1|  PREDICTED: CBL-interacting serine/threonine-...    249   7e-76    
ref|XP_002986060.1|  hypothetical protein SELMODRAFT_234951             249   7e-76    
ref|XP_009610556.1|  PREDICTED: CBL-interacting serine/threonine-...    249   7e-76    
ref|XP_002314239.1|  CBL-interacting protein kinase 3                   249   7e-76    
ref|XP_008811953.1|  PREDICTED: CBL-interacting protein kinase 32...    249   8e-76    
ref|XP_010251746.1|  PREDICTED: CBL-interacting protein kinase 32       248   9e-76    
gb|AEZ51507.1|  CBL-interacting protein kinase 23                       249   1e-75    
gb|AGY49228.1|  CBL-interacting protein kinase 1                        248   1e-75    
ref|XP_011042033.1|  PREDICTED: CBL-interacting protein kinase 32...    248   1e-75    
ref|XP_009610559.1|  PREDICTED: CBL-interacting serine/threonine-...    248   1e-75    
ref|XP_001754736.1|  predicted protein                                  248   1e-75    
ref|NP_001058901.1|  Os07g0150700                                       248   1e-75    
ref|XP_007015397.1|  CBL-interacting protein kinase 3 isoform 3         248   2e-75    
ref|XP_010521589.1|  PREDICTED: CBL-interacting serine/threonine-...    248   2e-75    
ref|XP_009768703.1|  PREDICTED: CBL-interacting serine/threonine-...    248   2e-75    
gb|KCW51023.1|  hypothetical protein EUGRSUZ_J00641                     244   2e-75    
gb|KDO66326.1|  hypothetical protein CISIN_1g013407mg                   247   3e-75    
gb|KJB55426.1|  hypothetical protein B456_009G076400                    247   3e-75    
gb|KEH18587.1|  CBL-interacting kinase                                  247   3e-75    
ref|XP_009347024.1|  PREDICTED: CBL-interacting serine/threonine-...    246   3e-75    
ref|XP_012075972.1|  PREDICTED: CBL-interacting serine/threonine-...    247   3e-75    
ref|XP_001757895.1|  predicted protein                                  247   3e-75    
gb|EMT32296.1|  CBL-interacting protein kinase 23                       247   4e-75    
ref|XP_011008382.1|  PREDICTED: CBL-interacting protein kinase 32...    245   4e-75    
ref|NP_001131525.1|  LOC100192864                                       245   4e-75    
ref|XP_011096616.1|  PREDICTED: CBL-interacting protein kinase 23       248   4e-75    
ref|XP_009768708.1|  PREDICTED: CBL-interacting serine/threonine-...    247   4e-75    
gb|ACF22742.1|  CBL interacting serine/threonine kinase                 257   4e-75    
ref|XP_006832895.1|  PREDICTED: CBL-interacting protein kinase 32...    247   4e-75    
ref|XP_011090186.1|  PREDICTED: CBL-interacting serine/threonine-...    246   5e-75    
ref|XP_009347018.1|  PREDICTED: CBL-interacting serine/threonine-...    246   5e-75    
ref|XP_006846572.1|  PREDICTED: CBL-interacting serine/threonine-...    247   5e-75    
gb|KDO86590.1|  hypothetical protein CISIN_1g012228mg                   244   5e-75    
ref|XP_008444639.1|  PREDICTED: CBL-interacting serine/threonine-...    244   5e-75    
ref|XP_004133788.1|  PREDICTED: CBL-interacting serine/threonine-...    246   6e-75    
ref|XP_007015395.1|  CBL-interacting serine/threonine-protein kin...    247   6e-75    
ref|XP_008811952.1|  PREDICTED: CBL-interacting protein kinase 32...    248   6e-75    
ref|XP_010922115.1|  PREDICTED: CBL-interacting protein kinase 32...    250   6e-75    
ref|XP_011008376.1|  PREDICTED: CBL-interacting protein kinase 32...    246   8e-75    
ref|XP_008811951.1|  PREDICTED: CBL-interacting protein kinase 32...    248   9e-75    
ref|XP_010275894.1|  PREDICTED: CBL-interacting serine/threonine-...    246   9e-75    
gb|ACN29035.1|  unknown                                                 246   1e-74    
gb|KJB09263.1|  hypothetical protein B456_001G132200                    246   1e-74    
ref|XP_006657449.1|  PREDICTED: CBL-interacting protein kinase 23...    246   1e-74    
ref|XP_009787738.1|  PREDICTED: CBL-interacting serine/threonine-...    246   1e-74    
ref|XP_009787739.1|  PREDICTED: CBL-interacting serine/threonine-...    246   1e-74    
emb|CDP09658.1|  unnamed protein product                                245   1e-74    
ref|XP_009610094.1|  PREDICTED: CBL-interacting serine/threonine-...    246   1e-74    
ref|XP_002532581.1|  CBL-interacting serine/threonine-protein kin...    246   1e-74    
ref|XP_006577353.1|  PREDICTED: CBL-interacting serine/threonine-...    245   1e-74    
ref|XP_009610096.1|  PREDICTED: CBL-interacting serine/threonine-...    245   2e-74    
ref|XP_011658898.1|  PREDICTED: CBL-interacting serine/threonine-...    243   2e-74    
gb|KJB64755.1|  hypothetical protein B456_010G063300                    244   2e-74    
ref|XP_010031661.1|  PREDICTED: CBL-interacting protein kinase 32...    245   2e-74    
gb|EYU33397.1|  hypothetical protein MIMGU_mgv1a005956mg                246   2e-74    
gb|AJL33748.1|  CBL-interacting protein kinase 23                       245   2e-74    
ref|XP_008444632.1|  PREDICTED: CBL-interacting serine/threonine-...    246   2e-74    
ref|XP_002461461.1|  hypothetical protein SORBIDRAFT_02g003030          245   2e-74    
ref|XP_006444751.1|  hypothetical protein CICLE_v10020168mg             245   2e-74    
ref|XP_008786806.1|  PREDICTED: CBL-interacting protein kinase 32...    245   2e-74    
gb|KCW51021.1|  hypothetical protein EUGRSUZ_J00641                     245   2e-74    
ref|XP_004955457.1|  PREDICTED: CBL-interacting protein kinase 23...    245   2e-74    
ref|XP_008805576.1|  PREDICTED: CBL-interacting protein kinase 9 ...    243   3e-74    
ref|XP_011008381.1|  PREDICTED: CBL-interacting protein kinase 32...    244   4e-74    
ref|XP_008805575.1|  PREDICTED: CBL-interacting protein kinase 9 ...    242   4e-74    
ref|XP_008437833.1|  PREDICTED: CBL-interacting serine/threonine-...    244   5e-74    
ref|XP_010541706.1|  PREDICTED: CBL-interacting serine/threonine-...    244   5e-74    
gb|KHG02542.1|  CBL-interacting serine/threonine-protein kinase 3       244   6e-74    
gb|KDO86588.1|  hypothetical protein CISIN_1g012228mg                   244   6e-74    
ref|XP_004145226.1|  PREDICTED: CBL-interacting serine/threonine-...    244   7e-74    
gb|KHG03616.1|  CBL-interacting serine/threonine-protein kinase 9       244   8e-74    
gb|EYU46170.1|  hypothetical protein MIMGU_mgv1a009762mg                240   9e-74    
gb|KEH32123.1|  CBL-interacting kinase                                  241   9e-74    
ref|XP_004228494.1|  PREDICTED: CBL-interacting serine/threonine-...    243   9e-74    
ref|XP_008371628.1|  PREDICTED: CBL-interacting serine/threonine-...    244   1e-73    
ref|XP_011459448.1|  PREDICTED: CBL-interacting serine/threonine-...    243   1e-73    
ref|XP_009397402.1|  PREDICTED: CBL-interacting protein kinase 23...    240   1e-73    
ref|XP_004250885.1|  PREDICTED: CBL-interacting serine/threonine-...    243   1e-73    
ref|XP_010690725.1|  PREDICTED: CBL-interacting serine/threonine-...    243   2e-73    
gb|KJB66956.1|  hypothetical protein B456_010G168100                    243   2e-73    
gb|KJB34940.1|  hypothetical protein B456_006G092100                    243   2e-73    
ref|XP_010275072.1|  PREDICTED: CBL-interacting serine/threonine-...    242   3e-73    
ref|XP_009592366.1|  PREDICTED: CBL-interacting serine/threonine-...    242   3e-73    
ref|XP_008784843.1|  PREDICTED: CBL-interacting protein kinase 23...    242   3e-73    
ref|XP_010275070.1|  PREDICTED: CBL-interacting serine/threonine-...    242   3e-73    
ref|XP_010655434.1|  PREDICTED: CBL-interacting protein kinase 04...    241   3e-73    
pdb|4CZT|A  Chain A, Crystal Structure Of The Kinase Domain Of Sn...    242   4e-73    
gb|KJB66954.1|  hypothetical protein B456_010G168100                    243   4e-73    
gb|KJB66958.1|  hypothetical protein B456_010G168100                    243   4e-73    
gb|AIZ68216.1|  CBL-interacting protein kinase 32 isoform X3            241   4e-73    
ref|XP_006356369.1|  PREDICTED: CBL-interacting serine/threonine-...    241   4e-73    
pdb|4CZU|A  Chain A, Crystal Structure Of The Kinase Domain Of Sn...    242   4e-73    
gb|EPS70454.1|  hypothetical protein M569_04293                         242   5e-73    
ref|XP_012072157.1|  PREDICTED: CBL-interacting serine/threonine-...    242   5e-73    
ref|XP_008786804.1|  PREDICTED: CBL-interacting protein kinase 32...    244   5e-73    
ref|NP_564353.1|  CBL-interacting serine/threonine-protein kinase 23    243   5e-73    
gb|AAG50566.1|AC073506_8  serine/threonine kinase, putative             242   6e-73    
dbj|BAD95889.1|  Ser/Thr protein kinase                                 241   6e-73    
ref|XP_012083118.1|  PREDICTED: CBL-interacting serine/threonine-...    241   6e-73    
ref|NP_001268217.1|  CBL-interacting protein kinase 04                  241   6e-73    
ref|XP_009360934.1|  PREDICTED: CBL-interacting serine/threonine-...    241   7e-73    
ref|XP_011620409.1|  PREDICTED: CBL-interacting protein kinase 32...    241   7e-73    
ref|XP_010655433.1|  PREDICTED: CBL-interacting protein kinase 04...    241   7e-73    
ref|XP_009360933.1|  PREDICTED: CBL-interacting serine/threonine-...    241   7e-73    
ref|XP_009360932.1|  PREDICTED: CBL-interacting serine/threonine-...    241   8e-73    
ref|XP_009360931.1|  PREDICTED: CBL-interacting serine/threonine-...    241   8e-73    
ref|NP_001168211.1|  uncharacterized LOC100381968                       240   1e-72    
ref|XP_012072155.1|  PREDICTED: CBL-interacting serine/threonine-...    242   1e-72    
ref|XP_008794482.1|  PREDICTED: CBL-interacting protein kinase 23...    241   2e-72    
ref|XP_009397401.1|  PREDICTED: CBL-interacting protein kinase 23...    240   2e-72    
gb|EYU35960.1|  hypothetical protein MIMGU_mgv1a007891mg                238   2e-72    
emb|CAN72580.1|  hypothetical protein VITISV_034332                     240   2e-72    
ref|XP_006306367.1|  hypothetical protein CARUB_v10012271mg             241   2e-72    
ref|XP_004977459.1|  PREDICTED: CBL-interacting protein kinase 32...    239   2e-72    
ref|XP_004293511.1|  PREDICTED: CBL-interacting serine/threonine-...    240   2e-72    
ref|NP_001291236.1|  CBL-interacting serine/threonine-protein kin...    239   2e-72    
ref|XP_010919140.1|  PREDICTED: CBL-interacting protein kinase 9-...    239   3e-72    
ref|XP_006491351.1|  PREDICTED: CBL-interacting serine/threonine-...    239   3e-72    
ref|XP_010499554.1|  PREDICTED: CBL-interacting serine/threonine-...    241   3e-72    
ref|XP_009772992.1|  PREDICTED: CBL-interacting serine/threonine-...    239   3e-72    
ref|XP_010478409.1|  PREDICTED: CBL-interacting serine/threonine-...    241   3e-72    
ref|XP_010499553.1|  PREDICTED: CBL-interacting serine/threonine-...    241   3e-72    
ref|XP_011023108.1|  PREDICTED: CBL-interacting serine/threonine-...    239   3e-72    
ref|XP_010478408.1|  PREDICTED: CBL-interacting serine/threonine-...    241   3e-72    
ref|XP_006574419.1|  PREDICTED: uncharacterized protein LOC100794...    239   3e-72    
gb|ABF95649.1|  CIPK-like protein 1, putative, expressed                237   4e-72    
gb|EEC75139.1|  hypothetical protein OsI_11332                          239   4e-72    
dbj|BAF74756.1|  CBL-interacting protein kinase                         239   4e-72    
gb|ABJ91219.1|  CBL-interacting protein kinase 12                       239   5e-72    
gb|AFK49568.1|  unknown                                                 232   5e-72    
gb|KHN26015.1|  CBL-interacting serine/threonine-protein kinase 3       239   5e-72    
ref|XP_010923725.1|  PREDICTED: CBL-interacting protein kinase 23...    238   7e-72    
ref|XP_007141550.1|  hypothetical protein PHAVU_008G205700g             238   8e-72    
ref|XP_006362750.1|  PREDICTED: CBL-interacting serine/threonine-...    238   8e-72    
gb|ABF95648.1|  CIPK-like protein 1, putative, expressed                236   9e-72    
ref|XP_010054970.1|  PREDICTED: CBL-interacting serine/threonine-...    238   1e-71    
ref|XP_009398325.1|  PREDICTED: CBL-interacting protein kinase 23...    237   1e-71    
gb|ABF95650.1|  CIPK-like protein 1, putative, expressed                237   1e-71    
gb|KHN15895.1|  CBL-interacting serine/threonine-protein kinase 9       238   2e-71    
ref|XP_010460820.1|  PREDICTED: CBL-interacting serine/threonine-...    238   2e-71    
emb|CAA73067.1|  serine/threonine kinase                                237   2e-71    
ref|XP_010460819.1|  PREDICTED: CBL-interacting serine/threonine-...    238   2e-71    
gb|ACQ83503.1|  CBL-interacting protein kinase 03                       237   2e-71    
ref|XP_009410447.1|  PREDICTED: CBL-interacting protein kinase 32...    237   2e-71    
ref|XP_008225519.1|  PREDICTED: CBL-interacting serine/threonine-...    238   2e-71    
ref|XP_008676594.1|  PREDICTED: uncharacterized protein LOC100193...    237   2e-71    
ref|XP_008356087.1|  PREDICTED: CBL-interacting serine/threonine-...    242   2e-71    
ref|XP_001762917.1|  predicted protein                                  237   2e-71    
gb|KCW71454.1|  hypothetical protein EUGRSUZ_E00017                     237   2e-71    
ref|XP_004491203.1|  PREDICTED: CBL-interacting serine/threonine-...    237   2e-71    
gb|KJB35622.1|  hypothetical protein B456_006G121600                    236   3e-71    
ref|XP_009398323.1|  PREDICTED: CBL-interacting protein kinase 23...    236   3e-71    
gb|EMT11568.1|  CBL-interacting protein kinase 9                        237   3e-71    
ref|NP_001049949.1|  Os03g0319400                                       237   3e-71    
ref|XP_007025002.1|  CBL-interacting protein kinase 23 isoform 4        236   3e-71    
ref|XP_004985890.1|  PREDICTED: CBL-interacting protein kinase 9-...    237   4e-71    
ref|XP_008794481.1|  PREDICTED: CBL-interacting protein kinase 23...    237   4e-71    
ref|XP_010538259.1|  PREDICTED: CBL-interacting serine/threonine-...    237   4e-71    
ref|XP_002532976.1|  CBL-interacting serine/threonine-protein kin...    237   4e-71    
ref|XP_006649310.1|  PREDICTED: CBL-interacting protein kinase 9-...    236   4e-71    
ref|XP_009410444.1|  PREDICTED: CBL-interacting protein kinase 32...    236   4e-71    
emb|CDY26276.1|  BnaA09g26270D                                          237   4e-71    
ref|XP_009115173.1|  PREDICTED: CBL-interacting serine/threonine-...    237   5e-71    
ref|XP_007025004.1|  CBL-interacting protein kinase 23 isoform 6        236   5e-71    
gb|KHN06353.1|  CBL-interacting serine/threonine-protein kinase 9       233   6e-71    
ref|XP_007025001.1|  CBL-interacting protein kinase 23 isoform 3        236   6e-71    
ref|XP_007024999.1|  CBL-interacting protein kinase 23 isoform 1        236   7e-71    
ref|XP_010940882.1|  PREDICTED: CBL-interacting protein kinase 23...    236   7e-71    
gb|EMS68378.1|  CBL-interacting protein kinase 23                       248   7e-71    
ref|XP_008658824.1|  PREDICTED: uncharacterized LOC100382328 isof...    234   8e-71    
gb|AIZ68217.1|  CBL-interacting protein kinase 23-like protein          236   8e-71    
ref|XP_007213911.1|  hypothetical protein PRUPE_ppa005492mg             236   9e-71    
gb|EMS68415.1|  CBL-interacting protein kinase 9                        237   1e-70    
ref|XP_010052037.1|  PREDICTED: CBL-interacting serine/threonine-...    236   1e-70    
gb|KJB66957.1|  hypothetical protein B456_010G168100                    236   1e-70    
ref|XP_006415491.1|  hypothetical protein EUTSA_v10007518mg             236   1e-70    
gb|KJB41608.1|  hypothetical protein B456_007G112100                    234   1e-70    
ref|XP_011039062.1|  PREDICTED: CBL-interacting serine/threonine-...    235   1e-70    
ref|XP_004978441.1|  PREDICTED: CBL-interacting protein kinase 32...    235   1e-70    
ref|XP_010549503.1|  PREDICTED: CBL-interacting serine/threonine-...    236   1e-70    
dbj|BAF01803.1|  putative protein kinase                                230   1e-70    
ref|XP_008672846.1|  PREDICTED: LOC100281727 isoform X5                 233   1e-70    
gb|KHG08503.1|  CBL-interacting serine/threonine-protein kinase 3       235   1e-70    
ref|XP_011039070.1|  PREDICTED: CBL-interacting serine/threonine-...    235   1e-70    
ref|XP_008672845.1|  PREDICTED: LOC100281727 isoform X4                 233   2e-70    
ref|XP_006468060.1|  PREDICTED: CBL-interacting serine/threonine-...    235   2e-70    
ref|XP_002320224.1|  CBL-interacting protein kinase 9                   235   2e-70    



>ref|XP_009615544.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X2 [Nicotiana tomentosiformis]
Length=447

 Score =   488 bits (1255),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 226/260 (87%), Positives = 246/260 (95%), Gaps = 1/260 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVILYVLMAGYLPFDEVDLTTLY KIE+AEFSCPSWFPVGAKSLIH+ILDPNP
Sbjct  188  VADIWSCGVILYVLMAGYLPFDEVDLTTLYAKIEKAEFSCPSWFPVGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            +TRIRIEEIRNDEWFKKGY+PVK +EYEDVNLDDINAAFDDTEEE PNEQC+N D GPLA
Sbjct  248  QTRIRIEEIRNDEWFKKGYVPVKAMEYEDVNLDDINAAFDDTEEERPNEQCDNADAGPLA  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDS-ATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIR  251
            LNAFDLIILS+GLNLSVLFDRGQD+   HQTRFLTQKPAKV LS+MEVVAQSMGFKTHIR
Sbjct  308  LNAFDLIILSQGLNLSVLFDRGQDTMKQHQTRFLTQKPAKVVLSSMEVVAQSMGFKTHIR  367

Query  250  NYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLI  71
            NYKMRVEGLSA+K SHFSVILE+F+VAPTFFMVD+QKAAGD+ EFLKFYKNFCGNLED+I
Sbjct  368  NYKMRVEGLSANKTSHFSVILEVFEVAPTFFMVDVQKAAGDAGEFLKFYKNFCGNLEDII  427

Query  70   WKPPDELCKSRITKAKSKKR  11
            WKP DE CKSR+TK +S+KR
Sbjct  428  WKPSDESCKSRVTKTRSRKR  447



>ref|XP_006364978.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X1 [Solanum tuberosum]
Length=447

 Score =   483 bits (1243),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 222/260 (85%), Positives = 247/260 (95%), Gaps = 1/260 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVILYVLMAGYLPFDEVDLTTLY KI++A+FSCPSWFPVGAKSLIH+ILDPNP
Sbjct  188  VADIWSCGVILYVLMAGYLPFDEVDLTTLYAKIDKADFSCPSWFPVGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            +TRIRIEEIRNDEWFKK Y PVK++EYEDVNLDDINAAFDDTEEE  NEQC+N D GPLA
Sbjct  248  QTRIRIEEIRNDEWFKKNYDPVKVMEYEDVNLDDINAAFDDTEEEASNEQCDNADAGPLA  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSAT-HQTRFLTQKPAKVALSTMEVVAQSMGFKTHIR  251
            LNAFDLIILS+GLNLS+LFDRGQDS   HQTRFLTQKPAKV LS+MEVVAQSMGFKTHIR
Sbjct  308  LNAFDLIILSQGLNLSILFDRGQDSMKHHQTRFLTQKPAKVVLSSMEVVAQSMGFKTHIR  367

Query  250  NYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLI  71
            N+KMRVEGLSA+K SHFSVILE+F+VAPTFFMVD+QKAAGD++EFLKFYKNFCGNLED+I
Sbjct  368  NFKMRVEGLSANKTSHFSVILEVFEVAPTFFMVDVQKAAGDASEFLKFYKNFCGNLEDII  427

Query  70   WKPPDELCKSRITKAKSKKR  11
            W+PPDE CKSR+TKA+S+KR
Sbjct  428  WRPPDESCKSRVTKARSRKR  447



>ref|XP_006364979.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X2 [Solanum tuberosum]
Length=387

 Score =   480 bits (1235),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 222/260 (85%), Positives = 247/260 (95%), Gaps = 1/260 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVILYVLMAGYLPFDEVDLTTLY KI++A+FSCPSWFPVGAKSLIH+ILDPNP
Sbjct  128  VADIWSCGVILYVLMAGYLPFDEVDLTTLYAKIDKADFSCPSWFPVGAKSLIHRILDPNP  187

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            +TRIRIEEIRNDEWFKK Y PVK++EYEDVNLDDINAAFDDTEEE  NEQC+N D GPLA
Sbjct  188  QTRIRIEEIRNDEWFKKNYDPVKVMEYEDVNLDDINAAFDDTEEEASNEQCDNADAGPLA  247

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSAT-HQTRFLTQKPAKVALSTMEVVAQSMGFKTHIR  251
            LNAFDLIILS+GLNLS+LFDRGQDS   HQTRFLTQKPAKV LS+MEVVAQSMGFKTHIR
Sbjct  248  LNAFDLIILSQGLNLSILFDRGQDSMKHHQTRFLTQKPAKVVLSSMEVVAQSMGFKTHIR  307

Query  250  NYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLI  71
            N+KMRVEGLSA+K SHFSVILE+F+VAPTFFMVD+QKAAGD++EFLKFYKNFCGNLED+I
Sbjct  308  NFKMRVEGLSANKTSHFSVILEVFEVAPTFFMVDVQKAAGDASEFLKFYKNFCGNLEDII  367

Query  70   WKPPDELCKSRITKAKSKKR  11
            W+PPDE CKSR+TKA+S+KR
Sbjct  368  WRPPDESCKSRVTKARSRKR  387



>ref|XP_009615543.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Nicotiana tomentosiformis]
Length=454

 Score =   481 bits (1238),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 226/267 (85%), Positives = 246/267 (92%), Gaps = 8/267 (3%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVILYVLMAGYLPFDEVDLTTLY KIE+AEFSCPSWFPVGAKSLIH+ILDPNP
Sbjct  188  VADIWSCGVILYVLMAGYLPFDEVDLTTLYAKIEKAEFSCPSWFPVGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTE-------EEVPNEQCNN  449
            +TRIRIEEIRNDEWFKKGY+PVK +EYEDVNLDDINAAFDDTE       EE PNEQC+N
Sbjct  248  QTRIRIEEIRNDEWFKKGYVPVKAMEYEDVNLDDINAAFDDTEVLLGGKLEERPNEQCDN  307

Query  448  EDFGPLALNAFDLIILSEGLNLSVLFDRGQDS-ATHQTRFLTQKPAKVALSTMEVVAQSM  272
             D GPLALNAFDLIILS+GLNLSVLFDRGQD+   HQTRFLTQKPAKV LS+MEVVAQSM
Sbjct  308  ADAGPLALNAFDLIILSQGLNLSVLFDRGQDTMKQHQTRFLTQKPAKVVLSSMEVVAQSM  367

Query  271  GFKTHIRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFC  92
            GFKTHIRNYKMRVEGLSA+K SHFSVILE+F+VAPTFFMVD+QKAAGD+ EFLKFYKNFC
Sbjct  368  GFKTHIRNYKMRVEGLSANKTSHFSVILEVFEVAPTFFMVDVQKAAGDAGEFLKFYKNFC  427

Query  91   GNLEDLIWKPPDELCKSRITKAKSKKR  11
            GNLED+IWKP DE CKSR+TK +S+KR
Sbjct  428  GNLEDIIWKPSDESCKSRVTKTRSRKR  454



>ref|XP_004238031.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Solanum lycopersicum]
Length=447

 Score =   480 bits (1235),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 220/260 (85%), Positives = 246/260 (95%), Gaps = 1/260 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVILYVLMAGYLPFDEVDLTTLY KI++A+FSCPSWFPVGAKSLIH+ILDPNP
Sbjct  188  VADIWSCGVILYVLMAGYLPFDEVDLTTLYAKIDKADFSCPSWFPVGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            +TRIRIEEIRNDEWFKK Y PVK++EYEDVNLDDINAAFDDTEEE  NEQC+N D GPLA
Sbjct  248  QTRIRIEEIRNDEWFKKNYDPVKVMEYEDVNLDDINAAFDDTEEEASNEQCDNADAGPLA  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSAT-HQTRFLTQKPAKVALSTMEVVAQSMGFKTHIR  251
            LNAFDLIILS+GLNLS+LFDRGQDS   HQTRFLTQKPAKV LS+MEVVAQSMGFKTHIR
Sbjct  308  LNAFDLIILSQGLNLSILFDRGQDSMKHHQTRFLTQKPAKVVLSSMEVVAQSMGFKTHIR  367

Query  250  NYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLI  71
            N+KMRVEGLS +K SHFSVILE+F+VAPTFFMVD+QKAAGD++EFLKFYKNFCGNLED+I
Sbjct  368  NFKMRVEGLSTNKTSHFSVILEVFEVAPTFFMVDVQKAAGDASEFLKFYKNFCGNLEDII  427

Query  70   WKPPDELCKSRITKAKSKKR  11
            W+PPDE CKS++TKA+S+KR
Sbjct  428  WRPPDESCKSKVTKARSRKR  447



>ref|XP_009790124.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X4 [Nicotiana sylvestris]
Length=447

 Score =   474 bits (1220),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 221/260 (85%), Positives = 242/260 (93%), Gaps = 1/260 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVILYVLMAGYLPFDEVDLTTLY KIERAEFSCPSWFPVGAKSLI +ILDPNP
Sbjct  188  VADIWSCGVILYVLMAGYLPFDEVDLTTLYAKIERAEFSCPSWFPVGAKSLISRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            +TRIRIE+IRNDEWFKKGY+PVK +EYEDVNLDDINAAFDDTE    NEQC+N D GPLA
Sbjct  248  QTRIRIEDIRNDEWFKKGYVPVKSMEYEDVNLDDINAAFDDTEGVRSNEQCDNADAGPLA  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDS-ATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIR  251
            LNAFDLIILS+GLNLSVLFDRGQDS   HQTRFLTQKPAKV LS+MEVVAQSMGFKTHIR
Sbjct  308  LNAFDLIILSQGLNLSVLFDRGQDSMKQHQTRFLTQKPAKVVLSSMEVVAQSMGFKTHIR  367

Query  250  NYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLI  71
            N+KMRVEGLS++K SHFSVILE+F+VAPTFFMVD+QKAAGD+ EFLKFYKNFCGNLED+I
Sbjct  368  NFKMRVEGLSSNKTSHFSVILEVFEVAPTFFMVDVQKAAGDAGEFLKFYKNFCGNLEDII  427

Query  70   WKPPDELCKSRITKAKSKKR  11
            WKP DE CKSR+TK +S+KR
Sbjct  428  WKPSDETCKSRVTKTRSRKR  447



>ref|XP_009790123.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X3 [Nicotiana sylvestris]
Length=454

 Score =   468 bits (1205),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 221/267 (83%), Positives = 243/267 (91%), Gaps = 8/267 (3%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVILYVLMAGYLPFDEVDLTTLY KIERAEFSCPSWFPVGAKSLI +ILDPNP
Sbjct  188  VADIWSCGVILYVLMAGYLPFDEVDLTTLYAKIERAEFSCPSWFPVGAKSLISRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEV-------PNEQCNN  449
            +TRIRIE+IRNDEWFKKGY+PVK +EYEDVNLDDINAAFDDTE  +        NEQC+N
Sbjct  248  QTRIRIEDIRNDEWFKKGYVPVKSMEYEDVNLDDINAAFDDTEVLLGGKLGVRSNEQCDN  307

Query  448  EDFGPLALNAFDLIILSEGLNLSVLFDRGQDS-ATHQTRFLTQKPAKVALSTMEVVAQSM  272
             D GPLALNAFDLIILS+GLNLSVLFDRGQDS   HQTRFLTQKPAKV LS+MEVVAQSM
Sbjct  308  ADAGPLALNAFDLIILSQGLNLSVLFDRGQDSMKQHQTRFLTQKPAKVVLSSMEVVAQSM  367

Query  271  GFKTHIRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFC  92
            GFKTHIRN+KMRVEGLS++K SHFSVILE+F+VAPTFFMVD+QKAAGD+ EFLKFYKNFC
Sbjct  368  GFKTHIRNFKMRVEGLSSNKTSHFSVILEVFEVAPTFFMVDVQKAAGDAGEFLKFYKNFC  427

Query  91   GNLEDLIWKPPDELCKSRITKAKSKKR  11
            GNLED+IWKP DE CKSR+TK +S+KR
Sbjct  428  GNLEDIIWKPSDETCKSRVTKTRSRKR  454



>ref|XP_006433759.1| hypothetical protein CICLE_v10001147mg [Citrus clementina]
 gb|ESR46999.1| hypothetical protein CICLE_v10001147mg [Citrus clementina]
Length=447

 Score =   462 bits (1189),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 211/259 (81%), Positives = 241/259 (93%), Gaps = 1/259 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVL+AGYLPFDE+DLTTLY K+E+A+FSCP+WFPVGAKSLIH+ILDPNPE
Sbjct  189  ADVWSCGVILYVLIAGYLPFDELDLTTLYSKVEKADFSCPTWFPVGAKSLIHRILDPNPE  248

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPN-EQCNNEDFGPLA  428
            TRI IEEIRNDEWF+KGY+PVK+IEYEDVNLDD+NAAFDD+EE  PN EQC  ED GPL 
Sbjct  249  TRITIEEIRNDEWFRKGYVPVKLIEYEDVNLDDVNAAFDDSEEGEPNNEQCGTEDMGPLN  308

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNLS LFDRG++S  HQTRF++QKPAKV LS+MEVVAQSMG+KTHIRN
Sbjct  309  LNAFDLIILSQGLNLSTLFDRGEESVKHQTRFVSQKPAKVVLSSMEVVAQSMGYKTHIRN  368

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA+KI+HFSVILE+F+VAPTFFMVDIQKAAGD+ E+LKFYKNFC NLED+IW
Sbjct  369  YKMRVEGLSANKITHFSVILEVFEVAPTFFMVDIQKAAGDAAEYLKFYKNFCSNLEDIIW  428

Query  67   KPPDELCKSRITKAKSKKR  11
            KPP+E  K++IT +KSKKR
Sbjct  429  KPPNESTKAKITNSKSKKR  447



>ref|XP_009790122.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X2 [Nicotiana sylvestris]
Length=464

 Score =   462 bits (1190),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 221/277 (80%), Positives = 242/277 (87%), Gaps = 18/277 (6%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVILYVLMAGYLPFDEVDLTTLY KIERAEFSCPSWFPVGAKSLI +ILDPNP
Sbjct  188  VADIWSCGVILYVLMAGYLPFDEVDLTTLYAKIERAEFSCPSWFPVGAKSLISRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            +TRIRIE+IRNDEWFKKGY+PVK +EYEDVNLDDINAAFDDTE    NEQC+N D GPLA
Sbjct  248  QTRIRIEDIRNDEWFKKGYVPVKSMEYEDVNLDDINAAFDDTEGVRSNEQCDNADAGPLA  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDS-ATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIR  251
            LNAFDLIILS+GLNLSVLFDRGQDS   HQTRFLTQKPAKV LS+MEVVAQSMGFKTHIR
Sbjct  308  LNAFDLIILSQGLNLSVLFDRGQDSMKQHQTRFLTQKPAKVVLSSMEVVAQSMGFKTHIR  367

Query  250  NYK-----------------MRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDST  122
            N+K                 MRVEGLS++K SHFSVILE+F+VAPTFFMVD+QKAAGD+ 
Sbjct  368  NFKFSWRTLKVSLFCACMSQMRVEGLSSNKTSHFSVILEVFEVAPTFFMVDVQKAAGDAG  427

Query  121  EFLKFYKNFCGNLEDLIWKPPDELCKSRITKAKSKKR  11
            EFLKFYKNFCGNLED+IWKP DE CKSR+TK +S+KR
Sbjct  428  EFLKFYKNFCGNLEDIIWKPSDETCKSRVTKTRSRKR  464



>emb|CDP00953.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   461 bits (1185),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 211/259 (81%), Positives = 235/259 (91%), Gaps = 0/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLYGKIERAEF CPSWFPVGA+SLI + LDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDEIDLTTLYGKIERAEFLCPSWFPVGARSLISRTLDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            +TRIRIEEIRNDEWFKKGY+PVK+ E EDVNLDD+NA F+D EEE  NEQC NED GPL 
Sbjct  248  DTRIRIEEIRNDEWFKKGYVPVKLAESEDVNLDDVNAVFNDAEEEQTNEQCGNEDVGPLV  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNLS LFDR QD   HQTRF++QKPAKV LS+MEVVAQSMGFKTHIRN
Sbjct  308  LNAFDLIILSQGLNLSALFDRKQDLVKHQTRFVSQKPAKVVLSSMEVVAQSMGFKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA+K+SHFSV LEIF+VAPTF MVDIQKA GD++E+LKFYKNFC NLED+IW
Sbjct  368  YKMRVEGLSANKVSHFSVFLEIFEVAPTFIMVDIQKATGDASEYLKFYKNFCSNLEDIIW  427

Query  67   KPPDELCKSRITKAKSKKR  11
            KPP +LCKSRI+ A+SK+R
Sbjct  428  KPPTDLCKSRISLARSKRR  446



>ref|XP_006472400.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
[Citrus sinensis]
Length=447

 Score =   460 bits (1183),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 210/259 (81%), Positives = 240/259 (93%), Gaps = 1/259 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVL+AGYLPFDE+DLTTLY K+E+A+FSCP+WFPVGAKSLIH+ILDPNPE
Sbjct  189  ADVWSCGVILYVLIAGYLPFDELDLTTLYSKVEKADFSCPTWFPVGAKSLIHRILDPNPE  248

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPN-EQCNNEDFGPLA  428
            TRI IEEIRNDEWF+KGY+PVK+IEYEDVNLDD+NAAFDD+EE  PN EQC  ED GPL 
Sbjct  249  TRITIEEIRNDEWFRKGYVPVKLIEYEDVNLDDVNAAFDDSEEGEPNNEQCGTEDMGPLN  308

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNLS LFDRG++S  HQTRF++QKPAKV LS+MEVVAQSMG+KTHIRN
Sbjct  309  LNAFDLIILSQGLNLSTLFDRGEESVKHQTRFVSQKPAKVVLSSMEVVAQSMGYKTHIRN  368

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA+KI+HF VILE+F+VAPTFFMVDIQKAAGD+ E+LKFYKNFC NLED+IW
Sbjct  369  YKMRVEGLSANKITHFKVILEVFEVAPTFFMVDIQKAAGDADEYLKFYKNFCSNLEDIIW  428

Query  67   KPPDELCKSRITKAKSKKR  11
            KPP+E  K++IT +KSKKR
Sbjct  429  KPPNESTKAKITNSKSKKR  447



>ref|XP_007018315.1| CBL-interacting protein kinase 8 isoform 1 [Theobroma cacao]
 gb|EOY15540.1| CBL-interacting protein kinase 8 isoform 1 [Theobroma cacao]
Length=446

 Score =   458 bits (1179),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 208/259 (80%), Positives = 238/259 (92%), Gaps = 0/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KIERAEFSCPSWFPVGAKSLIH+ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDELDLTTLYSKIERAEFSCPSWFPVGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            +TRI IE+IR+DEWFKKG++PV+++EYED+NLDD+NA FDD EEE  NEQ  NED GPL 
Sbjct  248  QTRITIEQIRSDEWFKKGFVPVRLLEYEDINLDDVNAVFDDPEEERGNEQSGNEDMGPLI  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDRGQDS  +QTRF++QKPA+V LS+MEVVAQSMG+KTHIRN
Sbjct  308  LNAFDLIILSQGLNLATLFDRGQDSMKYQTRFVSQKPARVVLSSMEVVAQSMGYKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA+K SHFSVILE+F+VAPTF MVDIQKAAGD+ E+LKFYK FC NLED+IW
Sbjct  368  YKMRVEGLSANKTSHFSVILEVFEVAPTFLMVDIQKAAGDAGEYLKFYKTFCSNLEDIIW  427

Query  67   KPPDELCKSRITKAKSKKR  11
            KPP+E  KSRITK+KSK+R
Sbjct  428  KPPNESSKSRITKSKSKRR  446



>ref|XP_011074289.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Sesamum indicum]
Length=446

 Score =   457 bits (1176),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 209/259 (81%), Positives = 236/259 (91%), Gaps = 0/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            LAD+WSCGVILYVLMAGYLPFDE+DLTTLYGKIE AEFSCPSWFPVGA+SLIH+ILDPNP
Sbjct  188  LADIWSCGVILYVLMAGYLPFDEIDLTTLYGKIENAEFSCPSWFPVGARSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRIRIEEIRNDEWFKK Y PV++ E ED++LDD+NAAFDD EEE+P EQC ++D GPL 
Sbjct  248  ETRIRIEEIRNDEWFKKNYSPVRLPETEDIDLDDVNAAFDDPEEELPTEQCGSDDMGPLV  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNLS LFDR +DS  HQTRF++Q+PAKV LS+MEVVAQSMGFKTHIRN
Sbjct  308  LNAFDLIILSQGLNLSALFDRRKDSLKHQTRFVSQRPAKVVLSSMEVVAQSMGFKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA++ SHFSVI+EIFQVAPTF MVDIQKAAGD+ E+LKFY NFC NL+D+IW
Sbjct  368  YKMRVEGLSANRTSHFSVIVEIFQVAPTFIMVDIQKAAGDAEEYLKFYNNFCNNLDDIIW  427

Query  67   KPPDELCKSRITKAKSKKR  11
            KPPDE+ KSRI K KS+KR
Sbjct  428  KPPDEMPKSRIAKTKSRKR  446



>ref|XP_009790121.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Nicotiana sylvestris]
Length=471

 Score =   457 bits (1176),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 221/284 (78%), Positives = 243/284 (86%), Gaps = 25/284 (9%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVILYVLMAGYLPFDEVDLTTLY KIERAEFSCPSWFPVGAKSLI +ILDPNP
Sbjct  188  VADIWSCGVILYVLMAGYLPFDEVDLTTLYAKIERAEFSCPSWFPVGAKSLISRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEV-------PNEQCNN  449
            +TRIRIE+IRNDEWFKKGY+PVK +EYEDVNLDDINAAFDDTE  +        NEQC+N
Sbjct  248  QTRIRIEDIRNDEWFKKGYVPVKSMEYEDVNLDDINAAFDDTEVLLGGKLGVRSNEQCDN  307

Query  448  EDFGPLALNAFDLIILSEGLNLSVLFDRGQDSA-THQTRFLTQKPAKVALSTMEVVAQSM  272
             D GPLALNAFDLIILS+GLNLSVLFDRGQDS   HQTRFLTQKPAKV LS+MEVVAQSM
Sbjct  308  ADAGPLALNAFDLIILSQGLNLSVLFDRGQDSMKQHQTRFLTQKPAKVVLSSMEVVAQSM  367

Query  271  GFKTHIRNYK-----------------MRVEGLSADKISHFSVILEIFQVAPTFFMVDIQ  143
            GFKTHIRN+K                 MRVEGLS++K SHFSVILE+F+VAPTFFMVD+Q
Sbjct  368  GFKTHIRNFKFSWRTLKVSLFCACMSQMRVEGLSSNKTSHFSVILEVFEVAPTFFMVDVQ  427

Query  142  KAAGDSTEFLKFYKNFCGNLEDLIWKPPDELCKSRITKAKSKKR  11
            KAAGD+ EFLKFYKNFCGNLED+IWKP DE CKSR+TK +S+KR
Sbjct  428  KAAGDAGEFLKFYKNFCGNLEDIIWKPSDETCKSRVTKTRSRKR  471



>ref|XP_007018316.1| CBL-interacting protein kinase 8 isoform 2 [Theobroma cacao]
 gb|EOY15541.1| CBL-interacting protein kinase 8 isoform 2 [Theobroma cacao]
Length=449

 Score =   453 bits (1166),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 208/262 (79%), Positives = 238/262 (91%), Gaps = 3/262 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KIERAEFSCPSWFPVGAKSLIH+ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDELDLTTLYSKIERAEFSCPSWFPVGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTE---EEVPNEQCNNEDFG  437
            +TRI IE+IR+DEWFKKG++PV+++EYED+NLDD+NA FDD E   EE  NEQ  NED G
Sbjct  248  QTRITIEQIRSDEWFKKGFVPVRLLEYEDINLDDVNAVFDDPEVSKEERGNEQSGNEDMG  307

Query  436  PLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTH  257
            PL LNAFDLIILS+GLNL+ LFDRGQDS  +QTRF++QKPA+V LS+MEVVAQSMG+KTH
Sbjct  308  PLILNAFDLIILSQGLNLATLFDRGQDSMKYQTRFVSQKPARVVLSSMEVVAQSMGYKTH  367

Query  256  IRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLED  77
            IRNYKMRVEGLSA+K SHFSVILE+F+VAPTF MVDIQKAAGD+ E+LKFYK FC NLED
Sbjct  368  IRNYKMRVEGLSANKTSHFSVILEVFEVAPTFLMVDIQKAAGDAGEYLKFYKTFCSNLED  427

Query  76   LIWKPPDELCKSRITKAKSKKR  11
            +IWKPP+E  KSRITK+KSK+R
Sbjct  428  IIWKPPNESSKSRITKSKSKRR  449



>ref|XP_006581480.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X2 [Glycine max]
Length=422

 Score =   451 bits (1159),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 204/259 (79%), Positives = 236/259 (91%), Gaps = 0/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVIL+VL+AGYLPFDE+DLTTLY KIERAEFSCPSWFPVGAK LIH+ILDPNP
Sbjct  164  VADVWSCGVILFVLLAGYLPFDELDLTTLYSKIERAEFSCPSWFPVGAKMLIHRILDPNP  223

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI IE+IRNDEWF++ Y+PV ++EYEDVNLDD+NAAFDD EE   ++QC+ ED GPL 
Sbjct  224  ETRITIEQIRNDEWFQRSYVPVSLLEYEDVNLDDVNAAFDDAEEPRADQQCDKEDMGPLM  283

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ +FDRGQDS  +QTRF++QKPAKV LS+MEVVAQSMGFKTHIRN
Sbjct  284  LNAFDLIILSQGLNLATIFDRGQDSVKYQTRFISQKPAKVVLSSMEVVAQSMGFKTHIRN  343

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEG+SA+K S+FSVILEIF+VAPTF+MVDIQKAAGD+ E+LKFYKNFC NLED+IW
Sbjct  344  YKMRVEGISANKTSYFSVILEIFEVAPTFYMVDIQKAAGDTGEYLKFYKNFCSNLEDIIW  403

Query  67   KPPDELCKSRITKAKSKKR  11
            KPP E  KSRI+K KSK+R
Sbjct  404  KPPHEASKSRISKTKSKRR  422



>ref|XP_010060129.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X3 [Eucalyptus grandis]
 gb|KCW66681.1| hypothetical protein EUGRSUZ_F00453 [Eucalyptus grandis]
Length=446

 Score =   451 bits (1160),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 211/258 (82%), Positives = 235/258 (91%), Gaps = 0/258 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVL+AGYLPFDE+DLTTLY KI+ A+FSCPSWFPVGAKSLI +ILDPNPE
Sbjct  189  ADVWSCGVILYVLIAGYLPFDELDLTTLYSKIDNADFSCPSWFPVGAKSLIKRILDPNPE  248

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE+IR+DEWFKKGY PVK+IE EDVNL+DINAAFDD EE+ PNE+  NED  PL L
Sbjct  249  TRITIEQIRDDEWFKKGYNPVKVIESEDVNLEDINAAFDDDEEQQPNEEGGNEDMRPLIL  308

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAFDLIILS+GLNLS LFDRGQDS  HQTRF++QKPAKV LS+MEVVAQSMGFKTHIRNY
Sbjct  309  NAFDLIILSQGLNLSALFDRGQDSVKHQTRFVSQKPAKVVLSSMEVVAQSMGFKTHIRNY  368

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMRVEGLSA K SHFSVILEIF+VAPTFFMVDIQ+AAGD+ E+LKFY++FCGNL+D+IWK
Sbjct  369  KMRVEGLSASKTSHFSVILEIFEVAPTFFMVDIQRAAGDANEYLKFYQSFCGNLDDIIWK  428

Query  64   PPDELCKSRITKAKSKKR  11
            PP E  KSRITK+KSKKR
Sbjct  429  PPGESTKSRITKSKSKKR  446



>ref|XP_003526526.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X1 [Glycine max]
Length=446

 Score =   451 bits (1159),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 204/259 (79%), Positives = 236/259 (91%), Gaps = 0/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVIL+VL+AGYLPFDE+DLTTLY KIERAEFSCPSWFPVGAK LIH+ILDPNP
Sbjct  188  VADVWSCGVILFVLLAGYLPFDELDLTTLYSKIERAEFSCPSWFPVGAKMLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI IE+IRNDEWF++ Y+PV ++EYEDVNLDD+NAAFDD EE   ++QC+ ED GPL 
Sbjct  248  ETRITIEQIRNDEWFQRSYVPVSLLEYEDVNLDDVNAAFDDAEEPRADQQCDKEDMGPLM  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ +FDRGQDS  +QTRF++QKPAKV LS+MEVVAQSMGFKTHIRN
Sbjct  308  LNAFDLIILSQGLNLATIFDRGQDSVKYQTRFISQKPAKVVLSSMEVVAQSMGFKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEG+SA+K S+FSVILEIF+VAPTF+MVDIQKAAGD+ E+LKFYKNFC NLED+IW
Sbjct  368  YKMRVEGISANKTSYFSVILEIFEVAPTFYMVDIQKAAGDTGEYLKFYKNFCSNLEDIIW  427

Query  67   KPPDELCKSRITKAKSKKR  11
            KPP E  KSRI+K KSK+R
Sbjct  428  KPPHEASKSRISKTKSKRR  446



>gb|EYU36430.1| hypothetical protein MIMGU_mgv1a006373mg [Erythranthe guttata]
Length=446

 Score =   451 bits (1159),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 204/259 (79%), Positives = 238/259 (92%), Gaps = 0/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            LAD+WSCGVILYVLMAGYLPFDE+DLTTLYGKIE AEFSCPSWFPVGAKSLIH+ILDPNP
Sbjct  188  LADIWSCGVILYVLMAGYLPFDEIDLTTLYGKIENAEFSCPSWFPVGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRIRIE+IRNDEWFKK Y P+++ E E+++LDD+NAAFDD EEE PNE+C N+D GPL 
Sbjct  248  ETRIRIEDIRNDEWFKKNYDPIRLPETEEIDLDDVNAAFDDPEEESPNEECGNDDTGPLV  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDR +DS  H+TRF++QKPAKV LS+MEVVAQSMGFKTHIRN
Sbjct  308  LNAFDLIILSQGLNLASLFDRRKDSLNHRTRFVSQKPAKVVLSSMEVVAQSMGFKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA++ SHFSVI+EIF+VAPTF MVDIQKAAGD+ E+LKFYKNFC +L+D+IW
Sbjct  368  YKMRVEGLSANRASHFSVIMEIFEVAPTFIMVDIQKAAGDADEYLKFYKNFCNSLDDVIW  427

Query  67   KPPDELCKSRITKAKSKKR  11
            KPPDE+ KSR++K KS++R
Sbjct  428  KPPDEVSKSRVSKTKSRRR  446



>gb|EYU36431.1| hypothetical protein MIMGU_mgv1a006373mg [Erythranthe guttata]
Length=441

 Score =   450 bits (1158),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 204/259 (79%), Positives = 238/259 (92%), Gaps = 0/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            LAD+WSCGVILYVLMAGYLPFDE+DLTTLYGKIE AEFSCPSWFPVGAKSLIH+ILDPNP
Sbjct  183  LADIWSCGVILYVLMAGYLPFDEIDLTTLYGKIENAEFSCPSWFPVGAKSLIHRILDPNP  242

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRIRIE+IRNDEWFKK Y P+++ E E+++LDD+NAAFDD EEE PNE+C N+D GPL 
Sbjct  243  ETRIRIEDIRNDEWFKKNYDPIRLPETEEIDLDDVNAAFDDPEEESPNEECGNDDTGPLV  302

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDR +DS  H+TRF++QKPAKV LS+MEVVAQSMGFKTHIRN
Sbjct  303  LNAFDLIILSQGLNLASLFDRRKDSLNHRTRFVSQKPAKVVLSSMEVVAQSMGFKTHIRN  362

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA++ SHFSVI+EIF+VAPTF MVDIQKAAGD+ E+LKFYKNFC +L+D+IW
Sbjct  363  YKMRVEGLSANRASHFSVIMEIFEVAPTFIMVDIQKAAGDADEYLKFYKNFCNSLDDVIW  422

Query  67   KPPDELCKSRITKAKSKKR  11
            KPPDE+ KSR++K KS++R
Sbjct  423  KPPDEVSKSRVSKTKSRRR  441



>ref|XP_003522743.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
[Glycine max]
Length=446

 Score =   449 bits (1156),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 204/259 (79%), Positives = 235/259 (91%), Gaps = 0/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVL+AGYLPFDE+DLTTLY KIERAEFSCP WFPVGAK LIH+ILDPNP
Sbjct  188  VADVWSCGVILYVLLAGYLPFDELDLTTLYSKIERAEFSCPPWFPVGAKLLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI IE IRNDEWF++ Y+PV ++EYEDVNLDD+NAAFDD EE   ++QC+N+D GPL 
Sbjct  248  ETRITIEHIRNDEWFQRSYVPVSLLEYEDVNLDDVNAAFDDAEELRADQQCDNDDMGPLM  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ +FDRGQDS  +QTRF++QKPAKV LS+MEVVAQSMGFKTHIRN
Sbjct  308  LNAFDLIILSQGLNLATIFDRGQDSVKYQTRFISQKPAKVVLSSMEVVAQSMGFKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEG+SA+K S+FSVILEIF+VAPTF+MVDIQKAAGD+ E+LKFYKNFC NLED+IW
Sbjct  368  YKMRVEGVSANKTSYFSVILEIFEVAPTFYMVDIQKAAGDTGEYLKFYKNFCSNLEDIIW  427

Query  67   KPPDELCKSRITKAKSKKR  11
            KPP E  KSRI+K KSK+R
Sbjct  428  KPPHEASKSRISKTKSKRR  446



>dbj|BAD95890.1| Ser/Thr protein kinase [Lotus japonicus]
Length=448

 Score =   449 bits (1156),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 201/259 (78%), Positives = 236/259 (91%), Gaps = 0/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVL+ GYLPFDE+DLT+LY KIE+AE+SCP  FPVGAK+LIHKILDPNP
Sbjct  188  VADVWSCGVILYVLLVGYLPFDELDLTSLYSKIEKAEYSCPPGFPVGAKTLIHKILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI IE+IRNDEWF++GY+PV ++EYEDVNLDD+NA FDD EE+  N+QC++ED GPL 
Sbjct  248  ETRITIEQIRNDEWFQRGYVPVSLLEYEDVNLDDVNAVFDDAEEQRANQQCDHEDMGPLM  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ +FDRGQDS  +QTRF+TQKPAKV LS+MEVVAQSMGFKTHIRN
Sbjct  308  LNAFDLIILSQGLNLAAIFDRGQDSMKYQTRFITQKPAKVVLSSMEVVAQSMGFKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA K SHFSV+LEIF+VAPTF+MVDIQKAAGD+ E+LKFYKNFCGNLED+IW
Sbjct  368  YKMRVEGLSAKKTSHFSVMLEIFEVAPTFYMVDIQKAAGDAGEYLKFYKNFCGNLEDIIW  427

Query  67   KPPDELCKSRITKAKSKKR  11
            KPP E  KS+++K +SK+R
Sbjct  428  KPPHESTKSKVSKTRSKRR  446



>dbj|BAD95976.1| Ser/Thr protein kinase [Lotus japonicus]
Length=421

 Score =   447 bits (1151),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 201/259 (78%), Positives = 236/259 (91%), Gaps = 0/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVL+ GYLPFDE+DLT+LY KIE+AE+SCP  FPVGAK+LIHKILDPNP
Sbjct  161  VADVWSCGVILYVLLVGYLPFDELDLTSLYSKIEKAEYSCPPGFPVGAKTLIHKILDPNP  220

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI IE+IRNDEWF++GY+PV ++EYEDVNLDD+NA FDD EE+  N+QC++ED GPL 
Sbjct  221  ETRITIEQIRNDEWFQRGYVPVSLLEYEDVNLDDVNAVFDDAEEQRANQQCDHEDMGPLM  280

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ +FDRGQDS  +QTRF+TQKPAKV LS+MEVVAQSMGFKTHIRN
Sbjct  281  LNAFDLIILSQGLNLAAIFDRGQDSMKYQTRFITQKPAKVVLSSMEVVAQSMGFKTHIRN  340

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA K SHFSV+LEIF+VAPTF+MVDIQKAAGD+ E+LKFYKNFCGNLED+IW
Sbjct  341  YKMRVEGLSAKKTSHFSVMLEIFEVAPTFYMVDIQKAAGDAGEYLKFYKNFCGNLEDIIW  400

Query  67   KPPDELCKSRITKAKSKKR  11
            KPP E  KS+++K +SK+R
Sbjct  401  KPPHESTKSKVSKTRSKRR  419



>ref|XP_002527344.1| CBL-interacting serine/threonine-protein kinase, putative [Ricinus 
communis]
 gb|EEF35016.1| CBL-interacting serine/threonine-protein kinase, putative [Ricinus 
communis]
Length=446

 Score =   448 bits (1152),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 205/259 (79%), Positives = 237/259 (92%), Gaps = 0/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KIERAEFSCPSWFPVGAKSLIH+ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDELDLTTLYSKIERAEFSCPSWFPVGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI IE+IRNDEWFKKGY P ++IEYEDVNLDD++AAF D EE+  +EQC NED  PL 
Sbjct  248  ETRITIEQIRNDEWFKKGYAPARLIEYEDVNLDDVDAAFYDPEEQKADEQCRNEDARPLI  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDRG+DS  +QTRF+++KPAKV LS+MEVVAQSMGFKTHIRN
Sbjct  308  LNAFDLIILSQGLNLATLFDRGRDSLKNQTRFVSRKPAKVVLSSMEVVAQSMGFKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA+K +HFSV +E+F+VAP+F MVDIQKAAGD+ E+LKFYK+FCGNL+D+IW
Sbjct  368  YKMRVEGLSANKTAHFSVFVEVFEVAPSFLMVDIQKAAGDAAEYLKFYKDFCGNLDDIIW  427

Query  67   KPPDELCKSRITKAKSKKR  11
            KPP+E  KSR+TK+KSKKR
Sbjct  428  KPPNESSKSRVTKSKSKKR  446



>ref|XP_011016975.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X2 [Populus euphratica]
Length=423

 Score =   447 bits (1150),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 202/258 (78%), Positives = 233/258 (90%), Gaps = 0/258 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KI+RAEFSCPSWFPVGAKSLIH+ILDP P
Sbjct  165  IADVWSCGVILYVLMAGYLPFDELDLTTLYSKIDRAEFSCPSWFPVGAKSLIHRILDPKP  224

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI +E+IRNDEWFKKGY+P+K++EYEDVNLDD+NA FDD EE+  +EQ  NE+  PL 
Sbjct  225  ETRITVEQIRNDEWFKKGYVPIKLVEYEDVNLDDVNAVFDDPEEQRADEQHGNEEMSPLI  284

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDRGQDS  HQTRF+++KPA V LS+MEVVAQSMGFKTHIRN
Sbjct  285  LNAFDLIILSQGLNLAALFDRGQDSLKHQTRFVSKKPATVVLSSMEVVAQSMGFKTHIRN  344

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            +KMRVEGLSADK  HFSVILE+F++APTF MVDIQ+AAGD+ E+LKFYKNFC NLED+IW
Sbjct  345  FKMRVEGLSADKAGHFSVILEVFEIAPTFLMVDIQRAAGDAAEYLKFYKNFCSNLEDIIW  404

Query  67   KPPDELCKSRITKAKSKK  14
            KP  EL KSR+TK+KSK+
Sbjct  405  KPSTELSKSRMTKSKSKR  422



>ref|XP_011016974.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Populus euphratica]
Length=447

 Score =   448 bits (1152),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 202/258 (78%), Positives = 233/258 (90%), Gaps = 0/258 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KI+RAEFSCPSWFPVGAKSLIH+ILDP P
Sbjct  189  IADVWSCGVILYVLMAGYLPFDELDLTTLYSKIDRAEFSCPSWFPVGAKSLIHRILDPKP  248

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI +E+IRNDEWFKKGY+P+K++EYEDVNLDD+NA FDD EE+  +EQ  NE+  PL 
Sbjct  249  ETRITVEQIRNDEWFKKGYVPIKLVEYEDVNLDDVNAVFDDPEEQRADEQHGNEEMSPLI  308

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDRGQDS  HQTRF+++KPA V LS+MEVVAQSMGFKTHIRN
Sbjct  309  LNAFDLIILSQGLNLAALFDRGQDSLKHQTRFVSKKPATVVLSSMEVVAQSMGFKTHIRN  368

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            +KMRVEGLSADK  HFSVILE+F++APTF MVDIQ+AAGD+ E+LKFYKNFC NLED+IW
Sbjct  369  FKMRVEGLSADKAGHFSVILEVFEIAPTFLMVDIQRAAGDAAEYLKFYKNFCSNLEDIIW  428

Query  67   KPPDELCKSRITKAKSKK  14
            KP  EL KSR+TK+KSK+
Sbjct  429  KPSTELSKSRMTKSKSKR  446



>ref|XP_010664075.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X1 [Vitis vinifera]
Length=447

 Score =   446 bits (1146),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 204/258 (79%), Positives = 233/258 (90%), Gaps = 0/258 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KIERAEFSCPSWFPVGAKSLIH+ILDPNP
Sbjct  189  VADVWSCGVILYVLMAGYLPFDELDLTTLYSKIERAEFSCPSWFPVGAKSLIHRILDPNP  248

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRIRIE+IR+DEWF+KGY+PV+++EYEDVNLDD+NA FDD EE+  N+Q  NED GPL 
Sbjct  249  ETRIRIEQIRSDEWFRKGYVPVRLLEYEDVNLDDVNAVFDDPEEQHANDQHGNEDMGPLI  308

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNLS LF+RG+    HQTRF++QKP +V LS+MEVVAQSMGFKTHIRN
Sbjct  309  LNAFDLIILSQGLNLSALFERGEGPVKHQTRFVSQKPPRVVLSSMEVVAQSMGFKTHIRN  368

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEG+SA+K+ HFSV+LEIF+VAPTF MVDIQKAAGD+ E+ KFYKNFC NLED+IW
Sbjct  369  YKMRVEGISANKMEHFSVMLEIFEVAPTFIMVDIQKAAGDAGEYQKFYKNFCSNLEDIIW  428

Query  67   KPPDELCKSRITKAKSKK  14
            KP +E  KSRITK KSKK
Sbjct  429  KPLNESSKSRITKTKSKK  446



>ref|XP_002301109.2| hypothetical protein POPTR_0002s10970g [Populus trichocarpa]
 gb|EEE80382.2| hypothetical protein POPTR_0002s10970g [Populus trichocarpa]
Length=447

 Score =   446 bits (1146),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 202/259 (78%), Positives = 232/259 (90%), Gaps = 0/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KI+RAEFSCPSWFPVGAKSLIH+ILDP P
Sbjct  189  IADVWSCGVILYVLMAGYLPFDELDLTTLYSKIDRAEFSCPSWFPVGAKSLIHRILDPKP  248

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI +E+IRNDEWFKKGY+P+K +EYEDVNLDD+NA FDD EE+  +EQ  NE+  PL 
Sbjct  249  ETRITVEQIRNDEWFKKGYVPIKPVEYEDVNLDDVNAVFDDPEEQRADEQHGNEEMSPLI  308

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDRGQDS  HQTRF+++KPA V LS+MEVVAQSMGFKTHIRN
Sbjct  309  LNAFDLIILSQGLNLAALFDRGQDSLKHQTRFVSKKPATVVLSSMEVVAQSMGFKTHIRN  368

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            +KMRVEGLSADK  HFSVILE+F++APTF MVDIQ+AAGD+ E+LKFYKNFC NLED+IW
Sbjct  369  FKMRVEGLSADKAGHFSVILEVFEIAPTFLMVDIQRAAGDAAEYLKFYKNFCSNLEDIIW  428

Query  67   KPPDELCKSRITKAKSKKR  11
            KP  E  KSR+TK+KSK+R
Sbjct  429  KPSTESSKSRMTKSKSKRR  447



>gb|KCW66680.1| hypothetical protein EUGRSUZ_F00453 [Eucalyptus grandis]
Length=444

 Score =   445 bits (1145),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 210/258 (81%), Positives = 234/258 (91%), Gaps = 2/258 (1%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVL+AGYLPFDE+DLTTLY KI+ A+FSCPSWFPVGAKSLI +ILDPNPE
Sbjct  189  ADVWSCGVILYVLIAGYLPFDELDLTTLYSKIDNADFSCPSWFPVGAKSLIKRILDPNPE  248

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE+IR+DEWFKKGY PVK+IE EDVNL+DINAAFDD E+  PNE+  NED  PL L
Sbjct  249  TRITIEQIRDDEWFKKGYNPVKVIESEDVNLEDINAAFDDDEQ--PNEEGGNEDMRPLIL  306

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAFDLIILS+GLNLS LFDRGQDS  HQTRF++QKPAKV LS+MEVVAQSMGFKTHIRNY
Sbjct  307  NAFDLIILSQGLNLSALFDRGQDSVKHQTRFVSQKPAKVVLSSMEVVAQSMGFKTHIRNY  366

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMRVEGLSA K SHFSVILEIF+VAPTFFMVDIQ+AAGD+ E+LKFY++FCGNL+D+IWK
Sbjct  367  KMRVEGLSASKTSHFSVILEIFEVAPTFFMVDIQRAAGDANEYLKFYQSFCGNLDDIIWK  426

Query  64   PPDELCKSRITKAKSKKR  11
            PP E  KSRITK+KSKKR
Sbjct  427  PPGESTKSRITKSKSKKR  444



>ref|XP_010060127.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Eucalyptus grandis]
 gb|KCW66682.1| hypothetical protein EUGRSUZ_F00453 [Eucalyptus grandis]
Length=455

 Score =   444 bits (1143),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 211/267 (79%), Positives = 235/267 (88%), Gaps = 9/267 (3%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVL+AGYLPFDE+DLTTLY KI+ A+FSCPSWFPVGAKSLI +ILDPNPE
Sbjct  189  ADVWSCGVILYVLIAGYLPFDELDLTTLYSKIDNADFSCPSWFPVGAKSLIKRILDPNPE  248

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE+IR+DEWFKKGY PVK+IE EDVNL+DINAAFDD EE+ PNE+  NED  PL L
Sbjct  249  TRITIEQIRDDEWFKKGYNPVKVIESEDVNLEDINAAFDDDEEQQPNEEGGNEDMRPLIL  308

Query  424  NAFDLIILSEGLNLSVLFDRG---------QDSATHQTRFLTQKPAKVALSTMEVVAQSM  272
            NAFDLIILS+GLNLS LFDRG         QDS  HQTRF++QKPAKV LS+MEVVAQSM
Sbjct  309  NAFDLIILSQGLNLSALFDRGQNFDSSHLRQDSVKHQTRFVSQKPAKVVLSSMEVVAQSM  368

Query  271  GFKTHIRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFC  92
            GFKTHIRNYKMRVEGLSA K SHFSVILEIF+VAPTFFMVDIQ+AAGD+ E+LKFY++FC
Sbjct  369  GFKTHIRNYKMRVEGLSASKTSHFSVILEIFEVAPTFFMVDIQRAAGDANEYLKFYQSFC  428

Query  91   GNLEDLIWKPPDELCKSRITKAKSKKR  11
            GNL+D+IWKPP E  KSRITK+KSKKR
Sbjct  429  GNLDDIIWKPPGESTKSRITKSKSKKR  455



>ref|XP_012068077.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Jatropha curcas]
 gb|KDP41522.1| hypothetical protein JCGZ_15929 [Jatropha curcas]
Length=446

 Score =   441 bits (1133),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 199/259 (77%), Positives = 234/259 (90%), Gaps = 0/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVILYVLMAGYLPFDE+DLTTLY KIE+AEFSCPSWFPV A SLI +ILDPNP
Sbjct  188  VADIWSCGVILYVLMAGYLPFDELDLTTLYSKIEKAEFSCPSWFPVAATSLIRRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI IE+IRNDEWF KGY+P ++IEYEDVNLDD+NAAF+D EE+  +EQ  NED GPL 
Sbjct  248  ETRITIEQIRNDEWFNKGYVPARLIEYEDVNLDDVNAAFNDPEEQRADEQRGNEDTGPLN  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDRG+DS  +QTRF++Q+PAKV LSTMEVVAQSMGFKTHIRN
Sbjct  308  LNAFDLIILSQGLNLATLFDRGKDSVEYQTRFISQRPAKVVLSTMEVVAQSMGFKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA+K ++FSVILE+F+VAP+FFMV+IQ AAGD+ E++KFYKNFC NLED+IW
Sbjct  368  YKMRVEGLSANKTAYFSVILEVFEVAPSFFMVEIQNAAGDAAEYMKFYKNFCNNLEDIIW  427

Query  67   KPPDELCKSRITKAKSKKR  11
            KPP+E  KSRI K++S+KR
Sbjct  428  KPPNESGKSRINKSRSRKR  446



>ref|XP_007137664.1| hypothetical protein PHAVU_009G145400g [Phaseolus vulgaris]
 gb|ESW09658.1| hypothetical protein PHAVU_009G145400g [Phaseolus vulgaris]
Length=446

 Score =   440 bits (1132),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 200/259 (77%), Positives = 234/259 (90%), Gaps = 0/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVL+AGYLPFDE+DLTTLY KIERAEFS P WFPVGAK LI +ILDPNP
Sbjct  188  VADVWSCGVILYVLLAGYLPFDELDLTTLYSKIERAEFSSPPWFPVGAKILIKRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETR+ IE+IRNDEWF++ Y+PV ++EYEDVNLDD+NAAFD+ EE+  ++QC+NED GPL 
Sbjct  248  ETRMTIEQIRNDEWFQRSYVPVSLLEYEDVNLDDVNAAFDEAEEQRADQQCDNEDMGPLM  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ +FDRGQDS  +QTRF+TQKPAKV LS+MEVVAQSMG+KTHIRN
Sbjct  308  LNAFDLIILSQGLNLATIFDRGQDSVKYQTRFITQKPAKVVLSSMEVVAQSMGYKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEG+SA+K S+FSVILEIF+VAPTF+MVDIQKAAGD+ E+LKFYKNF  NLED+IW
Sbjct  368  YKMRVEGVSANKTSYFSVILEIFEVAPTFYMVDIQKAAGDTGEYLKFYKNFHSNLEDIIW  427

Query  67   KPPDELCKSRITKAKSKKR  11
            KPP E  KSRI+K KSK+R
Sbjct  428  KPPHEASKSRISKTKSKRR  446



>emb|CBI19308.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   439 bits (1129),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 204/264 (77%), Positives = 233/264 (88%), Gaps = 6/264 (2%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLY------GKIERAEFSCPSWFPVGAKSLIHK  626
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY      G IERAEFSCPSWFPVGAKSLIH+
Sbjct  189  VADVWSCGVILYVLMAGYLPFDELDLTTLYNIIFRYGLIERAEFSCPSWFPVGAKSLIHR  248

Query  625  ILDPNPETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNE  446
            ILDPNPETRIRIE+IR+DEWF+KGY+PV+++EYEDVNLDD+NA FDD EE+  N+Q  NE
Sbjct  249  ILDPNPETRIRIEQIRSDEWFRKGYVPVRLLEYEDVNLDDVNAVFDDPEEQHANDQHGNE  308

Query  445  DFGPLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGF  266
            D GPL LNAFDLIILS+GLNLS LF+RG+    HQTRF++QKP +V LS+MEVVAQSMGF
Sbjct  309  DMGPLILNAFDLIILSQGLNLSALFERGEGPVKHQTRFVSQKPPRVVLSSMEVVAQSMGF  368

Query  265  KTHIRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGN  86
            KTHIRNYKMRVEG+SA+K+ HFSV+LEIF+VAPTF MVDIQKAAGD+ E+ KFYKNFC N
Sbjct  369  KTHIRNYKMRVEGISANKMEHFSVMLEIFEVAPTFIMVDIQKAAGDAGEYQKFYKNFCSN  428

Query  85   LEDLIWKPPDELCKSRITKAKSKK  14
            LED+IWKP +E  KSRITK KSKK
Sbjct  429  LEDIIWKPLNESSKSRITKTKSKK  452



>gb|KJB58805.1| hypothetical protein B456_009G226900 [Gossypium raimondii]
Length=425

 Score =   437 bits (1124),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 199/262 (76%), Positives = 235/262 (90%), Gaps = 3/262 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KIERAEFSCPSWFP+GAKSLIH+ILDPNP
Sbjct  164  VADVWSCGVILYVLMAGYLPFDELDLTTLYSKIERAEFSCPSWFPMGAKSLIHRILDPNP  223

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTE---EEVPNEQCNNEDFG  437
            +TRI IE+IR+DEWFKK Y+P +++EYED+NLDD+NA FDD E   EE  +E   NE+ G
Sbjct  224  QTRITIEQIRSDEWFKKSYVPARLLEYEDINLDDVNAVFDDPEIDKEERGDEPSRNENMG  283

Query  436  PLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTH  257
            PL LNAFDLIILS+GLNL+ LFDRG+D+  HQTRF+++KPA+V LS+MEVVAQSMG+KTH
Sbjct  284  PLNLNAFDLIILSQGLNLATLFDRGKDTMKHQTRFVSRKPARVVLSSMEVVAQSMGYKTH  343

Query  256  IRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLED  77
            IRNYKMRVEGLSA+K SHFSVILE+F+VAPTF MVDIQKAAGD+ ++LKFYK FC NL+D
Sbjct  344  IRNYKMRVEGLSANKTSHFSVILEVFEVAPTFLMVDIQKAAGDAGDYLKFYKTFCSNLDD  403

Query  76   LIWKPPDELCKSRITKAKSKKR  11
            +IWKPP+E  KSRITK+KSK+R
Sbjct  404  IIWKPPNESSKSRITKSKSKRR  425



>ref|XP_010060128.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X2 [Eucalyptus grandis]
Length=453

 Score =   438 bits (1126),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 210/267 (79%), Positives = 234/267 (88%), Gaps = 11/267 (4%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVL+AGYLPFDE+DLTTLY KI+ A+FSCPSWFPVGAKSLI +ILDPNPE
Sbjct  189  ADVWSCGVILYVLIAGYLPFDELDLTTLYSKIDNADFSCPSWFPVGAKSLIKRILDPNPE  248

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE+IR+DEWFKKGY PVK+IE EDVNL+DINAAFDD E+  PNE+  NED  PL L
Sbjct  249  TRITIEQIRDDEWFKKGYNPVKVIESEDVNLEDINAAFDDDEQ--PNEEGGNEDMRPLIL  306

Query  424  NAFDLIILSEGLNLSVLFDRGQ---------DSATHQTRFLTQKPAKVALSTMEVVAQSM  272
            NAFDLIILS+GLNLS LFDRGQ         DS  HQTRF++QKPAKV LS+MEVVAQSM
Sbjct  307  NAFDLIILSQGLNLSALFDRGQNFDSSHLRQDSVKHQTRFVSQKPAKVVLSSMEVVAQSM  366

Query  271  GFKTHIRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFC  92
            GFKTHIRNYKMRVEGLSA K SHFSVILEIF+VAPTFFMVDIQ+AAGD+ E+LKFY++FC
Sbjct  367  GFKTHIRNYKMRVEGLSASKTSHFSVILEIFEVAPTFFMVDIQRAAGDANEYLKFYQSFC  426

Query  91   GNLEDLIWKPPDELCKSRITKAKSKKR  11
            GNL+D+IWKPP E  KSRITK+KSKKR
Sbjct  427  GNLDDIIWKPPGESTKSRITKSKSKKR  453



>ref|XP_008352723.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X2 [Malus domestica]
Length=448

 Score =   438 bits (1126),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 201/261 (77%), Positives = 234/261 (90%), Gaps = 2/261 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVL+AGYLPFDE+DLTTLY KIE+A+F+CPSWFPVGAKSLIH+IL+ NP
Sbjct  188  VADVWSCGVILYVLLAGYLPFDELDLTTLYSKIEKADFTCPSWFPVGAKSLIHRILETNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFD--DTEEEVPNEQCNNEDFGP  434
            E RI IE+IRNDEWF+K YIP +++EYEDVNLDD+NA FD  D+EE+   E   NED GP
Sbjct  248  EKRIAIEQIRNDEWFQKNYIPARLLEYEDVNLDDVNAVFDEADSEEQRVIEHHGNEDMGP  307

Query  433  LALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHI  254
            L LNAFDLIILS+GLNL+ +FDRG+DS  +QTRF++QKPAKV LS+MEVVAQSMGFKTHI
Sbjct  308  LVLNAFDLIILSQGLNLATMFDRGKDSMKYQTRFVSQKPAKVVLSSMEVVAQSMGFKTHI  367

Query  253  RNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDL  74
            RNYKMRVEGLSA+K SHFS+ILEIF+VAPT++MVDIQKAAGD++EFLKFYKNFC NLED+
Sbjct  368  RNYKMRVEGLSANKTSHFSIILEIFEVAPTYYMVDIQKAAGDASEFLKFYKNFCSNLEDI  427

Query  73   IWKPPDELCKSRITKAKSKKR  11
            IWKPP E  KSRI K+KSKKR
Sbjct  428  IWKPPTETSKSRIGKSKSKKR  448



>gb|KJB58803.1| hypothetical protein B456_009G226900 [Gossypium raimondii]
Length=449

 Score =   437 bits (1124),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 199/262 (76%), Positives = 235/262 (90%), Gaps = 3/262 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KIERAEFSCPSWFP+GAKSLIH+ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDELDLTTLYSKIERAEFSCPSWFPMGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTE---EEVPNEQCNNEDFG  437
            +TRI IE+IR+DEWFKK Y+P +++EYED+NLDD+NA FDD E   EE  +E   NE+ G
Sbjct  248  QTRITIEQIRSDEWFKKSYVPARLLEYEDINLDDVNAVFDDPEIDKEERGDEPSRNENMG  307

Query  436  PLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTH  257
            PL LNAFDLIILS+GLNL+ LFDRG+D+  HQTRF+++KPA+V LS+MEVVAQSMG+KTH
Sbjct  308  PLNLNAFDLIILSQGLNLATLFDRGKDTMKHQTRFVSRKPARVVLSSMEVVAQSMGYKTH  367

Query  256  IRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLED  77
            IRNYKMRVEGLSA+K SHFSVILE+F+VAPTF MVDIQKAAGD+ ++LKFYK FC NL+D
Sbjct  368  IRNYKMRVEGLSANKTSHFSVILEVFEVAPTFLMVDIQKAAGDAGDYLKFYKTFCSNLDD  427

Query  76   LIWKPPDELCKSRITKAKSKKR  11
            +IWKPP+E  KSRITK+KSK+R
Sbjct  428  IIWKPPNESSKSRITKSKSKRR  449



>gb|KCW66679.1| hypothetical protein EUGRSUZ_F00453 [Eucalyptus grandis]
Length=452

 Score =   437 bits (1123),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 210/267 (79%), Positives = 233/267 (87%), Gaps = 12/267 (4%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVL+AGYLPFDE+DLTTLY KI+ A+FSCPSWFPVGAKSLI +ILDPNPE
Sbjct  189  ADVWSCGVILYVLIAGYLPFDELDLTTLYSKIDNADFSCPSWFPVGAKSLIKRILDPNPE  248

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE+IR+DEWFKKGY PVK+IE EDVNL+DINAAFDD E   PNE+  NED  PL L
Sbjct  249  TRITIEQIRDDEWFKKGYNPVKVIESEDVNLEDINAAFDDDE---PNEEGGNEDMRPLIL  305

Query  424  NAFDLIILSEGLNLSVLFDRGQ---------DSATHQTRFLTQKPAKVALSTMEVVAQSM  272
            NAFDLIILS+GLNLS LFDRGQ         DS  HQTRF++QKPAKV LS+MEVVAQSM
Sbjct  306  NAFDLIILSQGLNLSALFDRGQNFDSSHLRQDSVKHQTRFVSQKPAKVVLSSMEVVAQSM  365

Query  271  GFKTHIRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFC  92
            GFKTHIRNYKMRVEGLSA K SHFSVILEIF+VAPTFFMVDIQ+AAGD+ E+LKFY++FC
Sbjct  366  GFKTHIRNYKMRVEGLSASKTSHFSVILEIFEVAPTFFMVDIQRAAGDANEYLKFYQSFC  425

Query  91   GNLEDLIWKPPDELCKSRITKAKSKKR  11
            GNL+D+IWKPP E  KSRITK+KSKKR
Sbjct  426  GNLDDIIWKPPGESTKSRITKSKSKKR  452



>ref|XP_010254634.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Nelumbo nucifera]
 ref|XP_010254635.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Nelumbo nucifera]
 ref|XP_010254636.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Nelumbo nucifera]
Length=444

 Score =   436 bits (1120),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 201/257 (78%), Positives = 227/257 (88%), Gaps = 0/257 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVL+AGYLPFDEVDLTTLY KIE+AEFSCPSWFPVGAKSLIH+ILDPNP
Sbjct  188  VADVWSCGVILYVLLAGYLPFDEVDLTTLYSKIEKAEFSCPSWFPVGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI IEEIR DEWF+KGY+PV+++EYEDVNLDD+ A FDD EE   NEQ  N+D GPL 
Sbjct  248  ETRICIEEIRRDEWFRKGYVPVRLVEYEDVNLDDVYAVFDDPEEHRVNEQPGNDDIGPLI  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNLS LF+RGQDSA HQTRF+++KPAKV LS+MEVVAQSMGFKTHIRN
Sbjct  308  LNAFDLIILSQGLNLSALFNRGQDSAKHQTRFISKKPAKVVLSSMEVVAQSMGFKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA+K +H SVILE+F +AP+FFMVDIQK AGD+ EFLKFY NFC  LED+IW
Sbjct  368  YKMRVEGLSANKTTHISVILEVFGIAPSFFMVDIQKVAGDAVEFLKFYNNFCSKLEDIIW  427

Query  67   KPPDELCKSRITKAKSK  17
            KPP+E  KS ITK   +
Sbjct  428  KPPNETSKSWITKMTKR  444



>ref|NP_001268130.1| CBL-interacting serine/threonine-protein kinase 8-like [Vitis 
vinifera]
 gb|ACQ83533.1| CBL-interacting protein kinase 17 [Vitis vinifera]
Length=439

 Score =   435 bits (1119),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 201/258 (78%), Positives = 231/258 (90%), Gaps = 3/258 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTL+   ERAEFSCPSWFPVGAKSLIH+ILDPNP
Sbjct  184  VADVWSCGVILYVLMAGYLPFDELDLTTLH---ERAEFSCPSWFPVGAKSLIHRILDPNP  240

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRIRIE+IR+DEWF+KGY+PV+++EYEDVNLDD+NA FDD EE+  N+Q  NED GPL 
Sbjct  241  ETRIRIEQIRSDEWFRKGYVPVRLLEYEDVNLDDVNAVFDDPEEQHANDQHGNEDMGPLI  300

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNLS LF+RG+    HQTRF++QKP +V LS+MEVVAQSMGFKTHIRN
Sbjct  301  LNAFDLIILSQGLNLSALFERGEGPVKHQTRFVSQKPPRVVLSSMEVVAQSMGFKTHIRN  360

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEG+SA+K+ HFSV+LEIF+VAPTF MVDIQKAAGD+ E+ KFYKNFC NLED+IW
Sbjct  361  YKMRVEGISANKMEHFSVMLEIFEVAPTFIMVDIQKAAGDAGEYQKFYKNFCSNLEDIIW  420

Query  67   KPPDELCKSRITKAKSKK  14
            KP +E  KSRITK KSKK
Sbjct  421  KPLNESSKSRITKTKSKK  438



>ref|XP_009366378.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X2 [Pyrus x bretschneideri]
Length=448

 Score =   435 bits (1119),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 200/261 (77%), Positives = 233/261 (89%), Gaps = 2/261 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVL+AGYLPFDE+DLTTLY KIE+A+F+CPSWFPVGAKSLIH+IL+ NP
Sbjct  188  VADVWSCGVILYVLLAGYLPFDELDLTTLYSKIEKADFTCPSWFPVGAKSLIHRILETNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFD--DTEEEVPNEQCNNEDFGP  434
            E RI IE+IRNDEWF+K YIP +++EYEDVNLDD+NA FD  D+EE+   E   NED GP
Sbjct  248  EKRITIEQIRNDEWFQKNYIPARLLEYEDVNLDDVNAVFDEADSEEQRVIEHHGNEDMGP  307

Query  433  LALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHI  254
            L LNAFDLIILS+GLNL+ +FDRG+DS  +QTRF++QKPAKV LS+MEVVAQSMGFKTHI
Sbjct  308  LVLNAFDLIILSQGLNLATMFDRGKDSMKYQTRFVSQKPAKVVLSSMEVVAQSMGFKTHI  367

Query  253  RNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDL  74
            RNYKMRVEGLSA+K SHFS+ILEIF+VAPT++MVDIQKAAGD++EFLKFYKNFC NLED+
Sbjct  368  RNYKMRVEGLSANKTSHFSIILEIFEVAPTYYMVDIQKAAGDASEFLKFYKNFCSNLEDI  427

Query  73   IWKPPDELCKSRITKAKSKKR  11
            IWKP  E  KSRI K+KSKKR
Sbjct  428  IWKPSTETSKSRIGKSKSKKR  448



>ref|XP_008352722.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X1 [Malus domestica]
Length=449

 Score =   434 bits (1117),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 199/262 (76%), Positives = 232/262 (89%), Gaps = 3/262 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVL+AGYLPFDE+DLTTLY KIE+A+F+CPSWFPVGAKSLIH+IL+ NP
Sbjct  188  VADVWSCGVILYVLLAGYLPFDELDLTTLYSKIEKADFTCPSWFPVGAKSLIHRILETNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPN---EQCNNEDFG  437
            E RI IE+IRNDEWF+K YIP +++EYEDVNLDD+NA FD+ + E      E   NED G
Sbjct  248  EKRIAIEQIRNDEWFQKNYIPARLLEYEDVNLDDVNAVFDEADSEQEQRVIEHHGNEDMG  307

Query  436  PLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTH  257
            PL LNAFDLIILS+GLNL+ +FDRG+DS  +QTRF++QKPAKV LS+MEVVAQSMGFKTH
Sbjct  308  PLVLNAFDLIILSQGLNLATMFDRGKDSMKYQTRFVSQKPAKVVLSSMEVVAQSMGFKTH  367

Query  256  IRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLED  77
            IRNYKMRVEGLSA+K SHFS+ILEIF+VAPT++MVDIQKAAGD++EFLKFYKNFC NLED
Sbjct  368  IRNYKMRVEGLSANKTSHFSIILEIFEVAPTYYMVDIQKAAGDASEFLKFYKNFCSNLED  427

Query  76   LIWKPPDELCKSRITKAKSKKR  11
            +IWKPP E  KSRI K+KSKKR
Sbjct  428  IIWKPPTETSKSRIGKSKSKKR  449



>gb|KHN09031.1| CBL-interacting serine/threonine-protein kinase 8 [Glycine soja]
Length=490

 Score =   436 bits (1121),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 203/277 (73%), Positives = 235/277 (85%), Gaps = 18/277 (6%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGK------------------IERAEFSCPS  662
            +ADVWSCGVIL+VL+AGYLPFDE+DLTTLY                    IERAEFSCPS
Sbjct  214  VADVWSCGVILFVLLAGYLPFDELDLTTLYSAGCDSDKLRVLLINTLQFCIERAEFSCPS  273

Query  661  WFPVGAKSLIHKILDPNPETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDT  482
            WFPVGAK LIH+ILDPNPETRI IE+IRNDEWF++ Y+PV ++EYEDVNLDD+NAAFDD 
Sbjct  274  WFPVGAKMLIHRILDPNPETRITIEQIRNDEWFQRSYVPVSLLEYEDVNLDDVNAAFDDA  333

Query  481  EEEVPNEQCNNEDFGPLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVAL  302
            EE   ++QC+ ED GPL LNAFDLIILS+GLNL+ +FDRGQDS  +QTRF++QKPAKV L
Sbjct  334  EEPRADQQCDKEDMGPLMLNAFDLIILSQGLNLATIFDRGQDSVKYQTRFISQKPAKVVL  393

Query  301  STMEVVAQSMGFKTHIRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDST  122
            S+MEVVAQSMGFKTHIRNYKMRVEG+SA+K S+FSVILEIF+VAPTF+MVDIQKAAGD+ 
Sbjct  394  SSMEVVAQSMGFKTHIRNYKMRVEGISANKTSYFSVILEIFEVAPTFYMVDIQKAAGDTG  453

Query  121  EFLKFYKNFCGNLEDLIWKPPDELCKSRITKAKSKKR  11
            E+LKFYKNFC NLED+IWKPP E  KSRI+K KSK+R
Sbjct  454  EYLKFYKNFCSNLEDIIWKPPHEASKSRISKTKSKRR  490



>ref|XP_010104570.1| CBL-interacting serine/threonine-protein kinase 8 [Morus notabilis]
 gb|EXC01171.1| CBL-interacting serine/threonine-protein kinase 8 [Morus notabilis]
Length=420

 Score =   433 bits (1113),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 200/259 (77%), Positives = 231/259 (89%), Gaps = 6/259 (2%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFD++DLTTLY       FSCPSWFPVGAKSLIH+ILDPNP
Sbjct  168  VADVWSCGVILYVLMAGYLPFDDLDLTTLY------NFSCPSWFPVGAKSLIHRILDPNP  221

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI I++IR+D+WFKK Y+PVK+ +YEDVNLDD+NA FDD EE+  NE C NED GPL 
Sbjct  222  ETRITIQQIRDDDWFKKDYVPVKLFQYEDVNLDDVNAVFDDPEEQRANEPCGNEDTGPLI  281

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDRGQDS  +QTRF+++KPAKV LS+MEVVAQSMGFKTHIRN
Sbjct  282  LNAFDLIILSQGLNLATLFDRGQDSIKYQTRFVSRKPAKVVLSSMEVVAQSMGFKTHIRN  341

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLS DK SHFSV+LEIF+VAPTFFMVDIQKAAGD++E+LKFYK+FC NL+D+IW
Sbjct  342  YKMRVEGLSTDKSSHFSVMLEIFEVAPTFFMVDIQKAAGDASEYLKFYKSFCSNLDDIIW  401

Query  67   KPPDELCKSRITKAKSKKR  11
            KPP+E  KSRITK +SK+R
Sbjct  402  KPPNESSKSRITKTRSKRR  420



>ref|XP_007137665.1| hypothetical protein PHAVU_009G145400g [Phaseolus vulgaris]
 gb|ESW09659.1| hypothetical protein PHAVU_009G145400g [Phaseolus vulgaris]
Length=444

 Score =   434 bits (1115),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 200/259 (77%), Positives = 232/259 (90%), Gaps = 2/259 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVL+AGYLPFDE+DLTTLY KIERAEFS P WFPVGAK LI +ILDPNP
Sbjct  188  VADVWSCGVILYVLLAGYLPFDELDLTTLYSKIERAEFSSPPWFPVGAKILIKRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETR+ IE+IRNDEWF++ Y+PV ++EYEDVNLDD+NAAFD  E E  ++QC+NED GPL 
Sbjct  248  ETRMTIEQIRNDEWFQRSYVPVSLLEYEDVNLDDVNAAFD--EAERADQQCDNEDMGPLM  305

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ +FDRGQDS  +QTRF+TQKPAKV LS+MEVVAQSMG+KTHIRN
Sbjct  306  LNAFDLIILSQGLNLATIFDRGQDSVKYQTRFITQKPAKVVLSSMEVVAQSMGYKTHIRN  365

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEG+SA+K S+FSVILEIF+VAPTF+MVDIQKAAGD+ E+LKFYKNF  NLED+IW
Sbjct  366  YKMRVEGVSANKTSYFSVILEIFEVAPTFYMVDIQKAAGDTGEYLKFYKNFHSNLEDIIW  425

Query  67   KPPDELCKSRITKAKSKKR  11
            KPP E  KSRI+K KSK+R
Sbjct  426  KPPHEASKSRISKTKSKRR  444



>ref|XP_009366377.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Pyrus x bretschneideri]
Length=449

 Score =   432 bits (1110),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 198/262 (76%), Positives = 231/262 (88%), Gaps = 3/262 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVL+AGYLPFDE+DLTTLY KIE+A+F+CPSWFPVGAKSLIH+IL+ NP
Sbjct  188  VADVWSCGVILYVLLAGYLPFDELDLTTLYSKIEKADFTCPSWFPVGAKSLIHRILETNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPN---EQCNNEDFG  437
            E RI IE+IRNDEWF+K YIP +++EYEDVNLDD+NA FD+ + E      E   NED G
Sbjct  248  EKRITIEQIRNDEWFQKNYIPARLLEYEDVNLDDVNAVFDEADSEQEQRVIEHHGNEDMG  307

Query  436  PLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTH  257
            PL LNAFDLIILS+GLNL+ +FDRG+DS  +QTRF++QKPAKV LS+MEVVAQSMGFKTH
Sbjct  308  PLVLNAFDLIILSQGLNLATMFDRGKDSMKYQTRFVSQKPAKVVLSSMEVVAQSMGFKTH  367

Query  256  IRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLED  77
            IRNYKMRVEGLSA+K SHFS+ILEIF+VAPT++MVDIQKAAGD++EFLKFYKNFC NLED
Sbjct  368  IRNYKMRVEGLSANKTSHFSIILEIFEVAPTYYMVDIQKAAGDASEFLKFYKNFCSNLED  427

Query  76   LIWKPPDELCKSRITKAKSKKR  11
            +IWKP  E  KSRI K+KSKKR
Sbjct  428  IIWKPSTETSKSRIGKSKSKKR  449



>gb|KHG19822.1| CBL-interacting serine/threonine-protein kinase 8 [Gossypium 
arboreum]
Length=449

 Score =   430 bits (1105),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 196/262 (75%), Positives = 232/262 (89%), Gaps = 3/262 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KIERAEFSCPSWFP+GAKSLI +ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDELDLTTLYSKIERAEFSCPSWFPMGAKSLIRRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTE---EEVPNEQCNNEDFG  437
            +TRI IE+IR+DEWFKK Y+P +++EYED+NLDD+NA FDD E   EE  +E   NED G
Sbjct  248  QTRITIEQIRSDEWFKKSYVPARLLEYEDINLDDVNAVFDDPEIDKEERGDEPSRNEDMG  307

Query  436  PLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTH  257
            PL LNAFDLIILS+GLNL+ LFDRG+D+  HQTRF+++KPA+V LS+MEVVAQSMG+KTH
Sbjct  308  PLNLNAFDLIILSQGLNLATLFDRGKDTMKHQTRFVSRKPARVVLSSMEVVAQSMGYKTH  367

Query  256  IRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLED  77
            IRNYKMRVEGLSA+K  HFSVILE+F++APTF MVDIQKAAGD+ ++LKFYK FC NL+D
Sbjct  368  IRNYKMRVEGLSANKTPHFSVILEVFELAPTFLMVDIQKAAGDAGDYLKFYKTFCSNLDD  427

Query  76   LIWKPPDELCKSRITKAKSKKR  11
            +IWKPP+E  KSRI K+KSK+R
Sbjct  428  IIWKPPNESSKSRIRKSKSKRR  449



>ref|XP_004490473.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X2 [Cicer arietinum]
Length=395

 Score =   426 bits (1094),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 196/257 (76%), Positives = 227/257 (88%), Gaps = 0/257 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPFDE+DLTTLY KI++AEFSCP+WFPVGAKSLI +ILDPNPE
Sbjct  138  ADVWSCGVILYVLMAGYLPFDELDLTTLYSKIDKAEFSCPAWFPVGAKSLIQRILDPNPE  197

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RI IE+IRNDEWFKK Y+P  ++EYEDVNLDDINAAFD  E++  N Q   ED GPL L
Sbjct  198  NRITIEQIRNDEWFKKSYVPAHLLEYEDVNLDDINAAFDSAEDQSDNPQSEIEDTGPLIL  257

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAFD+I+LS+GLNL+ +FDRGQDS  +QTRF+TQKPAKV LS+MEVVAQSMGFKTHIRNY
Sbjct  258  NAFDMIMLSQGLNLASIFDRGQDSMKYQTRFVTQKPAKVVLSSMEVVAQSMGFKTHIRNY  317

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMR+EG+SA+K SHFSVILE+F+VAPTFFMVDIQKAAGD++E+LKFYKNF  NLED+IWK
Sbjct  318  KMRIEGISANKKSHFSVILEVFEVAPTFFMVDIQKAAGDASEYLKFYKNFSSNLEDIIWK  377

Query  64   PPDELCKSRITKAKSKK  14
             P E  K + +KA+SKK
Sbjct  378  SPYETSKLKTSKARSKK  394



>ref|XP_004490472.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X1 [Cicer arietinum]
Length=446

 Score =   427 bits (1098),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 196/257 (76%), Positives = 227/257 (88%), Gaps = 0/257 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPFDE+DLTTLY KI++AEFSCP+WFPVGAKSLI +ILDPNPE
Sbjct  189  ADVWSCGVILYVLMAGYLPFDELDLTTLYSKIDKAEFSCPAWFPVGAKSLIQRILDPNPE  248

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RI IE+IRNDEWFKK Y+P  ++EYEDVNLDDINAAFD  E++  N Q   ED GPL L
Sbjct  249  NRITIEQIRNDEWFKKSYVPAHLLEYEDVNLDDINAAFDSAEDQSDNPQSEIEDTGPLIL  308

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAFD+I+LS+GLNL+ +FDRGQDS  +QTRF+TQKPAKV LS+MEVVAQSMGFKTHIRNY
Sbjct  309  NAFDMIMLSQGLNLASIFDRGQDSMKYQTRFVTQKPAKVVLSSMEVVAQSMGFKTHIRNY  368

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMR+EG+SA+K SHFSVILE+F+VAPTFFMVDIQKAAGD++E+LKFYKNF  NLED+IWK
Sbjct  369  KMRIEGISANKKSHFSVILEVFEVAPTFFMVDIQKAAGDASEYLKFYKNFSSNLEDIIWK  428

Query  64   PPDELCKSRITKAKSKK  14
             P E  K + +KA+SKK
Sbjct  429  SPYETSKLKTSKARSKK  445



>gb|KJB64072.1| hypothetical protein B456_010G032200 [Gossypium raimondii]
Length=449

 Score =   426 bits (1096),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 194/262 (74%), Positives = 234/262 (89%), Gaps = 3/262 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KIERA+FSCPSWFPVGAKSLIH+ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDELDLTTLYSKIERADFSCPSWFPVGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTE---EEVPNEQCNNEDFG  437
            +TRI IE+IR+DEWF KGY+PV+++EYED+NLD++NA FDD E   EE  NE   NED G
Sbjct  248  QTRITIEQIRSDEWFNKGYVPVRLLEYEDINLDEVNAVFDDPEVDTEERGNEPSGNEDMG  307

Query  436  PLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTH  257
            PL+LNAFDLIILS+GLNL+ LFDRG+D+  +QTRF++QKPA+V LS+MEVVAQSMG+KTH
Sbjct  308  PLSLNAFDLIILSQGLNLATLFDRGKDNMKYQTRFVSQKPARVVLSSMEVVAQSMGYKTH  367

Query  256  IRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLED  77
            IRNYKMRVEG SA+K SH SVILE+F+VAPTF MVD++KAAGD+ E+LKFY+ F  NLE+
Sbjct  368  IRNYKMRVEGPSANKNSHLSVILEVFEVAPTFLMVDMEKAAGDAGEYLKFYQAFYSNLEE  427

Query  76   LIWKPPDELCKSRITKAKSKKR  11
            +IWKPP+E  K+RITK++SK+R
Sbjct  428  IIWKPPNESSKTRITKSRSKRR  449



>ref|XP_010520822.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010520823.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Tarenaya hassleriana]
Length=446

 Score =   426 bits (1094),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 195/259 (75%), Positives = 231/259 (89%), Gaps = 0/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAG+LPFDE+DLTTLY KI+RAEFSCP+WFP+GAKSLIH+ILDPNP
Sbjct  188  IADVWSCGVILYVLMAGFLPFDELDLTTLYSKIDRAEFSCPTWFPLGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI I EIR D+WF+K Y PV++++YE V+LDD+ AAF D EE+  +E   NED GPL 
Sbjct  248  ETRITIAEIRKDDWFQKDYTPVQLLDYEHVDLDDVYAAFGDPEEQRTDELNGNEDTGPLF  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFD+IILS+GLNL+ LFDRG+DS  +QTRF++ KPAKVALS+MEVVAQSMGFKTHIRN
Sbjct  308  LNAFDMIILSQGLNLATLFDRGKDSMKYQTRFISHKPAKVALSSMEVVAQSMGFKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSADK+SHFSVILE+F+VAP+FFMVDIQKAAGD+ E+LKFYK FC NLED+IW
Sbjct  368  YKMRVEGLSADKMSHFSVILEVFKVAPSFFMVDIQKAAGDTDEYLKFYKTFCSNLEDIIW  427

Query  67   KPPDELCKSRITKAKSKKR  11
            KP DE  K+R+ K+KSK+R
Sbjct  428  KPSDESGKTRVPKSKSKRR  446



>ref|XP_008219189.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X2 [Prunus mume]
Length=448

 Score =   426 bits (1094),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 195/247 (79%), Positives = 224/247 (91%), Gaps = 2/247 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KIE+AEFSCPSWFPVGAKSLIH+ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDELDLTTLYSKIEKAEFSCPSWFPVGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDD--TEEEVPNEQCNNEDFGP  434
            ETRI IE+IR+ EWF+K Y+PV+  EYEDVNLDD+NA FDD  +EE+  +E   NED GP
Sbjct  248  ETRITIEQIRDHEWFQKNYVPVRSFEYEDVNLDDVNAVFDDADSEEQRVSEHRGNEDMGP  307

Query  433  LALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHI  254
            L LNAFDLIILS+GLNL+ +FDRG+DS  +QTRF++QKPAKV LS+MEVVAQSMGFKTHI
Sbjct  308  LVLNAFDLIILSQGLNLATMFDRGKDSMKYQTRFVSQKPAKVVLSSMEVVAQSMGFKTHI  367

Query  253  RNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDL  74
            RNYKMRVEGLSA+K SHFS+ILEIF+VAPT++MVDIQKAAGD++EFLKFYKNFC NLED+
Sbjct  368  RNYKMRVEGLSANKTSHFSIILEIFEVAPTYYMVDIQKAAGDASEFLKFYKNFCSNLEDI  427

Query  73   IWKPPDE  53
            IWKPP E
Sbjct  428  IWKPPTE  434



>ref|XP_004287407.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Fragaria vesca subsp. vesca]
Length=446

 Score =   424 bits (1091),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 193/245 (79%), Positives = 223/245 (91%), Gaps = 0/245 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KIE+A+FSCPSWFP+GAKSLIH ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDELDLTTLYSKIEKAQFSCPSWFPMGAKSLIHSILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
             TRI I++IRNDEWF+K Y+P KI+EYEDVNLDD+NA FD+TEEE  +E   +ED GPL 
Sbjct  248  ATRITIQQIRNDEWFQKNYVPPKILEYEDVNLDDVNAVFDETEEERDSEHQGSEDMGPLV  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ +FDRG+D   +QTRF++QKPAKV LS+MEVVAQSMGFKTHIRN
Sbjct  308  LNAFDLIILSQGLNLASMFDRGKDCMKYQTRFVSQKPAKVVLSSMEVVAQSMGFKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA+K SHFS+ILEIF+VAPT++MVDIQKAAGD++EFLKFYKNFC NLED+IW
Sbjct  368  YKMRVEGLSANKTSHFSIILEIFEVAPTYYMVDIQKAAGDASEFLKFYKNFCSNLEDIIW  427

Query  67   KPPDE  53
            KPP E
Sbjct  428  KPPTE  432



>ref|XP_008219188.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Prunus mume]
Length=449

 Score =   423 bits (1088),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 194/248 (78%), Positives = 223/248 (90%), Gaps = 3/248 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KIE+AEFSCPSWFPVGAKSLIH+ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDELDLTTLYSKIEKAEFSCPSWFPVGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDT---EEEVPNEQCNNEDFG  437
            ETRI IE+IR+ EWF+K Y+PV+  EYEDVNLDD+NA FDD    +E+  +E   NED G
Sbjct  248  ETRITIEQIRDHEWFQKNYVPVRSFEYEDVNLDDVNAVFDDADSEQEQRVSEHRGNEDMG  307

Query  436  PLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTH  257
            PL LNAFDLIILS+GLNL+ +FDRG+DS  +QTRF++QKPAKV LS+MEVVAQSMGFKTH
Sbjct  308  PLVLNAFDLIILSQGLNLATMFDRGKDSMKYQTRFVSQKPAKVVLSSMEVVAQSMGFKTH  367

Query  256  IRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLED  77
            IRNYKMRVEGLSA+K SHFS+ILEIF+VAPT++MVDIQKAAGD++EFLKFYKNFC NLED
Sbjct  368  IRNYKMRVEGLSANKTSHFSIILEIFEVAPTYYMVDIQKAAGDASEFLKFYKNFCSNLED  427

Query  76   LIWKPPDE  53
            +IWKPP E
Sbjct  428  IIWKPPTE  435



>gb|AFO10125.1| CIPK [Gossypium aridum]
Length=449

 Score =   423 bits (1088),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 193/262 (74%), Positives = 232/262 (89%), Gaps = 3/262 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KIERA+FSCPSWFPVGAKSLIH+ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDELDLTTLYSKIERADFSCPSWFPVGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTE---EEVPNEQCNNEDFG  437
            +TRI IE+IR+DEWFKK Y+P ++IEYED+NLDD+NA FDD E   EE  +E   NE+ G
Sbjct  248  QTRITIEQIRSDEWFKKSYVPARLIEYEDINLDDVNAVFDDPEIDKEERGDEPSRNENMG  307

Query  436  PLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTH  257
            PL LNAFDLIILS+GLNL+ LFDRG+D+  HQTRF+++KPA+V LS+MEVVAQSMG+KTH
Sbjct  308  PLNLNAFDLIILSQGLNLATLFDRGKDTMKHQTRFVSRKPARVVLSSMEVVAQSMGYKTH  367

Query  256  IRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLED  77
            IRNYKMRVEG SA+K SH SVILE+F+VAPTF MVD++KAAGD+ E+LKFY+ F  NLE+
Sbjct  368  IRNYKMRVEGPSANKNSHLSVILEVFEVAPTFLMVDMEKAAGDAGEYLKFYQAFYSNLEE  427

Query  76   LIWKPPDELCKSRITKAKSKKR  11
            +IWKPP+E  K+RITK++SK+R
Sbjct  428  IIWKPPNESSKTRITKSRSKRR  449



>gb|AES98330.2| CBL-interacting kinase [Medicago truncatula]
Length=446

 Score =   422 bits (1086),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 191/258 (74%), Positives = 226/258 (88%), Gaps = 0/258 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPFDE+DLTTLY KI++A+FSCP+WFPVGAKSLI +ILDPNPE
Sbjct  189  ADVWSCGVILYVLMAGYLPFDELDLTTLYSKIDKADFSCPAWFPVGAKSLIQRILDPNPE  248

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RI IE+IRNDEWF+K Y+PV ++EYEDVNLD+INAAFD  E+E  N QC   D GPL L
Sbjct  249  HRITIEQIRNDEWFQKSYVPVHLLEYEDVNLDEINAAFDSAEDEGDNPQCEIADTGPLIL  308

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAFD+I+LS+GLNL+ +FDRGQD+  +QTRF+TQKPAKV LS+MEVVAQSMGFKTHIRNY
Sbjct  309  NAFDMIMLSQGLNLATIFDRGQDTMKYQTRFITQKPAKVVLSSMEVVAQSMGFKTHIRNY  368

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMR+EG+SA K +HFSVILE+F+VAPTFFMVDIQKAAGD++E+LKFYKNF  NLED+IWK
Sbjct  369  KMRIEGISAKKTTHFSVILEVFEVAPTFFMVDIQKAAGDASEYLKFYKNFSSNLEDIIWK  428

Query  64   PPDELCKSRITKAKSKKR  11
             P E  K + +K +SK+ 
Sbjct  429  SPHETSKLKTSKTRSKRH  446



>ref|XP_007141302.1| hypothetical protein PHAVU_008G184400g [Phaseolus vulgaris]
 gb|ESW13296.1| hypothetical protein PHAVU_008G184400g [Phaseolus vulgaris]
Length=446

 Score =   419 bits (1077),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 186/258 (72%), Positives = 230/258 (89%), Gaps = 0/258 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVL+AGYLPFDE+DLTTLY KIE+A+FSCP+WFPVGAKSL+H+ILDPNPE
Sbjct  189  ADVWSCGVILYVLLAGYLPFDELDLTTLYSKIEKAQFSCPTWFPVGAKSLMHRILDPNPE  248

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RI I++IRNDEWF+KGY+PV ++EYEDVNLDD+NAAFD+ E++  N+Q  N+D GPL L
Sbjct  249  HRITIQQIRNDEWFQKGYVPVSLLEYEDVNLDDVNAAFDNVEDQSTNQQFENDDMGPLTL  308

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAFD+I+LS+GLNL+ LFDRG+DS  ++TRF++QKP KV LS+MEVVAQSMGFKTHIRNY
Sbjct  309  NAFDMIMLSQGLNLATLFDRGEDSFKYETRFISQKPPKVVLSSMEVVAQSMGFKTHIRNY  368

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMR+EG+SA+K S+FSVILE+F++APTFFMV+IQKAAGD+ E+LKFYKNF  NLED++WK
Sbjct  369  KMRIEGISANKASYFSVILEVFEIAPTFFMVNIQKAAGDAREYLKFYKNFSSNLEDIMWK  428

Query  64   PPDELCKSRITKAKSKKR  11
            PP E  K R +K   K++
Sbjct  429  PPHEKSKLRNSKTNCKEQ  446



>ref|XP_006575369.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X3 [Glycine max]
Length=370

 Score =   414 bits (1065),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 188/256 (73%), Positives = 224/256 (88%), Gaps = 0/256 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVL+AGYLPFDE+DLTTLY KIE+A+FSCP  FPVGAKSLIH +LDPNPE
Sbjct  115  ADVWSCGVILYVLLAGYLPFDELDLTTLYSKIEKAQFSCPPSFPVGAKSLIHTMLDPNPE  174

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RI IE+IRNDEWF+K Y+PV +IEYEDVNLDD+NAAFD+ E++  N+QC N+D GPL L
Sbjct  175  RRITIEQIRNDEWFQKEYVPVSLIEYEDVNLDDVNAAFDNDEDQRTNQQCENDDMGPLTL  234

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAFD+IILS+GLNL+ LFDRGQDS  ++TRF++QKP KV LS+MEVVAQSMGFKTHIRNY
Sbjct  235  NAFDMIILSQGLNLATLFDRGQDSMKYETRFISQKPPKVILSSMEVVAQSMGFKTHIRNY  294

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMR+E +S +K S+FSVILE+F++APTFFMVDIQKAAGD+ E+LKFYKNF  NLED++WK
Sbjct  295  KMRIESISTNKASYFSVILEVFEIAPTFFMVDIQKAAGDAGEYLKFYKNFSSNLEDIMWK  354

Query  64   PPDELCKSRITKAKSK  17
            PP E  K R +K K +
Sbjct  355  PPHETSKLRNSKTKGQ  370



>ref|XP_008378623.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X2 [Malus domestica]
Length=448

 Score =   416 bits (1070),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 188/247 (76%), Positives = 223/247 (90%), Gaps = 2/247 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVL+AGYLPFDE+DLTTLY KIE+A+F+CP WFPVGAKSLIH+IL+ NP
Sbjct  188  VADVWSCGVILYVLLAGYLPFDELDLTTLYSKIEKADFTCPFWFPVGAKSLIHRILETNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDD--TEEEVPNEQCNNEDFGP  434
            E RI+IE+IRNDEWF+K Y+P +++EYEDVNLDD+NA FDD  +EE+   E   NED GP
Sbjct  248  ENRIKIEQIRNDEWFQKNYVPARLLEYEDVNLDDVNAVFDDADSEEQRAIEHHGNEDMGP  307

Query  433  LALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHI  254
            L LNAFDLIILS+GLNL+ +FDRG+DS  +QTRF++QKPA+V LS+MEVVAQSMGFKTHI
Sbjct  308  LVLNAFDLIILSQGLNLATMFDRGKDSMKYQTRFVSQKPARVVLSSMEVVAQSMGFKTHI  367

Query  253  RNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDL  74
            RNYKMRVEGLSA+K SHFS+ILEIF+VAPT++MVDIQKAAGD++EFLKFYKNFC NLED+
Sbjct  368  RNYKMRVEGLSANKTSHFSIILEIFEVAPTYYMVDIQKAAGDASEFLKFYKNFCSNLEDI  427

Query  73   IWKPPDE  53
            IWKPP E
Sbjct  428  IWKPPTE  434



>ref|XP_006575368.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X2 [Glycine max]
Length=394

 Score =   414 bits (1065),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 188/256 (73%), Positives = 224/256 (88%), Gaps = 0/256 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVL+AGYLPFDE+DLTTLY KIE+A+FSCP  FPVGAKSLIH +LDPNPE
Sbjct  139  ADVWSCGVILYVLLAGYLPFDELDLTTLYSKIEKAQFSCPPSFPVGAKSLIHTMLDPNPE  198

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RI IE+IRNDEWF+K Y+PV +IEYEDVNLDD+NAAFD+ E++  N+QC N+D GPL L
Sbjct  199  RRITIEQIRNDEWFQKEYVPVSLIEYEDVNLDDVNAAFDNDEDQRTNQQCENDDMGPLTL  258

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAFD+IILS+GLNL+ LFDRGQDS  ++TRF++QKP KV LS+MEVVAQSMGFKTHIRNY
Sbjct  259  NAFDMIILSQGLNLATLFDRGQDSMKYETRFISQKPPKVILSSMEVVAQSMGFKTHIRNY  318

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMR+E +S +K S+FSVILE+F++APTFFMVDIQKAAGD+ E+LKFYKNF  NLED++WK
Sbjct  319  KMRIESISTNKASYFSVILEVFEIAPTFFMVDIQKAAGDAGEYLKFYKNFSSNLEDIMWK  378

Query  64   PPDELCKSRITKAKSK  17
            PP E  K R +K K +
Sbjct  379  PPHETSKLRNSKTKGQ  394



>ref|XP_003519209.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Glycine max]
Length=444

 Score =   416 bits (1069),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 188/256 (73%), Positives = 224/256 (88%), Gaps = 0/256 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVL+AGYLPFDE+DLTTLY KIE+A+FSCP  FPVGAKSLIH +LDPNPE
Sbjct  189  ADVWSCGVILYVLLAGYLPFDELDLTTLYSKIEKAQFSCPPSFPVGAKSLIHTMLDPNPE  248

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RI IE+IRNDEWF+K Y+PV +IEYEDVNLDD+NAAFD+ E++  N+QC N+D GPL L
Sbjct  249  RRITIEQIRNDEWFQKEYVPVSLIEYEDVNLDDVNAAFDNDEDQRTNQQCENDDMGPLTL  308

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAFD+IILS+GLNL+ LFDRGQDS  ++TRF++QKP KV LS+MEVVAQSMGFKTHIRNY
Sbjct  309  NAFDMIILSQGLNLATLFDRGQDSMKYETRFISQKPPKVILSSMEVVAQSMGFKTHIRNY  368

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMR+E +S +K S+FSVILE+F++APTFFMVDIQKAAGD+ E+LKFYKNF  NLED++WK
Sbjct  369  KMRIESISTNKASYFSVILEVFEIAPTFFMVDIQKAAGDAGEYLKFYKNFSSNLEDIMWK  428

Query  64   PPDELCKSRITKAKSK  17
            PP E  K R +K K +
Sbjct  429  PPHETSKLRNSKTKGQ  444



>ref|XP_004148410.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Cucumis sativus]
 gb|KGN62772.1| hypothetical protein Csa_2G372190 [Cucumis sativus]
Length=446

 Score =   416 bits (1068),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 197/259 (76%), Positives = 224/259 (86%), Gaps = 0/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KIERA+FSCPSWFPVGAK+LI +I DPNP
Sbjct  188  MADVWSCGVILYVLMAGYLPFDELDLTTLYSKIERADFSCPSWFPVGAKALICRIFDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
             TRI IE+IR DEWFKK Y+ VK++E EDVNLDD+NA FDD EE    EQ +NE+  PLA
Sbjct  248  STRITIEQIREDEWFKKNYVSVKLVEDEDVNLDDVNAVFDDPEEPRTEEQRSNENMCPLA  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL  +FDRGQDS  + TRF+ QKPAKV LSTMEVVAQSMGFKTHIRN
Sbjct  308  LNAFDLIILSQGLNLGTMFDRGQDSMKYPTRFVCQKPAKVLLSTMEVVAQSMGFKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEG SA K S+FSVI+EIF+VAPTFFMVDIQKAAG+++E+LKFYK+F GNLED++W
Sbjct  368  YKMRVEGPSASKTSYFSVIMEIFEVAPTFFMVDIQKAAGETSEYLKFYKSFYGNLEDIVW  427

Query  67   KPPDELCKSRITKAKSKKR  11
            KP  +  KSRI K KSKKR
Sbjct  428  KPSFDTSKSRIAKNKSKKR  446



>ref|XP_008378622.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Malus domestica]
Length=449

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 187/248 (75%), Positives = 222/248 (90%), Gaps = 3/248 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVL+AGYLPFDE+DLTTLY KIE+A+F+CP WFPVGAKSLIH+IL+ NP
Sbjct  188  VADVWSCGVILYVLLAGYLPFDELDLTTLYSKIEKADFTCPFWFPVGAKSLIHRILETNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDT---EEEVPNEQCNNEDFG  437
            E RI+IE+IRNDEWF+K Y+P +++EYEDVNLDD+NA FDD    +E+   E   NED G
Sbjct  248  ENRIKIEQIRNDEWFQKNYVPARLLEYEDVNLDDVNAVFDDADSEQEQRAIEHHGNEDMG  307

Query  436  PLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTH  257
            PL LNAFDLIILS+GLNL+ +FDRG+DS  +QTRF++QKPA+V LS+MEVVAQSMGFKTH
Sbjct  308  PLVLNAFDLIILSQGLNLATMFDRGKDSMKYQTRFVSQKPARVVLSSMEVVAQSMGFKTH  367

Query  256  IRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLED  77
            IRNYKMRVEGLSA+K SHFS+ILEIF+VAPT++MVDIQKAAGD++EFLKFYKNFC NLED
Sbjct  368  IRNYKMRVEGLSANKTSHFSIILEIFEVAPTYYMVDIQKAAGDASEFLKFYKNFCSNLED  427

Query  76   LIWKPPDE  53
            +IWKPP E
Sbjct  428  IIWKPPTE  435



>ref|XP_010519151.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Tarenaya hassleriana]
Length=446

 Score =   414 bits (1063),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 187/259 (72%), Positives = 224/259 (86%), Gaps = 0/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAG+LPFDE+DLTTLY KI+RAEFSCPSWFP+GAKSLIH+ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGFLPFDELDLTTLYSKIDRAEFSCPSWFPLGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            + RI I EIR DEWF+K Y PV++++YE V+LDD+ AAFDD EE+  +    NED GPL 
Sbjct  248  QMRITIAEIRKDEWFRKDYTPVQLLDYEHVDLDDVYAAFDDPEEQRTDGHSGNEDTGPLF  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLI+LS+GLNL+ LFDRG+DS  +QTRF++ KPA V LS+MEVVAQSMGFKTHIRN
Sbjct  308  LNAFDLIVLSQGLNLATLFDRGKDSMKYQTRFVSHKPANVVLSSMEVVAQSMGFKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLS  K SHFSVILE+F+VAP FFMVD+QKA+G+  E+LKFYK FC NL+D+IW
Sbjct  368  YKMRVEGLSMRKTSHFSVILEVFKVAPPFFMVDLQKASGNEDEYLKFYKTFCSNLDDIIW  427

Query  67   KPPDELCKSRITKAKSKKR  11
            KPPDE  ++R+ K+KSK+R
Sbjct  428  KPPDESGRTRVAKSKSKRR  446



>ref|XP_008357566.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X2 [Malus domestica]
Length=448

 Score =   414 bits (1063),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 187/247 (76%), Positives = 222/247 (90%), Gaps = 2/247 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVL+AGYLPFDE+DLTTLY KIE+A+ +CP WFPVGAKSLIH+IL+ NP
Sbjct  188  VADVWSCGVILYVLLAGYLPFDELDLTTLYSKIEKADXTCPFWFPVGAKSLIHRILETNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDD--TEEEVPNEQCNNEDFGP  434
            E RI+IE+IRNDEWF+K Y+P +++EYEDVNLDD+NA FDD  +EE+   E   NED GP
Sbjct  248  ENRIKIEQIRNDEWFQKNYVPARLLEYEDVNLDDVNAVFDDADSEEQRAIEHHGNEDMGP  307

Query  433  LALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHI  254
            L LNAFDLIILS+GLNL+ +FDRG+DS  +QTRF++QKPA+V LS+MEVVAQSMGFKTHI
Sbjct  308  LVLNAFDLIILSQGLNLATMFDRGKDSMKYQTRFVSQKPARVVLSSMEVVAQSMGFKTHI  367

Query  253  RNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDL  74
            RNYKMRVEGLSA+K SHFS+ILEIF+VAPT++MVDIQKAAGD++EFLKFYKNFC NLED+
Sbjct  368  RNYKMRVEGLSANKTSHFSIILEIFEVAPTYYMVDIQKAAGDASEFLKFYKNFCSNLEDI  427

Query  73   IWKPPDE  53
            IWKPP E
Sbjct  428  IWKPPTE  434



>ref|XP_008357565.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X1 [Malus domestica]
Length=449

 Score =   412 bits (1059),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 186/248 (75%), Positives = 221/248 (89%), Gaps = 3/248 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVL+AGYLPFDE+DLTTLY KIE+A+ +CP WFPVGAKSLIH+IL+ NP
Sbjct  188  VADVWSCGVILYVLLAGYLPFDELDLTTLYSKIEKADXTCPFWFPVGAKSLIHRILETNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDT---EEEVPNEQCNNEDFG  437
            E RI+IE+IRNDEWF+K Y+P +++EYEDVNLDD+NA FDD    +E+   E   NED G
Sbjct  248  ENRIKIEQIRNDEWFQKNYVPARLLEYEDVNLDDVNAVFDDADSEQEQRAIEHHGNEDMG  307

Query  436  PLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTH  257
            PL LNAFDLIILS+GLNL+ +FDRG+DS  +QTRF++QKPA+V LS+MEVVAQSMGFKTH
Sbjct  308  PLVLNAFDLIILSQGLNLATMFDRGKDSMKYQTRFVSQKPARVVLSSMEVVAQSMGFKTH  367

Query  256  IRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLED  77
            IRNYKMRVEGLSA+K SHFS+ILEIF+VAPT++MVDIQKAAGD++EFLKFYKNFC NLED
Sbjct  368  IRNYKMRVEGLSANKTSHFSIILEIFEVAPTYYMVDIQKAAGDASEFLKFYKNFCSNLED  427

Query  76   LIWKPPDE  53
            +IWKPP E
Sbjct  428  IIWKPPTE  435



>ref|XP_008444962.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Cucumis melo]
Length=446

 Score =   409 bits (1052),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 193/259 (75%), Positives = 221/259 (85%), Gaps = 0/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KIERA+FSCPSWFPVGAK+LI +I DPNP
Sbjct  188  MADVWSCGVILYVLMAGYLPFDELDLTTLYSKIERADFSCPSWFPVGAKALICRIFDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
             TRI IE+IR +EWFKK Y+ VK++E EDVNLDD+NA FDD EE    EQ  NE+  PLA
Sbjct  248  STRITIEQIRENEWFKKNYVSVKLVEDEDVNLDDVNAVFDDPEEPRTEEQSGNENMSPLA  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL  +FDRGQDS  + TRF+ QKPAKV LSTMEVVAQSMGFKTHIRN
Sbjct  308  LNAFDLIILSQGLNLGTMFDRGQDSMKYPTRFVCQKPAKVLLSTMEVVAQSMGFKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEG SA K S+FSVI+EIF+VAPTF+MVDIQKAAG+++E+LKFYK+F  NLED++W
Sbjct  368  YKMRVEGPSASKTSYFSVIMEIFEVAPTFYMVDIQKAAGETSEYLKFYKSFYSNLEDIVW  427

Query  67   KPPDELCKSRITKAKSKKR  11
            KP  +  KSR  K KSKKR
Sbjct  428  KPSFDTSKSRSGKNKSKKR  446



>ref|XP_003615372.1| CBL-interacting protein kinase [Medicago truncatula]
Length=475

 Score =   407 bits (1047),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/287 (67%), Positives = 226/287 (79%), Gaps = 29/287 (10%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPFDE+DLTTLY KI++A+FSCP+WFPVGAKSLI +ILDPNPE
Sbjct  189  ADVWSCGVILYVLMAGYLPFDELDLTTLYSKIDKADFSCPAWFPVGAKSLIQRILDPNPE  248

Query  604  -----------------------------TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNL  512
                                          RI IE+IRNDEWF+K Y+PV ++EYEDVNL
Sbjct  249  HILYRATHSCLVLQTSHARYLHAWARAACRRITIEQIRNDEWFQKSYVPVHLLEYEDVNL  308

Query  511  DDINAAFDDTEEEVPNEQCNNEDFGPLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRF  332
            D+INAAFD  E+E  N QC   D GPL LNAFD+I+LS+GLNL+ +FDRGQD+  +QTRF
Sbjct  309  DEINAAFDSAEDEGDNPQCEIADTGPLILNAFDMIMLSQGLNLATIFDRGQDTMKYQTRF  368

Query  331  LTQKPAKVALSTMEVVAQSMGFKTHIRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMV  152
            +TQKPAKV LS+MEVVAQSMGFKTHIRNYKMR+EG+SA K +HFSVILE+F+VAPTFFMV
Sbjct  369  ITQKPAKVVLSSMEVVAQSMGFKTHIRNYKMRIEGISAKKTTHFSVILEVFEVAPTFFMV  428

Query  151  DIQKAAGDSTEFLKFYKNFCGNLEDLIWKPPDELCKSRITKAKSKKR  11
            DIQKAAGD++E+LKFYKNF  NLED+IWK P E  K + +K +SK+ 
Sbjct  429  DIQKAAGDASEYLKFYKNFSSNLEDIIWKSPHETSKLKTSKTRSKRH  475



>ref|XP_011627891.1| PREDICTED: CBL-interacting protein kinase 8 isoform X1 [Amborella 
trichopoda]
Length=443

 Score =   405 bits (1041),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 221/255 (87%), Gaps = 1/255 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVL+AGYLPFDEVDLTTLYGKIERA+FSCPSWFPVGAK LIHKILDPNP
Sbjct  189  VADVWSCGVILYVLLAGYLPFDEVDLTTLYGKIERADFSCPSWFPVGAKLLIHKILDPNP  248

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
             TR+RIEEIRND+WFKKGY+ V+ +E EDVNLDD+ AAFDD E++  +E   + + GPL 
Sbjct  249  NTRVRIEEIRNDDWFKKGYVAVRHVEDEDVNLDDVYAAFDDAEDQYVSEHSGH-NMGPLI  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFD+IILSEGLNL+ LFDR Q+    Q RF++QKPAKV LS+MEVVAQSMGFKTHIRN
Sbjct  308  LNAFDMIILSEGLNLAALFDRRQEYVKRQGRFVSQKPAKVVLSSMEVVAQSMGFKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            +KMRVEGLSA+K +HFSVILE+F+VAP FFMVD+Q+A+GD  E+ KFY NFC NLED+IW
Sbjct  368  FKMRVEGLSANKAAHFSVILEVFEVAPAFFMVDVQQASGDILEYQKFYNNFCSNLEDIIW  427

Query  67   KPPDELCKSRITKAK  23
            KPP+E+ K R++  +
Sbjct  428  KPPEEMAKPRLSMKR  442



>ref|XP_006856630.1| PREDICTED: CBL-interacting protein kinase 8 isoform X2 [Amborella 
trichopoda]
 gb|ERN18097.1| hypothetical protein AMTR_s00046p00229830 [Amborella trichopoda]
Length=442

 Score =   405 bits (1041),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 221/255 (87%), Gaps = 1/255 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVL+AGYLPFDEVDLTTLYGKIERA+FSCPSWFPVGAK LIHKILDPNP
Sbjct  188  VADVWSCGVILYVLLAGYLPFDEVDLTTLYGKIERADFSCPSWFPVGAKLLIHKILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
             TR+RIEEIRND+WFKKGY+ V+ +E EDVNLDD+ AAFDD E++  +E   + + GPL 
Sbjct  248  NTRVRIEEIRNDDWFKKGYVAVRHVEDEDVNLDDVYAAFDDAEDQYVSEHSGH-NMGPLI  306

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFD+IILSEGLNL+ LFDR Q+    Q RF++QKPAKV LS+MEVVAQSMGFKTHIRN
Sbjct  307  LNAFDMIILSEGLNLAALFDRRQEYVKRQGRFVSQKPAKVVLSSMEVVAQSMGFKTHIRN  366

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            +KMRVEGLSA+K +HFSVILE+F+VAP FFMVD+Q+A+GD  E+ KFY NFC NLED+IW
Sbjct  367  FKMRVEGLSANKAAHFSVILEVFEVAPAFFMVDVQQASGDILEYQKFYNNFCSNLEDIIW  426

Query  67   KPPDELCKSRITKAK  23
            KPP+E+ K R++  +
Sbjct  427  KPPEEMAKPRLSMKR  441



>ref|XP_009138030.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Brassica rapa]
 ref|XP_009138034.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Brassica rapa]
Length=446

 Score =   404 bits (1039),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 187/259 (72%), Positives = 219/259 (85%), Gaps = 1/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DL TLY KI+ A+FSCPS+F +GAK+LI +ILDPNP
Sbjct  189  VADVWSCGVILYVLMAGYLPFDEMDLPTLYSKIDNADFSCPSYFALGAKALIRRILDPNP  248

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI I EIR DEWF K Y PV++I+YE VNLDD+ AAFDD EE+    Q    D GPL 
Sbjct  249  ETRITIAEIRKDEWFVKDYTPVQVIDYEHVNLDDVYAAFDDPEEQ-KEAQVGTRDTGPLT  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDRG+DS  HQTRF++ KPA V LS+MEVV+QSMGFKTHIRN
Sbjct  308  LNAFDLIILSQGLNLATLFDRGKDSMKHQTRFISHKPANVVLSSMEVVSQSMGFKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA+K SHFSVILE+F+VAP+F MVDIQ AAGD+ E+LKFYK FCG L+D+IW
Sbjct  368  YKMRVEGLSANKSSHFSVILEVFKVAPSFLMVDIQNAAGDAEEYLKFYKTFCGKLDDIIW  427

Query  67   KPPDELCKSRITKAKSKKR  11
            KPPD   ++R+TK KSK+R
Sbjct  428  KPPDASVRNRVTKTKSKRR  446



>ref|XP_010433771.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
[Camelina sativa]
Length=446

 Score =   404 bits (1038),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 188/259 (73%), Positives = 221/259 (85%), Gaps = 1/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DL TLY KI++AEF+CPS+F +GAKSLI++ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDELDLPTLYSKIDKAEFACPSYFALGAKSLINRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI I EIR DEWF K Y PV++I+YE VNLDD+ AAFDD EE++   Q    D GPL 
Sbjct  248  ETRITIAEIRKDEWFLKDYTPVQLIDYEHVNLDDVYAAFDDPEEQI-YAQDGTGDTGPLT  306

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLI+LS+GLNL+ LFDRG+DS  HQTRF++ KPA V LS+MEVV+QSMGFKTHIRN
Sbjct  307  LNAFDLIVLSQGLNLATLFDRGKDSMKHQTRFISHKPASVVLSSMEVVSQSMGFKTHIRN  366

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA+K SHFSVILE+F+VAP+ FMVDIQ AAGD+ E+LKFYK FC  L+D+IW
Sbjct  367  YKMRVEGLSANKTSHFSVILEVFKVAPSIFMVDIQNAAGDAEEYLKFYKTFCSKLDDIIW  426

Query  67   KPPDELCKSRITKAKSKKR  11
            KPPD   ++RITKAKSK R
Sbjct  427  KPPDASVRNRITKAKSKSR  445



>ref|XP_007227712.1| hypothetical protein PRUPE_ppa005163mg [Prunus persica]
 gb|EMJ28911.1| hypothetical protein PRUPE_ppa005163mg [Prunus persica]
Length=474

 Score =   405 bits (1040),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 193/273 (71%), Positives = 222/273 (81%), Gaps = 28/273 (10%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGK-------------------------IER  683
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY                           IE+
Sbjct  188  VADVWSCGVILYVLMAGYLPFDELDLTTLYILPLPQYFTSSDVYFSVRMLRCDIKIIIEK  247

Query  682  AEFSCPSWFPVGAKSLIHKILDPNPETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDI  503
            AEFSCPSWFPVGAKSLIH+ILDPNPETRI IE+IR+ EWF+K Y+PV+  EYEDVNLDD+
Sbjct  248  AEFSCPSWFPVGAKSLIHRILDPNPETRITIEQIRDHEWFQKNYVPVRSFEYEDVNLDDV  307

Query  502  NAAFDDT---EEEVPNEQCNNEDFGPLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRF  332
            NA FDD    +E+  +E   NED GPL LNAFDLIILS+GLNL+ +FDRG+DS  +QTRF
Sbjct  308  NAVFDDADSEQEQRVSEHRGNEDMGPLVLNAFDLIILSQGLNLATMFDRGKDSMKYQTRF  367

Query  331  LTQKPAKVALSTMEVVAQSMGFKTHIRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMV  152
            ++QKPAKV LS+MEVVAQSMGFKTHIRNYKMRVEGLSA+K SHFS+ILEIF+VAPT++MV
Sbjct  368  VSQKPAKVVLSSMEVVAQSMGFKTHIRNYKMRVEGLSANKTSHFSIILEIFEVAPTYYMV  427

Query  151  DIQKAAGDSTEFLKFYKNFCGNLEDLIWKPPDE  53
            DIQKAAGD++EFLKFYKNFC NLED+IWKPP E
Sbjct  428  DIQKAAGDASEFLKFYKNFCSNLEDIIWKPPTE  460



>ref|NP_194171.1| CBL-interacting serine/threonine-protein kinase 8 [Arabidopsis 
thaliana]
 sp|Q9STV4.1|CIPK8_ARATH RecName: Full=CBL-interacting serine/threonine-protein kinase 
8; AltName: Full=SNF1-related kinase 3.13; AltName: Full=SOS2-like 
protein kinase PKS11 [Arabidopsis thaliana]
 gb|AAK16683.2|AF290193_1 CBL-interacting protein kinase 8 [Arabidopsis thaliana]
 emb|CAB45075.1| serine/threonine kinase-like protein [Arabidopsis thaliana]
 emb|CAB79350.1| serine/threonine kinase-like protein [Arabidopsis thaliana]
 gb|AAN41358.1| putative serine/threonine kinase [Arabidopsis thaliana]
 gb|AEE84899.1| CBL-interacting serine/threonine-protein kinase 8 [Arabidopsis 
thaliana]
Length=445

 Score =   403 bits (1036),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 187/259 (72%), Positives = 220/259 (85%), Gaps = 1/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVILYVLMAGYLPFDE+DL TLY KI++AEFSCPS+F +GAKSLI++ILDPNP
Sbjct  188  VADIWSCGVILYVLMAGYLPFDEMDLPTLYSKIDKAEFSCPSYFALGAKSLINRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI I EIR DEWF K Y PV++I+YE VNLDD+ AAFDD EE+    Q    D GPL 
Sbjct  248  ETRITIAEIRKDEWFLKDYTPVQLIDYEHVNLDDVYAAFDDPEEQT-YAQDGTRDTGPLT  306

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDRG+DS  HQTRF++ KPA V LS+MEVV+QSMGFKTHIRN
Sbjct  307  LNAFDLIILSQGLNLATLFDRGKDSMKHQTRFISHKPANVVLSSMEVVSQSMGFKTHIRN  366

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA+K SHFSVILE+F+VAP+  MVDIQ AAGD+ E+LKFYK FC  L+D+IW
Sbjct  367  YKMRVEGLSANKTSHFSVILEVFKVAPSILMVDIQNAAGDAEEYLKFYKTFCSKLDDIIW  426

Query  67   KPPDELCKSRITKAKSKKR  11
            KPPD   ++R+TKAKSK+R
Sbjct  427  KPPDASMRNRVTKAKSKRR  445



>ref|XP_006413437.1| hypothetical protein EUTSA_v10025204mg [Eutrema salsugineum]
 gb|ESQ54890.1| hypothetical protein EUTSA_v10025204mg [Eutrema salsugineum]
Length=445

 Score =   402 bits (1032),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 187/259 (72%), Positives = 219/259 (85%), Gaps = 1/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DL TLY KI++AEF+CPS+F +GAKSLI +ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDELDLPTLYSKIDKAEFACPSYFALGAKSLIRRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            E+R+ I EIR DEWF K Y PV++I+YE VNLDD+ AAFDD EE+    Q    D GPL 
Sbjct  248  ESRVTIAEIRKDEWFVKDYTPVQLIDYEHVNLDDVYAAFDDPEEQ-KGAQDETGDTGPLT  306

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDRG+DS  HQTRF++ KPA V LS+MEVV+QSMGFKTHIRN
Sbjct  307  LNAFDLIILSQGLNLATLFDRGKDSMKHQTRFISHKPANVVLSSMEVVSQSMGFKTHIRN  366

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA+K SHFSVILE+F+VAPTF MVDIQ AAGD+ E+LKFYK FCG L+D+IW
Sbjct  367  YKMRVEGLSANKTSHFSVILEVFKVAPTFLMVDIQNAAGDAEEYLKFYKTFCGKLDDIIW  426

Query  67   KPPDELCKSRITKAKSKKR  11
            KPPD   ++R TK KSK+R
Sbjct  427  KPPDASVRNRATKPKSKRR  445



>ref|XP_009615545.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X3 [Nicotiana tomentosiformis]
Length=407

 Score =   399 bits (1026),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 190/259 (73%), Positives = 209/259 (81%), Gaps = 39/259 (15%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVILYVLMAGYLPFDEVDLTTLY KIE+AEFSCPSWFPVGAKSLIH+ILDPNP
Sbjct  188  VADIWSCGVILYVLMAGYLPFDEVDLTTLYAKIEKAEFSCPSWFPVGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            +TRIRIEEIRNDEWFKKGY+PVK +EYEDVNLDDINAAFDDTE+ +              
Sbjct  248  QTRIRIEEIRNDEWFKKGYVPVKAMEYEDVNLDDINAAFDDTEDTMKQ------------  295

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
                                       HQTRFLTQKPAKV LS+MEVVAQSMGFKTHIRN
Sbjct  296  ---------------------------HQTRFLTQKPAKVVLSSMEVVAQSMGFKTHIRN  328

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA+K SHFSVILE+F+VAPTFFMVD+QKAAGD+ EFLKFYKNFCGNLED+IW
Sbjct  329  YKMRVEGLSANKTSHFSVILEVFEVAPTFFMVDVQKAAGDAGEFLKFYKNFCGNLEDIIW  388

Query  67   KPPDELCKSRITKAKSKKR  11
            KP DE CKSR+TK +S+KR
Sbjct  389  KPSDESCKSRVTKTRSRKR  407



>ref|XP_006283734.1| hypothetical protein CARUB_v10004806mg [Capsella rubella]
 gb|EOA16632.1| hypothetical protein CARUB_v10004806mg [Capsella rubella]
Length=445

 Score =   400 bits (1029),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 184/259 (71%), Positives = 221/259 (85%), Gaps = 1/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCG+ILYVLMAGYLPFDE+DL TLY KI++AEF+CPS+F +GAKSLI++ILDPNP
Sbjct  188  VADVWSCGIILYVLMAGYLPFDELDLPTLYSKIDKAEFACPSYFALGAKSLINRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI I EIR D+WF K Y PV++I+YE VNLDD+ AAFDD EE++   Q    D GPL 
Sbjct  248  ETRITIAEIRKDDWFLKDYTPVQLIDYEHVNLDDVYAAFDDPEEQI-YAQDGTGDTGPLT  306

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLI+LS+GLNL+ LFDRG+DS  HQTRF++ KPA V LS+MEVV+QSMGFKTHIRN
Sbjct  307  LNAFDLIVLSQGLNLATLFDRGKDSMKHQTRFISHKPANVVLSSMEVVSQSMGFKTHIRN  366

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA+K SHFSVILE+F+VAP+  MVDIQ AAGD+ E+LKFYK FC  L+D+IW
Sbjct  367  YKMRVEGLSANKTSHFSVILEVFKVAPSILMVDIQNAAGDTEEYLKFYKTFCSKLDDIIW  426

Query  67   KPPDELCKSRITKAKSKKR  11
            KPPD   ++R+TKAKSK+R
Sbjct  427  KPPDASVRNRVTKAKSKRR  445



>ref|XP_010439044.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Camelina sativa]
Length=446

 Score =   400 bits (1028),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 186/259 (72%), Positives = 220/259 (85%), Gaps = 1/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DL TLY KI++AEF+CPS+F +GAKSLI++ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDELDLPTLYSKIDKAEFACPSYFALGAKSLINRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI I EIR D+WF K Y PV++I+YE VNLDD+ AAFDD EE++   Q    D GPL 
Sbjct  248  ETRITIAEIRKDDWFLKDYAPVQLIDYEHVNLDDVYAAFDDPEEQI-YAQDGTGDTGPLT  306

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLI+LS+GLNL+ LFDRG+DS  HQTRF++ KPA V LS+MEVV+QSMGFKTHIRN
Sbjct  307  LNAFDLIVLSQGLNLATLFDRGKDSMKHQTRFISHKPANVVLSSMEVVSQSMGFKTHIRN  366

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA+K SHFSVILE+F+VAP+  MVDIQ AAGD+ E+LKFYK FC  L+D+IW
Sbjct  367  YKMRVEGLSANKTSHFSVILEVFKVAPSILMVDIQNAAGDAEEYLKFYKTFCSKLDDIIW  426

Query  67   KPPDELCKSRITKAKSKKR  11
            KPPD   ++RITKAKSK R
Sbjct  427  KPPDASVRNRITKAKSKNR  445



>ref|XP_010448567.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
[Camelina sativa]
Length=446

 Score =   400 bits (1027),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 186/259 (72%), Positives = 219/259 (85%), Gaps = 1/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DL TLY KI++AEF+CPS+F +GAKSLI++ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDELDLPTLYSKIDKAEFACPSYFALGAKSLINRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI I EIR DEWF K Y PV++I+YE VNLDD+ AAFDD EE++   Q    D GPL 
Sbjct  248  ETRITIAEIRKDEWFLKDYTPVQLIDYEHVNLDDVYAAFDDPEEQI-YAQDGTGDTGPLT  306

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLI+LS GLNL+ LFDRG+DS  HQTRF++ KPA V LS+MEVV+QSMGFKTHIRN
Sbjct  307  LNAFDLIVLSHGLNLATLFDRGKDSMKHQTRFISHKPANVVLSSMEVVSQSMGFKTHIRN  366

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA+K SHFSVILE+F+VAP+  MVDIQ AAGD+ E+LKFYK FC  L+D+IW
Sbjct  367  YKMRVEGLSANKTSHFSVILEVFKVAPSILMVDIQNAAGDAEEYLKFYKTFCSKLDDIIW  426

Query  67   KPPDELCKSRITKAKSKKR  11
            KPPD   ++RITKAK+K R
Sbjct  427  KPPDASVRNRITKAKNKSR  445



>ref|XP_002869721.1| cbl-interacting protein kinase 8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45980.1| cbl-interacting protein kinase 8 [Arabidopsis lyrata subsp. lyrata]
Length=445

 Score =   400 bits (1027),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 187/259 (72%), Positives = 218/259 (84%), Gaps = 1/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DL TLY KI+RA+F+CPS+F +GAKSLI++ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDEMDLPTLYSKIDRADFACPSYFALGAKSLINRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI I EIR DEWF K Y PV++I+YE VNLDD+ AAFDD EE     Q      GPL 
Sbjct  248  ETRITIAEIRKDEWFLKDYTPVQLIDYEHVNLDDVYAAFDDPEEHT-YAQDGTGSTGPLT  306

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDRG+DS  HQTRF++ KPA V LS+MEVV+QSMGFKTHIRN
Sbjct  307  LNAFDLIILSQGLNLATLFDRGKDSMKHQTRFISHKPANVVLSSMEVVSQSMGFKTHIRN  366

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSA+K SHFSVILE+F+VAP+  MVDIQ AAGD+ E+LKFYK FC  L+D+IW
Sbjct  367  YKMRVEGLSANKTSHFSVILEVFKVAPSILMVDIQNAAGDAEEYLKFYKTFCSKLDDIIW  426

Query  67   KPPDELCKSRITKAKSKKR  11
            KPPD   K+R+TKAKSK+R
Sbjct  427  KPPDASMKNRVTKAKSKRR  445



>gb|AGA37211.1| CBL-interacting protein kinase 8.1 [Brassica napus]
Length=451

 Score =   400 bits (1027),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/265 (71%), Positives = 219/265 (83%), Gaps = 7/265 (3%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DL TLY KI+ A+FSCPS+F +GAK+LIH+ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDEMDLPTLYSKIDNADFSCPSYFALGAKALIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI I EIR DEWF K Y PV++I+YE VNLDD+ AAFDD EE     Q    D GPL 
Sbjct  248  ETRITIAEIRKDEWFAKDYTPVQVIDYEHVNLDDVYAAFDDPEER-KEAQVGTGDTGPLT  306

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDRG++S  HQTRF++ KPA V LS+MEVV+QSMGFKTHIRN
Sbjct  307  LNAFDLIILSQGLNLATLFDRGKESMKHQTRFISHKPANVVLSSMEVVSQSMGFKTHIRN  366

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLK------FYKNFCGN  86
            YKMRVEGLSA+K SHFSVILE+F+VAPTF MVDIQ AAGD+ E+LK      FYK FCG 
Sbjct  367  YKMRVEGLSANKSSHFSVILEVFKVAPTFLMVDIQNAAGDAEEYLKFVNVLQFYKTFCGK  426

Query  85   LEDLIWKPPDELCKSRITKAKSKKR  11
            L+D+IWKPPD   ++R+TK KSK+R
Sbjct  427  LDDIIWKPPDASVRNRVTKTKSKRR  451



>gb|KHG16968.1| CBL-interacting serine/threonine-protein kinase 8 [Gossypium 
arboreum]
Length=431

 Score =   398 bits (1023),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 181/246 (74%), Positives = 219/246 (89%), Gaps = 3/246 (1%)
 Frame = -1

Query  739  GYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPETRIRIEEIRNDEWFK  560
            GYLPFDE+DLTTLY KIERA+FSCPSWFPVGAKSLIH+ILDPNP+TRI IE+IR+DEWF 
Sbjct  186  GYLPFDELDLTTLYSKIERADFSCPSWFPVGAKSLIHRILDPNPQTRITIEQIRSDEWFN  245

Query  559  KGYIPVKIIEYEDVNLDDINAAFDDTE---EEVPNEQCNNEDFGPLALNAFDLIILSEGL  389
            KGY+PV+++EYED+NLD++NA FDD E   EE  NE   NED GPL+LNAFDLIILS+GL
Sbjct  246  KGYVPVRLLEYEDINLDEVNAVFDDPEVDKEERGNEPSGNEDMGPLSLNAFDLIILSQGL  305

Query  388  NLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNYKMRVEGLSADKI  209
            NL+ LFDRG+D+  +QTRF++QKPA+V LS+MEVVAQSMG+KTHIRNYKMRVEGLSA+K 
Sbjct  306  NLATLFDRGKDNMKYQTRFVSQKPARVVLSSMEVVAQSMGYKTHIRNYKMRVEGLSANKN  365

Query  208  SHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWKPPDELCKSRITK  29
            SH SVILE+F+VAPTF MVD+QKAAGD+ E+LKFY+ F  NLE++IWKPP+E  K+RITK
Sbjct  366  SHLSVILEVFEVAPTFLMVDMQKAAGDAGEYLKFYQAFYSNLEEIIWKPPNESSKTRITK  425

Query  28   AKSKKR  11
            ++SK+R
Sbjct  426  SRSKRR  431



>ref|XP_010671031.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   398 bits (1023),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 183/259 (71%), Positives = 220/259 (85%), Gaps = 0/259 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            LAD+WSCGV+LYVLMAGYLPFDE+DLTTLY KIE A+FS PSWF +GAKSLI +ILDPNP
Sbjct  188  LADIWSCGVLLYVLMAGYLPFDELDLTTLYSKIEHADFSFPSWFSMGAKSLIKRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ++RIR+E+I++DEWFKKGY PV  IEYEDVNLDDINA FD+TE +   +Q  N+D GPL 
Sbjct  248  QSRIRMEDIKDDEWFKKGYTPVNFIEYEDVNLDDINAVFDETENQQDYQQHINDDVGPLI  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL  LFD+G+DS  HQTRF++QKP KV +S+MEVVAQSMGFKTHIRN
Sbjct  308  LNAFDLIILSQGLNLESLFDKGKDSVKHQTRFVSQKPVKVVVSSMEVVAQSMGFKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMR+EGLSA+K  + +VILE+F+VAP   +VDIQKAAGD  E+L FYK+FC NLED+IW
Sbjct  368  YKMRIEGLSANKTGNITVILEVFEVAPPLLLVDIQKAAGDLNEYLNFYKSFCENLEDIIW  427

Query  67   KPPDELCKSRITKAKSKKR  11
            +PP +   SR+ K KS+KR
Sbjct  428  RPPGDSGISRVGKNKSRKR  446



>emb|CDY68878.1| BnaA01g35110D [Brassica napus]
Length=446

 Score =   398 bits (1022),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 187/260 (72%), Positives = 218/260 (84%), Gaps = 2/260 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLY-GKIERAEFSCPSWFPVGAKSLIHKILDPN  611
            +ADVWSCGVILYVLMAGYLPFDE+DL TLY   I+ A+FSCPS+F +GAK+LI +ILDPN
Sbjct  188  VADVWSCGVILYVLMAGYLPFDEMDLPTLYMTSIDNADFSCPSYFALGAKALIRRILDPN  247

Query  610  PETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPL  431
            PETRI I EIR DEWF K Y PV++I+YE VNLDD+ AAFDD EE+    Q    D GPL
Sbjct  248  PETRITIAEIRKDEWFVKDYTPVQVIDYEHVNLDDVYAAFDDPEEQ-KEAQVGTGDTGPL  306

Query  430  ALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIR  251
             LNAFDLIILS+GLNL+ LFDRG+DS  HQTRF++ KPA V LS+MEVV+QSMGFKTHIR
Sbjct  307  TLNAFDLIILSQGLNLATLFDRGKDSMKHQTRFISHKPANVVLSSMEVVSQSMGFKTHIR  366

Query  250  NYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLI  71
            NYKMRVEGLSA+K SHFSVILE+F+VAPTF MVDIQ AAGD+ E+LKFYK FCG L+D+I
Sbjct  367  NYKMRVEGLSANKSSHFSVILEVFKVAPTFLMVDIQNAAGDAEEYLKFYKTFCGKLDDII  426

Query  70   WKPPDELCKSRITKAKSKKR  11
            WKPPD   ++R+TK KSK+R
Sbjct  427  WKPPDASVRNRVTKTKSKRR  446



>ref|XP_010924071.1| PREDICTED: CBL-interacting protein kinase 8 isoform X1 [Elaeis 
guineensis]
Length=442

 Score =   397 bits (1021),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 184/257 (72%), Positives = 216/257 (84%), Gaps = 2/257 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVILYVLMAGYLPFDEVDLTTLY KIE+AEFSCPSWF  GAKSLIH+ILDPNP
Sbjct  188  IADIWSCGVILYVLMAGYLPFDEVDLTTLYTKIEKAEFSCPSWFSGGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
             +RIRIEEIR +EWF+K Y+PV+ +E EDVNLDD+ A FDD E+   +EQ  NE  GPL 
Sbjct  248  ASRIRIEEIRCNEWFRKNYVPVRPVENEDVNLDDVYAVFDDPEQ--ASEQSRNEGLGPLI  305

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNLS LFDR Q+    QTRFL++KPAKV LS+MEVVAQSMGFKTHIRN
Sbjct  306  LNAFDLIILSQGLNLSALFDRRQEYVRQQTRFLSRKPAKVVLSSMEVVAQSMGFKTHIRN  365

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMR+EGLSADK +H SV+LEIF+VAP+F MV+IQ+AAGD  E++ F KNFC  LE++IW
Sbjct  366  YKMRIEGLSADKTAHLSVMLEIFEVAPSFLMVEIQRAAGDGAEYVTFNKNFCSKLEEIIW  425

Query  67   KPPDELCKSRITKAKSK  17
            +PP E  KSRIT+   +
Sbjct  426  RPPVEKSKSRITRMSKR  442



>ref|XP_010924072.1| PREDICTED: CBL-interacting protein kinase 8 isoform X2 [Elaeis 
guineensis]
Length=441

 Score =   396 bits (1017),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 184/257 (72%), Positives = 215/257 (84%), Gaps = 3/257 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVILYVLMAGYLPFDEVDLTTLY KIE+AEFSCPSWF  GAKSLIH+ILDPNP
Sbjct  188  IADIWSCGVILYVLMAGYLPFDEVDLTTLYTKIEKAEFSCPSWFSGGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
             +RIRIEEIR +EWF+K Y+PV+ +E EDVNLDD+ A FDD E    +EQ  NE  GPL 
Sbjct  248  ASRIRIEEIRCNEWFRKNYVPVRPVENEDVNLDDVYAVFDDPE---ASEQSRNEGLGPLI  304

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNLS LFDR Q+    QTRFL++KPAKV LS+MEVVAQSMGFKTHIRN
Sbjct  305  LNAFDLIILSQGLNLSALFDRRQEYVRQQTRFLSRKPAKVVLSSMEVVAQSMGFKTHIRN  364

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMR+EGLSADK +H SV+LEIF+VAP+F MV+IQ+AAGD  E++ F KNFC  LE++IW
Sbjct  365  YKMRIEGLSADKTAHLSVMLEIFEVAPSFLMVEIQRAAGDGAEYVTFNKNFCSKLEEIIW  424

Query  67   KPPDELCKSRITKAKSK  17
            +PP E  KSRIT+   +
Sbjct  425  RPPVEKSKSRITRMSKR  441



>emb|CDY03449.1| BnaC01g16330D [Brassica napus]
Length=453

 Score =   396 bits (1017),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 186/260 (72%), Positives = 217/260 (83%), Gaps = 2/260 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLY-GKIERAEFSCPSWFPVGAKSLIHKILDPN  611
            +ADVWSCGVILYVLMAGYLPFDE+DL TLY   I+ A+FSCPS+F +GAK+LI +ILDPN
Sbjct  195  VADVWSCGVILYVLMAGYLPFDEMDLPTLYMTSIDNADFSCPSYFALGAKALIRRILDPN  254

Query  610  PETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPL  431
            PETRI I EIR DEWF K Y PV++I+YE VNLDD+ AAFDD EE     Q    D GPL
Sbjct  255  PETRITIAEIRKDEWFAKDYTPVQVIDYEHVNLDDVYAAFDDPEER-KEAQVGTGDTGPL  313

Query  430  ALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIR  251
             LNAFDLIILS+GLNL+ LFDRG++S  HQTRF++ KPA V LS+MEVV+QSMGFKTHIR
Sbjct  314  TLNAFDLIILSQGLNLATLFDRGKESMKHQTRFISHKPANVVLSSMEVVSQSMGFKTHIR  373

Query  250  NYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLI  71
            NYKMRVEGLSA+K SHFSVILE+F+VAPTF MVDIQ AAGD+ E+LKFYK FCG L+D+I
Sbjct  374  NYKMRVEGLSANKSSHFSVILEVFKVAPTFLMVDIQNAAGDAEEYLKFYKTFCGKLDDII  433

Query  70   WKPPDELCKSRITKAKSKKR  11
            WKPPD   ++R+TK KSK+R
Sbjct  434  WKPPDASVRNRVTKTKSKRR  453



>gb|KFK26444.1| hypothetical protein AALP_AA8G249200 [Arabis alpina]
Length=448

 Score =   395 bits (1014),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/260 (70%), Positives = 219/260 (84%), Gaps = 1/260 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCG+ILYVLMAGYLPFDE+DL TLY KI+ A+FSCPS+FP+ AKSLIH+ILDPNP
Sbjct  188  VADVWSCGIILYVLMAGYLPFDELDLPTLYSKIDTADFSCPSYFPLAAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI I EIRN++WFKK Y PV++++YE VNLDD+ AAFDD EE+  +EQ    D  PL 
Sbjct  248  ETRITISEIRNNDWFKKDYDPVQLVDYEHVNLDDVYAAFDDPEEQKDDEQDGARDMSPLT  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDRG++S  HQTRF+T KPA V LS+MEVVAQSMGFKTHIRN
Sbjct  308  LNAFDLIILSQGLNLATLFDRGKESMKHQTRFITHKPANVVLSSMEVVAQSMGFKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGL  +K S FSVILE+F+VAPTF MVDIQ A+GD+ E+L FYK F G L+D+IW
Sbjct  368  YKMRVEGLYGNKTSRFSVILEVFKVAPTFLMVDIQNASGDADEYLTFYKTFYGKLDDIIW  427

Query  67   K-PPDELCKSRITKAKSKKR  11
            K PP+E  ++R TKAKS++R
Sbjct  428  KPPPEESARNRTTKAKSRRR  447



>ref|XP_010671024.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/262 (70%), Positives = 220/262 (84%), Gaps = 3/262 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            LAD+WSCGV+LYVLMAGYLPFDE+DLTTLY KIE A+FS PSWF +GAKSLI +ILDPNP
Sbjct  188  LADIWSCGVLLYVLMAGYLPFDELDLTTLYSKIEHADFSFPSWFSMGAKSLIKRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ++RIR+E+I++DEWFKKGY PV  IEYEDVNLDDINA FD+TE +   +Q  N+D GPL 
Sbjct  248  QSRIRMEDIKDDEWFKKGYTPVNFIEYEDVNLDDINAVFDETENQQDYQQHINDDVGPLI  307

Query  427  LNAFDLIILSEGLNLSVLFDRG---QDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTH  257
            LNAFDLIILS+GLNL  LFD+G   QDS  HQTRF++QKP KV +S+MEVVAQSMGFKTH
Sbjct  308  LNAFDLIILSQGLNLESLFDKGKFQQDSVKHQTRFVSQKPVKVVVSSMEVVAQSMGFKTH  367

Query  256  IRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLED  77
            IRNYKMR+EGLSA+K  + +VILE+F+VAP   +VDIQKAAGD  E+L FYK+FC NLED
Sbjct  368  IRNYKMRIEGLSANKTGNITVILEVFEVAPPLLLVDIQKAAGDLNEYLNFYKSFCENLED  427

Query  76   LIWKPPDELCKSRITKAKSKKR  11
            +IW+PP +   SR+ K KS+KR
Sbjct  428  IIWRPPGDSGISRVGKNKSRKR  449



>ref|XP_006386453.1| hypothetical protein POPTR_0002s10970g [Populus trichocarpa]
 gb|ERP64250.1| hypothetical protein POPTR_0002s10970g [Populus trichocarpa]
Length=416

 Score =   392 bits (1008),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 178/226 (79%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KI+RAEFSCPSWFPVGAKSLIH+ILDP P
Sbjct  189  IADVWSCGVILYVLMAGYLPFDELDLTTLYSKIDRAEFSCPSWFPVGAKSLIHRILDPKP  248

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI +E+IRNDEWFKKGY+P+K +EYEDVNLDD+NA FDD EE+  +EQ  NE+  PL 
Sbjct  249  ETRITVEQIRNDEWFKKGYVPIKPVEYEDVNLDDVNAVFDDPEEQRADEQHGNEEMSPLI  308

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDRGQDS  HQTRF+++KPA V LS+MEVVAQSMGFKTHIRN
Sbjct  309  LNAFDLIILSQGLNLAALFDRGQDSLKHQTRFVSKKPATVVLSSMEVVAQSMGFKTHIRN  368

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLK  110
            +KMRVEGLSADK  HFSVILE+F++APTF MVDIQ+AAGD+ E+LK
Sbjct  369  FKMRVEGLSADKAGHFSVILEVFEIAPTFLMVDIQRAAGDAAEYLK  414



>gb|KHN08228.1| CBL-interacting serine/threonine-protein kinase 8 [Glycine soja]
Length=417

 Score =   388 bits (996),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 176/227 (78%), Positives = 204/227 (90%), Gaps = 0/227 (0%)
 Frame = -1

Query  691  IERAEFSCPSWFPVGAKSLIHKILDPNPETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNL  512
            IERAEFSCP WFPVGAK LIH+ILDPNPETRI IE IRNDEWF++ Y+PV ++EYEDVNL
Sbjct  191  IERAEFSCPPWFPVGAKLLIHRILDPNPETRITIEHIRNDEWFQRSYVPVSLLEYEDVNL  250

Query  511  DDINAAFDDTEEEVPNEQCNNEDFGPLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRF  332
            DD+NAAFDD EE   ++QC+N+D GPL LNAFDLIILS+GLNL+ +FDRGQDS  +QTRF
Sbjct  251  DDVNAAFDDAEELRADQQCDNDDMGPLMLNAFDLIILSQGLNLATIFDRGQDSVKYQTRF  310

Query  331  LTQKPAKVALSTMEVVAQSMGFKTHIRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMV  152
            ++QKPAKV LS+MEVVAQSMGFKTHIRNYKMRVEG+SA+K S+FSVILEIF+VAPTF+MV
Sbjct  311  ISQKPAKVVLSSMEVVAQSMGFKTHIRNYKMRVEGVSANKTSYFSVILEIFEVAPTFYMV  370

Query  151  DIQKAAGDSTEFLKFYKNFCGNLEDLIWKPPDELCKSRITKAKSKKR  11
            DIQKAAGD+ E+LKFYKNFC NLED+IWKPP E  KSRI+K KSK+R
Sbjct  371  DIQKAAGDTGEYLKFYKNFCSNLEDIIWKPPHEASKSRISKTKSKRR  417



>gb|KFK26443.1| hypothetical protein AALP_AA8G249200 [Arabis alpina]
Length=444

 Score =   387 bits (995),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 182/260 (70%), Positives = 217/260 (83%), Gaps = 5/260 (2%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCG+ILYVLMAGYLPFDE+DL TLY KI+ A+FSCPS+FP+ AKSLIH+ILDPNP
Sbjct  188  VADVWSCGIILYVLMAGYLPFDELDLPTLYSKIDTADFSCPSYFPLAAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI I EIRN++WFKK Y PV++++YE VNLDD+ AAFDD EE+  +EQ    D  PL 
Sbjct  248  ETRITISEIRNNDWFKKDYDPVQLVDYEHVNLDDVYAAFDDPEEQKDDEQDGARDMSPLT  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDRG+    HQTRF+T KPA V LS+MEVVAQSMGFKTHIRN
Sbjct  308  LNAFDLIILSQGLNLATLFDRGK----HQTRFITHKPANVVLSSMEVVAQSMGFKTHIRN  363

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGL  +K S FSVILE+F+VAPTF MVDIQ A+GD+ E+L FYK F G L+D+IW
Sbjct  364  YKMRVEGLYGNKTSRFSVILEVFKVAPTFLMVDIQNASGDADEYLTFYKTFYGKLDDIIW  423

Query  67   K-PPDELCKSRITKAKSKKR  11
            K PP+E  ++R TKAKS++R
Sbjct  424  KPPPEESARNRTTKAKSRRR  443



>ref|XP_009396326.1| PREDICTED: CBL-interacting protein kinase 8 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009396328.1| PREDICTED: CBL-interacting protein kinase 8 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=443

 Score =   387 bits (993),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/253 (70%), Positives = 216/253 (85%), Gaps = 2/253 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVILYVL+AGYLPFDEVDLTTLY KIE+AEFSCPSWF +GAKSL+ KILDPNP
Sbjct  189  IADIWSCGVILYVLLAGYLPFDEVDLTTLYSKIEKAEFSCPSWFSIGAKSLLCKILDPNP  248

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETR+RIEEIRND+WFKK Y+PV  +E ED+NLDD+ AAFDD E+   +EQ  NE+ GPL 
Sbjct  249  ETRMRIEEIRNDDWFKKNYVPVSEVETEDINLDDVFAAFDDPEQ--ASEQSRNEELGPLN  306

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNLS LFDR QD   H+TRFL+ K A+V LS+MEVVAQSMGFKTHIRN
Sbjct  307  LNAFDLIILSQGLNLSALFDRRQDYTRHETRFLSCKSARVVLSSMEVVAQSMGFKTHIRN  366

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGL+A+K +H SV++EIF++AP+F MV+IQ+AAG++ ++LKF +NFC  L+D+IW
Sbjct  367  YKMRVEGLTANKATHLSVMIEIFEIAPSFLMVEIQRAAGEAADYLKFNRNFCSKLDDIIW  426

Query  67   KPPDELCKSRITK  29
            K   E  KS IT+
Sbjct  427  KSAIEKSKSHITR  439



>ref|XP_010520824.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X2 [Tarenaya hassleriana]
Length=429

 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 181/259 (70%), Positives = 215/259 (83%), Gaps = 17/259 (7%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLM                 I+RAEFSCP+WFP+GAKSLIH+ILDPNP
Sbjct  188  IADVWSCGVILYVLM-----------------IDRAEFSCPTWFPLGAKSLIHRILDPNP  230

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI I EIR D+WF+K Y PV++++YE V+LDD+ AAF D EE+  +E   NED GPL 
Sbjct  231  ETRITIAEIRKDDWFQKDYTPVQLLDYEHVDLDDVYAAFGDPEEQRTDELNGNEDTGPLF  290

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFD+IILS+GLNL+ LFDRG+DS  +QTRF++ KPAKVALS+MEVVAQSMGFKTHIRN
Sbjct  291  LNAFDMIILSQGLNLATLFDRGKDSMKYQTRFISHKPAKVALSSMEVVAQSMGFKTHIRN  350

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSADK+SHFSVILE+F+VAP+FFMVDIQKAAGD+ E+LKFYK FC NLED+IW
Sbjct  351  YKMRVEGLSADKMSHFSVILEVFKVAPSFFMVDIQKAAGDTDEYLKFYKTFCSNLEDIIW  410

Query  67   KPPDELCKSRITKAKSKKR  11
            KP DE  K+R+ K+KSK+R
Sbjct  411  KPSDESGKTRVPKSKSKRR  429



>ref|XP_009396329.1| PREDICTED: CBL-interacting protein kinase 8 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=442

 Score =   385 bits (990),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 178/253 (70%), Positives = 215/253 (85%), Gaps = 3/253 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVILYVL+AGYLPFDEVDLTTLY KIE+AEFSCPSWF +GAKSL+ KILDPNP
Sbjct  189  IADIWSCGVILYVLLAGYLPFDEVDLTTLYSKIEKAEFSCPSWFSIGAKSLLCKILDPNP  248

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETR+RIEEIRND+WFKK Y+PV  +E ED+NLDD+ AAFDD E    +EQ  NE+ GPL 
Sbjct  249  ETRMRIEEIRNDDWFKKNYVPVSEVETEDINLDDVFAAFDDPE---ASEQSRNEELGPLN  305

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNLS LFDR QD   H+TRFL+ K A+V LS+MEVVAQSMGFKTHIRN
Sbjct  306  LNAFDLIILSQGLNLSALFDRRQDYTRHETRFLSCKSARVVLSSMEVVAQSMGFKTHIRN  365

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGL+A+K +H SV++EIF++AP+F MV+IQ+AAG++ ++LKF +NFC  L+D+IW
Sbjct  366  YKMRVEGLTANKATHLSVMIEIFEIAPSFLMVEIQRAAGEAADYLKFNRNFCSKLDDIIW  425

Query  67   KPPDELCKSRITK  29
            K   E  KS IT+
Sbjct  426  KSAIEKSKSHITR  438



>gb|KJB58806.1| hypothetical protein B456_009G226900 [Gossypium raimondii]
Length=435

 Score =   382 bits (982),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 206/229 (90%), Gaps = 3/229 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KIERAEFSCPSWFP+GAKSLIH+ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDELDLTTLYSKIERAEFSCPSWFPMGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTE---EEVPNEQCNNEDFG  437
            +TRI IE+IR+DEWFKK Y+P +++EYED+NLDD+NA FDD E   EE  +E   NE+ G
Sbjct  248  QTRITIEQIRSDEWFKKSYVPARLLEYEDINLDDVNAVFDDPEIDKEERGDEPSRNENMG  307

Query  436  PLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTH  257
            PL LNAFDLIILS+GLNL+ LFDRG+D+  HQTRF+++KPA+V LS+MEVVAQSMG+KTH
Sbjct  308  PLNLNAFDLIILSQGLNLATLFDRGKDTMKHQTRFVSRKPARVVLSSMEVVAQSMGYKTH  367

Query  256  IRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLK  110
            IRNYKMRVEGLSA+K SHFSVILE+F+VAPTF MVDIQKAAGD+ ++LK
Sbjct  368  IRNYKMRVEGLSANKTSHFSVILEVFEVAPTFLMVDIQKAAGDAGDYLK  416



>gb|ADP37977.1| CBL-interacting protein kinase [Brassica napus]
Length=244

 Score =   375 bits (962),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 175/245 (71%), Positives = 205/245 (84%), Gaps = 1/245 (0%)
 Frame = -1

Query  745  MAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPETRIRIEEIRNDEW  566
            MAGYLPFDE+DL TLY KI+ A+FSCPS+F +GAK+LI +ILDPNPETRI I EIR DEW
Sbjct  1    MAGYLPFDEMDLPTLYSKIDNADFSCPSYFALGAKALIRRILDPNPETRITIAEIRKDEW  60

Query  565  FKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLALNAFDLIILSEGLN  386
            F K Y PV++I+YE VNLDD+ AAFDD EE+    Q    D GPL LNAFDLIILS+GLN
Sbjct  61   FVKDYTPVQVIDYEHVNLDDVYAAFDDPEEQ-KEAQVGTGDTGPLTLNAFDLIILSQGLN  119

Query  385  LSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNYKMRVEGLSADKIS  206
            L+ LFDRG+DS  HQTRF++ KPA V LS+MEVV+QSMGFKTHIRNYKMRVEGLSA+K S
Sbjct  120  LATLFDRGKDSMKHQTRFISHKPANVVLSSMEVVSQSMGFKTHIRNYKMRVEGLSANKSS  179

Query  205  HFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWKPPDELCKSRITKA  26
            HFSVILE+F+VAPTF MVDIQ AAGD+ E+LKFYK FCG L+D+IWKPPD   ++R+TK 
Sbjct  180  HFSVILEVFKVAPTFLMVDIQNAAGDAEEYLKFYKTFCGKLDDIIWKPPDASVRNRVTKT  239

Query  25   KSKKR  11
            KSK+R
Sbjct  240  KSKRR  244



>ref|XP_009790125.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X5 [Nicotiana sylvestris]
Length=424

 Score =   382 bits (980),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 187/276 (68%), Positives = 208/276 (75%), Gaps = 56/276 (20%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVILYVLMAGYLPFDEVDLTTLY KIERAEFSCPSWFPVGAKSLI +ILDPNP
Sbjct  188  VADIWSCGVILYVLMAGYLPFDEVDLTTLYAKIERAEFSCPSWFPVGAKSLISRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            +TRIRIE+IRNDEWFKKGY+PVK +EYEDVNLDDINAAFDDTE+ +              
Sbjct  248  QTRIRIEDIRNDEWFKKGYVPVKSMEYEDVNLDDINAAFDDTEDSMKQ------------  295

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
                                       HQTRFLTQKPAKV LS+MEVVAQSMGFKTHIRN
Sbjct  296  ---------------------------HQTRFLTQKPAKVVLSSMEVVAQSMGFKTHIRN  328

Query  247  YK-----------------MRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTE  119
            +K                 MRVEGLS++K SHFSVILE+F+VAPTFFMVD+QKAAGD+ E
Sbjct  329  FKFSWRTLKVSLFCACMSQMRVEGLSSNKTSHFSVILEVFEVAPTFFMVDVQKAAGDAGE  388

Query  118  FLKFYKNFCGNLEDLIWKPPDELCKSRITKAKSKKR  11
            FLKFYKNFCGNLED+IWKP DE CKSR+TK +S+KR
Sbjct  389  FLKFYKNFCGNLEDIIWKPSDETCKSRVTKTRSRKR  424



>gb|AFK34091.1| unknown [Lotus japonicus]
Length=429

 Score =   381 bits (979),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 211/260 (81%), Gaps = 21/260 (8%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPFDE+DLT LY KI +AEFSCP WFPVGAKSLI+++LD NPE
Sbjct  189  ADVWSCGVILYVLMAGYLPFDELDLTALYSKIGKAEFSCPPWFPVGAKSLIYRMLDTNPE  248

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAF--DDTEEEVPNEQCNNEDFGPL  431
             RI I++IRNDEWF++GYIP  ++EYEDVNLDD+NAAF  D+ E++  N+QC  ED GPL
Sbjct  249  HRITIQQIRNDEWFQRGYIPAHLLEYEDVNLDDVNAAFESDNIEDQRANQQCEKEDMGPL  308

Query  430  ALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIR  251
             LNAFD+IILS+GLNL+ LFDRG+DS  +QTRF+TQKPAKV LS+MEVVAQSMGFKTHIR
Sbjct  309  VLNAFDMIILSQGLNLATLFDRGKDSLNYQTRFITQKPAKVVLSSMEVVAQSMGFKTHIR  368

Query  250  NYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLI  71
            NYK                   +F+VAPTFFMVDIQKAAGD+ E+LKFYKNF  NLED+I
Sbjct  369  NYK-------------------VFEVAPTFFMVDIQKAAGDADEYLKFYKNFSSNLEDII  409

Query  70   WKPPDELCKSRITKAKSKKR  11
            W+PP E  K +++K KSK++
Sbjct  410  WRPPTETSKLKVSKNKSKRK  429



>gb|EPS70902.1| hypothetical protein M569_03857, partial [Genlisea aurea]
Length=269

 Score =   375 bits (962),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 176/259 (68%), Positives = 211/259 (81%), Gaps = 3/259 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            LAD+WSCGVILYVL+AGYLPFDE+DLTTLYGKIE AEFS PSWFP+GA+SLI +ILDPNP
Sbjct  12   LADIWSCGVILYVLIAGYLPFDEIDLTTLYGKIENAEFSSPSWFPMGARSLIRRILDPNP  71

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGP--  434
            ETRIRI+EIRNDEWF + Y PVK+ E  D++ DD+NAAFDD E+  P EQ  + + GP  
Sbjct  72   ETRIRIDEIRNDEWFSRNYTPVKVPEVVDIDFDDVNAAFDDVED-TPIEQGVDHNTGPEP  130

Query  433  LALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHI  254
            LALNAFDLIILS+GLNL+ LFDR QD++   TRF++Q+PA   LS+MEVV QSMGFKTHI
Sbjct  131  LALNAFDLIILSQGLNLAALFDRRQDASRRHTRFVSQRPANAVLSSMEVVVQSMGFKTHI  190

Query  253  RNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDL  74
            R+YKMRVEGLSA+K +HFSVI+EIFQ++  F MVD+Q   GD  E+LKFY+N C  L+D+
Sbjct  191  RSYKMRVEGLSANKTAHFSVIIEIFQISANFIMVDVQNGTGDCDEYLKFYQNLCSKLDDI  250

Query  73   IWKPPDELCKSRITKAKSK  17
            IWKP DE  KSR  K + K
Sbjct  251  IWKPRDETPKSRGLKNRRK  269



>ref|NP_001043259.1| Os01g0536000 [Oryza sativa Japonica Group]
 sp|Q5JLD8.1|CIPK8_ORYSJ RecName: Full=CBL-interacting protein kinase 8; AltName: Full=OsCIPK08 
[Oryza sativa Japonica Group]
 dbj|BAD87720.1| putative serine/threonine kinase [Oryza sativa Japonica Group]
 dbj|BAF05173.1| Os01g0536000 [Oryza sativa Japonica Group]
Length=446

 Score =   373 bits (957),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 174/257 (68%), Positives = 214/257 (83%), Gaps = 2/257 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            LAD WSCGVILYVL+AGYLPFDEVDLTTLYGKIE AE+S P+WFP GAKSLIH+ILDPNP
Sbjct  192  LADTWSCGVILYVLLAGYLPFDEVDLTTLYGKIESAEYSFPAWFPNGAKSLIHRILDPNP  251

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            + RIRIEEIRNDEWFKK Y P + IE E+VNLDD+NAAFDD EE+   +   +++ GPL 
Sbjct  252  DKRIRIEEIRNDEWFKKNYEPTREIESEEVNLDDVNAAFDDPEEDA--DHTLDDEAGPLT  309

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDR QD    Q RFL++KPAKV +S+MEVVAQSMG+KTHIRN
Sbjct  310  LNAFDLIILSQGLNLAALFDRRQDYDKLQNRFLSRKPAKVIMSSMEVVAQSMGYKTHIRN  369

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGL+A+K SH +V+LEIF+VAP+ FM+++Q+AAGD++++ KF  N+C  L+D+IW
Sbjct  370  YKMRVEGLNANKTSHLAVMLEIFEVAPSIFMIELQRAAGDTSDYNKFINNYCSKLDDIIW  429

Query  67   KPPDELCKSRITKAKSK  17
              P E  KSRI++   +
Sbjct  430  NFPIEKSKSRISRLSKR  446



>ref|NP_001168497.1| uncharacterized LOC100382276 [Zea mays]
 gb|ACN28426.1| unknown [Zea mays]
 tpg|DAA59082.1| TPA: putative CBL-interacting protein kinase family protein [Zea 
mays]
Length=451

 Score =   371 bits (952),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/253 (70%), Positives = 211/253 (83%), Gaps = 2/253 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            LAD WSCGVILYVL+AGYLPFDEVDLTTLYGKIE AE+S P+WF  GAKSLI +ILDPNP
Sbjct  195  LADTWSCGVILYVLLAGYLPFDEVDLTTLYGKIESAEYSFPAWFSGGAKSLIRRILDPNP  254

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRIRIEEIR+DEWF+K Y P+K IE E+VNLDD+NAAFDD E++  NE    ++ GPL 
Sbjct  255  ETRIRIEEIRSDEWFQKNYEPIKEIENEEVNLDDVNAAFDDPEDD--NEDAFEDETGPLT  312

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDR QD    Q RFL++ PAKV LS+MEVVAQSMGFKTHIRN
Sbjct  313  LNAFDLIILSQGLNLAALFDRRQDCDKLQNRFLSRNPAKVILSSMEVVAQSMGFKTHIRN  372

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGL+ADK SH SV++E+F+VAP+ FMV++Q+AAGD++E+  F  N+C  L+D+IW
Sbjct  373  YKMRVEGLNADKTSHLSVMVEVFEVAPSIFMVELQRAAGDTSEYNTFVNNYCSKLDDIIW  432

Query  67   KPPDELCKSRITK  29
            K P E  KSRI +
Sbjct  433  KFPTEKGKSRIPR  445



>gb|KHN26167.1| CBL-interacting serine/threonine-protein kinase 8 [Glycine soja]
Length=403

 Score =   368 bits (944),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 171/256 (67%), Positives = 205/256 (80%), Gaps = 20/256 (8%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILY                    IE+A+FSCP  FPVGAKSLIH +LDPNPE
Sbjct  168  ADVWSCGVILY--------------------IEKAQFSCPPSFPVGAKSLIHTMLDPNPE  207

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RI IE+IRNDEWF+K Y+PV +IEYEDVNLDD+NAAFD+ E++  N+QC N+D GPL L
Sbjct  208  RRITIEQIRNDEWFQKEYVPVSLIEYEDVNLDDVNAAFDNDEDQRTNQQCENDDMGPLTL  267

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAFD+IILS+GLNL+ LFDRGQDS  ++TRF++QKP KV LS+MEVVAQSMGFKTHIRNY
Sbjct  268  NAFDMIILSQGLNLATLFDRGQDSMKYETRFISQKPPKVILSSMEVVAQSMGFKTHIRNY  327

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMR+E +S +K S+FSVILE+F++APTFFMVDIQKAAGD+ E+LKFYKNF  NLED++WK
Sbjct  328  KMRIESISTNKASYFSVILEVFEIAPTFFMVDIQKAAGDAGEYLKFYKNFSSNLEDIMWK  387

Query  64   PPDELCKSRITKAKSK  17
            PP E  K R +K K +
Sbjct  388  PPHETSKLRNSKTKGQ  403



>tpg|DAA52657.1| TPA: LOW QUALITY PROTEIN: putative CBL-interacting protein kinase 
family protein [Zea mays]
Length=566

 Score =   372 bits (955),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 178/253 (70%), Positives = 212/253 (84%), Gaps = 2/253 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            LAD WSCGVILYVL+AGYLPFDEVDLTTLYGKIE AE+S P+WF  GAKSLI +ILDPNP
Sbjct  310  LADTWSCGVILYVLLAGYLPFDEVDLTTLYGKIESAEYSFPAWFSGGAKSLIRRILDPNP  369

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRIRIEEIR+DEWF+K Y P+K IE E+VNLDD+NAAFDD E++  NE    ++ GPL 
Sbjct  370  ETRIRIEEIRSDEWFQKNYEPIKEIENEEVNLDDVNAAFDDPEDD--NEDAFEDETGPLT  427

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDR QD    Q RFL++ PAKV LS+MEVVAQSMGFKTHIRN
Sbjct  428  LNAFDLIILSQGLNLAALFDRRQDCDKLQNRFLSRNPAKVILSSMEVVAQSMGFKTHIRN  487

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGL+ADK SH SV++E+F+VAP+ FMV++Q+AAGD++E+  F  N+CG L+D+IW
Sbjct  488  YKMRVEGLNADKTSHLSVMVEVFEVAPSIFMVELQRAAGDTSEYNTFVNNYCGKLDDIIW  547

Query  67   KPPDELCKSRITK  29
            K P E  KSRI +
Sbjct  548  KFPTEKGKSRIPR  560



>ref|XP_007018317.1| CBL-interacting protein kinase 8 isoform 3 [Theobroma cacao]
 gb|EOY15542.1| CBL-interacting protein kinase 8 isoform 3 [Theobroma cacao]
Length=397

 Score =   365 bits (936),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 192/210 (91%), Gaps = 1/210 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KIERAEFSCPSWFPVGAKSLIH+ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDELDLTTLYSKIERAEFSCPSWFPVGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            +TRI IE+IR+DEWFKKG++PV+++EYED+NLDD+NA FDD EEE  NEQ  NED GPL 
Sbjct  248  QTRITIEQIRSDEWFKKGFVPVRLLEYEDINLDDVNAVFDDPEEERGNEQSGNEDMGPLI  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDRGQDS  +QTRF++QKPA+V LS+MEVVAQSMG+KTHIRN
Sbjct  308  LNAFDLIILSQGLNLATLFDRGQDSMKYQTRFVSQKPARVVLSSMEVVAQSMGYKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIF-QVAPTF  161
            YKMRVEGLSA+K SHFSVILE+F ++ P F
Sbjct  368  YKMRVEGLSANKTSHFSVILEVFLRLLPHF  397



>ref|XP_003569165.1| PREDICTED: CBL-interacting protein kinase 8 [Brachypodium distachyon]
Length=450

 Score =   366 bits (940),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/257 (67%), Positives = 211/257 (82%), Gaps = 2/257 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            LAD WSCGVILYVL+AGYLPFDEVDLTTLYGKIE AE+S P+WFP GAKSLI +ILDP P
Sbjct  196  LADTWSCGVILYVLLAGYLPFDEVDLTTLYGKIESAEYSFPAWFPTGAKSLIRRILDPKP  255

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ++RIRIEEIRNDEWFKK Y PV  +E E+VNLDD+NAAF D EE+   E   +++ GPL 
Sbjct  256  DSRIRIEEIRNDEWFKKNYEPVSEVENEEVNLDDVNAAFLDHEEDT--EHTFDDEAGPLT  313

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDR QD    Q RFL++KPA V LS+MEVVAQSMGFKTHIRN
Sbjct  314  LNAFDLIILSQGLNLASLFDRRQDHGKLQNRFLSRKPANVILSSMEVVAQSMGFKTHIRN  373

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGL+A+K SH +++L+IF+VAP+ FMV++Q+AAGD++E+ KF  N+C  L+D++W
Sbjct  374  YKMRVEGLNANKTSHLTILLQIFEVAPSIFMVELQRAAGDTSEYNKFLNNYCCKLDDIVW  433

Query  67   KPPDELCKSRITKAKSK  17
            K P E  KSR ++   +
Sbjct  434  KFPVEKGKSRTSRLSKR  450



>ref|XP_004971907.1| PREDICTED: CBL-interacting protein kinase 8-like, partial [Setaria 
italica]
Length=519

 Score =   368 bits (945),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/254 (69%), Positives = 211/254 (83%), Gaps = 2/254 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            LAD WSCGVILYVL+AGYLPFDEVDLTTLYGKIE A++S P WF  GAKSLI +ILDPNP
Sbjct  265  LADTWSCGVILYVLLAGYLPFDEVDLTTLYGKIESAQYSFPPWFSGGAKSLIRRILDPNP  324

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            +TRIRIEEIRNDEWF+K Y P+K IE E+VNLDD+NAAFDD EE+   E   +E  GPL 
Sbjct  325  DTRIRIEEIRNDEWFQKNYEPIKDIENEEVNLDDVNAAFDDPEEDT--EDAFDEAAGPLT  382

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDR QD    + RFL+ KPAKV LS+MEVVAQSMGFKTHIRN
Sbjct  383  LNAFDLIILSQGLNLAALFDRRQDYDKLRNRFLSCKPAKVILSSMEVVAQSMGFKTHIRN  442

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGL+A+K SH S+++E+F+VAP+ FMVD+Q+AAGD++E+  F  N+C  L+D+IW
Sbjct  443  YKMRVEGLNANKTSHLSIMVEVFEVAPSIFMVDLQRAAGDTSEYNTFVSNYCSKLDDIIW  502

Query  67   KPPDELCKSRITKA  26
            K P E  KSRI+++
Sbjct  503  KFPMEKGKSRISRS  516



>gb|ACQ83515.1| CBL-interacting protein kinase 08 [Sorghum bicolor]
Length=459

 Score =   365 bits (938),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 175/253 (69%), Positives = 209/253 (83%), Gaps = 2/253 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            LAD WSCGVILYVL+AGYLPFDEVDLTTLYGKIE AE+S P+WF  GAKSLI +ILDPNP
Sbjct  203  LADTWSCGVILYVLLAGYLPFDEVDLTTLYGKIESAEYSFPAWFSGGAKSLIRRILDPNP  262

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            E RIRIEEIRNDEWF+K Y P+K IE E+VNLDD+NAAFDD E++   E    ++ GPL 
Sbjct  263  EKRIRIEEIRNDEWFQKNYEPIKEIENEEVNLDDVNAAFDDPEDDT--EDAFEDEAGPLT  320

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDR QD    Q RFL++ PAKV LS+MEVVAQSMGFKTHIRN
Sbjct  321  LNAFDLIILSQGLNLAALFDRRQDYDKLQNRFLSRNPAKVILSSMEVVAQSMGFKTHIRN  380

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGLSADK S+ SV++E+F+VAP+ FMV++Q+AAGD++E+  F  N+C  L+D+IW
Sbjct  381  YKMRVEGLSADKTSYLSVMVEVFEVAPSIFMVELQRAAGDTSEYNTFVNNYCSKLDDIIW  440

Query  67   KPPDELCKSRITK  29
            K P E  KSR+ +
Sbjct  441  KFPTEKGKSRMPR  453



>ref|XP_006645971.1| PREDICTED: CBL-interacting protein kinase 8-like, partial [Oryza 
brachyantha]
Length=434

 Score =   362 bits (930),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/257 (66%), Positives = 209/257 (81%), Gaps = 2/257 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            LAD WSCGVILYVL+AGYLPFDEVDLTTLYGKIE AE+S P+WFP GAKSLI +ILDPNP
Sbjct  180  LADTWSCGVILYVLLAGYLPFDEVDLTTLYGKIESAEYSFPAWFPSGAKSLIRRILDPNP  239

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            + RIRIE+IRNDEWFKK Y PV+ +  E++NLDD+NAAFDD EE+   E   ++  GPL 
Sbjct  240  DKRIRIEDIRNDEWFKKNYEPVREVTNEEINLDDVNAAFDDPEEDT--EHTYDDKAGPLT  297

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDR QD    Q RFL+ KPA+V +S+MEVVAQSMGFKTHIRN
Sbjct  298  LNAFDLIILSQGLNLAALFDRRQDYDKLQNRFLSCKPARVIMSSMEVVAQSMGFKTHIRN  357

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEGL+ +K SH ++++EIF+VAP+ FMV++Q+AAGD++E+ K   N+C  L+D+IW
Sbjct  358  YKMRVEGLNTNKTSHLTIMIEIFEVAPSIFMVELQRAAGDTSEYNKIINNYCSKLDDIIW  417

Query  67   KPPDELCKSRITKAKSK  17
              P E  KSRI++   +
Sbjct  418  NIPIEKSKSRISRLSKR  434



>ref|XP_010519152.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X2 [Tarenaya hassleriana]
Length=428

 Score =   362 bits (928),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAG+LPFDE+DLTTLY KI+RAEFSCPSWFP+GAKSLIH+ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGFLPFDELDLTTLYSKIDRAEFSCPSWFPLGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            + RI I EIR DEWF+K Y PV++++YE V+LDD+ AAFDD EE+  +    NED GPL 
Sbjct  248  QMRITIAEIRKDEWFRKDYTPVQLLDYEHVDLDDVYAAFDDPEEQRTDGHSGNEDTGPLF  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLI+LS+GLNL+ LFDRG+DS  +QTRF++ KPA V LS+MEVVAQSMGFKTHIRN
Sbjct  308  LNAFDLIVLSQGLNLATLFDRGKDSMKYQTRFVSHKPANVVLSSMEVVAQSMGFKTHIRN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLK  110
            YKMRVEGLS  K SHFSVILE+F+VAP FFMVD+QKA+G+  E+LK
Sbjct  368  YKMRVEGLSMRKTSHFSVILEVFKVAPPFFMVDLQKASGNEDEYLK  413



>dbj|BAJ86807.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=321

 Score =   356 bits (913),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 169/257 (66%), Positives = 210/257 (82%), Gaps = 2/257 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            LAD WSCGVILYVL+AGYLPFDEVDLTTLYGKIE AE+S P+ FP GAKSLI +ILDP+P
Sbjct  67   LADTWSCGVILYVLLAGYLPFDEVDLTTLYGKIESAEYSFPAVFPSGAKSLIRRILDPSP  126

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            +TRIRI+EIR DEWFKK Y PV+ +E E+VNLDD+NAAFDD EE+  +E   +++ GPL 
Sbjct  127  DTRIRIDEIRKDEWFKKNYEPVREVENEEVNLDDVNAAFDDPEED--SEHTFDDEAGPLT  184

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNLS LFDR QD    Q RFL+ KPA V LS+MEVVAQSMGFKTHIRN
Sbjct  185  LNAFDLIILSQGLNLSALFDRRQDYGKLQNRFLSYKPANVILSSMEVVAQSMGFKTHIRN  244

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEG +A+K SH +++L+IF+VAP+ FMV+++++AGD++E+ KF  N+C  L+D+IW
Sbjct  245  YKMRVEGPNANKTSHLTIMLQIFEVAPSIFMVELERSAGDTSEYNKFINNYCSKLDDIIW  304

Query  67   KPPDELCKSRITKAKSK  17
            K   E  KSR ++   +
Sbjct  305  KISAEKGKSRTSRLSKR  321



>dbj|BAK07603.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   357 bits (917),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 169/257 (66%), Positives = 210/257 (82%), Gaps = 2/257 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            LAD WSCGVILYVL+AGYLPFDEVDLTTLYGKIE AE+S P+ FP GAKSLI +ILDP+P
Sbjct  195  LADTWSCGVILYVLLAGYLPFDEVDLTTLYGKIESAEYSFPAVFPSGAKSLIRRILDPSP  254

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            +TRIRI+EIR DEWFKK Y PV+ +E E+VNLDD+NAAFDD EE+  +E   +++ GPL 
Sbjct  255  DTRIRIDEIRKDEWFKKNYEPVREVENEEVNLDDVNAAFDDPEED--SEHTFDDEAGPLT  312

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNLS LFDR QD    Q RFL+ KPA V LS+MEVVAQSMGFKTHIRN
Sbjct  313  LNAFDLIILSQGLNLSALFDRRQDYGKLQNRFLSYKPANVILSSMEVVAQSMGFKTHIRN  372

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEG +A+K SH +++L+IF+VAP+ FMV+++++AGD++E+ KF  N+C  L+D+IW
Sbjct  373  YKMRVEGPNANKTSHLTIMLQIFEVAPSIFMVELERSAGDTSEYNKFINNYCSKLDDIIW  432

Query  67   KPPDELCKSRITKAKSK  17
            K   E  KSR ++   +
Sbjct  433  KISAEKGKSRTSRLSKR  449



>gb|AJR22392.1| CBL-interacting protein kinase 8 [Triticum aestivum]
Length=449

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/253 (66%), Positives = 208/253 (82%), Gaps = 2/253 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            LAD WSCGVILYVL+AGYLPFDEVDLTTLYGKIE AE+S P+ FP GAKSLI +ILDP+P
Sbjct  195  LADTWSCGVILYVLLAGYLPFDEVDLTTLYGKIESAEYSFPAVFPSGAKSLIRRILDPSP  254

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            +TRIRI+EIR DEWFKK Y P + +E E+VNLDD+NAAFDD EE+  NE   +++ GPL 
Sbjct  255  DTRIRIKEIRKDEWFKKNYEPAREVENEEVNLDDVNAAFDDPEED--NEHTFDDEAGPLT  312

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNLS LFDR QD    Q RFL++KPA V LS+MEVVAQSMG KTHIRN
Sbjct  313  LNAFDLIILSQGLNLSALFDRRQDYGKLQNRFLSRKPANVILSSMEVVAQSMGLKTHIRN  372

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMRVEG +A+K SH +++L+IF+VAP+ FMV+++++AG+++E+ KF  N+C  L+D+IW
Sbjct  373  YKMRVEGPNANKTSHLTIMLQIFEVAPSIFMVELERSAGETSEYNKFVNNYCSKLDDIIW  432

Query  67   KPPDELCKSRITK  29
            K   E  KSR ++
Sbjct  433  KVSAEKGKSRTSR  445



>ref|XP_006842063.1| PREDICTED: CBL-interacting protein kinase 24 isoform X2 [Amborella 
trichopoda]
 gb|ERN03738.1| hypothetical protein AMTR_s00078p00042970 [Amborella trichopoda]
Length=442

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 196/249 (79%), Gaps = 1/249 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGY PFDE DL  LY KI  A+FSCPSWF  GA+SLIH+ILDP+PE
Sbjct  187  ADVWSCGVILYVLMAGYRPFDETDLANLYRKINVADFSCPSWFSAGARSLIHRILDPDPE  246

Query  604  TRIRIEEIRNDEWFKKGYIPVKII-EYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            +RI I+ IRND WF+K Y+PV+   EYEDVNLDD++A F+D E++  +EQ  + D GPL 
Sbjct  247  SRITIQAIRNDPWFRKNYVPVRHGGEYEDVNLDDVHAVFNDIEDQYVSEQKEDNDMGPLI  306

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            +NAF++I LS+GLNLS LFDR QD    QTRF+++KPAKV +STME VA+ MG K H RN
Sbjct  307  MNAFEMITLSQGLNLSALFDRRQDYVKRQTRFVSRKPAKVIISTMEAVAEYMGLKVHSRN  366

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMR+EG+SA+    F+V LE+F+VAP+ FMVD++KAAGD+ E+ KFYKNFC  +E +IW
Sbjct  367  YKMRLEGISANNTGQFAVALEVFEVAPSLFMVDVRKAAGDTLEYHKFYKNFCSKIEHIIW  426

Query  67   KPPDELCKS  41
            KP D   KS
Sbjct  427  KPSDSTTKS  435



>ref|XP_004287304.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Fragaria vesca subsp. vesca]
Length=448

 Score =   345 bits (884),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 157/255 (62%), Positives = 197/255 (77%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPFDE +L  LY KI  AEFSCP WF  GA SLIHKILDPNP+
Sbjct  193  ADVWSCGVILYVLMAGYLPFDEANLAALYKKINAAEFSCPFWFSPGANSLIHKILDPNPK  252

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TR RIEEIR D WF+K Y PV+  E E+V+LDD+ A F+D E++   E+ +N+D GPL +
Sbjct  253  TRFRIEEIRKDPWFRKNYAPVEYREDEEVSLDDVRAVFEDIEDQYAEERTDNKDSGPLLM  312

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPAKV +S +E VA+SM  K H RN+
Sbjct  313  NAFEMITLSQGLNLSALFDRRQDYIKRQTRFVSRKPAKVIISNVEAVAESMSLKVHTRNF  372

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA+K   F+V+LEIF+VAP+ FMVD++KAAGD+ E+ KFYKNFC  L+D+IWK
Sbjct  373  KTRLEGISANKAGQFAVVLEIFEVAPSLFMVDVRKAAGDTLEYHKFYKNFCAKLDDIIWK  432

Query  64   PPDELCKSRITKAKS  20
            P D +  S I +  +
Sbjct  433  PKDGMASSNILRTTT  447



>tpg|DAA59081.1| TPA: putative CBL-interacting protein kinase family protein [Zea 
mays]
Length=434

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/224 (73%), Positives = 193/224 (86%), Gaps = 2/224 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            LAD WSCGVILYVL+AGYLPFDEVDLTTLYGKIE AE+S P+WF  GAKSLI +ILDPNP
Sbjct  195  LADTWSCGVILYVLLAGYLPFDEVDLTTLYGKIESAEYSFPAWFSGGAKSLIRRILDPNP  254

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRIRIEEIR+DEWF+K Y P+K IE E+VNLDD+NAAFDD E++  NE    ++ GPL 
Sbjct  255  ETRIRIEEIRSDEWFQKNYEPIKEIENEEVNLDDVNAAFDDPEDD--NEDAFEDETGPLT  312

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDR QD    Q RFL++ PAKV LS+MEVVAQSMGFKTHIRN
Sbjct  313  LNAFDLIILSQGLNLAALFDRRQDCDKLQNRFLSRNPAKVILSSMEVVAQSMGFKTHIRN  372

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEF  116
            YKMRVEGL+ADK SH SV++E+F+VAP+ FMV++Q+AAGD++E+
Sbjct  373  YKMRVEGLNADKTSHLSVMVEVFEVAPSIFMVELQRAAGDTSEY  416



>ref|NP_001268145.1| CBL-interacting protein kinase 09 [Vitis vinifera]
 emb|CAN83760.1| hypothetical protein VITISV_043742 [Vitis vinifera]
 gb|ACQ83525.1| CBL-interacting protein kinase 09 [Vitis vinifera]
Length=446

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 155/253 (61%), Positives = 198/253 (78%), Gaps = 0/253 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPF+E+DL +LY KI  AEFSCP WF  G+KS + +ILDPNP+
Sbjct  191  ADVWSCGVILYVLMAGYLPFNEIDLPSLYKKINAAEFSCPFWFSSGSKSFLCRILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRIRIE I+ND WF+K Y+  K  E E+VNLDDI+A FDD EE   +EQ  N D GPL +
Sbjct  251  TRIRIEGIKNDPWFRKNYVSSKCREDEEVNLDDIHAVFDDIEENYVSEQSGNNDTGPLIM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++PAKV +ST+E VA+SM FK H R+Y
Sbjct  311  NAFEMITLSQGLNLSALFDRRQDYVKRQTRFVSREPAKVIISTIEAVAESMNFKVHTRHY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA+K + F+V+LE+F+VAP+ FMVD++KAAGD+ E+ KFYKNFC  LE +IWK
Sbjct  371  KTRLEGISANKTAQFAVVLEVFEVAPSLFMVDVRKAAGDTLEYHKFYKNFCAKLEHIIWK  430

Query  64   PPDELCKSRITKA  26
            P + +  S + + 
Sbjct  431  PKEAMTNSSLLRT  443



>gb|KJB58804.1| hypothetical protein B456_009G226900 [Gossypium raimondii]
Length=428

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 184/206 (89%), Gaps = 3/206 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KIERAEFSCPSWFP+GAKSLIH+ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDELDLTTLYSKIERAEFSCPSWFPMGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTE---EEVPNEQCNNEDFG  437
            +TRI IE+IR+DEWFKK Y+P +++EYED+NLDD+NA FDD E   EE  +E   NE+ G
Sbjct  248  QTRITIEQIRSDEWFKKSYVPARLLEYEDINLDDVNAVFDDPEIDKEERGDEPSRNENMG  307

Query  436  PLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTH  257
            PL LNAFDLIILS+GLNL+ LFDRG+D+  HQTRF+++KPA+V LS+MEVVAQSMG+KTH
Sbjct  308  PLNLNAFDLIILSQGLNLATLFDRGKDTMKHQTRFVSRKPARVVLSSMEVVAQSMGYKTH  367

Query  256  IRNYKMRVEGLSADKISHFSVILEIF  179
            IRNYKMRVEGLSA+K SHFSVILE+ 
Sbjct  368  IRNYKMRVEGLSANKTSHFSVILELL  393



>gb|KJB64073.1| hypothetical protein B456_010G032200 [Gossypium raimondii]
Length=421

 Score =   342 bits (876),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 187/216 (87%), Gaps = 7/216 (3%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE+DLTTLY KIERA+FSCPSWFPVGAKSLIH+ILDPNP
Sbjct  188  VADVWSCGVILYVLMAGYLPFDELDLTTLYSKIERADFSCPSWFPVGAKSLIHRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTE---EEVPNEQCNNEDFG  437
            +TRI IE+IR+DEWF KGY+PV+++EYED+NLD++NA FDD E   EE  NE   NED G
Sbjct  248  QTRITIEQIRSDEWFNKGYVPVRLLEYEDINLDEVNAVFDDPEVDTEERGNEPSGNEDMG  307

Query  436  PLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTH  257
            PL+LNAFDLIILS+GLNL+ LFDRG+D+  +QTRF++QKPA+V LS+MEVVAQSMG+KTH
Sbjct  308  PLSLNAFDLIILSQGLNLATLFDRGKDNMKYQTRFVSQKPARVVLSSMEVVAQSMGYKTH  367

Query  256  IRNYKMRVEGLSADKISHFSVILEIFQV----APTF  161
            IRNYKMRVEG SA+K SH SVILE+        PTF
Sbjct  368  IRNYKMRVEGPSANKNSHLSVILEVGSTPADSTPTF  403



>ref|XP_010656044.1| PREDICTED: CBL-interacting protein kinase 09 isoform X1 [Vitis 
vinifera]
 ref|XP_010656045.1| PREDICTED: CBL-interacting protein kinase 09 isoform X1 [Vitis 
vinifera]
 ref|XP_010656046.1| PREDICTED: CBL-interacting protein kinase 09 isoform X1 [Vitis 
vinifera]
 emb|CBI28210.3| unnamed protein product [Vitis vinifera]
Length=446

 Score =   342 bits (877),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 155/253 (61%), Positives = 198/253 (78%), Gaps = 0/253 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPF+E+DL +LY KI  AEFSCP WF  G+KSL+ +ILD NP+
Sbjct  191  ADVWSCGVILYVLMAGYLPFNEIDLPSLYKKINAAEFSCPFWFSSGSKSLLCRILDSNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRIRIE I+ND WF+K Y+  K  E E+VNLDDI+A FDD EE   +EQ  N D GPL +
Sbjct  251  TRIRIEGIKNDPWFRKNYVSSKCREDEEVNLDDIHAVFDDIEENYVSEQSGNNDTGPLIM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++PAKV +ST+E VA+SM FK H R+Y
Sbjct  311  NAFEMITLSQGLNLSALFDRRQDYVKRQTRFVSREPAKVIISTIEAVAESMNFKVHTRHY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA+K + F+V+LE+F+VAP+ FMVD++KAAGD+ E+ KFYKNFC  LE +IWK
Sbjct  371  KTRLEGISANKTAQFAVVLEVFEVAPSLFMVDVRKAAGDTLEYHKFYKNFCAKLEHIIWK  430

Query  64   PPDELCKSRITKA  26
            P + +  S + + 
Sbjct  431  PKEAMTNSSLLRT  443



>ref|XP_011622468.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Amborella trichopoda]
 ref|XP_011622469.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Amborella trichopoda]
Length=449

 Score =   341 bits (875),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/256 (62%), Positives = 196/256 (77%), Gaps = 8/256 (3%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGY PFDE DL  LY KI  A+FSCPSWF  GA+SLIH+ILDP+PE
Sbjct  187  ADVWSCGVILYVLMAGYRPFDETDLANLYRKINVADFSCPSWFSAGARSLIHRILDPDPE  246

Query  604  TRIRIEEIRNDEWFKKGYIPVKI-IEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            +RI I+ IRND WF+K Y+PV+   EYEDVNLDD++A F+D E++  +EQ  + D GPL 
Sbjct  247  SRITIQAIRNDPWFRKNYVPVRHGGEYEDVNLDDVHAVFNDIEDQYVSEQKEDNDMGPLI  306

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            +NAF++I LS+GLNLS LFDR QD    QTRF+++KPAKV +STME VA+ MG K H RN
Sbjct  307  MNAFEMITLSQGLNLSALFDRRQDYVKRQTRFVSRKPAKVIISTMEAVAEYMGLKVHSRN  366

Query  247  YK-------MRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCG  89
            YK       MR+EG+SA+    F+V LE+F+VAP+ FMVD++KAAGD+ E+ KFYKNFC 
Sbjct  367  YKLASHGLQMRLEGISANNTGQFAVALEVFEVAPSLFMVDVRKAAGDTLEYHKFYKNFCS  426

Query  88   NLEDLIWKPPDELCKS  41
             +E +IWKP D   KS
Sbjct  427  KIEHIIWKPSDSTTKS  442



>ref|XP_009791398.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Nicotiana sylvestris]
 ref|XP_009791399.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Nicotiana sylvestris]
 ref|XP_009791400.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Nicotiana sylvestris]
Length=446

 Score =   339 bits (869),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 195/256 (76%), Gaps = 0/256 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGV+LYVLMAGYLPFDE DL TLY KI  AEFSCP WF +GA SLI KI+DPNP 
Sbjct  191  ADVWSCGVVLYVLMAGYLPFDEADLHTLYTKINAAEFSCPFWFSLGATSLIRKIIDPNPR  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+IE IR D WF+K Y+PV+    E VNLDD+ A FDD E+   +E+  N D GPL +
Sbjct  251  TRIKIEGIRRDPWFRKNYVPVRAKADEVVNLDDVRAVFDDIEDAFVSEKSENSDSGPLVM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++PAKV ++T+E  A+S+G K H RNY
Sbjct  311  NAFEMITLSQGLNLSALFDRRQDYVKRQTRFVSRQPAKVIITTIEAAAESLGLKVHTRNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG++A+K   F+V++E+FQVAP+ FMVD +KAAGD+ E+ KFYK FC  ++D+IWK
Sbjct  371  KTRIEGVTANKAGQFAVVMEVFQVAPSLFMVDARKAAGDTLEYHKFYKTFCTKIDDIIWK  430

Query  64   PPDELCKSRITKAKSK  17
            P D + K+ + +  ++
Sbjct  431  PKDGMSKAALLRTMTR  446



>gb|KEH28132.1| CBL-interacting kinase [Medicago truncatula]
Length=407

 Score =   335 bits (860),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 159/258 (62%), Positives = 190/258 (74%), Gaps = 39/258 (15%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPFDE+DLTTLY KI++A+FSCP+WFPVGAKSLI +ILDPNPE
Sbjct  189  ADVWSCGVILYVLMAGYLPFDELDLTTLYSKIDKADFSCPAWFPVGAKSLIQRILDPNPE  248

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RI IE+IRNDEWF+K Y+PV ++EYEDVNLD+INAAFD  E+E  N QC   D GPL L
Sbjct  249  HRITIEQIRNDEWFQKSYVPVHLLEYEDVNLDEINAAFDSAEDEGDNPQCEIADTGPLIL  308

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAFD+I+LS+GLNL+ +FDRGQ                                      
Sbjct  309  NAFDMIMLSQGLNLATIFDRGQ--------------------------------------  330

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
             MR+EG+SA K +HFSVILE+F+VAPTFFMVDIQKAAGD++E+LKFYKNF  NLED+IWK
Sbjct  331  -MRIEGISAKKTTHFSVILEVFEVAPTFFMVDIQKAAGDASEYLKFYKNFSSNLEDIIWK  389

Query  64   PPDELCKSRITKAKSKKR  11
             P E  K + +K +SK+ 
Sbjct  390  SPHETSKLKTSKTRSKRH  407



>ref|XP_006475856.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X1 [Citrus sinensis]
 gb|KDO80229.1| hypothetical protein CISIN_1g013421mg [Citrus sinensis]
Length=443

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/243 (63%), Positives = 190/243 (78%), Gaps = 0/243 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVIL+VLMAGYLPF E DL TLY KI  AEFSCP WF  GA SLIHKILDPNP+
Sbjct  191  ADVWSCGVILFVLMAGYLPFGETDLPTLYKKINAAEFSCPFWFSTGATSLIHKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRIRIE IR   WF+K Y PVK  E E+VNLDD++A FDD E++   EQ  N+  GPL +
Sbjct  251  TRIRIEGIRKHPWFRKNYNPVKCSEEEEVNLDDVHAVFDDIEDQYVAEQSENKVGGPLLM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNL+ LFDR QD    QTRF++++PA+V LS +E VA+S+  K H RNY
Sbjct  311  NAFEMITLSQGLNLAALFDRRQDYVKRQTRFVSRQPAQVILSNIEAVAESLSLKVHTRNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA+K   F+V+LE+F+VAP+ FMVD++KAAGD+ E+ KFYKNFC  LE++IWK
Sbjct  371  KTRLEGVSANKTGQFAVVLEVFEVAPSLFMVDVRKAAGDTLEYHKFYKNFCAKLENIIWK  430

Query  64   PPD  56
            P +
Sbjct  431  PTE  433



>ref|XP_006475857.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X2 [Citrus sinensis]
 gb|KDO80233.1| hypothetical protein CISIN_1g013421mg [Citrus sinensis]
Length=381

 Score =   333 bits (855),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/243 (63%), Positives = 190/243 (78%), Gaps = 0/243 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVIL+VLMAGYLPF E DL TLY KI  AEFSCP WF  GA SLIHKILDPNP+
Sbjct  129  ADVWSCGVILFVLMAGYLPFGETDLPTLYKKINAAEFSCPFWFSTGATSLIHKILDPNPK  188

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRIRIE IR   WF+K Y PVK  E E+VNLDD++A FDD E++   EQ  N+  GPL +
Sbjct  189  TRIRIEGIRKHPWFRKNYNPVKCSEEEEVNLDDVHAVFDDIEDQYVAEQSENKVGGPLLM  248

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNL+ LFDR QD    QTRF++++PA+V LS +E VA+S+  K H RNY
Sbjct  249  NAFEMITLSQGLNLAALFDRRQDYVKRQTRFVSRQPAQVILSNIEAVAESLSLKVHTRNY  308

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA+K   F+V+LE+F+VAP+ FMVD++KAAGD+ E+ KFYKNFC  LE++IWK
Sbjct  309  KTRLEGVSANKTGQFAVVLEVFEVAPSLFMVDVRKAAGDTLEYHKFYKNFCAKLENIIWK  368

Query  64   PPD  56
            P +
Sbjct  369  PTE  371



>ref|XP_007013469.1| Salt overly sensitive protein 2a isoform 1 [Theobroma cacao]
 ref|XP_007013470.1| Salt overly sensitive protein 2a isoform 1 [Theobroma cacao]
 ref|XP_007013471.1| Salt overly sensitive protein 2a isoform 1 [Theobroma cacao]
 gb|EOY31088.1| Salt overly sensitive protein 2a isoform 1 [Theobroma cacao]
 gb|EOY31089.1| Salt overly sensitive protein 2a isoform 1 [Theobroma cacao]
 gb|EOY31090.1| Salt overly sensitive protein 2a isoform 1 [Theobroma cacao]
Length=445

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 151/252 (60%), Positives = 201/252 (80%), Gaps = 1/252 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGV+L+V+MAGYLPFDE+DL TLY K+  A+FS P WF  GAKSL+ KILDPNP+
Sbjct  191  ADVWSCGVVLFVIMAGYLPFDEIDLPTLYKKVNAAQFSFPFWFSPGAKSLVQKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+IE I+ND WF+K Y+PV+  E E+VNLDD+ A FDD E++  +EQ   ++ GPL +
Sbjct  251  TRIKIEGIKNDPWFQKHYVPVRPRE-EEVNLDDVRAVFDDIEDQYVSEQSVVDEGGPLIM  309

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPA+V +S++E VA+SMG K H RNY
Sbjct  310  NAFEMITLSQGLNLSALFDRQQDYVKRQTRFVSRKPARVIISSVEAVAESMGLKVHTRNY  369

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA+K+  F+V+LE+F+VAP+ FMVD++KAAGD+ E+ KFYKNFC  LE++IWK
Sbjct  370  KARLEGISANKVGQFAVVLEVFEVAPSLFMVDVRKAAGDTLEYHKFYKNFCAKLENIIWK  429

Query  64   PPDELCKSRITK  29
            P + L  S + +
Sbjct  430  PTEGLANSSLLR  441



>gb|AHW50679.1| calcineurin B-like interacting protein kinase [Nicotiana tabacum]
Length=446

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 193/256 (75%), Gaps = 0/256 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGV+LYVLMAGYLPFDE DL TLY KI  AEFSCP WF  GA SLI KI+DPNP 
Sbjct  191  ADVWSCGVVLYVLMAGYLPFDEADLHTLYTKINAAEFSCPFWFSPGATSLIRKIIDPNPR  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+IE IR D WF+K Y+PV+    E VNLDD+ A FDD E+   +E+  N D GP  +
Sbjct  251  TRIKIEGIRRDPWFRKNYMPVRAKADEVVNLDDVRAVFDDIEDAFVSEKSENSDSGPFVM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++PAKV ++T+E  A+S+G K H RNY
Sbjct  311  NAFEMITLSQGLNLSALFDRRQDYVKRQTRFVSRQPAKVIITTIEAAAESLGLKVHTRNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG++A+K   F+V++E+FQVAP+ FMVD +KAAGD+ E+ KFYK FC  ++D+IWK
Sbjct  371  KTRIEGVTANKAGQFAVVMEVFQVAPSLFMVDARKAAGDTLEYHKFYKTFCTKIDDIIWK  430

Query  64   PPDELCKSRITKAKSK  17
            P D + K+ + +  ++
Sbjct  431  PKDGMSKAALLRTMTR  446



>ref|XP_002524508.1| CBL-interacting serine/threonine-protein kinase, putative [Ricinus 
communis]
 gb|EEF37948.1| CBL-interacting serine/threonine-protein kinase, putative [Ricinus 
communis]
Length=449

 Score =   334 bits (857),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 153/243 (63%), Positives = 192/243 (79%), Gaps = 0/243 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPFDEVDL TLY KI  AE+S P WF  GAKSLI KILDPNP+
Sbjct  194  ADVWSCGVILYVLMAGYLPFDEVDLPTLYRKINAAEYSSPFWFSPGAKSLIDKILDPNPK  253

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+IE I+   WF+K Y+PVK  E E+VNLDD++A F D E++   EQ  N + GPL +
Sbjct  254  TRIKIEGIKKHLWFRKNYMPVKQSEEEEVNLDDVHAVFGDIEDQYVAEQTENSEGGPLIM  313

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++PAK  +ST+E VA+SM  K H RNY
Sbjct  314  NAFEMITLSQGLNLSALFDRQQDYIKRQTRFVSRRPAKDIISTIEAVAESMSLKVHTRNY  373

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA+K  HF+V+LE+F+VAP+ FMVD++KA+GD+ E+ KFYK+FC  LED+IW+
Sbjct  374  KTRLEGISANKAGHFAVVLEVFEVAPSLFMVDVRKASGDTLEYHKFYKDFCSKLEDIIWR  433

Query  64   PPD  56
            P D
Sbjct  434  PAD  436



>ref|XP_010250123.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Nelumbo nucifera]
 ref|XP_010250124.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Nelumbo nucifera]
Length=444

 Score =   333 bits (854),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/252 (60%), Positives = 194/252 (77%), Gaps = 0/252 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPFDE+DL  LY KI  A+FSCP WF  GA +LI KILDPNP+
Sbjct  189  ADIWSCGVILYVLMAGYLPFDEIDLPMLYKKINAADFSCPPWFSPGAMALIRKILDPNPK  248

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            +RIRIE I+ND WF+K Y+ V+  E E VNLDD+ A FDD E++  +EQ  + D GPL +
Sbjct  249  SRIRIEGIKNDPWFRKNYVTVRHGEDEVVNLDDVRAVFDDIEDQFVSEQSQHGDRGPLIM  308

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++PA+V  ST+E VA+SMG K H RNY
Sbjct  309  NAFEMITLSQGLNLSALFDRRQDYVKRQTRFVSRQPARVITSTVEAVAESMGLKVHSRNY  368

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMR+EG+SA+K   F+V LE+F+VAP+ FMVD++KA+GD+ E+ KFYK FC  LE +IWK
Sbjct  369  KMRLEGISANKAGQFAVALEVFEVAPSLFMVDVRKASGDTLEYHKFYKTFCSKLEHIIWK  428

Query  64   PPDELCKSRITK  29
            P +   KS + +
Sbjct  429  PTEGTAKSGMLR  440



>ref|XP_010907282.1| PREDICTED: CBL-interacting protein kinase 24 isoform X1 [Elaeis 
guineensis]
Length=439

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 148/249 (59%), Positives = 192/249 (77%), Gaps = 0/249 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE DL TLY KI  AEFSCP WF  GAK LIHKILDP+P
Sbjct  188  VADVWSCGVILYVLMAGYLPFDETDLPTLYRKINTAEFSCPPWFSSGAKLLIHKILDPSP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ++RI IE I+ND WF++ Y+PV+  E E VNL+D+ A F+D E+    EQ   +D GPL 
Sbjct  248  KSRIHIEGIKNDPWFRRNYVPVRHGEEEKVNLEDVQAVFNDIEDHYVTEQVETKDGGPLI  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            +NAF++I LS+GL+LS LFDR QD    QTRF+++ PA+  ++T+E VAQSMG K H +N
Sbjct  308  MNAFEMITLSQGLDLSALFDRRQDCVKRQTRFVSRHPARTIIATIEAVAQSMGLKVHSQN  367

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMR+EG+S++K+  F+V+LE+F+VAP+ FMVD++K AGD+ E+ KFYK  CG LE +IW
Sbjct  368  YKMRLEGVSSNKMGQFTVVLEVFEVAPSLFMVDVRKVAGDTLEYHKFYKILCGKLEHIIW  427

Query  67   KPPDELCKS  41
            +P +   KS
Sbjct  428  RPAEAAAKS  436



>ref|XP_009607233.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X3 [Nicotiana tomentosiformis]
Length=396

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 147/256 (57%), Positives = 192/256 (75%), Gaps = 0/256 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGV+LYVLMAGYLPFDE DL TLY KI  AEFSCP WF  GA SLI KI+DPNP 
Sbjct  141  ADVWSCGVVLYVLMAGYLPFDEADLHTLYTKINAAEFSCPFWFSPGATSLIRKIIDPNPR  200

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+IE IR D WF+K Y+PV+    E VNLDD+ A FDD E+   +E+  N D GP  +
Sbjct  201  TRIKIEGIRRDPWFRKNYMPVRAKADEVVNLDDVRAVFDDIEDAFVSEKSENSDSGPFVM  260

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++PAKV ++T+E  A+S+G K H RNY
Sbjct  261  NAFEMITLSQGLNLSALFDRRQDYVKRQTRFVSRQPAKVIIATIEAAAESLGLKVHTRNY  320

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG++A+K   F+V++E+FQV P+ FMVD++KAAGD+ E+ KFYK FC  ++D+IWK
Sbjct  321  KTRIEGVTANKAGQFAVVMEVFQVVPSLFMVDVRKAAGDTLEYHKFYKTFCTKIDDIIWK  380

Query  64   PPDELCKSRITKAKSK  17
              D + K+ + +  ++
Sbjct  381  SQDGMSKAALLRTMTR  396



>ref|XP_010907285.1| PREDICTED: CBL-interacting protein kinase 24 isoform X4 [Elaeis 
guineensis]
Length=391

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 148/249 (59%), Positives = 192/249 (77%), Gaps = 0/249 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE DL TLY KI  AEFSCP WF  GAK LIHKILDP+P
Sbjct  140  VADVWSCGVILYVLMAGYLPFDETDLPTLYRKINTAEFSCPPWFSSGAKLLIHKILDPSP  199

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ++RI IE I+ND WF++ Y+PV+  E E VNL+D+ A F+D E+    EQ   +D GPL 
Sbjct  200  KSRIHIEGIKNDPWFRRNYVPVRHGEEEKVNLEDVQAVFNDIEDHYVTEQVETKDGGPLI  259

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            +NAF++I LS+GL+LS LFDR QD    QTRF+++ PA+  ++T+E VAQSMG K H +N
Sbjct  260  MNAFEMITLSQGLDLSALFDRRQDCVKRQTRFVSRHPARTIIATIEAVAQSMGLKVHSQN  319

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMR+EG+S++K+  F+V+LE+F+VAP+ FMVD++K AGD+ E+ KFYK  CG LE +IW
Sbjct  320  YKMRLEGVSSNKMGQFTVVLEVFEVAPSLFMVDVRKVAGDTLEYHKFYKILCGKLEHIIW  379

Query  67   KPPDELCKS  41
            +P +   KS
Sbjct  380  RPAEAAAKS  388



>ref|XP_009607229.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009607230.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009607231.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Nicotiana tomentosiformis]
Length=443

 Score =   332 bits (851),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 147/256 (57%), Positives = 192/256 (75%), Gaps = 0/256 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGV+LYVLMAGYLPFDE DL TLY KI  AEFSCP WF  GA SLI KI+DPNP 
Sbjct  188  ADVWSCGVVLYVLMAGYLPFDEADLHTLYTKINAAEFSCPFWFSPGATSLIRKIIDPNPR  247

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+IE IR D WF+K Y+PV+    E VNLDD+ A FDD E+   +E+  N D GP  +
Sbjct  248  TRIKIEGIRRDPWFRKNYMPVRAKADEVVNLDDVRAVFDDIEDAFVSEKSENSDSGPFVM  307

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++PAKV ++T+E  A+S+G K H RNY
Sbjct  308  NAFEMITLSQGLNLSALFDRRQDYVKRQTRFVSRQPAKVIIATIEAAAESLGLKVHTRNY  367

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG++A+K   F+V++E+FQV P+ FMVD++KAAGD+ E+ KFYK FC  ++D+IWK
Sbjct  368  KTRIEGVTANKAGQFAVVMEVFQVVPSLFMVDVRKAAGDTLEYHKFYKTFCTKIDDIIWK  427

Query  64   PPDELCKSRITKAKSK  17
              D + K+ + +  ++
Sbjct  428  SQDGMSKAALLRTMTR  443



>ref|XP_003549757.1| PREDICTED: CBL-interacting protein kinase 24 isoform 1 [Glycine 
max]
 gb|KHN15082.1| CBL-interacting protein kinase 24 [Glycine soja]
Length=446

 Score =   332 bits (851),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 150/252 (60%), Positives = 194/252 (77%), Gaps = 0/252 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPF+E DL TLY +I  AEF CP WF    KS I KILDPNP+
Sbjct  191  ADVWSCGVILYVLMAGYLPFEEADLPTLYRRINAAEFVCPFWFSADTKSFIQKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TR++IEEIR D WFKK Y PVK+ E E VNLDD+ A FDD E++  +E+    + GPL +
Sbjct  251  TRVKIEEIRKDPWFKKNYFPVKLGEDEQVNLDDVRAVFDDIEDQYVSERSEITEGGPLIM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPAKV +S++E VA+SMG K H RNY
Sbjct  311  NAFEMIALSQGLNLSPLFDRHQDYVKRQTRFVSRKPAKVIISSIEAVAESMGLKVHSRNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K+R+EG+SA+++  F+V+LE+F+VAP+ FMVD++KA GD+ ++ KFYKNFCG L ++IW+
Sbjct  371  KVRLEGVSANRVGQFAVVLEVFEVAPSLFMVDVRKATGDTFDYHKFYKNFCGKLGNIIWR  430

Query  64   PPDELCKSRITK  29
            P   +  S + K
Sbjct  431  PAGTMPNSNLRK  442



>ref|XP_007155013.1| hypothetical protein PHAVU_003G165700g [Phaseolus vulgaris]
 gb|ESW27007.1| hypothetical protein PHAVU_003G165700g [Phaseolus vulgaris]
Length=452

 Score =   332 bits (851),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 153/252 (61%), Positives = 192/252 (76%), Gaps = 0/252 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWS GVILYVLMAG+LPF+E DL TLY +I  AE+ CP WF    KS IHKILDPNPE
Sbjct  197  ADVWSSGVILYVLMAGHLPFEEPDLPTLYRRINAAEYVCPFWFSAETKSFIHKILDPNPE  256

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TR++IEEIR D WF+K YIPVK+ EYE VNLDD+ A FDD E++   EQ    + GPL +
Sbjct  257  TRLKIEEIRKDPWFQKNYIPVKLGEYEQVNLDDVRAVFDDIEDQYVAEQSEITEGGPLIM  316

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPAKV +S++E VA+SMG K H RNY
Sbjct  317  NAFEMIALSQGLNLSPLFDRHQDYVKRQTRFVSRKPAKVIISSIEAVAESMGLKVHSRNY  376

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K+R+EG SA+K+  F+V+LE+F+VAP+ FMVDI+KAAGD+ ++ KFYKNFC  L  +IW+
Sbjct  377  KVRLEGFSANKVGQFAVVLEVFEVAPSLFMVDIRKAAGDTFDYHKFYKNFCTKLGSIIWR  436

Query  64   PPDELCKSRITK  29
            P   +  S   K
Sbjct  437  PAGTMPNSNTLK  448



>emb|CDL67726.1| Ser/Thr protein kinase [Arachis hypogaea]
Length=446

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 145/241 (60%), Positives = 190/241 (79%), Gaps = 0/241 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPF+E DL  LY  I  AEF CP WF  GAK+LI KILDPNP+
Sbjct  191  ADVWSCGVILYVLMAGYLPFEEADLPALYNGINAAEFVCPFWFSAGAKTLIQKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TR++IEEIR D WF++ Y+PV++ E  +VNLDD+ A FDD E++  +E+  + + GPL +
Sbjct  251  TRMKIEEIRKDPWFRRNYVPVRLSEDVEVNLDDVQAVFDDIEDKYVSEKSESTEGGPLIM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPA+V +S +E   +SMG K H RNY
Sbjct  311  NAFEMITLSQGLNLSPLFDRRQDYVKRQTRFVSRKPARVIISYIEAATESMGLKVHSRNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMR+EG++A+ ++ F+V+LE+F+VAP+ FMVD+QKAAGD+ E+ KFYKN CG LE +IW+
Sbjct  371  KMRLEGVAANNVAQFAVVLEVFEVAPSLFMVDVQKAAGDTLEYHKFYKNLCGKLESIIWR  430

Query  64   P  62
            P
Sbjct  431  P  431



>emb|CDP10420.1| unnamed protein product [Coffea canephora]
Length=294

 Score =   325 bits (832),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 147/257 (57%), Positives = 192/257 (75%), Gaps = 0/257 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVL AGYLPFDE DL TLY KI  AEFSCP WF  G  +L+ KILDPNPE
Sbjct  28   ADLWSCGVILYVLTAGYLPFDERDLPTLYQKINAAEFSCPCWFSPGVAALLLKILDPNPE  87

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+I+ IR D WF+K Y+ V+  E E VNLDD++A FDD E+    EQ  N+D GPL +
Sbjct  88   TRIKIDGIRRDRWFRKNYVAVRHKEDEAVNLDDVDAVFDDIEDHYVKEQSENKDSGPLLM  147

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLSVLFDR QD    QTRF++++PAKV ++T+E   +S G K H RNY
Sbjct  148  NAFEMITLSQGLNLSVLFDRQQDYVKRQTRFVSRQPAKVIIATIEAAGESFGLKVHTRNY  207

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA+K   F+V+LE+F+VAP+ FMVD++KAAGD+ E+ KFYKNFC  L+ +IWK
Sbjct  208  KTRLEGVSANKAGQFAVVLEVFEVAPSLFMVDVRKAAGDTLEYHKFYKNFCAKLDHIIWK  267

Query  64   PPDELCKSRITKAKSKK  14
              + +  + +    +++
Sbjct  268  TKEGVSDTALLGTTTRR  284



>gb|KDO80230.1| hypothetical protein CISIN_1g013421mg [Citrus sinensis]
Length=441

 Score =   330 bits (845),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/243 (63%), Positives = 188/243 (77%), Gaps = 2/243 (1%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVIL+VLMAGYLPF E DL TLY KI  AEFSCP WF  GA SLIHKILDPNP+
Sbjct  191  ADVWSCGVILFVLMAGYLPFGETDLPTLYKKINAAEFSCPFWFSTGATSLIHKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRIRIE IR   WF+K Y PVK  E E+VNLDD++A FDD E     EQ  N+  GPL +
Sbjct  251  TRIRIEGIRKHPWFRKNYNPVKCSEEEEVNLDDVHAVFDDIE--YVAEQSENKVGGPLLM  308

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNL+ LFDR QD    QTRF++++PA+V LS +E VA+S+  K H RNY
Sbjct  309  NAFEMITLSQGLNLAALFDRRQDYVKRQTRFVSRQPAQVILSNIEAVAESLSLKVHTRNY  368

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA+K   F+V+LE+F+VAP+ FMVD++KAAGD+ E+ KFYKNFC  LE++IWK
Sbjct  369  KTRLEGVSANKTGQFAVVLEVFEVAPSLFMVDVRKAAGDTLEYHKFYKNFCAKLENIIWK  428

Query  64   PPD  56
            P +
Sbjct  429  PTE  431



>ref|XP_010924073.1| PREDICTED: CBL-interacting protein kinase 8 isoform X3 [Elaeis 
guineensis]
Length=412

 Score =   328 bits (840),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 160/257 (62%), Positives = 189/257 (74%), Gaps = 32/257 (12%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVILYVLMAGYLPFDEVDLTTLY K                            
Sbjct  188  IADIWSCGVILYVLMAGYLPFDEVDLTTLYTK----------------------------  219

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
              RIRIEEIR +EWF+K Y+PV+ +E EDVNLDD+ A FDD E+   +EQ  NE  GPL 
Sbjct  220  --RIRIEEIRCNEWFRKNYVPVRPVENEDVNLDDVYAVFDDPEQ--ASEQSRNEGLGPLI  275

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNLS LFDR Q+    QTRFL++KPAKV LS+MEVVAQSMGFKTHIRN
Sbjct  276  LNAFDLIILSQGLNLSALFDRRQEYVRQQTRFLSRKPAKVVLSSMEVVAQSMGFKTHIRN  335

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMR+EGLSADK +H SV+LEIF+VAP+F MV+IQ+AAGD  E++ F KNFC  LE++IW
Sbjct  336  YKMRIEGLSADKTAHLSVMLEIFEVAPSFLMVEIQRAAGDGAEYVTFNKNFCSKLEEIIW  395

Query  67   KPPDELCKSRITKAKSK  17
            +PP E  KSRIT+   +
Sbjct  396  RPPVEKSKSRITRMSKR  412



>ref|XP_007202049.1| hypothetical protein PRUPE_ppa005741mg [Prunus persica]
 gb|EMJ03248.1| hypothetical protein PRUPE_ppa005741mg [Prunus persica]
Length=446

 Score =   329 bits (843),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 149/253 (59%), Positives = 193/253 (76%), Gaps = 0/253 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPFDE +L TLY KI  AEFSCP WF   A SLIHKILDPNP+
Sbjct  191  ADVWSCGVILYVLMAGYLPFDETNLHTLYRKINAAEFSCPYWFSPEANSLIHKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+I  IR D WF++ Y+P K  E E+V+LDD++A F+D E++   E+  ++D GPL +
Sbjct  251  TRIQIGGIRKDPWFRRNYVPFKNGEDEEVSLDDVHAVFEDIEDQYVAERSESKDGGPLLM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPAKV +S +E VA+SM  K H RNY
Sbjct  311  NAFEMITLSQGLNLSALFDRRQDYINRQTRFVSRKPAKVIISNVEAVAESMSLKVHTRNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+S+DK   F+V+LE+++VAP+ FMVD++KA GD+ E+ KFYKN C  LED+IWK
Sbjct  371  KTRLEGISSDKAGQFAVVLEVYEVAPSLFMVDVRKATGDTLEYHKFYKNLCAKLEDIIWK  430

Query  64   PPDELCKSRITKA  26
            P + +  S + + 
Sbjct  431  PKEGMASSNLLRT  443



>ref|XP_008362901.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Malus domestica]
Length=446

 Score =   328 bits (841),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 148/253 (58%), Positives = 194/253 (77%), Gaps = 0/253 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+VLMAGYLPFDE +L+TLY KI  A+FSCP WF   A  LIHKILDPNP+
Sbjct  191  ADIWSCGVILFVLMAGYLPFDETNLSTLYRKINDADFSCPFWFSPEANKLIHKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRIRI+ IR D WFKK Y P+   E E+V+LDD+ A F+D E++   E+   +D GPL +
Sbjct  251  TRIRIDGIRKDPWFKKNYAPLTYREDEEVSLDDVRAVFEDIEDQYVAERSEIKDGGPLLM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPA V +S +E VA+SMG K H RNY
Sbjct  311  NAFEMITLSQGLNLSALFDRRQDYVNRQTRFVSRKPAHVIISNVEAVAESMGLKVHTRNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA++   F+V+LE+++VAP+ FMVD++KAAGD+ E+ KFYKNFC  LE++IWK
Sbjct  371  KTRLEGISANRTGQFAVVLEVYEVAPSLFMVDVRKAAGDTLEYHKFYKNFCAKLEEIIWK  430

Query  64   PPDELCKSRITKA  26
            P + + +S + K 
Sbjct  431  PKEGMGRSNLRKT  443



>ref|XP_009368859.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009368860.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X1 [Pyrus x bretschneideri]
Length=446

 Score =   328 bits (841),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/255 (58%), Positives = 194/255 (76%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPFDE +L TLY KI  AEFSCP WF   A  LIHKILDPNP+
Sbjct  191  ADIWSCGVILYVLMAGYLPFDETNLYTLYSKITAAEFSCPYWFSPEANKLIHKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRIRI+ IRND WFKK Y PVK  E E+V+LDD+ A F+D E++   E+   +D GPL +
Sbjct  251  TRIRIDVIRNDPWFKKKYAPVKYREDEEVSLDDVRAVFEDIEDQYIPERSEIKDGGPLLM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPA+V +S +E VA+SM  K H RNY
Sbjct  311  NAFEMITLSQGLNLSALFDRRQDYVNRQTRFVSRKPAQVIISNVEAVAESMSLKVHTRNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA+++  F+V+LE+++V P+ FMVD++KAAGD+ E+ KFYKNFC  L+D+IW 
Sbjct  371  KTRLEGISANRMGQFAVVLEVYEVGPSLFMVDVRKAAGDTLEYHKFYKNFCAKLKDIIWN  430

Query  64   PPDELCKSRITKAKS  20
            P +    S + + ++
Sbjct  431  PKEGKDSSNLLRTRA  445



>gb|ABK25058.1| unknown [Picea sitchensis]
Length=450

 Score =   328 bits (841),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 144/242 (60%), Positives = 191/242 (79%), Gaps = 0/242 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            LADVWSCGVILYVLMAG+LPFDE DLT+LY KI  A+FSCP+WF  GAKSLI +ILDP+P
Sbjct  195  LADVWSCGVILYVLMAGFLPFDEDDLTSLYRKINEADFSCPTWFSPGAKSLISRILDPDP  254

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            +TRI++  IR D+WF+K Y+PV++ E +DVNLDD+ A FDD+E++  +EQ   ++ GP  
Sbjct  255  QTRIKVSGIREDDWFRKNYVPVRLYEDDDVNLDDVQAVFDDSEDQYVSEQREAKELGPSM  314

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            +NAF+LI LS+GLNLS LF+  QD    QTRF+++KPAKV +S +E   +SMGFK  + N
Sbjct  315  MNAFELITLSQGLNLSALFETQQDHVKRQTRFISRKPAKVIISKIESAVESMGFKIQVSN  374

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMR+EGL+ +K  H SV LE+F+VAP+ +MVD++KAAGD+ E+ +FYK  C  LED++W
Sbjct  375  YKMRIEGLTLNKTGHISVALEVFEVAPSLYMVDVRKAAGDTLEYHRFYKALCAQLEDIVW  434

Query  67   KP  62
            KP
Sbjct  435  KP  436



>ref|XP_009368863.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X3 [Pyrus x bretschneideri]
Length=445

 Score =   328 bits (840),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/255 (58%), Positives = 194/255 (76%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPFDE +L TLY KI  AEFSCP WF   A  LIHKILDPNP+
Sbjct  190  ADIWSCGVILYVLMAGYLPFDETNLYTLYSKITAAEFSCPYWFSPEANKLIHKILDPNPK  249

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRIRI+ IRND WFKK Y PVK  E E+V+LDD+ A F+D E++   E+   +D GPL +
Sbjct  250  TRIRIDVIRNDPWFKKKYAPVKYREDEEVSLDDVRAVFEDIEDQYIPERSEIKDGGPLLM  309

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPA+V +S +E VA+SM  K H RNY
Sbjct  310  NAFEMITLSQGLNLSALFDRRQDYVNRQTRFVSRKPAQVIISNVEAVAESMSLKVHTRNY  369

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA+++  F+V+LE+++V P+ FMVD++KAAGD+ E+ KFYKNFC  L+D+IW 
Sbjct  370  KTRLEGISANRMGQFAVVLEVYEVGPSLFMVDVRKAAGDTLEYHKFYKNFCAKLKDIIWN  429

Query  64   PPDELCKSRITKAKS  20
            P +    S + + ++
Sbjct  430  PKEGKDSSNLLRTRA  444



>ref|XP_009368861.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X2 [Pyrus x bretschneideri]
Length=446

 Score =   327 bits (839),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/255 (58%), Positives = 194/255 (76%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPFDE +L TLY KI  AEFSCP WF   A  LIHKILDPNP+
Sbjct  191  ADIWSCGVILYVLMAGYLPFDETNLYTLYSKITAAEFSCPYWFSPEANKLIHKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRIRI+ IRND WFKK Y PVK  E E+V+LDD+ A F+D E++   E+   +D GPL +
Sbjct  251  TRIRIDVIRNDPWFKKKYAPVKYREDEEVSLDDVRAVFEDIEDQYIPERSEIKDGGPLLM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPA+V +S +E VA+SM  K H RNY
Sbjct  311  NAFEMITLSQGLNLSALFDRRQDYVNRQTRFVSRKPAQVIISNVEAVAESMSLKVHTRNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA+++  F+V+LE+++V P+ FMVD++KAAGD+ E+ KFYKNFC  L+D+IW 
Sbjct  371  KTRLEGISANRMGQFAVVLEVYEVGPSLFMVDVRKAAGDTLEYHKFYKNFCAKLKDIIWN  430

Query  64   PPDELCKSRITKAKS  20
            P +    S + + ++
Sbjct  431  PKEGKDSSNLLRTRA  445



>gb|AIZ68215.1| CBL-interacting protein kinase 09-like protein [Ornithogalum 
saundersiae]
Length=444

 Score =   327 bits (837),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 197/255 (77%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPF+E+DL TLY KI  AEFSCPSWF   A+SLIH+IL+PNP+
Sbjct  189  ADVWSCGVILYVLMAGYLPFEEIDLPTLYRKICAAEFSCPSWFSASARSLIHRILEPNPK  248

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE I+ND WF++ Y+ V+  + E+VNLDD+NA F+D E++  +EQ   +  GPL +
Sbjct  249  TRINIEGIKNDAWFRRSYVAVRHGDEEEVNLDDVNAVFNDIEDKYVSEQIEGDAGGPLIM  308

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++ PAK  ++ +E VA +MG K H R+Y
Sbjct  309  NAFEMITLSQGLNLSALFDRRQDYVKRQTRFVSRYPAKRIVTAIEEVADTMGLKVHSRDY  368

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K+R+EG+S++K+  F+V+LE+F+VAP+ FMVD++KAAGD+ E+ KFYKN C  L+ +IWK
Sbjct  369  KIRLEGVSSNKMGQFAVVLEVFEVAPSLFMVDVRKAAGDTLEYHKFYKNLCSKLDHIIWK  428

Query  64   PPDELCKSRITKAKS  20
            P +   KS + K  +
Sbjct  429  PAEGAAKSALLKTTT  443



>ref|NP_001280754.1| son of sevenless homolog 2 [Malus domestica]
 gb|ACQ90245.1| serine/threonine protein kinase [Malus domestica]
Length=446

 Score =   326 bits (836),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 148/253 (58%), Positives = 193/253 (76%), Gaps = 0/253 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+VLMAGYLPFDE +L+TLY KI  A+FSCP WF   A  LIHKILDPNP+
Sbjct  191  ADIWSCGVILFVLMAGYLPFDETNLSTLYRKINDADFSCPFWFSPEANKLIHKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRIRI+ IR D WFKK Y P+   E E+V+LDD+ A F+D E++   E+   +D GPL +
Sbjct  251  TRIRIDGIRKDPWFKKNYAPLTYREDEEVSLDDVRAVFEDIEDQYVAERSEIKDGGPLLM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPA V +S +E VA+SMG K H RNY
Sbjct  311  NAFEMITLSQGLNLSALFDRRQDYVNRQTRFVSRKPAHVIISNVEAVAESMGLKVHTRNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA++   F+V+LE+++VAP+ FMVD++KAAGD+ E+ KFYKNFC  LE++IWK
Sbjct  371  KTRLEGISANRTGQFAVVLEVYEVAPSLFMVDVRKAAGDTLEYHKFYKNFCAKLEEIIWK  430

Query  64   PPDELCKSRITKA  26
            P + +  S + K 
Sbjct  431  PKEGMGHSNLLKT  443



>ref|XP_011078405.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Sesamum indicum]
Length=446

 Score =   325 bits (834),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 145/243 (60%), Positives = 189/243 (78%), Gaps = 0/243 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+VLMAGYLPF+E+DL +LY KI  A+FSCP WF   A SLIHKILDPNPE
Sbjct  191  ADIWSCGVILFVLMAGYLPFEEIDLLSLYNKINAAQFSCPFWFSPAAASLIHKILDPNPE  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+IE I+ D WF+K Y+PV+  E E VNLDD+ A FDD E++  NE+  N   GPL +
Sbjct  251  TRIKIEGIKKDPWFQKNYVPVRPREDEVVNLDDVRAVFDDIEDKYVNEEPENNGNGPLIM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++PAKV ++ +E   QS+G K H RNY
Sbjct  311  NAFEMITLSQGLNLSALFDRRQDYVKRQTRFVSRQPAKVIVAAIEAAGQSLGLKVHTRNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA++   F+V+LE+F+VAP+ FMVD++KAAGD+ E+ KFYKNFC  L+ +IW+
Sbjct  371  KTRLEGVSANRAGQFAVVLEVFEVAPSLFMVDVRKAAGDTLEYHKFYKNFCAMLDHIIWR  430

Query  64   PPD  56
            P +
Sbjct  431  PKE  433



>gb|AES91544.2| CBL-interacting kinase [Medicago truncatula]
Length=433

 Score =   325 bits (833),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 143/243 (59%), Positives = 188/243 (77%), Gaps = 0/243 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCG+ILYVLMAGYLPF+E DL TL+ +I   EF CP WF  GAK+ IHKILDP+P+
Sbjct  178  ADVWSCGIILYVLMAGYLPFEEADLPTLFRRISAGEFVCPVWFSAGAKTFIHKILDPDPK  237

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TR++I EIR D WF+K Y P+K+ E E VNLDDI A FDD E++  +E+    + GPL +
Sbjct  238  TRVKIVEIRKDPWFRKNYSPIKLREDEQVNLDDIKAVFDDIEDQYVSERSEIAEGGPLIM  297

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPA V +S++E VA+SM  K H RNY
Sbjct  298  NAFEMITLSQGLNLSPLFDRHQDYVKRQTRFVSRKPATVIISSIEAVAESMSLKVHSRNY  357

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMR+E +S++K+  F+V+LE+F+VAP+ FMVD++KAAGD+ E+ KFYKN C  LE +IW+
Sbjct  358  KMRIERVSSNKVGQFAVVLEVFEVAPSLFMVDVRKAAGDTLEYHKFYKNLCSKLESIIWR  417

Query  64   PPD  56
            P +
Sbjct  418  PAE  420



>dbj|BAD95978.1| Ser/Thr protein kinase [Lotus japonicus]
Length=446

 Score =   325 bits (834),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 145/252 (58%), Positives = 193/252 (77%), Gaps = 0/252 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVL AGYLPF+E DL+TLY +   AEF CPSWF  G  +LIHKILDPNP+
Sbjct  191  ADVWSCGVILYVLKAGYLPFEEADLSTLYRRTSAAEFVCPSWFSTGTTTLIHKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TR++I EIR D WF++ Y+P+K+ E E VNLDD+ A FDD E++    Q    + GPL +
Sbjct  251  TRVKIGEIRKDPWFQRNYLPLKLNEDEQVNLDDVQAVFDDIEDQYVPVQSEITEGGPLVM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPAKV +S+++VVA+SMG K   RNY
Sbjct  311  NAFEMITLSQGLNLSPLFDRHQDYVKRQTRFVSRKPAKVIISSIKVVAESMGLKLQSRNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMR+EGLSA+K   F+V+LE+++VAP  +MVD++KAAGD+ ++ KFYKN C  LE++IW+
Sbjct  371  KMRIEGLSANKAGQFAVVLEVYEVAPCLYMVDVRKAAGDTLDYHKFYKNLCAKLENIIWR  430

Query  64   PPDELCKSRITK  29
            P + +  S + +
Sbjct  431  PTETMPDSGLLR  442



>ref|NP_001234210.1| calcineurin B-like interacting protein kinase [Solanum lycopersicum]
 emb|CAG30526.1| calcineurin B-like interacting protein kinase [Solanum lycopersicum]
 gb|ABR37648.1| putative SOS2-like protein kinase [Solanum lycopersicum]
Length=446

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 195/256 (76%), Gaps = 0/256 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCG+ILYVLMAGYLPFDE DL TLY KI+ AEFSCP WF  GA SLI KI+DPNP+
Sbjct  191  ADVWSCGIILYVLMAGYLPFDETDLPTLYTKIKAAEFSCPFWFSPGATSLIQKIIDPNPQ  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+I+ I+ D WF+K Y  VK    E VNLDDI+A FDD E+   +E+  + + GPL +
Sbjct  251  TRIKIDGIKRDPWFRKNYRAVKAKADEVVNLDDIHAVFDDIEDAFVSEKSEDSESGPLVM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++PAKV + T+E  A+S+G K H R+Y
Sbjct  311  NAFEMITLSQGLNLSALFDRRQDYVKRQTRFISRQPAKVVIETIEAAAESLGLKVHTRDY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG++A++   F+V+LE+FQVAP+ FMVD++KAAGD+ E+ KFYK FC  ++D+IWK
Sbjct  371  KTRIEGVTANRAGQFAVVLEVFQVAPSLFMVDVRKAAGDTLEYHKFYKTFCTKIDDVIWK  430

Query  64   PPDELCKSRITKAKSK  17
            P + +  + + + +++
Sbjct  431  PKEGMSNAVLLRTRTR  446



>ref|XP_008385538.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Malus domestica]
Length=446

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 147/253 (58%), Positives = 193/253 (76%), Gaps = 0/253 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+VLMAGYLPFDE +L+TLY KI  A+FSCP WF   A  LIHKILDPNP+
Sbjct  191  ADIWSCGVILFVLMAGYLPFDETNLSTLYRKINDADFSCPFWFSPEANKLIHKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRIRI+ IR D WFKK Y P+   E E+V+LDD+ A F+D E++   E+   +D GPL +
Sbjct  251  TRIRIDGIRKDPWFKKNYAPLTYREDEEVSLDDVRAVFEDIEDQYVAERSEIKDGGPLLM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPA V +S +E VA+SMG K H RNY
Sbjct  311  NAFEMITLSQGLNLSALFDRRQDYVNRQTRFVSRKPAHVIISNVEAVAESMGLKVHTRNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA++   F+V+LE+++VAP+ FMV+++KAAGD+ E+ KFYKNFC  LE++IWK
Sbjct  371  KTRLEGISANRTGQFAVVLEVYEVAPSLFMVNVRKAAGDTLEYHKFYKNFCAKLEEIIWK  430

Query  64   PPDELCKSRITKA  26
            P + +  S + K 
Sbjct  431  PKEGMGHSNLLKT  443



>gb|AES91543.2| CBL-interacting kinase [Medicago truncatula]
Length=446

 Score =   325 bits (832),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 143/243 (59%), Positives = 188/243 (77%), Gaps = 0/243 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCG+ILYVLMAGYLPF+E DL TL+ +I   EF CP WF  GAK+ IHKILDP+P+
Sbjct  191  ADVWSCGIILYVLMAGYLPFEEADLPTLFRRISAGEFVCPVWFSAGAKTFIHKILDPDPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TR++I EIR D WF+K Y P+K+ E E VNLDDI A FDD E++  +E+    + GPL +
Sbjct  251  TRVKIVEIRKDPWFRKNYSPIKLREDEQVNLDDIKAVFDDIEDQYVSERSEIAEGGPLIM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPA V +S++E VA+SM  K H RNY
Sbjct  311  NAFEMITLSQGLNLSPLFDRHQDYVKRQTRFVSRKPATVIISSIEAVAESMSLKVHSRNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMR+E +S++K+  F+V+LE+F+VAP+ FMVD++KAAGD+ E+ KFYKN C  LE +IW+
Sbjct  371  KMRIERVSSNKVGQFAVVLEVFEVAPSLFMVDVRKAAGDTLEYHKFYKNLCSKLESIIWR  430

Query  64   PPD  56
            P +
Sbjct  431  PAE  433



>ref|XP_009364020.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Pyrus x bretschneideri]
 ref|XP_009364021.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Pyrus x bretschneideri]
Length=446

 Score =   324 bits (831),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 147/253 (58%), Positives = 194/253 (77%), Gaps = 0/253 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+VLMAGYLPFDE +L++LY KI  AEFSCP WF   A  LIH ILDPNP+
Sbjct  191  ADIWSCGVILFVLMAGYLPFDETNLSSLYRKINDAEFSCPFWFSPKANKLIHMILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRIRI+ IR D WFKK Y P+   E E+V+LDD+ A F+D E++   E+   +D GPL +
Sbjct  251  TRIRIDGIRKDPWFKKNYAPLIYREDEEVSLDDVCAVFEDIEDQYVAERSEIKDGGPLLM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPA V +S +E VA+SMG K H RNY
Sbjct  311  NAFEMITLSQGLNLSALFDRRQDYVNRQTRFVSRKPAHVIISNVEAVAESMGLKVHTRNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA+++  F+V+LE+++VAP+ FMVD++KAAGD+ E+ KFYKNFC  LE++IWK
Sbjct  371  KTRLEGISANRMGQFAVVLEVYEVAPSLFMVDVRKAAGDTLEYHKFYKNFCAKLEEIIWK  430

Query  64   PPDELCKSRITKA  26
            P + + +S + K 
Sbjct  431  PKEVMGRSNLLKT  443



>gb|AKA42979.1| salt overly sensitive 2 [Oryza coarctata]
Length=455

 Score =   324 bits (831),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 144/252 (57%), Positives = 197/252 (78%), Gaps = 0/252 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPF+E DL TLY KI   +FSCP WF  GA SLIH+ILDPNP+
Sbjct  200  ADVWSCGVILYVLMAGYLPFEENDLPTLYDKITAGQFSCPYWFSPGATSLIHRILDPNPK  259

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE+IR D WFKK Y+ +K  E E+V+LDD+ A FD+ E++  +EQ  + D GPL +
Sbjct  260  TRITIEQIREDTWFKKTYVAIKRGEDENVDLDDVQAVFDNIEDKYVSEQVTHNDGGPLVM  319

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GL+LS LFDR Q+    QTRF+++KPAK  ++T+EVVA+SMG K H +NY
Sbjct  320  NAFEMITLSQGLDLSALFDRQQEFVKRQTRFVSRKPAKTIVATIEVVAESMGLKVHSQNY  379

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K+R+EG+S++++S F+V+L++F+VAP+ FMVD++K AGD+ E+ +FYKN C  +E +IW+
Sbjct  380  KLRLEGVSSNRMSPFAVVLQVFEVAPSLFMVDVRKVAGDTLEYHRFYKNLCNKMESIIWR  439

Query  64   PPDELCKSRITK  29
            P +   KS + +
Sbjct  440  PIEVSAKSALLR  451



>gb|EMT11501.1| CBL-interacting protein kinase 24 [Aegilops tauschii]
Length=430

 Score =   322 bits (826),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 194/255 (76%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPF+E DL TLY KI  A FSCP WF  GAKSLI +ILDP P+
Sbjct  175  ADVWSCGVILYVLMAGYLPFEENDLPTLYDKITAAHFSCPDWFSQGAKSLIQRILDPTPK  234

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TR+ I+E+++D WF K Y+ V+  E E+V+LDD+ AAFD+ E++  +EQ    D GPL +
Sbjct  235  TRMTIKEMKSDTWFSKNYVGVRHGEDENVSLDDVQAAFDNIEDKYVSEQVTRNDGGPLMM  294

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR Q+    QTRF+++KPAK   +T+EVVA SMG K H +NY
Sbjct  295  NAFEMITLSQGLNLSSLFDRQQEYVKRQTRFVSRKPAKTIAATIEVVADSMGLKVHSQNY  354

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K+R+EG+S++K+S F+V+LEIF+VAP  FMVD++K AGDS E+ +FYKN C  LE +IW+
Sbjct  355  KLRLEGVSSNKMSPFAVVLEIFEVAPALFMVDVRKVAGDSLEYHRFYKNLCSKLESIIWR  414

Query  64   PPDELCKSRITKAKS  20
            P +   KS + +  +
Sbjct  415  PIEVSAKSALLRTTT  429



>gb|EEC80936.1| hypothetical protein OsI_23636 [Oryza sativa Indica Group]
Length=447

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 198/255 (78%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPF+E DL TLY KI   +FSCP WF  GA SLIH+ILDPNP+
Sbjct  192  ADVWSCGVILYVLMAGYLPFEEDDLPTLYDKITAGQFSCPYWFSPGATSLIHRILDPNPK  251

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE+IR D WFKK Y+ +K  E E+V+LDD+ A FD+ E++  +EQ  + D GPL +
Sbjct  252  TRITIEQIREDTWFKKTYVAIKRGEDENVDLDDVQAVFDNIEDKYVSEQVTHNDGGPLVM  311

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GL+LS LFDR Q+    QTRF+++KPAK  ++T+EVVA++MG K H +NY
Sbjct  312  NAFEMITLSQGLDLSALFDRQQEFVKRQTRFVSRKPAKTIVATIEVVAETMGLKVHSQNY  371

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K+R+EG+S++++S F+V+L++F+VAP+ FMVD++K AGD+ E+ +FYKN C  +E +IW+
Sbjct  372  KLRLEGVSSNRMSPFAVVLQVFEVAPSLFMVDVRKVAGDTLEYHRFYKNLCNKMESIIWR  431

Query  64   PPDELCKSRITKAKS  20
            P +   KS + +  +
Sbjct  432  PIEVSAKSALLRTAT  446



>gb|ACD76985.1| CBL-interacting protein kinase 24 isoform 2 [Oryza sativa Japonica 
Group]
Length=438

 Score =   322 bits (826),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 198/255 (78%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPF+E DL TLY KI   +FSCP WF  GA SLIH+ILDPNP+
Sbjct  183  ADVWSCGVILYVLMAGYLPFEEDDLPTLYDKITAGQFSCPYWFSPGATSLIHRILDPNPK  242

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE+IR D WFKK Y+ +K  E E+V+LDD+ A FD+ E++  +EQ  + D GPL +
Sbjct  243  TRITIEQIREDTWFKKTYVAIKRGEDENVDLDDVQAVFDNIEDKYVSEQVTHNDGGPLVM  302

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GL+LS LFDR Q+    QTRF+++KPAK  ++T+EVVA++MG K H +NY
Sbjct  303  NAFEMITLSQGLDLSALFDRQQEFVKRQTRFVSRKPAKTIVATIEVVAETMGLKVHSQNY  362

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K+R+EG+S++++S F+V+L++F+VAP+ FMVD++K AGD+ E+ +FYKN C  +E +IW+
Sbjct  363  KLRLEGVSSNRMSPFAVVLQVFEVAPSLFMVDVRKVAGDTLEYHRFYKNLCNKMESIIWR  422

Query  64   PPDELCKSRITKAKS  20
            P +   KS + +  +
Sbjct  423  PIEVSAKSALLRTAT  437



>gb|EEE65986.1| hypothetical protein OsJ_21916 [Oryza sativa Japonica Group]
Length=447

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 198/255 (78%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPF+E DL TLY KI   +FSCP WF  GA SLIH+ILDPNP+
Sbjct  192  ADVWSCGVILYVLMAGYLPFEEDDLPTLYDKITAGQFSCPYWFSPGATSLIHRILDPNPK  251

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE+IR D WFKK Y+ +K  E E+V+LDD+ A FD+ E++  +EQ  + D GPL +
Sbjct  252  TRITIEQIREDTWFKKTYVAIKRGEDENVDLDDVQAVFDNIEDKYVSEQVTHNDGGPLVM  311

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GL+LS LFDR Q+    QTRF+++KPAK  ++T+EVVA++MG K H +NY
Sbjct  312  NAFEMITLSQGLDLSALFDRQQEFVKRQTRFVSRKPAKTIVATIEVVAETMGLKVHSQNY  371

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K+R+EG+S++++S F+V+L++F+VAP+ FMVD++K AGD+ E+ +FYKN C  +E +IW+
Sbjct  372  KLRLEGVSSNRMSPFAVVLQVFEVAPSLFMVDVRKVAGDTLEYHRFYKNLCNKMESIIWR  431

Query  64   PPDELCKSRITKAKS  20
            P +   KS + +  +
Sbjct  432  PIEVSAKSALLRTAT  446



>ref|NP_001058024.1| Os06g0606000 [Oryza sativa Japonica Group]
 sp|Q69Q47.1|CIPKO_ORYSJ RecName: Full=CBL-interacting protein kinase 24; AltName: Full=OsCIPK24 
[Oryza sativa Japonica Group]
 dbj|BAD35545.1| putative serine/threonine kinase [Oryza sativa Japonica Group]
 dbj|BAD36106.1| putative serine/threonine kinase [Oryza sativa Japonica Group]
 gb|ABB52101.1| serine/threonine kinase [Oryza sativa Indica Group]
 dbj|BAF19938.1| Os06g0606000 [Oryza sativa Japonica Group]
 gb|ACD76984.1| CBL-interacting protein kinase 24 isoform 1 [Oryza sativa Japonica 
Group]
Length=453

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 198/255 (78%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPF+E DL TLY KI   +FSCP WF  GA SLIH+ILDPNP+
Sbjct  198  ADVWSCGVILYVLMAGYLPFEEDDLPTLYDKITAGQFSCPYWFSPGATSLIHRILDPNPK  257

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE+IR D WFKK Y+ +K  E E+V+LDD+ A FD+ E++  +EQ  + D GPL +
Sbjct  258  TRITIEQIREDTWFKKTYVAIKRGEDENVDLDDVQAVFDNIEDKYVSEQVTHNDGGPLVM  317

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GL+LS LFDR Q+    QTRF+++KPAK  ++T+EVVA++MG K H +NY
Sbjct  318  NAFEMITLSQGLDLSALFDRQQEFVKRQTRFVSRKPAKTIVATIEVVAETMGLKVHSQNY  377

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K+R+EG+S++++S F+V+L++F+VAP+ FMVD++K AGD+ E+ +FYKN C  +E +IW+
Sbjct  378  KLRLEGVSSNRMSPFAVVLQVFEVAPSLFMVDVRKVAGDTLEYHRFYKNLCNKMESIIWR  437

Query  64   PPDELCKSRITKAKS  20
            P +   KS + +  +
Sbjct  438  PIEVSAKSALLRTAT  452



>ref|XP_003542672.1| PREDICTED: CBL-interacting protein kinase 24-like isoformX1 [Glycine 
max]
Length=446

 Score =   322 bits (826),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/252 (58%), Positives = 192/252 (76%), Gaps = 0/252 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPF+E DL TLY +I  AEF CP WF    KS I KILDPNP+
Sbjct  191  ADVWSCGVILYVLMAGYLPFEEADLPTLYRRINAAEFVCPFWFSADTKSFIQKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TR++IEEIR + WFKK Y PVK+ E E VNLDD+ A FDD E++   E+    + GPL +
Sbjct  251  TRVKIEEIRKEPWFKKNYFPVKLGEDEQVNLDDVRAVFDDIEDQYVAERSEITEGGPLIM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD+   QTRF+++KPAKV +S++E VA+SMG K H RNY
Sbjct  311  NAFEMIALSQGLNLSPLFDRLQDNVKRQTRFVSRKPAKVIISSIEAVAESMGLKVHSRNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K+R+EG+SA+++  F+V+LE+F+VAP+ FMVD+++A GD+ ++ KFY NFC  L ++IW+
Sbjct  371  KVRLEGVSANRVGPFAVVLEVFEVAPSLFMVDVRRATGDTFDYHKFYMNFCAKLGNIIWR  430

Query  64   PPDELCKSRITK  29
            P   +  S + K
Sbjct  431  PAGTMPNSNLLK  442



>gb|AEZ51508.1| CBL-interacting protein kinase 24 [Hordeum vulgare subsp. spontaneum]
Length=448

 Score =   322 bits (826),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 197/255 (77%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPF+E DL TLY KI  A+FSCP WF  GAKS+I +ILD NP+
Sbjct  193  ADIWSCGVILYVLMAGYLPFEENDLPTLYDKITAAQFSCPDWFSPGAKSMIQRILDRNPK  252

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IEEIR D WFKK Y+ ++  E E+V+LDD+ A FDD E++  +E   ++D GPL +
Sbjct  253  TRITIEEIRADPWFKKNYVALRRGEDENVSLDDVQAVFDDIEDKYVSEGVTHKDGGPLIM  312

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GL+LS LFDR Q+    QTRF+++KPAK  ++T+EVVA SMG K H +NY
Sbjct  313  NAFEMITLSQGLDLSSLFDRQQEYVKRQTRFVSRKPAKTIVATIEVVADSMGLKVHSQNY  372

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMR+EG+SA+K+S F+V+L+IF+VAP+ FMVD++K AGD+ E+ +FYKN C  LE +IW+
Sbjct  373  KMRLEGVSANKMSPFAVVLQIFEVAPSLFMVDVRKVAGDTLEYHRFYKNLCSKLETIIWR  432

Query  64   PPDELCKSRITKAKS  20
            P +   KS + +  +
Sbjct  433  PTEVSAKSALLRTTT  447



>ref|XP_008443989.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Cucumis melo]
Length=437

 Score =   322 bits (824),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 144/245 (59%), Positives = 187/245 (76%), Gaps = 0/245 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPF E DL TL  KI  AE+SCP WF  GAKSLI KILDPNP+
Sbjct  191  ADIWSCGVILYVLMAGYLPFSETDLPTLNMKINAAEYSCPYWFSPGAKSLIEKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRIRIEEIR D WF++ Y+P K+ E E+VNLDD+ A FDD E+E   +Q    D GPL +
Sbjct  251  TRIRIEEIRKDPWFRRNYVPAKLGEDEEVNLDDVRAVFDDIEDEYVADQSEKNDDGPLIM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++PA   +S++E VA++MG   H RN+
Sbjct  311  NAFEMITLSQGLNLSPLFDRRQDYIKRQTRFVSRRPANFIMSSIEAVAETMGLNVHTRNF  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+E  +  +++ F+ +LEI++VAP+ FMVD++KAAGD+ E+ KFYKNFC  LE++IWK
Sbjct  371  KTRLERRTGHRVAQFAAVLEIYEVAPSLFMVDVRKAAGDTLEYHKFYKNFCAKLENIIWK  430

Query  64   PPDEL  50
            P + +
Sbjct  431  PSESV  435



>ref|XP_011659826.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X2 [Cucumis sativus]
Length=356

 Score =   318 bits (816),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 187/245 (76%), Gaps = 0/245 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPF E+DL TL  KI  AE+SCP WF  GAKSLI KILDPNP+
Sbjct  110  ADIWSCGVILYVLMAGYLPFSEMDLPTLNMKINAAEYSCPYWFSPGAKSLIQKILDPNPK  169

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RIRIEEIR D WF++ YIP K+ E E+VNLDD+ A FDD E+E   +Q    D GPL +
Sbjct  170  ARIRIEEIRKDPWFRRNYIPAKLGEDEEVNLDDVRAVFDDIEDEYVADQTEKSDDGPLIM  229

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPA   +S++E VA++MG     RN+
Sbjct  230  NAFEMITLSQGLNLSPLFDRRQDYIKRQTRFVSRKPASFIMSSIEAVAEAMGLNVQTRNF  289

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+E  +  +++ F+ +LEI++VAP+ FMVD++KAAGD+ E+ KFYKNFCG LE++IWK
Sbjct  290  KTRLERRTGYRVAQFAAVLEIYEVAPSLFMVDVRKAAGDTLEYHKFYKNFCGKLENIIWK  349

Query  64   PPDEL  50
            P + +
Sbjct  350  PSESV  354



>ref|XP_011659824.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Cucumis sativus]
 ref|XP_011659825.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Cucumis sativus]
Length=437

 Score =   320 bits (821),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 187/245 (76%), Gaps = 0/245 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPF E+DL TL  KI  AE+SCP WF  GAKSLI KILDPNP+
Sbjct  191  ADIWSCGVILYVLMAGYLPFSEMDLPTLNMKINAAEYSCPYWFSPGAKSLIQKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RIRIEEIR D WF++ YIP K+ E E+VNLDD+ A FDD E+E   +Q    D GPL +
Sbjct  251  ARIRIEEIRKDPWFRRNYIPAKLGEDEEVNLDDVRAVFDDIEDEYVADQTEKSDDGPLIM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPA   +S++E VA++MG     RN+
Sbjct  311  NAFEMITLSQGLNLSPLFDRRQDYIKRQTRFVSRKPASFIMSSIEAVAEAMGLNVQTRNF  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+E  +  +++ F+ +LEI++VAP+ FMVD++KAAGD+ E+ KFYKNFCG LE++IWK
Sbjct  371  KTRLERRTGYRVAQFAAVLEIYEVAPSLFMVDVRKAAGDTLEYHKFYKNFCGKLENIIWK  430

Query  64   PPDEL  50
            P + +
Sbjct  431  PSESV  435



>gb|AJR22382.1| CBL-interacting protein kinase 24 [Triticum aestivum]
Length=446

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 193/255 (76%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPF+E DL TLY KI  A FSCP WF  GAKSLI +ILDPNP+
Sbjct  191  ADVWSCGVILYVLMAGYLPFEENDLPTLYDKITAAHFSCPDWFSQGAKSLIQRILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RI I+E++ D WF K Y+ V+  E E+V+LDD+ AAFD+ E++  +EQ    D GPL +
Sbjct  251  ARITIKEMKADTWFSKNYVGVRHGEDENVSLDDVQAAFDNIEDKYVSEQVTRNDGGPLMM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR Q+    QTRF+++KPAK   +T+EVVA SMG K H +NY
Sbjct  311  NAFEMITLSQGLNLSSLFDRQQEYVKRQTRFVSRKPAKTIAATIEVVADSMGLKVHSQNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K+R+EG+S++K+S F+V+LEIF+VAP  FMVD++K AGDS E+ +FYK+ C  LE +IW+
Sbjct  371  KLRLEGVSSNKMSPFAVVLEIFEVAPALFMVDVRKVAGDSLEYHRFYKSLCSKLESIIWR  430

Query  64   PPDELCKSRITKAKS  20
            P +   KS + +  +
Sbjct  431  PIEVSAKSALLRTTT  445



>ref|XP_012078803.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Jatropha curcas]
 ref|XP_012078804.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Jatropha curcas]
 gb|KDP32419.1| hypothetical protein JCGZ_13344 [Jatropha curcas]
Length=448

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/249 (60%), Positives = 191/249 (77%), Gaps = 1/249 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPFDE DL TLY KI  AE+SCP WF  GAK+LI KILD +P+
Sbjct  193  ADVWSCGVILYVLMAGYLPFDEADLPTLYKKINAAEYSCPHWFSPGAKALIDKILDRSPK  252

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFG-PLA  428
            TRI IE I+ D WF+K Y+PVK  + E+VNLDD+ A FDD E++   EQ  ++  G PL 
Sbjct  253  TRIGIEGIKRDPWFQKYYVPVKNNKEEEVNLDDVRAVFDDIEDKYVAEQSEDKSQGRPLI  312

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            +NAF++I LS+GLNLS LFDR QD    QTRF+++KPA V +S++E VA+SM  K H RN
Sbjct  313  MNAFEMITLSQGLNLSALFDRQQDYVKRQTRFVSRKPANVIISSIEAVAESMNLKVHTRN  372

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YK R+EG+SA+K   F+V+LE+++VAP+ FMVD++KA+GD+ E+ KFYKNFC  LE +IW
Sbjct  373  YKTRLEGISANKAGPFAVVLEVYEVAPSLFMVDVRKASGDTLEYHKFYKNFCAKLEHIIW  432

Query  67   KPPDELCKS  41
            KP + +  S
Sbjct  433  KPSENVNSS  441



>ref|XP_006345226.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Solanum tuberosum]
Length=446

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 193/256 (75%), Gaps = 0/256 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCG+ILYVLMAGYLPF+E DL TLY KI+ AEFSCP WF  GA SLI KI+DPNP+
Sbjct  191  ADVWSCGIILYVLMAGYLPFEETDLPTLYTKIKAAEFSCPFWFSPGATSLIQKIIDPNPQ  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+I+ I+ D WF+K Y  V+    E VNLDD+ A FDD E+   +E+  + + GPL +
Sbjct  251  TRIKIDGIKRDPWFRKNYRAVRAKADEVVNLDDVRAVFDDIEDAFVSEKSEDSESGPLVM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++PAKV + T+E  A+S+G K H R+Y
Sbjct  311  NAFEMITLSQGLNLSALFDRRQDYVKRQTRFVSRQPAKVIIETIEAAAESLGLKVHTRDY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG++A++   F+V+LE+FQVAP+ FMVD++KAAGD+ E+ KFYK FC  ++D+IWK
Sbjct  371  KTRIEGVTANRAGQFAVVLEVFQVAPSLFMVDVRKAAGDTLEYHKFYKTFCTKIDDVIWK  430

Query  64   PPDELCKSRITKAKSK  17
            P + +  + + +  ++
Sbjct  431  PKEGMSNAVLLRTMTR  446



>ref|XP_012078806.1| PREDICTED: CBL-interacting protein kinase 24 isoform X2 [Jatropha 
curcas]
Length=445

 Score =   320 bits (819),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/249 (60%), Positives = 191/249 (77%), Gaps = 1/249 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPFDE DL TLY KI  AE+SCP WF  GAK+LI KILD +P+
Sbjct  190  ADVWSCGVILYVLMAGYLPFDEADLPTLYKKINAAEYSCPHWFSPGAKALIDKILDRSPK  249

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFG-PLA  428
            TRI IE I+ D WF+K Y+PVK  + E+VNLDD+ A FDD E++   EQ  ++  G PL 
Sbjct  250  TRIGIEGIKRDPWFQKYYVPVKNNKEEEVNLDDVRAVFDDIEDKYVAEQSEDKSQGRPLI  309

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            +NAF++I LS+GLNLS LFDR QD    QTRF+++KPA V +S++E VA+SM  K H RN
Sbjct  310  MNAFEMITLSQGLNLSALFDRQQDYVKRQTRFVSRKPANVIISSIEAVAESMNLKVHTRN  369

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YK R+EG+SA+K   F+V+LE+++VAP+ FMVD++KA+GD+ E+ KFYKNFC  LE +IW
Sbjct  370  YKTRLEGISANKAGPFAVVLEVYEVAPSLFMVDVRKASGDTLEYHKFYKNFCAKLEHIIW  429

Query  67   KPPDELCKS  41
            KP + +  S
Sbjct  430  KPSENVNSS  438



>ref|NP_001078442.1| CBL-interacting serine/threonine-protein kinase 8 [Arabidopsis 
thaliana]
 gb|AEE84900.1| CBL-interacting serine/threonine-protein kinase 8 [Arabidopsis 
thaliana]
Length=416

 Score =   318 bits (816),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 172/201 (86%), Gaps = 1/201 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVILYVLMAGYLPFDE+DL TLY KI++AEFSCPS+F +GAKSLI++ILDPNP
Sbjct  188  VADIWSCGVILYVLMAGYLPFDEMDLPTLYSKIDKAEFSCPSYFALGAKSLINRILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETRI I EIR DEWF K Y PV++I+YE VNLDD+ AAFDD EE+    Q    D GPL 
Sbjct  248  ETRITIAEIRKDEWFLKDYTPVQLIDYEHVNLDDVYAAFDDPEEQT-YAQDGTRDTGPLT  306

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDRG+DS  HQTRF++ KPA V LS+MEVV+QSMGFKTHIRN
Sbjct  307  LNAFDLIILSQGLNLATLFDRGKDSMKHQTRFISHKPANVVLSSMEVVSQSMGFKTHIRN  366

Query  247  YKMRVEGLSADKISHFSVILE  185
            YKMRVEGLSA+K SHFSVILE
Sbjct  367  YKMRVEGLSANKTSHFSVILE  387



>ref|XP_009380407.1| PREDICTED: CBL-interacting protein kinase 24 [Musa acuminata 
subsp. malaccensis]
Length=433

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 140/241 (58%), Positives = 190/241 (79%), Gaps = 0/241 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPF+E +L TLY KI  AEF+CP+WF  GAKSLI++ILDPNP+
Sbjct  189  ADVWSCGVILYVLMAGYLPFNETNLQTLYEKISAAEFTCPAWFSSGAKSLIYRILDPNPK  248

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE I+ND WF+  Y+ V+    E+VNLDDI+A F+D E++   E+  + D GPL +
Sbjct  249  TRINIEGIKNDAWFQINYVAVRHGVEEEVNLDDIDAVFNDIEDQYVTERVQDTDNGPLIM  308

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GL+LS LFDR Q+    QTRF++++PAK  ++T+E VA+S+GFK H +NY
Sbjct  309  NAFEMITLSQGLDLSALFDRRQEYVNRQTRFVSRQPAKTIIATIEAVAESIGFKVHSQNY  368

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMR+EG+S  K+   +V+LE+F+VAP+ FMVD++K +GD+ E+ KFYKN C  LE++IW+
Sbjct  369  KMRLEGVSTSKMHQLAVVLEVFEVAPSLFMVDVRKVSGDTLEYHKFYKNLCNKLENIIWR  428

Query  64   P  62
            P
Sbjct  429  P  429



>ref|XP_002438654.1| hypothetical protein SORBIDRAFT_10g023680 [Sorghum bicolor]
 gb|ACQ83514.1| CBL-interacting protein kinase 24 [Sorghum bicolor]
 gb|EER90021.1| hypothetical protein SORBIDRAFT_10g023680 [Sorghum bicolor]
Length=449

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 197/255 (77%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPF+E DL +LY KI  A++SCP WF  GAKSLI +ILDPNP 
Sbjct  194  ADIWSCGVILYVLMAGYLPFEENDLPSLYEKITAAQYSCPYWFSPGAKSLIQRILDPNPR  253

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IEEIR D WF K Y+ ++  E E+V+LDD+ A FD+ E++  +E+  ++D GPL +
Sbjct  254  TRITIEEIRADPWFGKNYVAIRRGEDENVSLDDVQAVFDNIEDKYVSEEVTHKDGGPLMM  313

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GL+LS LFDR Q+    QTRF+++KPAK  ++T+EVVA+SMG K H +NY
Sbjct  314  NAFEMITLSQGLDLSALFDRQQEFVKRQTRFVSRKPAKTIVATIEVVAESMGLKVHSQNY  373

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K+R+EG +++++S F+V+LE+F+VAP+ FMVD++K AGD+ E+ +FYKN C  L+ +IW+
Sbjct  374  KLRLEGAASNRMSQFAVVLEVFEVAPSLFMVDVRKVAGDTLEYHRFYKNLCSKLDSIIWR  433

Query  64   PPDELCKSRITKAKS  20
            P +   KS + +  +
Sbjct  434  PTEVSAKSTLLRTTT  448



>ref|XP_010047960.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X2 [Eucalyptus grandis]
Length=446

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 189/255 (74%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPFDE DL TLY KI  AE+ CP W  +GA SLI ++LDPNP 
Sbjct  189  ADIWSCGVILYVLMAGYLPFDETDLPTLYKKITAAEYVCPIWLSLGATSLIKRLLDPNPR  248

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RI IE IR   WF+K Y+P +  E E+VNLDD+ A FDD +E+   EQ  ++D GPL +
Sbjct  249  NRIGIEGIRKHSWFRKNYMPARCKEDEEVNLDDVRAVFDDIKEQYVAEQSESKDGGPLIM  308

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++K AKV +S++E VA SMG K H RN+
Sbjct  309  NAFEMITLSQGLNLSSLFDRQQDFIKRQTRFVSRKSAKVIISSIEAVAGSMGLKVHTRNF  368

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EGLSA+K   F+ ++E+++VAP+ F+VD++KAAGD+ ++ KFY++FC  LE +IWK
Sbjct  369  KTRLEGLSANKAGQFAAVIEVYEVAPSLFLVDVRKAAGDTLDYHKFYRSFCKKLEHIIWK  428

Query  64   PPDELCKSRITKAKS  20
            P +   K  + + KS
Sbjct  429  PTESNAKHGLLRTKS  443



>ref|XP_010047958.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X1 [Eucalyptus grandis]
 ref|XP_010047959.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X1 [Eucalyptus grandis]
Length=448

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 189/255 (74%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPFDE DL TLY KI  AE+ CP W  +GA SLI ++LDPNP 
Sbjct  191  ADIWSCGVILYVLMAGYLPFDETDLPTLYKKITAAEYVCPIWLSLGATSLIKRLLDPNPR  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RI IE IR   WF+K Y+P +  E E+VNLDD+ A FDD +E+   EQ  ++D GPL +
Sbjct  251  NRIGIEGIRKHSWFRKNYMPARCKEDEEVNLDDVRAVFDDIKEQYVAEQSESKDGGPLIM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++K AKV +S++E VA SMG K H RN+
Sbjct  311  NAFEMITLSQGLNLSSLFDRQQDFIKRQTRFVSRKSAKVIISSIEAVAGSMGLKVHTRNF  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EGLSA+K   F+ ++E+++VAP+ F+VD++KAAGD+ ++ KFY++FC  LE +IWK
Sbjct  371  KTRLEGLSANKAGQFAAVIEVYEVAPSLFLVDVRKAAGDTLDYHKFYRSFCKKLEHIIWK  430

Query  64   PPDELCKSRITKAKS  20
            P +   K  + + KS
Sbjct  431  PTESNAKHGLLRTKS  445



>ref|XP_010533153.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Tarenaya hassleriana]
Length=455

 Score =   318 bits (814),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 139/242 (57%), Positives = 185/242 (76%), Gaps = 0/242 (0%)
 Frame = -1

Query  781  DVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPET  602
            D+WSCGVIL+V+MAG+LPF E +L  LY +I  AEF+CP WF  GA+SLIHKILDPNP+T
Sbjct  201  DIWSCGVILFVVMAGFLPFSETELPALYRRINAAEFACPHWFSAGARSLIHKILDPNPKT  260

Query  601  RIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLALN  422
            RIRIEEIR D WF K Y+PV+  E E+VN DD+ A FD  E     +   +++ GPL +N
Sbjct  261  RIRIEEIRQDAWFNKSYVPVRPSEDEEVNFDDVRAVFDCIEASYVADNVESKEGGPLMMN  320

Query  421  AFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNYK  242
            AF++I LS+GLNLS LFDR QD    QTRF++++PAKV ++ +E VA SMG K H RNYK
Sbjct  321  AFEMITLSQGLNLSALFDRRQDFIKRQTRFVSRRPAKVIIANIEAVANSMGLKVHTRNYK  380

Query  241  MRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWKP  62
             R+EGLS++K   F+V++EI++VAP+ FMVD++KAAG++ E+ KFYKNFC  L ++IW+P
Sbjct  381  TRLEGLSSNKAGQFAVVIEIYEVAPSLFMVDVRKAAGETLEYHKFYKNFCAKLVNIIWRP  440

Query  61   PD  56
             +
Sbjct  441  TE  442



>ref|XP_006657117.1| PREDICTED: CBL-interacting protein kinase 24-like [Oryza brachyantha]
Length=455

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 142/255 (56%), Positives = 194/255 (76%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPF+E DL TLY KI   +FSCP WF  G  SLIHKILDPNP+
Sbjct  200  ADVWSCGVILYVLMAGYLPFEENDLPTLYDKITAGQFSCPYWFSPGVTSLIHKILDPNPK  259

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RI IE+IR D WFKK Y+ +K  E E+V+LDD+ A FD+ E++  +EQ    D GPL +
Sbjct  260  ARITIEQIREDTWFKKTYVAIKRGEDENVDLDDVQAVFDNIEDKYVSEQVTRNDGGPLVM  319

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GL+LS LFDR Q+    QTRF+++KPAK  ++T+EVVA+SMG K H +NY
Sbjct  320  NAFEMITLSQGLDLSALFDRQQEFVKRQTRFVSRKPAKTIVATIEVVAKSMGLKVHSQNY  379

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K+R+EG+S++++S F+V+L++F+VAP+ FMVD++K AGD+ E+ +FYK  C  +E +IW+
Sbjct  380  KLRLEGVSSNRMSPFAVVLQVFEVAPSLFMVDVRKVAGDTLEYHRFYKKLCNKMESIIWR  439

Query  64   PPDELCKSRITKAKS  20
            P +   KS + +  +
Sbjct  440  PIEVSEKSTLLRTAT  454



>ref|XP_011017773.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X2 [Populus euphratica]
Length=381

 Score =   314 bits (805),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 147/243 (60%), Positives = 186/243 (77%), Gaps = 0/243 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVIL+VLMAGYLPF+E DL TLY KI  AE+SCP WF  GAK+LI KIL+PNP 
Sbjct  129  ADVWSCGVILFVLMAGYLPFEEADLPTLYRKINAAEYSCPFWFSPGAKALIDKILNPNPR  188

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE I+   WF+K Y PV   E E+VNLDD++A FDD E++   EQ  N   GPL +
Sbjct  189  TRIGIEGIKKHPWFQKNYEPVGHREDEEVNLDDVHAVFDDIEDQYVAEQLENSVGGPLVM  248

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPAK  +ST+E VA+SM  K H RNY
Sbjct  249  NAFEMITLSQGLNLSALFDRRQDYIKRQTRFVSRKPAKDIISTIEAVAESMNLKVHTRNY  308

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+S +K   F+V+LE+++VAP+ FMVD +KA+G++ E+ KFYKNFC  LE++IWK
Sbjct  309  KTRLEGVSENKAGQFAVVLEVYEVAPSLFMVDARKASGETLEYHKFYKNFCTKLENIIWK  368

Query  64   PPD  56
            PP+
Sbjct  369  PPE  371



>ref|XP_011017771.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Populus euphratica]
 ref|XP_011017772.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Populus euphratica]
Length=444

 Score =   316 bits (810),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 147/243 (60%), Positives = 186/243 (77%), Gaps = 0/243 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVIL+VLMAGYLPF+E DL TLY KI  AE+SCP WF  GAK+LI KIL+PNP 
Sbjct  192  ADVWSCGVILFVLMAGYLPFEEADLPTLYRKINAAEYSCPFWFSPGAKALIDKILNPNPR  251

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE I+   WF+K Y PV   E E+VNLDD++A FDD E++   EQ  N   GPL +
Sbjct  252  TRIGIEGIKKHPWFQKNYEPVGHREDEEVNLDDVHAVFDDIEDQYVAEQLENSVGGPLVM  311

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPAK  +ST+E VA+SM  K H RNY
Sbjct  312  NAFEMITLSQGLNLSALFDRRQDYIKRQTRFVSRKPAKDIISTIEAVAESMNLKVHTRNY  371

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+S +K   F+V+LE+++VAP+ FMVD +KA+G++ E+ KFYKNFC  LE++IWK
Sbjct  372  KTRLEGVSENKAGQFAVVLEVYEVAPSLFMVDARKASGETLEYHKFYKNFCTKLENIIWK  431

Query  64   PPD  56
            PP+
Sbjct  432  PPE  434



>ref|XP_002324651.1| CBL-interacting protein kinase 24 [Populus trichocarpa]
 gb|ABJ91232.1| CBL-interacting protein kinase 26 [Populus trichocarpa]
 gb|EEF03216.1| CBL-interacting protein kinase 24 [Populus trichocarpa]
Length=444

 Score =   316 bits (810),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 187/243 (77%), Gaps = 0/243 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVIL+VLMAGYLPF+E DL TLY KI  AE+SCP WF  GAK+LI KIL+PNP+
Sbjct  192  ADVWSCGVILFVLMAGYLPFEETDLPTLYRKINAAEYSCPFWFSPGAKALIDKILNPNPK  251

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE I+   WF+K Y PV   E E+VNLDD++A FDD E++   EQ  N + GPL +
Sbjct  252  TRIGIEGIKKHPWFQKNYEPVGHREDEEVNLDDVHAVFDDIEDQYVAEQLENSEDGPLVM  311

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPAK  +S +E VA+SM  K H RNY
Sbjct  312  NAFEMITLSQGLNLSALFDRRQDYIKRQTRFVSRKPAKDIISAIEAVAESMNLKVHTRNY  371

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+S +K   F+V+LE+++VAP+ FMVD +KA+G++ E+ KFYKNFC  LE++IWK
Sbjct  372  KTRLEGVSENKAGQFAVVLEVYEVAPSLFMVDARKASGETLEYHKFYKNFCTKLENIIWK  431

Query  64   PPD  56
            PP+
Sbjct  432  PPE  434



>gb|AFW76400.1| putative CBL-interacting protein kinase family protein [Zea mays]
Length=384

 Score =   314 bits (804),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 196/255 (77%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPF+E DL +LY KI  A++SCP WF  GAKSLI ++LDPNP 
Sbjct  129  ADIWSCGVILYVLMAGYLPFEENDLPSLYEKITAAKYSCPYWFSPGAKSLIQRLLDPNPR  188

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI I EIR D WF+K Y+ ++  E E+V+LDD+ A FD+ E++  +E+  ++D GPL +
Sbjct  189  TRITIGEIRADPWFEKNYVAIRRGEDENVSLDDVQAVFDNIEDKYVSEEVTHKDGGPLMM  248

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GL+LS LFDR Q+    QTRF+++KPAK  ++T+EVVA+SM  K H +NY
Sbjct  249  NAFEMITLSQGLDLSALFDRQQEYVKRQTRFVSRKPAKTIVATIEVVAESMSLKVHSQNY  308

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K+R+EG S+++ S F+V+LE+FQVAP+ FMVD++K AGD+ E+ +FYKN C  L+ +IW+
Sbjct  309  KLRLEGASSNRTSQFAVVLEVFQVAPSLFMVDVRKVAGDTLEYHRFYKNLCSRLDSIIWR  368

Query  64   PPDELCKSRITKAKS  20
            P +   KS++ +  +
Sbjct  369  PIEVSAKSKLLRTTT  383



>gb|AFW87209.1| putative CBL-interacting protein kinase family protein [Zea mays]
Length=327

 Score =   311 bits (798),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 140/248 (56%), Positives = 192/248 (77%), Gaps = 0/248 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPF+E DL  LY KI  A++SCP WF  GAKSLI +ILDPNP 
Sbjct  72   ADIWSCGVILYVLMAGYLPFEENDLPHLYEKITAAQYSCPYWFSPGAKSLIQRILDPNPR  131

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IEEIR D WFKK Y+ ++  E E+V+LDD+ A FD+ E++  +++  ++D GPL +
Sbjct  132  TRITIEEIREDPWFKKNYVTIRCGEDENVSLDDVQAIFDNIEDKYVSDEVTHKDGGPLMM  191

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GL+LS LFDR Q+    QTRF+++KPAK  ++T+EVVA+SMG K H RNY
Sbjct  192  NAFEMIALSQGLDLSALFDRQQEFVKRQTRFVSRKPAKTVVATIEVVAESMGLKVHSRNY  251

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K+R+EG ++++ S F+V+LE+F+VAP+ FMVD++K AGD+ E+ +FY+N C  L  +IW+
Sbjct  252  KVRLEGPASNRASQFAVVLEVFEVAPSLFMVDVRKVAGDTPEYHRFYENLCSKLCSIIWR  311

Query  64   PPDELCKS  41
            P +   KS
Sbjct  312  PTEVSAKS  319



>ref|XP_008792023.1| PREDICTED: CBL-interacting protein kinase 24-like isoform X2 
[Phoenix dactylifera]
Length=410

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 142/243 (58%), Positives = 182/243 (75%), Gaps = 0/243 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPFDE DL TL  KI  AEFSCP WF  GA  LIHKILDPNP 
Sbjct  165  ADIWSCGVILYVLMAGYLPFDETDLPTLSRKINTAEFSCPPWFSSGAILLIHKILDPNPN  224

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI +E I+ND WF+  Y+PV+  E E+VNLDD+ A F+D E+    EQ   +D GPL +
Sbjct  225  TRIHVEGIKNDPWFRINYVPVRHGEEEEVNLDDVQAVFNDIEDHYVTEQVETKDGGPLIM  284

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GL+LS LFDR QD    QTRF+++  A+  ++T+E VAQS+G K H +NY
Sbjct  285  NAFEMITLSQGLDLSALFDRRQDFVKRQTRFVSRHSARTIIATIEAVAQSIGLKVHSQNY  344

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMR+EG+S++K+  F V+LE+F+VA + FMVD++K AGD+ E+ KFY   CG LE +IW+
Sbjct  345  KMRLEGVSSNKMGQFIVVLEVFEVASSLFMVDVRKVAGDTLEYHKFYNILCGKLEHIIWR  404

Query  64   PPD  56
            P D
Sbjct  405  PTD  407



>ref|XP_008649101.1| PREDICTED: CBL-interacting protein kinase 24 [Zea mays]
 ref|XP_008649102.1| PREDICTED: CBL-interacting protein kinase 24 [Zea mays]
 gb|AFW76399.1| putative CBL-interacting protein kinase family protein [Zea mays]
Length=449

 Score =   315 bits (807),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 196/255 (77%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPF+E DL +LY KI  A++SCP WF  GAKSLI ++LDPNP 
Sbjct  194  ADIWSCGVILYVLMAGYLPFEENDLPSLYEKITAAKYSCPYWFSPGAKSLIQRLLDPNPR  253

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI I EIR D WF+K Y+ ++  E E+V+LDD+ A FD+ E++  +E+  ++D GPL +
Sbjct  254  TRITIGEIRADPWFEKNYVAIRRGEDENVSLDDVQAVFDNIEDKYVSEEVTHKDGGPLMM  313

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GL+LS LFDR Q+    QTRF+++KPAK  ++T+EVVA+SM  K H +NY
Sbjct  314  NAFEMITLSQGLDLSALFDRQQEYVKRQTRFVSRKPAKTIVATIEVVAESMSLKVHSQNY  373

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K+R+EG S+++ S F+V+LE+FQVAP+ FMVD++K AGD+ E+ +FYKN C  L+ +IW+
Sbjct  374  KLRLEGASSNRTSQFAVVLEVFQVAPSLFMVDVRKVAGDTLEYHRFYKNLCSRLDSIIWR  433

Query  64   PPDELCKSRITKAKS  20
            P +   KS++ +  +
Sbjct  434  PIEVSAKSKLLRTTT  448



>gb|KCW79999.1| hypothetical protein EUGRSUZ_C01333 [Eucalyptus grandis]
Length=550

 Score =   317 bits (813),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 189/255 (74%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPFDE DL TLY KI  AE+ CP W  +GA SLI ++LDPNP 
Sbjct  293  ADIWSCGVILYVLMAGYLPFDETDLPTLYKKITAAEYVCPIWLSLGATSLIKRLLDPNPR  352

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RI IE IR   WF+K Y+P +  E E+VNLDD+ A FDD +E+   EQ  ++D GPL +
Sbjct  353  NRIGIEGIRKHSWFRKNYMPARCKEDEEVNLDDVRAVFDDIKEQYVAEQSESKDGGPLIM  412

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++K AKV +S++E VA SMG K H RN+
Sbjct  413  NAFEMITLSQGLNLSSLFDRQQDFIKRQTRFVSRKSAKVIISSIEAVAGSMGLKVHTRNF  472

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EGLSA+K   F+ ++E+++VAP+ F+VD++KAAGD+ ++ KFY++FC  LE +IWK
Sbjct  473  KTRLEGLSANKAGQFAAVIEVYEVAPSLFLVDVRKAAGDTLDYHKFYRSFCKKLEHIIWK  532

Query  64   PPDELCKSRITKAKS  20
            P +   K  + + KS
Sbjct  533  PTESNAKHGLLRTKS  547



>gb|KCW80000.1| hypothetical protein EUGRSUZ_C01333 [Eucalyptus grandis]
Length=548

 Score =   317 bits (813),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 189/255 (74%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPFDE DL TLY KI  AE+ CP W  +GA SLI ++LDPNP 
Sbjct  291  ADIWSCGVILYVLMAGYLPFDETDLPTLYKKITAAEYVCPIWLSLGATSLIKRLLDPNPR  350

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RI IE IR   WF+K Y+P +  E E+VNLDD+ A FDD +E+   EQ  ++D GPL +
Sbjct  351  NRIGIEGIRKHSWFRKNYMPARCKEDEEVNLDDVRAVFDDIKEQYVAEQSESKDGGPLIM  410

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++K AKV +S++E VA SMG K H RN+
Sbjct  411  NAFEMITLSQGLNLSSLFDRQQDFIKRQTRFVSRKSAKVIISSIEAVAGSMGLKVHTRNF  470

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EGLSA+K   F+ ++E+++VAP+ F+VD++KAAGD+ ++ KFY++FC  LE +IWK
Sbjct  471  KTRLEGLSANKAGQFAAVIEVYEVAPSLFLVDVRKAAGDTLDYHKFYRSFCKKLEHIIWK  530

Query  64   PPDELCKSRITKAKS  20
            P +   K  + + KS
Sbjct  531  PTESNAKHGLLRTKS  545



>ref|XP_010687974.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=455

 Score =   315 bits (806),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 146/256 (57%), Positives = 188/256 (73%), Gaps = 0/256 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVL+AGYLPF+E DL +LY KI  A FSCP WF  GAKSLI ++LDPNP+
Sbjct  191  ADIWSCGVILYVLLAGYLPFEETDLPSLYKKINAATFSCPFWFSPGAKSLIERMLDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE IR D WF   YIPV+    EDVNLDDI AAFDD E+    EQ  + + GPL +
Sbjct  251  TRITIEGIRKDPWFPVNYIPVRQGVEEDVNLDDIRAAFDDIEDHFVTEQSRHLNRGPLIM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I +S+GLNLS LFDR QD    QTRF++++  K  +ST+E VA+SMG K H R Y
Sbjct  311  NAFEMITMSQGLNLSALFDRRQDYVKRQTRFVSRETPKDIISTIETVAESMGLKVHTRGY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA+K   F+V++EI++VAP+ FMVD ++AAGD+ E+ KFYK+FC  L+ +IWK
Sbjct  371  KTRLEGISANKAGQFAVVVEIYEVAPSLFMVDTRRAAGDTLEYHKFYKSFCAKLDHIIWK  430

Query  64   PPDELCKSRITKAKSK  17
            P D + +      +SK
Sbjct  431  PKDGIIEGGTRSHESK  446



>ref|XP_008792021.1| PREDICTED: CBL-interacting protein kinase 24-like isoform X1 
[Phoenix dactylifera]
Length=434

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 142/243 (58%), Positives = 182/243 (75%), Gaps = 0/243 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPFDE DL TL  KI  AEFSCP WF  GA  LIHKILDPNP 
Sbjct  189  ADIWSCGVILYVLMAGYLPFDETDLPTLSRKINTAEFSCPPWFSSGAILLIHKILDPNPN  248

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI +E I+ND WF+  Y+PV+  E E+VNLDD+ A F+D E+    EQ   +D GPL +
Sbjct  249  TRIHVEGIKNDPWFRINYVPVRHGEEEEVNLDDVQAVFNDIEDHYVTEQVETKDGGPLIM  308

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GL+LS LFDR QD    QTRF+++  A+  ++T+E VAQS+G K H +NY
Sbjct  309  NAFEMITLSQGLDLSALFDRRQDFVKRQTRFVSRHSARTIIATIEAVAQSIGLKVHSQNY  368

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMR+EG+S++K+  F V+LE+F+VA + FMVD++K AGD+ E+ KFY   CG LE +IW+
Sbjct  369  KMRLEGVSSNKMGQFIVVLEVFEVASSLFMVDVRKVAGDTLEYHKFYNILCGKLEHIIWR  428

Query  64   PPD  56
            P D
Sbjct  429  PTD  431



>ref|XP_010086583.1| CBL-interacting serine/threonine-protein kinase 24 [Morus notabilis]
 gb|EXB21296.1| CBL-interacting serine/threonine-protein kinase 24 [Morus notabilis]
Length=445

 Score =   313 bits (803),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/275 (54%), Positives = 193/275 (70%), Gaps = 23/275 (8%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYV+MAGY PFDE DL +LY KI  AEFSCPSWF  GAKSLIHKILDPNP+
Sbjct  167  ADVWSCGVILYVIMAGYRPFDESDLPSLYKKINAAEFSCPSWFSPGAKSLIHKILDPNPK  226

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            +RI IE IR D WF+K Y PV++ E E+VNLDD+ A F+D E++    +  + + GPL +
Sbjct  227  SRICIEGIRKDPWFRKNYAPVELREDEEVNLDDVCAVFEDIEDQYVAGRSESNEGGPLIM  286

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPAK  +S +E VA+SM  K H R Y
Sbjct  287  NAFEMITLSQGLNLSALFDRQQDYVKRQTRFVSRKPAKAIISNVEAVAESMNLKVHTRGY  346

Query  244  KMRVEGLSADKISHFSVILE-----------------------IFQVAPTFFMVDIQKAA  134
            K R+EG+SA++   F+V+LE                       +F+VAP+ FMVD++KAA
Sbjct  347  KTRLEGISANRTGQFAVVLEVTSPESVTITVDCSSEFELFSQMVFEVAPSLFMVDVRKAA  406

Query  133  GDSTEFLKFYKNFCGNLEDLIWKPPDELCKSRITK  29
            GD+ E+ KFYK+FC  LE++IWKP + +  S + +
Sbjct  407  GDTLEYHKFYKSFCTKLENIIWKPTEGMANSSLLR  441



>ref|XP_003563655.1| PREDICTED: CBL-interacting protein kinase 24 isoform X1 [Brachypodium 
distachyon]
Length=446

 Score =   313 bits (803),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 191/255 (75%), Gaps = 0/255 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPF+E DL TLY KI  A FSCP WF  GAKSLI +ILDPNP+
Sbjct  191  ADVWSCGVILYVLMAGYLPFEENDLPTLYDKITAAHFSCPDWFSSGAKSLIQRILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TR+ +E IR D WFK  Y+  K  E E+V LDD+ A FD+ E++  +EQ  + D GPL +
Sbjct  251  TRMTVEGIRADAWFKNNYVAHKRGEDENVCLDDVQAVFDNIEDKYVSEQVTHNDGGPLIM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GL+LS LFDR Q+    QTRF+++KPA+   +T++VVA SMG K H  NY
Sbjct  311  NAFEMITLSQGLDLSSLFDRQQEYVKRQTRFVSRKPARTIAATIQVVADSMGIKVHSYNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K+R+EG+S++K+S F+V+LEIF+VAP+ FMVD++K AGD+ E+ +FYKN C  LE +IW+
Sbjct  371  KLRLEGVSSNKMSPFAVVLEIFEVAPSLFMVDVRKVAGDTLEYHRFYKNLCSKLESIIWR  430

Query  64   PPDELCKSRITKAKS  20
            P +   KS + +  +
Sbjct  431  PIEVSAKSALLRTTT  445



>ref|NP_001291255.1| CBL-interacting serine/threonine-protein kinase 24 [Populus euphratica]
 gb|ACN76476.1| CBL-interacting protein kinase 26 [Populus euphratica]
Length=444

 Score =   313 bits (803),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 185/243 (76%), Gaps = 0/243 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVIL+VLMAGYLPF+E DL TLY KI  AE+SCP WF  GAK+LI KIL+PNP 
Sbjct  192  ADVWSCGVILFVLMAGYLPFEEADLPTLYRKINAAEYSCPFWFSPGAKALIDKILNPNPR  251

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE I+   WF+K Y PV   E E+VNLDD++A FDD E++   EQ  N   GPL +
Sbjct  252  TRIGIEGIKKHPWFQKNYEPVGHREDEEVNLDDVHAVFDDIEDQYVAEQLENSVGGPLVM  311

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPA+  +ST+E VA SM  K H RNY
Sbjct  312  NAFEMITLSQGLNLSALFDRRQDYIKRQTRFVSRKPAEDIISTIEAVAGSMNLKVHTRNY  371

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+S +K   F+V+LE+++VAP+ FMVD +KA+G++ E+ KFYKNFC  LE++IWK
Sbjct  372  KTRLEGVSENKAGQFAVVLEVYEVAPSLFMVDARKASGETLEYHKFYKNFCTKLENIIWK  431

Query  64   PPD  56
            PP+
Sbjct  432  PPE  434



>ref|XP_004965931.1| PREDICTED: CBL-interacting protein kinase 24-like isoform X1 
[Setaria italica]
Length=452

 Score =   313 bits (803),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 196/256 (77%), Gaps = 0/256 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPF+E DL +LY KI  A++SCP WF  GA SLI +ILDPNP+
Sbjct  194  ADIWSCGVILYVLMAGYLPFEENDLPSLYEKITAAQYSCPYWFSPGASSLIQRILDPNPK  253

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IEEIR D WFKK Y+ ++  E E+V+LDD+ A FD+ E++  +E+  ++D GPL +
Sbjct  254  TRITIEEIRADPWFKKNYVAIRRGEDENVSLDDVQAVFDNIEDKYVSEEVTHKDGGPLMM  313

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GL+LS LFDR Q+    QTRF+++KPA   ++T+EVVA+SMG K H +NY
Sbjct  314  NAFEMITLSQGLDLSALFDRQQEFVKRQTRFVSRKPAMTIVATIEVVAESMGLKVHSQNY  373

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K+R+EG S +++  F+V+LEIF+VAP+ +MVD++K AG++ E+ +FYKN C  L+ +IW+
Sbjct  374  KLRLEGTSPNRMGQFAVVLEIFEVAPSLYMVDVRKVAGETLEYHRFYKNLCSKLDSIIWR  433

Query  64   PPDELCKSRITKAKSK  17
            P +   KS + +  ++
Sbjct  434  PIEVSAKSTLLRTTTR  449



>ref|XP_004965932.1| PREDICTED: CBL-interacting protein kinase 24-like isoform X2 
[Setaria italica]
Length=452

 Score =   313 bits (803),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 196/256 (77%), Gaps = 0/256 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPF+E DL +LY KI  A++SCP WF  GA SLI +ILDPNP+
Sbjct  194  ADIWSCGVILYVLMAGYLPFEENDLPSLYEKITAAQYSCPYWFSPGASSLIQRILDPNPK  253

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IEEIR D WFKK Y+ ++  E E+V+LDD+ A FD+ E++  +E+  ++D GPL +
Sbjct  254  TRITIEEIRADPWFKKNYVAIRRGEDENVSLDDVQAVFDNIEDKYVSEEVTHKDGGPLMM  313

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GL+LS LFDR Q+    QTRF+++KPA   ++T+EVVA+SMG K H +NY
Sbjct  314  NAFEMITLSQGLDLSALFDRQQEFVKRQTRFVSRKPAMTIVATIEVVAESMGLKVHSQNY  373

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K+R+EG S +++  F+V+LEIF+VAP+ +MVD++K AG++ E+ +FYKN C  L+ +IW+
Sbjct  374  KLRLEGTSPNRMGQFAVVLEIFEVAPSLYMVDVRKVAGETLEYHRFYKNLCSKLDSIIWR  433

Query  64   PPDELCKSRITKAKSK  17
            P +   KS + +  ++
Sbjct  434  PIEVSAKSTLLRTTTR  449



>ref|XP_010050019.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Eucalyptus grandis]
 gb|KCW82857.1| hypothetical protein EUGRSUZ_C04226 [Eucalyptus grandis]
Length=445

 Score =   313 bits (802),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 143/252 (57%), Positives = 186/252 (74%), Gaps = 0/252 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYV+MAG+LPFDEVDL TLY K   A FSCP WF  GAKSLI KILDPNP+
Sbjct  190  ADIWSCGVILYVIMAGFLPFDEVDLPTLYKKTNAAAFSCPIWFSPGAKSLIQKILDPNPK  249

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI I  IR   WF K Y+P+K  E+EDV+LDD++A FDD +E+   E     +  PL +
Sbjct  250  TRIDINNIRKHPWFHKNYVPIKHREHEDVDLDDVHAVFDDIKEKYVAENSETLEGSPLMM  309

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDRG D    QTRF+++KPA+V +S++E V +SMG K H  N+
Sbjct  310  NAFEMITLSQGLNLSPLFDRGLDHVKRQTRFVSRKPAQVVISSIEAVGKSMGRKVHTLNF  369

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA+K    +V+LE+F+VAP+ FMVD++KAAGD+ EF KFYK+ C  LE +I K
Sbjct  370  KTRIEGISANKAGQLAVVLEMFEVAPSLFMVDVRKAAGDTLEFHKFYKDLCSKLEHIILK  429

Query  64   PPDELCKSRITK  29
            P + L  + + +
Sbjct  430  PAEHLASASLLR  441



>ref|XP_010687975.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=446

 Score =   313 bits (802),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 144/245 (59%), Positives = 184/245 (75%), Gaps = 0/245 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVL+AGYLPF+E DL +LY KI  A FSCP WF  GAKSLI ++LDPNP+
Sbjct  191  ADIWSCGVILYVLLAGYLPFEETDLPSLYKKINAATFSCPFWFSPGAKSLIERMLDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE IR D WF   YIPV+    EDVNLDDI AAFDD E+    EQ  + + GPL +
Sbjct  251  TRITIEGIRKDPWFPVNYIPVRQGVEEDVNLDDIRAAFDDIEDHFVTEQSRHLNRGPLIM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I +S+GLNLS LFDR QD    QTRF++++  K  +ST+E VA+SMG K H R Y
Sbjct  311  NAFEMITMSQGLNLSALFDRRQDYVKRQTRFVSRETPKDIISTIETVAESMGLKVHTRGY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA+K   F+V++EI++VAP+ FMVD ++AAGD+ E+ KFYK+FC  L+ +IWK
Sbjct  371  KTRLEGISANKAGQFAVVVEIYEVAPSLFMVDTRRAAGDTLEYHKFYKSFCAKLDHIIWK  430

Query  64   PPDEL  50
            P D +
Sbjct  431  PKDGM  435



>gb|AGY49229.1| CBL-interacting protein kinase 6 [Physcomitrella patens]
Length=448

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/241 (59%), Positives = 187/241 (78%), Gaps = 1/241 (0%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVIL+VLMAG+LPFDE DL TLY KI  A+F+CP WF  GAK+LI  ILDPNP
Sbjct  188  VADIWSCGVILFVLMAGFLPFDEADLNTLYSKIREADFTCPPWFSSGAKTLITNILDPNP  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
             TRIR++ IR+DEWFKK Y+PV++ + ED+NLDD+ AAFDD++E+   EQ   +D GP  
Sbjct  248  LTRIRMKGIRDDEWFKKNYVPVRMYDDEDINLDDVEAAFDDSKEQFVKEQREVKDVGPSL  307

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            +NAF+LI LS+GLNLS LFDR QD    QTRF ++KPA+  ++ ME  A+SMGF    RN
Sbjct  308  MNAFELISLSQGLNLSALFDRRQDHVKRQTRFTSKKPARDIINRMETAAKSMGFGVGTRN  367

Query  247  YKMRVEGLSADKIS-HFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLI  71
            YKMR+E  S  +IS H +V +E+++VAP+ FM++++KAAGD+ E+ KFYK+FC  L+D+I
Sbjct  368  YKMRLEAASECRISQHLAVAIEVYEVAPSLFMIEVRKAAGDTLEYHKFYKSFCTRLKDII  427

Query  70   W  68
            W
Sbjct  428  W  428



>ref|NP_001132150.1| uncharacterized LOC100193569 [Zea mays]
 gb|ACF80873.1| unknown [Zea mays]
 gb|AFW87211.1| LOW QUALITY PROTEIN: putative CBL-interacting protein kinase 
family protein [Zea mays]
Length=451

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 140/248 (56%), Positives = 192/248 (77%), Gaps = 0/248 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPF+E DL  LY KI  A++SCP WF  GAKSLI +ILDPNP 
Sbjct  196  ADIWSCGVILYVLMAGYLPFEENDLPHLYEKITAAQYSCPYWFSPGAKSLIQRILDPNPR  255

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IEEIR D WFKK Y+ ++  E E+V+LDD+ A FD+ E++  +++  ++D GPL +
Sbjct  256  TRITIEEIREDPWFKKNYVTIRCGEDENVSLDDVQAIFDNIEDKYVSDEVTHKDGGPLMM  315

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GL+LS LFDR Q+    QTRF+++KPAK  ++T+EVVA+SMG K H RNY
Sbjct  316  NAFEMIALSQGLDLSALFDRQQEFVKRQTRFVSRKPAKTVVATIEVVAESMGLKVHSRNY  375

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K+R+EG ++++ S F+V+LE+F+VAP+ FMVD++K AGD+ E+ +FY+N C  L  +IW+
Sbjct  376  KVRLEGPASNRASQFAVVLEVFEVAPSLFMVDVRKVAGDTPEYHRFYENLCSKLCSIIWR  435

Query  64   PPDELCKS  41
            P +   KS
Sbjct  436  PTEVSAKS  443



>ref|XP_004490474.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X3 [Cicer arietinum]
Length=373

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPFDE+DLTTLY KI++AEFSCP+WFPVGAKSLI +ILDPNPE
Sbjct  189  ADVWSCGVILYVLMAGYLPFDELDLTTLYSKIDKAEFSCPAWFPVGAKSLIQRILDPNPE  248

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RI IE+IRNDEWFKK Y+P  ++EYEDVNLDDINAAFD  E++  N Q   ED GPL L
Sbjct  249  NRITIEQIRNDEWFKKSYVPAHLLEYEDVNLDDINAAFDSAEDQSDNPQSEIEDTGPLIL  308

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAFD+I+LS+GLNL+ +FDRGQDS  +QTRF+TQKPAKV LS+MEVVAQSMGFKTHIRNY
Sbjct  309  NAFDMIMLSQGLNLASIFDRGQDSMKYQTRFVTQKPAKVVLSSMEVVAQSMGFKTHIRNY  368

Query  244  KM  239
            K+
Sbjct  369  KV  370



>gb|KEH28131.1| CBL-interacting kinase [Medicago truncatula]
Length=373

 Score =   308 bits (788),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPFDE+DLTTLY KI++A+FSCP+WFPVGAKSLI +ILDPNPE
Sbjct  189  ADVWSCGVILYVLMAGYLPFDELDLTTLYSKIDKADFSCPAWFPVGAKSLIQRILDPNPE  248

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RI IE+IRNDEWF+K Y+PV ++EYEDVNLD+INAAFD  E+E  N QC   D GPL L
Sbjct  249  HRITIEQIRNDEWFQKSYVPVHLLEYEDVNLDEINAAFDSAEDEGDNPQCEIADTGPLIL  308

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAFD+I+LS+GLNL+ +FDRGQD+  +QTRF+TQKPAKV LS+MEVVAQSMGFKTHIRNY
Sbjct  309  NAFDMIMLSQGLNLATIFDRGQDTMKYQTRFITQKPAKVVLSSMEVVAQSMGFKTHIRNY  368

Query  244  KM  239
            K+
Sbjct  369  KV  370



>gb|ADP37982.1| salt overly sensitive protein 2a [Gossypium hirsutum]
Length=421

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 191/253 (75%), Gaps = 1/253 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+ +MAGYLPF E+D+ TLY KI   +FS P WF   A SLI KILDPNP+
Sbjct  167  ADIWSCGVILFFIMAGYLPFYEIDIPTLYKKISAGQFSSPFWFSPEANSLIKKILDPNPK  226

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+IE I+   WFKK Y+PVK  E E+VNLDD+ A FDD E++  +EQ   ++ GPL +
Sbjct  227  TRIQIEGIKKHPWFKKNYLPVKPSE-EEVNLDDVRAVFDDIEDQYVSEQSVAKEGGPLMM  285

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KP +  +S++E VA+SMG K H RNY
Sbjct  286  NAFEMITLSQGLNLSSLFDRQQDYVKRQTRFVSRKPPRDIISSVEAVAESMGLKVHTRNY  345

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+E +SA+K+  F+V+LE+F+VAP+ FM D++KA+GD+ E+ KFYKNFC  LE++IWK
Sbjct  346  KTRLERISANKVGEFAVVLEVFEVAPSLFMADVRKASGDTLEYHKFYKNFCTKLENIIWK  405

Query  64   PPDELCKSRITKA  26
            P +++    + ++
Sbjct  406  PTEDVANPSVLRS  418



>gb|KJB64757.1| hypothetical protein B456_010G063300 [Gossypium raimondii]
Length=383

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 191/253 (75%), Gaps = 1/253 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+ +MAGYLPF E+D+ TLY KI   +FS P WF   A SLI KILDPNP+
Sbjct  129  ADIWSCGVILFFIMAGYLPFYEIDIPTLYKKISAGQFSSPFWFSPEANSLIKKILDPNPK  188

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+IE I+   WFKK Y+PVK  + E+VNLDD+ A FDD E++  +EQ   ++ GPL +
Sbjct  189  TRIQIEGIKKHPWFKKNYLPVKPSD-EEVNLDDVRAVFDDIEDQYVSEQSVAKEGGPLMM  247

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KP +  +S++E VA+SMG K H RNY
Sbjct  248  NAFEMITLSQGLNLSSLFDRQQDYVKRQTRFVSRKPPRDIISSVEAVAESMGLKVHTRNY  307

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+E +SA+K+  F+V+LE+F+VAP+ FM D++KAAGD+ E+ KFYKNFC  LE++IWK
Sbjct  308  KTRLERISANKVGEFAVVLEVFEVAPSLFMTDVRKAAGDTLEYHKFYKNFCTKLENIIWK  367

Query  64   PPDELCKSRITKA  26
            P +++    + ++
Sbjct  368  PTEDVANPSVLRS  380



>gb|ADP37983.1| salt overly sensitive protein 2b [Gossypium hirsutum]
Length=445

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 191/253 (75%), Gaps = 1/253 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+ +MAGYLPF E+D+ TLY KI   +FS P WF   A SLI KILDPNP+
Sbjct  191  ADIWSCGVILFFIMAGYLPFYEIDIPTLYKKISAGQFSSPFWFSPEANSLIKKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+IE I+   WFKK Y+PVK  E E+VNLDD+ A FDD E++  +EQ   ++ GPL +
Sbjct  251  TRIQIEGIKKHPWFKKNYLPVKPSE-EEVNLDDVRAVFDDIEDQYVSEQSVAKEGGPLMM  309

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KP +  +S++E VA+SMG K H RNY
Sbjct  310  NAFEMITLSQGLNLSSLFDRQQDYVKRQTRFVSRKPPRDIISSVEAVAESMGLKVHTRNY  369

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+E +SA+K+  F+V+LE+F+VAP+ FM D++KA+GD+ E+ KFYKNFC  LE++IWK
Sbjct  370  KTRLERISANKVGEFAVVLEVFEVAPSLFMADVRKASGDTLEYHKFYKNFCTKLENIIWK  429

Query  64   PPDELCKSRITKA  26
            P +++    + ++
Sbjct  430  PTEDVANPSVLRS  442



>gb|KJB64749.1| hypothetical protein B456_010G063300 [Gossypium raimondii]
 gb|KJB64750.1| hypothetical protein B456_010G063300 [Gossypium raimondii]
 gb|KJB64752.1| hypothetical protein B456_010G063300 [Gossypium raimondii]
Length=445

 Score =   306 bits (785),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 191/253 (75%), Gaps = 1/253 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+ +MAGYLPF E+D+ TLY KI   +FS P WF   A SLI KILDPNP+
Sbjct  191  ADIWSCGVILFFIMAGYLPFYEIDIPTLYKKISAGQFSSPFWFSPEANSLIKKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+IE I+   WFKK Y+PVK  + E+VNLDD+ A FDD E++  +EQ   ++ GPL +
Sbjct  251  TRIQIEGIKKHPWFKKNYLPVKPSD-EEVNLDDVRAVFDDIEDQYVSEQSVAKEGGPLMM  309

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KP +  +S++E VA+SMG K H RNY
Sbjct  310  NAFEMITLSQGLNLSSLFDRQQDYVKRQTRFVSRKPPRDIISSVEAVAESMGLKVHTRNY  369

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+E +SA+K+  F+V+LE+F+VAP+ FM D++KAAGD+ E+ KFYKNFC  LE++IWK
Sbjct  370  KTRLERISANKVGEFAVVLEVFEVAPSLFMTDVRKAAGDTLEYHKFYKNFCTKLENIIWK  429

Query  64   PPDELCKSRITKA  26
            P +++    + ++
Sbjct  430  PTEDVANPSVLRS  442



>gb|KJB64751.1| hypothetical protein B456_010G063300 [Gossypium raimondii]
Length=446

 Score =   306 bits (784),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 191/253 (75%), Gaps = 1/253 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+ +MAGYLPF E+D+ TLY KI   +FS P WF   A SLI KILDPNP+
Sbjct  192  ADIWSCGVILFFIMAGYLPFYEIDIPTLYKKISAGQFSSPFWFSPEANSLIKKILDPNPK  251

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+IE I+   WFKK Y+PVK  + E+VNLDD+ A FDD E++  +EQ   ++ GPL +
Sbjct  252  TRIQIEGIKKHPWFKKNYLPVKPSD-EEVNLDDVRAVFDDIEDQYVSEQSVAKEGGPLMM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KP +  +S++E VA+SMG K H RNY
Sbjct  311  NAFEMITLSQGLNLSSLFDRQQDYVKRQTRFVSRKPPRDIISSVEAVAESMGLKVHTRNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+E +SA+K+  F+V+LE+F+VAP+ FM D++KAAGD+ E+ KFYKNFC  LE++IWK
Sbjct  371  KTRLERISANKVGEFAVVLEVFEVAPSLFMTDVRKAAGDTLEYHKFYKNFCTKLENIIWK  430

Query  64   PPDELCKSRITKA  26
            P +++    + ++
Sbjct  431  PTEDVANPSVLRS  443



>ref|XP_002968247.1| hypothetical protein SELMODRAFT_267186 [Selaginella moellendorffii]
 gb|ACQ83484.1| CBL-interacting protein kinase 05 [Selaginella moellendorffii]
 gb|EFJ30501.1| hypothetical protein SELMODRAFT_267186 [Selaginella moellendorffii]
Length=457

 Score =   306 bits (783),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 143/241 (59%), Positives = 184/241 (76%), Gaps = 3/241 (1%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAG+LPFDEVDL TLY KI  AEF CPSWF  GA+SLI +ILDPNP+
Sbjct  198  ADIWSCGVILYVLMAGFLPFDEVDLVTLYRKIHEAEFLCPSWFSPGARSLISRILDPNPQ  257

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCN-NEDFGPLA  428
            TRI++  IR D+WFK+ Y+PV++ + ED  LDDI A FDD+E++   EQ + NE  GP  
Sbjct  258  TRIQMFGIRKDDWFKRNYVPVRLADDEDGTLDDIEAVFDDSEDQFVKEQRDINE--GPSM  315

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            +NAF+LI LS+GLNLS LFDR QD    QTRF+++ PAK  L+ ME  A+SMG+K + R 
Sbjct  316  MNAFELITLSQGLNLSALFDRRQDLVKRQTRFISKCPAKELLARMEDTAKSMGYKVYKRG  375

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMR EGL+A +    +V +E+F+VAP+ +MV+++KA GD+ E+ KFYK+FC NL D IW
Sbjct  376  YKMRFEGLTAGRTGQLAVAVEVFEVAPSLYMVEVRKAVGDTLEYHKFYKSFCTNLRDTIW  435

Query  67   K  65
            K
Sbjct  436  K  436



>ref|XP_002976133.1| hypothetical protein SELMODRAFT_175338 [Selaginella moellendorffii]
 gb|EFJ23038.1| hypothetical protein SELMODRAFT_175338 [Selaginella moellendorffii]
Length=457

 Score =   306 bits (783),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 142/241 (59%), Positives = 184/241 (76%), Gaps = 3/241 (1%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAG+LPFDEVDL TLY KI  AEF CPSWF  GA+SLI +ILDPNP+
Sbjct  198  ADIWSCGVILYVLMAGFLPFDEVDLVTLYRKIHEAEFLCPSWFSPGARSLISRILDPNPQ  257

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCN-NEDFGPLA  428
            TRI++  IR D+WFK+ Y+PV++ + ED  LDDI A FDD+E++   EQ + NE  GP  
Sbjct  258  TRIQMFGIRKDDWFKRNYVPVRLADDEDGTLDDIEAVFDDSEDQFVKEQRDINE--GPSM  315

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            +NAF+LI LS+GLNLS LFDR QD    QTRF+++ PAK  L+ ME  A+SMG+K + R 
Sbjct  316  MNAFELITLSQGLNLSALFDRRQDLVKRQTRFISKCPAKELLARMEDTAKSMGYKVYKRG  375

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMR EGL+A +    +V +E+F+VAP+ +MV+++KA GD+ E+ KFYK+FC NL D +W
Sbjct  376  YKMRFEGLTAGRTGQLAVAVEVFEVAPSLYMVEVRKAVGDTLEYHKFYKSFCTNLRDTVW  435

Query  67   K  65
            K
Sbjct  436  K  436



>ref|XP_009607232.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X2 [Nicotiana tomentosiformis]
Length=426

 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 172/225 (76%), Gaps = 0/225 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGV+LYVLMAGYLPFDE DL TLY KI  AEFSCP WF  GA SLI KI+DPNP 
Sbjct  188  ADVWSCGVVLYVLMAGYLPFDEADLHTLYTKINAAEFSCPFWFSPGATSLIRKIIDPNPR  247

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+IE IR D WF+K Y+PV+    E VNLDD+ A FDD E+   +E+  N D GP  +
Sbjct  248  TRIKIEGIRRDPWFRKNYMPVRAKADEVVNLDDVRAVFDDIEDAFVSEKSENSDSGPFVM  307

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++PAKV ++T+E  A+S+G K H RNY
Sbjct  308  NAFEMITLSQGLNLSALFDRRQDYVKRQTRFVSRQPAKVIIATIEAAAESLGLKVHTRNY  367

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLK  110
            K R+EG++A+K   F+V++E+FQV P+ FMVD++KAAGD+ E+ K
Sbjct  368  KTRIEGVTANKAGQFAVVMEVFQVVPSLFMVDVRKAAGDTLEYHK  412



>ref|XP_006450913.1| hypothetical protein CICLE_v10008418mg [Citrus clementina]
 gb|ESR64153.1| hypothetical protein CICLE_v10008418mg [Citrus clementina]
Length=419

 Score =   302 bits (774),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 174/225 (77%), Gaps = 0/225 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVIL+VLMAGYLPF E DL TLY KI  AEFSCP WF  GA SLIHKILDPNP+
Sbjct  191  ADVWSCGVILFVLMAGYLPFGETDLPTLYKKINAAEFSCPFWFSSGATSLIHKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRIRIE IR   WF+K Y PV+  E E+VNLDD+ A FDD E++   EQ  N+  GPL +
Sbjct  251  TRIRIEGIRKHPWFRKNYNPVRCSEEEEVNLDDVRAVFDDIEDQYVAEQSENKVGGPLLM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNL+ LFDR QD    QTRF++++PA+V LS +E VA+S+  K H RNY
Sbjct  311  NAFEMITLSQGLNLAALFDRRQDYVKRQTRFVSRQPAQVILSNIEAVAESLSLKVHTRNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLK  110
            K R+EG+S++K   F+V+LE+F+VAP+ FMVD++KAAGD+ E+ K
Sbjct  371  KTRLEGVSSNKTGQFAVVLEVFEVAPSLFMVDVRKAAGDTLEYHK  415



>ref|XP_007013472.1| Salt overly sensitive protein 2a isoform 4 [Theobroma cacao]
 gb|EOY31091.1| Salt overly sensitive protein 2a isoform 4 [Theobroma cacao]
Length=425

 Score =   302 bits (773),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 182/225 (81%), Gaps = 1/225 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGV+L+V+MAGYLPFDE+DL TLY K+  A+FS P WF  GAKSL+ KILDPNP+
Sbjct  191  ADVWSCGVVLFVIMAGYLPFDEIDLPTLYKKVNAAQFSFPFWFSPGAKSLVQKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+IE I+ND WF+K Y+PV+  E E+VNLDD+ A FDD E++  +EQ   ++ GPL +
Sbjct  251  TRIKIEGIKNDPWFQKHYVPVRPRE-EEVNLDDVRAVFDDIEDQYVSEQSVVDEGGPLIM  309

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPA+V +S++E VA+SMG K H RNY
Sbjct  310  NAFEMITLSQGLNLSALFDRQQDYVKRQTRFVSRKPARVIISSVEAVAESMGLKVHTRNY  369

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLK  110
            K R+EG+SA+K+  F+V+LE+F+VAP+ FMVD++KAAGD+ E+ K
Sbjct  370  KARLEGISANKVGQFAVVLEVFEVAPSLFMVDVRKAAGDTLEYHK  414



>gb|AAX31387.1| serine/threonine protein kinase [Aegiceras corniculatum]
Length=183

 Score =   293 bits (750),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 158/183 (86%), Gaps = 2/183 (1%)
 Frame = -1

Query  697  GKIERAEFSCPSWFPVGAKSLIHKILDPNPETRIRIEEIRNDEWFKKGYIPVKIIEYEDV  518
             KIE+AE+SCP WFPVGAKSLI +ILDPNP TRIRIEEIRNDEWF +GY+PVK+IEYEDV
Sbjct  1    SKIEKAEYSCPPWFPVGAKSLIQQILDPNPGTRIRIEEIRNDEWFSRGYVPVKLIEYEDV  60

Query  517  NLDDINAAFDDTE--EEVPNEQCNNEDFGPLALNAFDLIILSEGLNLSVLFDRGQDSATH  344
            NLDD+N+ FDD E  EE   +   NED GPL+LNAFD+IILSEGLNLS LFDR QD    
Sbjct  61   NLDDVNSFFDDPETGEERTEQLYKNEDMGPLSLNAFDMIILSEGLNLSALFDRRQDPVKK  120

Query  343  QTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNYKMRVEGLSADKISHFSVILEIFQVAPT  164
            QTRF++QKPAKV LS+MEVVAQSMGFKTHIRN+KMR+EGLSA+K SHFS +LE+FQVAPT
Sbjct  121  QTRFVSQKPAKVVLSSMEVVAQSMGFKTHIRNFKMRIEGLSANKTSHFSAMLEVFQVAPT  180

Query  163  FFM  155
            F++
Sbjct  181  FYI  183



>gb|KJB64758.1| hypothetical protein B456_010G063300 [Gossypium raimondii]
Length=446

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 191/254 (75%), Gaps = 2/254 (1%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+ +MAGYLPF E+D+ TLY KI   +FS P WF   A SLI KILDPNP+
Sbjct  191  ADIWSCGVILFFIMAGYLPFYEIDIPTLYKKISAGQFSSPFWFSPEANSLIKKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+IE I+   WFKK Y+PVK  + E+VNLDD+ A FDD E++  +EQ   ++ GPL +
Sbjct  251  TRIQIEGIKKHPWFKKNYLPVKPSD-EEVNLDDVRAVFDDIEDQYVSEQSVAKEGGPLMM  309

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KP +  +S++E VA+SMG K H RNY
Sbjct  310  NAFEMITLSQGLNLSSLFDRQQDYVKRQTRFVSRKPPRDIISSVEAVAESMGLKVHTRNY  369

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLK-FYKNFCGNLEDLIW  68
            K R+E +SA+K+  F+V+LE+F+VAP+ FM D++KAAGD+ E+ K FYKNFC  LE++IW
Sbjct  370  KTRLERISANKVGEFAVVLEVFEVAPSLFMTDVRKAAGDTLEYHKQFYKNFCTKLENIIW  429

Query  67   KPPDELCKSRITKA  26
            KP +++    + ++
Sbjct  430  KPTEDVANPSVLRS  443



>ref|XP_002308077.2| CBL-interacting protein kinase 24 [Populus trichocarpa]
 gb|EEE91600.2| CBL-interacting protein kinase 24 [Populus trichocarpa]
Length=431

 Score =   300 bits (769),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/243 (58%), Positives = 180/243 (74%), Gaps = 5/243 (2%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVIL+VLMAGYLPF+E+DL TL  K     +SCP WF   AK+LI KILDPNP+
Sbjct  192  ADVWSCGVILFVLMAGYLPFEEIDLPTLCRK-----YSCPFWFSPVAKALIDKILDPNPK  246

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE I+   WF+K Y PV   E E+VNLDD++A FDD E+    EQ  N + GPL +
Sbjct  247  TRIGIEGIKKHPWFRKSYEPVGHSEEEEVNLDDVHAVFDDIEDHYVAEQLENSEGGPLVM  306

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++ KPAKV +S  E VA+SM  K H  NY
Sbjct  307  NAFEMIALSQGLNLSALFDRRQDYVKKQTRFVSHKPAKVIISAFEAVAESMNLKFHTHNY  366

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+S +K   F+V+LE+++VAP+ FMVD +KA+G++ E+ +FYKNFC  LE++IWK
Sbjct  367  KTRLEGISENKAGQFAVVLEVYEVAPSLFMVDARKASGETLEYHEFYKNFCAQLENIIWK  426

Query  64   PPD  56
            PP+
Sbjct  427  PPE  429



>ref|XP_010435433.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Camelina sativa]
 ref|XP_010435434.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Camelina sativa]
Length=447

 Score =   301 bits (770),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 135/252 (54%), Positives = 184/252 (73%), Gaps = 0/252 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+V+MAG+LPF E DL  LY KI  AEF+CP WF    KSLIHKILDPNP+
Sbjct  192  ADIWSCGVILFVIMAGFLPFSETDLPGLYRKINAAEFACPPWFSAEVKSLIHKILDPNPK  251

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+I+ IRND WFK  Y+P ++ E E+VNLDD+ A FD  E     E   ++D GPL +
Sbjct  252  TRIQIQGIRNDHWFKLNYVPNRVREEEEVNLDDVRAVFDGIEGSYVAENLESKDEGPLMM  311

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++     ++ +E VA S+GFK+H RN+
Sbjct  312  NAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRRAPNEIIANIEAVADSIGFKSHTRNF  371

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EGLS+ K    +V++EI++VAP+ FMVD++KAAG++ E+ KFYK  C  LE++IW+
Sbjct  372  KTRLEGLSSIKAGQLAVVIEIYEVAPSLFMVDVRKAAGETLEYHKFYKKLCAKLENIIWR  431

Query  64   PPDELCKSRITK  29
              + + KS + +
Sbjct  432  AREGMPKSELLR  443



>gb|ABJ91233.1| CBL-interacting protein kinase 27 [Populus trichocarpa]
Length=431

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/243 (58%), Positives = 179/243 (74%), Gaps = 5/243 (2%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVIL+VLMAGYLPF+E+DL TL  K     +SCP WF   AK+LI KILDPNP+
Sbjct  192  ADVWSCGVILFVLMAGYLPFEEIDLPTLCRK-----YSCPFWFSPVAKALIDKILDPNPK  246

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE I+   WF+K Y PV   E E+VNLDD++A FDD E+    EQ  N + GPL +
Sbjct  247  TRIGIEGIKKHPWFRKSYEPVGHSEEEEVNLDDVHAVFDDIEDHYVAEQLENSEGGPLVM  306

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++ KPAKV +S  E VA+SM  K H  NY
Sbjct  307  NAFEMIALSQGLNLSALFDRRQDYVKKQTRFVSHKPAKVIISAFEAVAESMNLKFHTHNY  366

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+S +K   F+V+LE+++V P+ FMVD +KA+G++ E+ +FYKNFC  LE++IWK
Sbjct  367  KTRLEGISENKAGQFAVVLEVYEVGPSLFMVDARKASGETLEYHEFYKNFCAQLENIIWK  426

Query  64   PPD  56
            PP+
Sbjct  427  PPE  429



>ref|XP_010440713.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Camelina sativa]
 ref|XP_010440714.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Camelina sativa]
 ref|XP_010440715.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Camelina sativa]
 ref|XP_010440716.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Camelina sativa]
 ref|XP_010440717.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Camelina sativa]
Length=447

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/253 (53%), Positives = 183/253 (72%), Gaps = 0/253 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            +D+WSCGVIL+V+MAG+LPF E DL  LY KI  AEF+CP WF    KSLIHKILDPNP+
Sbjct  192  SDIWSCGVILFVIMAGFLPFSETDLPGLYRKINAAEFACPPWFSAEVKSLIHKILDPNPK  251

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+I+ IR D WFK  Y+P ++ E E+VNLDD+ A FD  E     E   N+D GPL +
Sbjct  252  TRIQIQGIRKDHWFKLNYVPNRVREEEEVNLDDVRAVFDGIEGSYVAENLENKDEGPLMM  311

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++     ++ +E VA S+GFK+H RN+
Sbjct  312  NAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRRAPNEIIANIEAVADSIGFKSHTRNF  371

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EGLS+ K    +V++EI++VAP+ FMVD++KAAG++ E+ KFYK  C  LE++IW+
Sbjct  372  KTRLEGLSSIKAGQLAVVIEIYEVAPSLFMVDVRKAAGETLEYHKFYKKLCAKLENIIWR  431

Query  64   PPDELCKSRITKA  26
              + + KS + + 
Sbjct  432  AREGMPKSELLRT  444



>ref|XP_002868418.1| hypothetical protein ARALYDRAFT_915669 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44677.1| hypothetical protein ARALYDRAFT_915669 [Arabidopsis lyrata subsp. 
lyrata]
Length=446

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/253 (54%), Positives = 181/253 (72%), Gaps = 0/253 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+V++AGYLPF E DL  LY KI  AEFSCP WF    K LIH+ILDPNP+
Sbjct  191  ADIWSCGVILFVILAGYLPFSETDLPGLYRKINAAEFSCPPWFSAEVKFLIHRILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+I+ IR D WF+  Y+P++  E E+VNLDD++A FD  E     E    +D GPL +
Sbjct  251  TRIQIQGIRKDPWFRINYVPIRAREEEEVNLDDVHAVFDGIEGSYVAENVETKDEGPLMM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++K     ++ +E VA SMGFK+H RN+
Sbjct  311  NAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRKAPSEIIANIETVANSMGFKSHTRNF  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EGLS+ K    +V++EI++VAP+ FMVD++KAAG++ E+ KFYK  C  LE +IWK
Sbjct  371  KTRLEGLSSIKDGQLAVVIEIYEVAPSLFMVDVRKAAGETLEYHKFYKKLCAKLESIIWK  430

Query  64   PPDELCKSRITKA  26
              + + KS + K 
Sbjct  431  ATEGMPKSELLKT  443



>ref|XP_006405548.1| hypothetical protein EUTSA_v10027753mg [Eutrema salsugineum]
 gb|ESQ47001.1| hypothetical protein EUTSA_v10027753mg [Eutrema salsugineum]
Length=457

 Score =   299 bits (765),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 134/250 (54%), Positives = 183/250 (73%), Gaps = 0/250 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+V+MAG+LPF E DL +LY KI  AE+SCP WF   AKSLIH+ILDPNP+
Sbjct  202  ADIWSCGVILFVIMAGFLPFSETDLPSLYRKINAAEYSCPPWFSTEAKSLIHRILDPNPK  261

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+I+ IR D WF+  Y+P +  E E+VNLDD+ A FD  E     E    ++ GPL +
Sbjct  262  TRIQIQGIRKDPWFRLHYVPTRAKEEEEVNLDDVRAVFDGIEGSYVAENIERKEEGPLMM  321

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++   V ++ +E VA SMGFK + RN+
Sbjct  322  NAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRRAPSVIIANIEAVATSMGFKAYTRNF  381

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EGLS+ K   F+V++EI++VAP+ FMVD++KAAG++ E+ KFYK  C  LE++IW+
Sbjct  382  KTRLEGLSSIKAGPFAVVIEIYEVAPSLFMVDVRKAAGETLEYHKFYKKLCAKLENIIWR  441

Query  64   PPDELCKSRI  35
              + + KS +
Sbjct  442  ASEGMPKSEL  451



>ref|XP_006283730.1| hypothetical protein CARUB_v10004801mg [Capsella rubella]
 gb|EOA16628.1| hypothetical protein CARUB_v10004801mg [Capsella rubella]
Length=447

 Score =   298 bits (763),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 133/252 (53%), Positives = 183/252 (73%), Gaps = 0/252 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGV+L+V+MAG+LPF E DL  LY KI  AEF+CP WF    KSLIHKILDPNP+
Sbjct  192  ADIWSCGVVLFVIMAGFLPFSETDLPGLYRKINAAEFACPPWFSAEVKSLIHKILDPNPK  251

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+I+ IR D WFK  Y+P ++ E E+VNLDD+ A FD  E     E   ++D GPL +
Sbjct  252  TRIQIQGIRKDHWFKLNYVPNRVREEEEVNLDDVRAVFDGIEGSYVAENLESKDEGPLMM  311

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++     ++ +E VA S+GFK+H RN+
Sbjct  312  NAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRRAPNEIIANIEAVADSIGFKSHTRNF  371

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EGLS+ K    +V++EI++VAP+ FMVD++KAAG++ E+ KFYK  C  LE++IW+
Sbjct  372  KTRLEGLSSIKAGQLAVVIEIYEVAPSLFMVDVRKAAGETLEYHKFYKKLCAKLENIIWR  431

Query  64   PPDELCKSRITK  29
              + + KS + +
Sbjct  432  AREGMPKSELLR  443



>ref|XP_009396330.1| PREDICTED: CBL-interacting protein kinase 8 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=377

 Score =   295 bits (756),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 159/183 (87%), Gaps = 2/183 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVILYVL+AGYLPFDEVDLTTLY KIE+AEFSCPSWF +GAKSL+ KILDPNP
Sbjct  189  IADIWSCGVILYVLLAGYLPFDEVDLTTLYSKIEKAEFSCPSWFSIGAKSLLCKILDPNP  248

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            ETR+RIEEIRND+WFKK Y+PV  +E ED+NLDD+ AAFDD E+   +EQ  NE+ GPL 
Sbjct  249  ETRMRIEEIRNDDWFKKNYVPVSEVETEDINLDDVFAAFDDPEQ--ASEQSRNEELGPLN  306

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNLS LFDR QD   H+TRFL+ K A+V LS+MEVVAQSMGFKTHIRN
Sbjct  307  LNAFDLIILSQGLNLSALFDRRQDYTRHETRFLSCKSARVVLSSMEVVAQSMGFKTHIRN  366

Query  247  YKM  239
            YK+
Sbjct  367  YKI  369



>pdb|4D28|A Chain A, Crystal Structure Of The Kinase Domain Of Snrk3.11 At5g35410
 pdb|4D28|B Chain B, Crystal Structure Of The Kinase Domain Of Snrk3.11 At5g35410
 pdb|4D28|C Chain C, Crystal Structure Of The Kinase Domain Of Snrk3.11 At5g35410
 pdb|4D28|D Chain D, Crystal Structure Of The Kinase Domain Of Snrk3.11 At5g35410
Length=446

 Score =   298 bits (762),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 134/253 (53%), Positives = 180/253 (71%), Gaps = 0/253 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+V++AGYLPF E DL  LY KI  AEF CP WF    K LIH+ILDPNP+
Sbjct  191  ADIWSCGVILFVILAGYLPFSETDLPGLYRKINAAEFDCPPWFSAEVKFLIHRILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+I+ I+ D WF+K Y+P++  E E+VNLDDI A FD  E     E     D GPL +
Sbjct  251  TRIQIQGIKKDPWFRKNYVPIRAREEEEVNLDDIRAVFDGIEGSYVAENVERNDEGPLMM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++     ++ +E VA SMGFK+H RN+
Sbjct  311  NAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRREPSEIIANIEAVANSMGFKSHTRNF  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EGLS+ K    +V++EI++VAP+ FMVD++KAAG++ E+ KFYK  C  LE++IW+
Sbjct  371  KTRLEGLSSIKAGQLAVVIEIYEVAPSLFMVDVRKAAGETLEYHKFYKKLCSKLENIIWR  430

Query  64   PPDELCKSRITKA  26
              + + KS I + 
Sbjct  431  ATEGIPKSEILRT  443



>ref|XP_001776382.1| predicted protein [Physcomitrella patens]
 gb|EDQ58766.1| predicted protein [Physcomitrella patens]
 gb|ACQ83478.1| CBL-interacting protein kinase 06 [Physcomitrella patens]
Length=445

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/241 (57%), Positives = 182/241 (76%), Gaps = 3/241 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVIL+VLMAG+LPFDE DL TLY KI  A+F+CP WF  GAK+LI  ILDPNP
Sbjct  187  VADIWSCGVILFVLMAGFLPFDEADLNTLYSKIREADFTCPPWFSSGAKTLITNILDPNP  246

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
             TRIR++ IR+DEWFKK Y+PV++ + ED+NLDD+ AAFDD+  +V          GP  
Sbjct  247  LTRIRMKGIRDDEWFKKNYVPVRMYDDEDINLDDVEAAFDDS--KVCCHFIFTSYVGPSL  304

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            +NAF+LI LS+GLNLS LFDR QD    QTRF ++KPA+  ++ ME  A+SMGF    RN
Sbjct  305  MNAFELISLSQGLNLSALFDRRQDHVKRQTRFTSKKPARDIINRMETAAKSMGFGVGTRN  364

Query  247  YKMRVEGLSADKIS-HFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLI  71
            YKMR+E  S  +IS H +V +E+++VAP+ FM++++KAAGD+ E+ KFYK+FC  L+D+I
Sbjct  365  YKMRLEAASECRISQHLAVAIEVYEVAPSLFMIEVRKAAGDTLEYHKFYKSFCTRLKDII  424

Query  70   W  68
            W
Sbjct  425  W  425



>ref|XP_010450374.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Camelina sativa]
 ref|XP_010450375.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Camelina sativa]
 ref|XP_010450376.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Camelina sativa]
Length=447

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 133/252 (53%), Positives = 183/252 (73%), Gaps = 0/252 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+V+MAG+LPF E DL  LY KI  AEF+CP WF    KSLIHKILDPNP+
Sbjct  192  ADIWSCGVILFVIMAGFLPFSETDLPGLYRKINAAEFACPPWFSAEVKSLIHKILDPNPK  251

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+I+ IR D WFK  Y+P ++ E E+VNLDD+ A FD  E     E   ++D GPL +
Sbjct  252  TRIQIQGIRKDHWFKLNYVPNRVREEEEVNLDDVRAVFDGIEGSYVAENLESKDEGPLMM  311

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++     ++ +E VA S+GFK+H RN+
Sbjct  312  NAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRRAPNEIIANIEAVADSIGFKSHTRNF  371

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EGL++ K    +V++EI++VAP+ FMVD++KAAG++ E+ KFYK  C  LE++IW+
Sbjct  372  KTRLEGLASIKAGKLAVVIEIYEVAPSLFMVDVRKAAGETLEYHKFYKKLCAKLENIIWR  431

Query  64   PPDELCKSRITK  29
              + + KS + +
Sbjct  432  AREGMPKSELLR  443



>ref|XP_006594268.1| PREDICTED: CBL-interacting protein kinase 24-like isoform X2 
[Glycine max]
Length=434

 Score =   296 bits (758),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 176/225 (78%), Gaps = 0/225 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPF+E DL TLY +I  AEF CP WF    KS I KILDPNP+
Sbjct  191  ADVWSCGVILYVLMAGYLPFEEADLPTLYRRINAAEFVCPFWFSADTKSFIQKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TR++IEEIR + WFKK Y PVK+ E E VNLDD+ A FDD E++   E+    + GPL +
Sbjct  251  TRVKIEEIRKEPWFKKNYFPVKLGEDEQVNLDDVRAVFDDIEDQYVAERSEITEGGPLIM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD+   QTRF+++KPAKV +S++E VA+SMG K H RNY
Sbjct  311  NAFEMIALSQGLNLSPLFDRLQDNVKRQTRFVSRKPAKVIISSIEAVAESMGLKVHSRNY  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLK  110
            K+R+EG+SA+++  F+V+LE+F+VAP+ FMVD+++A GD+ ++ K
Sbjct  371  KVRLEGVSANRVGPFAVVLEVFEVAPSLFMVDVRRATGDTFDYHK  415



>ref|NP_198391.1| CBL-interacting serine/threonine-protein kinase 24 [Arabidopsis 
thaliana]
 sp|Q9LDI3.1|CIPKO_ARATH RecName: Full=CBL-interacting serine/threonine-protein kinase 
24; AltName: Full=Protein SALT OVERLY SENSITIVE 2; AltName: 
Full=SNF1-related kinase 3.11 [Arabidopsis thaliana]
 gb|AAF62923.1|AF237670_1 serine/threonine protein kinase SOS2 [Arabidopsis thaliana]
 gb|AAK72257.1|AF395081_1 CBL-interacting protein kinase 24 [Arabidopsis thaliana]
 dbj|BAA98146.1| serine/threonine protein kinase SOS2 [Arabidopsis thaliana]
 gb|AAM20472.1| serine/threonine protein kinase SOS2 [Arabidopsis thaliana]
 gb|AAN72149.1| serine/threonine protein kinase SOS2 [Arabidopsis thaliana]
 gb|AED93966.1| CBL-interacting serine/threonine-protein kinase 24 [Arabidopsis 
thaliana]
 emb|CCH26588.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26590.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26591.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26593.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26594.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26595.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26596.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26597.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26598.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26599.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26600.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26601.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26602.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26603.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26604.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26605.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26606.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26607.1| salt overly sensitive 2 [Arabidopsis thaliana]
Length=446

 Score =   296 bits (758),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 134/253 (53%), Positives = 180/253 (71%), Gaps = 0/253 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+V++AGYLPF E DL  LY KI  AEFSCP WF    K LIH+ILDPNP+
Sbjct  191  ADIWSCGVILFVILAGYLPFSETDLPGLYRKINAAEFSCPPWFSAEVKFLIHRILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+I+ I+ D WF+  Y+P++  E E+VNLDDI A FD  E     E     D GPL +
Sbjct  251  TRIQIQGIKKDPWFRLNYVPIRAREEEEVNLDDIRAVFDGIEGSYVAENVERNDEGPLMM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++     ++ +E VA SMGFK+H RN+
Sbjct  311  NAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRREPSEIIANIEAVANSMGFKSHTRNF  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EGLS+ K    +V++EI++VAP+ FMVD++KAAG++ E+ KFYK  C  LE++IW+
Sbjct  371  KTRLEGLSSIKAGQLAVVIEIYEVAPSLFMVDVRKAAGETLEYHKFYKKLCSKLENIIWR  430

Query  64   PPDELCKSRITKA  26
              + + KS I + 
Sbjct  431  ATEGIPKSEILRT  443



>ref|NP_001291227.1| CBL-interacting serine/threonine-protein kinase 24-like [Populus 
euphratica]
 gb|ACN76477.1| CBL-interacting protein kinase 27 [Populus euphratica]
Length=434

 Score =   295 bits (755),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 139/243 (57%), Positives = 181/243 (74%), Gaps = 2/243 (1%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVIL+VLMAGYLPF+E+DL TL  KI   ++SCP WF   AK+LI KILDPNP+
Sbjct  192  ADVWSCGVILFVLMAGYLPFEEIDLPTLCRKINAEKYSCPFWFSPVAKALIDKILDPNPK  251

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE I+   WF+K Y PV   E E+VNLDD++A  DD E+    EQ  N + GP+ +
Sbjct  252  TRIGIEGIKKHPWFRKSYEPVGHSEEEEVNLDDVHA--DDIEDHYVAEQLENSEGGPVVM  309

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPA+V +S  E VA+SM  K H RNY
Sbjct  310  NAFEMIALSQGLNLSALFDRHQDYVKQQTRFVSRKPAEVIISAFEAVAESMNLKFHTRNY  369

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+E +S +K  H +V+LE+++VAP+ FMVD +KA+G++ E+ KFYKNFC  LE++I K
Sbjct  370  KTRLERISENKAGHLAVVLEVYEVAPSLFMVDARKASGETLEYHKFYKNFCAQLENIILK  429

Query  64   PPD  56
            PP+
Sbjct  430  PPE  432



>ref|XP_011020136.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X2 [Populus euphratica]
Length=407

 Score =   292 bits (747),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 139/242 (57%), Positives = 179/242 (74%), Gaps = 2/242 (1%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVIL+VLMAGYLPF+E+DL TL  KI   ++SCP WF   AK+LI KILDPNP+
Sbjct  168  ADVWSCGVILFVLMAGYLPFEEIDLPTLCRKINAEKYSCPFWFSPVAKALIDKILDPNPK  227

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE I+   WF+K Y PV   E E+VNLDD++A  DD E+    EQ  N + GP+ +
Sbjct  228  TRIGIEGIKKHPWFQKNYEPVGHREDEEVNLDDVHA--DDIEDHYVAEQLENSEGGPVVM  285

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPAKV +S  E VA+SM  K H RNY
Sbjct  286  NAFEMIALSQGLNLSALFDRHQDYVKQQTRFVSRKPAKVIISAFEAVAESMNLKFHTRNY  345

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+E +S +K  H +V+LE+++VAP+ FMVD +KA+G++ E+ KFYKNFC  LE++I K
Sbjct  346  KTRLERISENKAGHLAVVLEVYEVAPSLFMVDARKASGETLEYHKFYKNFCAQLENIILK  405

Query  64   PP  59
             P
Sbjct  406  SP  407



>emb|CCH26589.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26592.1| salt overly sensitive 2 [Arabidopsis thaliana]
Length=446

 Score =   293 bits (749),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 133/253 (53%), Positives = 179/253 (71%), Gaps = 0/253 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+V++AGYLPF E DL  LY KI  AEFSCP WF    K LIH+ILDPNP+
Sbjct  191  ADIWSCGVILFVILAGYLPFSETDLPGLYRKINAAEFSCPPWFSAEVKFLIHRILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+I+ I+ D WF+  Y+P++  E E+VNLDDI A FD  E     E     D GPL +
Sbjct  251  TRIQIQGIKKDPWFRLNYVPIRAREEEEVNLDDIRAVFDGIEGSYVAENVERNDEGPLMM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++     ++ +E VA SM FK+H RN+
Sbjct  311  NAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRREPSEIIANIEAVANSMCFKSHTRNF  370

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EGLS+ K    +V++EI++VAP+ FMVD++KAAG++ E+ KFYK  C  LE++IW+
Sbjct  371  KTRLEGLSSIKAGQLAVVIEIYEVAPSLFMVDVRKAAGETLEYHKFYKKLCSKLENIIWR  430

Query  64   PPDELCKSRITKA  26
              + + KS I + 
Sbjct  431  ATEGIPKSEILRT  443



>emb|CDY36813.1| BnaC04g32060D [Brassica napus]
Length=453

 Score =   293 bits (750),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 176/247 (71%), Gaps = 0/247 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+V+MAG+LPF E DL +LY KI  AEFSCP WF    KSLI +ILDPNP 
Sbjct  198  ADIWSCGVILFVIMAGFLPFSETDLPSLYRKISAAEFSCPQWFSADVKSLIQRILDPNPN  257

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+I+ IR D WFK  Y+P +  E E+VNLDD+ A FD  E     E       GPL +
Sbjct  258  TRIQIQGIRKDRWFKLNYMPTRAKEEEEVNLDDVRAVFDGIEGSYVAENIERRYEGPLMM  317

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFD+ QD    QTRF++++   V ++ +E VA SMGF+ H RN+
Sbjct  318  NAFEMITLSQGLNLSALFDKRQDFVKRQTRFVSRREPSVIIANIEAVATSMGFRAHTRNF  377

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EGLS+ K   F+V++E+++VAP+ FMVD++KAAG++ E+ KFYK  C  LE++IW+
Sbjct  378  KTRLEGLSSIKAGQFAVVIEVYEVAPSLFMVDVRKAAGETLEYHKFYKKLCEKLENIIWR  437

Query  64   PPDELCK  44
              + + K
Sbjct  438  ATEGMPK  444



>ref|XP_011020135.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X1 [Populus euphratica]
Length=431

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/242 (57%), Positives = 179/242 (74%), Gaps = 2/242 (1%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVIL+VLMAGYLPF+E+DL TL  KI   ++SCP WF   AK+LI KILDPNP+
Sbjct  192  ADVWSCGVILFVLMAGYLPFEEIDLPTLCRKINAEKYSCPFWFSPVAKALIDKILDPNPK  251

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IE I+   WF+K Y PV   E E+VNLDD++A  DD E+    EQ  N + GP+ +
Sbjct  252  TRIGIEGIKKHPWFQKNYEPVGHREDEEVNLDDVHA--DDIEDHYVAEQLENSEGGPVVM  309

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPAKV +S  E VA+SM  K H RNY
Sbjct  310  NAFEMIALSQGLNLSALFDRHQDYVKQQTRFVSRKPAKVIISAFEAVAESMNLKFHTRNY  369

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+E +S +K  H +V+LE+++VAP+ FMVD +KA+G++ E+ KFYKNFC  LE++I K
Sbjct  370  KTRLERISENKAGHLAVVLEVYEVAPSLFMVDARKASGETLEYHKFYKNFCAQLENIILK  429

Query  64   PP  59
             P
Sbjct  430  SP  431



>ref|XP_009139958.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Brassica rapa]
 ref|XP_009139959.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Brassica rapa]
Length=453

 Score =   291 bits (744),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 130/247 (53%), Positives = 175/247 (71%), Gaps = 0/247 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+V+MAG+LPF E DL +LY KI  AEFSCP WF    KSLI +ILDPNP 
Sbjct  198  ADIWSCGVILFVIMAGFLPFSETDLPSLYRKISAAEFSCPQWFSADVKSLIQRILDPNPN  257

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+I+ IR   WF+  Y+P +  E E+VNLDD+ A FD  E     E       GPL +
Sbjct  258  TRIQIQGIRKHSWFRINYMPTRAKEEEEVNLDDVRAVFDGIEGSYVAENIERRYEGPLMM  317

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++   V ++ +E VA SMGF+ H RN+
Sbjct  318  NAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRREPSVIIANIEAVATSMGFRAHTRNF  377

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EGLS+ K   F+V++E+++VAP+ FMVD++KAAG++ E+ KFYK  C  LE++IW+
Sbjct  378  KTRLEGLSSIKAGQFAVVIEVYEVAPSLFMVDVRKAAGETLEYHKFYKKLCEKLENIIWR  437

Query  64   PPDELCK  44
              + + K
Sbjct  438  ATEGMPK  444



>gb|AGA37205.1| CBL-interacting protein kinase 24.1 [Brassica napus]
 emb|CDY44603.1| BnaA04g09870D [Brassica napus]
Length=453

 Score =   291 bits (744),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 130/247 (53%), Positives = 175/247 (71%), Gaps = 0/247 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+V+MAG+LPF E DL +LY KI  AEFSCP WF    KSLI +ILDPNP 
Sbjct  198  ADIWSCGVILFVIMAGFLPFSETDLPSLYRKISAAEFSCPQWFSADVKSLIQRILDPNPN  257

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI+I+ IR   WF+  Y+P +  E E+VNLDD+ A FD  E     E       GPL +
Sbjct  258  TRIQIQGIRKHSWFRINYMPTRAKEEEEVNLDDVRAVFDGIEGSYVAENIERRYEGPLMM  317

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++   V ++ +E VA SMGF+ H RN+
Sbjct  318  NAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRREPSVIIANIEAVATSMGFRAHTRNF  377

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EGLS+ K   F+V++E+++VAP+ FMVD++KAAG++ E+ KFYK  C  LE++IW+
Sbjct  378  KTRLEGLSSIKAGQFAVVIEVYEVAPSLFMVDVRKAAGETLEYHKFYKKLCEKLENIIWR  437

Query  64   PPDELCK  44
              + + K
Sbjct  438  ATEGMPK  444



>ref|XP_009788245.1| PREDICTED: CBL-interacting protein kinase 24-like isoform X2 
[Nicotiana sylvestris]
Length=400

 Score =   289 bits (739),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 136/268 (51%), Positives = 188/268 (70%), Gaps = 16/268 (6%)
 Frame = -1

Query  781  DVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPET  602
            DVWSCGVIL+VLM+GYLPFDEVDL TL+ KI  A+FSCP WF  GA SLI KILDPNP+T
Sbjct  130  DVWSCGVILFVLMSGYLPFDEVDLPTLFSKINAADFSCPFWFSPGAVSLIRKILDPNPDT  189

Query  601  RIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDF------  440
            RI+I+ I+ D WF+K Y+P ++ + E+VNLDD+ A FDD E E+ +E+  N D       
Sbjct  190  RIKIKGIKRDSWFRKDYLPFRVKDDEEVNLDDVRAVFDDIEGELVSEKSVNTDSSPLEEL  249

Query  439  ----------GPLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTME  290
                      GPL +NAF++I LS+GLNL+ LFDR QD    QTRF++++PA + +ST+E
Sbjct  250  VSKKSEYSEGGPLIMNAFEMITLSQGLNLAALFDRRQDYVKRQTRFVSRQPANIIISTIE  309

Query  289  VVAQSMGFKTHIRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLK  110
              A SM  K    NYK+R++G+ A+K   F+V+LE+F VAP+ +MVD++KAAG++ E+ K
Sbjct  310  AAAWSMDLKVTTHNYKIRLQGVRANKAGPFAVVLEVFLVAPSLYMVDVRKAAGETLEYHK  369

Query  109  FYKNFCGNLEDLIWKPPDELCKSRITKA  26
            FYK FC  ++++I KP +    S + + 
Sbjct  370  FYKEFCQKIDNIILKPKEGTGNSSLART  397



>gb|EMS54161.1| CBL-interacting protein kinase 24 [Triticum urartu]
Length=411

 Score =   288 bits (738),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 174/248 (70%), Gaps = 19/248 (8%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPF+E DL TLY KI  A FSCP WF  GAKSLI +ILDPNP+
Sbjct  175  ADIWSCGVILYVLMAGYLPFEENDLPTLYDKITAAHFSCPDWFSQGAKSLIQRILDPNPK  234

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TR+ I+E++ D WF K Y+ V+  E E+V+LDD+ AAFD+ E++  +EQ    D GPL +
Sbjct  235  TRMTIKEMKADTWFSKNYVGVRHGEDENVSLDDVQAAFDNIEDKYVSEQVTRNDGGPLMM  294

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR Q+    QTRF+++KPAK   +T+EVVA SMG K H +NY
Sbjct  295  NAFEMITLSQGLNLSSLFDRQQEYVKRQTRFVSRKPAKTIAATIEVVADSMGLKVHSQNY  354

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K                   IF+VAP+ FMVD++K AGDS E+ +FYKN C  LE +IW+
Sbjct  355  K-------------------IFEVAPSLFMVDVRKVAGDSLEYHRFYKNLCSKLESIIWR  395

Query  64   PPDELCKS  41
            P +   KS
Sbjct  396  PIEVSAKS  403



>ref|XP_009788220.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009788228.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009788237.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X1 [Nicotiana sylvestris]
Length=462

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/268 (51%), Positives = 188/268 (70%), Gaps = 16/268 (6%)
 Frame = -1

Query  781  DVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPET  602
            DVWSCGVIL+VLM+GYLPFDEVDL TL+ KI  A+FSCP WF  GA SLI KILDPNP+T
Sbjct  192  DVWSCGVILFVLMSGYLPFDEVDLPTLFSKINAADFSCPFWFSPGAVSLIRKILDPNPDT  251

Query  601  RIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDF------  440
            RI+I+ I+ D WF+K Y+P ++ + E+VNLDD+ A FDD E E+ +E+  N D       
Sbjct  252  RIKIKGIKRDSWFRKDYLPFRVKDDEEVNLDDVRAVFDDIEGELVSEKSVNTDSSPLEEL  311

Query  439  ----------GPLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTME  290
                      GPL +NAF++I LS+GLNL+ LFDR QD    QTRF++++PA + +ST+E
Sbjct  312  VSKKSEYSEGGPLIMNAFEMITLSQGLNLAALFDRRQDYVKRQTRFVSRQPANIIISTIE  371

Query  289  VVAQSMGFKTHIRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLK  110
              A SM  K    NYK+R++G+ A+K   F+V+LE+F VAP+ +MVD++KAAG++ E+ K
Sbjct  372  AAAWSMDLKVTTHNYKIRLQGVRANKAGPFAVVLEVFLVAPSLYMVDVRKAAGETLEYHK  431

Query  109  FYKNFCGNLEDLIWKPPDELCKSRITKA  26
            FYK FC  ++++I KP +    S + + 
Sbjct  432  FYKEFCQKIDNIILKPKEGTGNSSLART  459



>gb|EEC70824.1| hypothetical protein OsI_02303 [Oryza sativa Indica Group]
Length=554

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 155/182 (85%), Gaps = 2/182 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            LAD WSCGVILYVL+AGYLPFDEVDLTTLYGKIE AE+S P+WFP GAKSLIH+ILDPNP
Sbjct  368  LADTWSCGVILYVLLAGYLPFDEVDLTTLYGKIESAEYSFPAWFPNGAKSLIHRILDPNP  427

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            + RIRIEEIRNDEWFKK Y P + IE E+VNLDD+NAAFDD EE+   +   +++ GPL 
Sbjct  428  DKRIRIEEIRNDEWFKKNYEPTREIESEEVNLDDVNAAFDDPEEDA--DHTLDDEAGPLT  485

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDR QD    Q RFL++KPAKV +S+MEVVAQSMG+KTHIRN
Sbjct  486  LNAFDLIILSQGLNLAALFDRRQDYDKLQNRFLSRKPAKVIMSSMEVVAQSMGYKTHIRN  545

Query  247  YK  242
            YK
Sbjct  546  YK  547



>gb|EPS60358.1| hypothetical protein M569_14444, partial [Genlisea aurea]
Length=354

 Score =   278 bits (710),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 170/223 (76%), Gaps = 0/223 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+VLMAGYLPFDE DL +LY KI  AEFSCP WF + A SLI+ IL+PNP+
Sbjct  131  ADIWSCGVILFVLMAGYLPFDEADLQSLYNKINAAEFSCPYWFSLDAVSLINGILNPNPQ  190

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RI IE ++   WF+K Y+P+   E E+VNLDD+ A FDD E++   E+  +   GPL +
Sbjct  191  LRITIEGMKKHPWFQKSYVPIMPSEDEEVNLDDVCAVFDDIEDKYVKEEPQHHHDGPLIM  250

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFD+ QD     TRF++++PAKV +++ E  A+S+G K H RNY
Sbjct  251  NAFEMIALSQGLNLSALFDKRQDYVKRHTRFVSREPAKVIIASTEAAAESIGLKAHTRNY  310

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEF  116
            K R+E +SA++ +HF+V+LE+F+VAP+ FMVDI+KAAGD+ EF
Sbjct  311  KTRLERVSANRAAHFAVVLEVFEVAPSLFMVDIRKAAGDTLEF  353



>ref|XP_011622470.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X3 [Amborella trichopoda]
Length=403

 Score =   278 bits (711),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/249 (54%), Positives = 167/249 (67%), Gaps = 40/249 (16%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGY PFDE DL  LY KI  A+FSCPSWF  GA+SLIH+ILDP+PE
Sbjct  187  ADVWSCGVILYVLMAGYRPFDETDLANLYRKINVADFSCPSWFSAGARSLIHRILDPDPE  246

Query  604  TRIRIEEIRNDEWFKKGYIPVKI-IEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            +RI I+ IRND WF+K Y+PV+   EYEDVNLDD++A F+D E++  +EQ  + D GPL 
Sbjct  247  SRITIQAIRNDPWFRKNYVPVRHGGEYEDVNLDDVHAVFNDIEDQYVSEQKEDNDMGPLI  306

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            +NAF++I LS+GLNLS LFDR Q                                     
Sbjct  307  MNAFEMITLSQGLNLSALFDRRQ-------------------------------------  329

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
              MR+EG+SA+    F+V LE+F+VAP+ FMVD++KAAGD+ E+ KFYKNFC  +E +IW
Sbjct  330  --MRLEGISANNTGQFAVALEVFEVAPSLFMVDVRKAAGDTLEYHKFYKNFCSKIEHIIW  387

Query  67   KPPDELCKS  41
            KP D   KS
Sbjct  388  KPSDSTTKS  396



>gb|KHN47144.1| CBL-interacting protein kinase 24 [Glycine soja]
Length=446

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 174/247 (70%), Gaps = 22/247 (9%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLY----------------------GKIERAEFS  671
            ADVWSCGVILYVLMAGYLPF+E DL TL                         I  AEF 
Sbjct  191  ADVWSCGVILYVLMAGYLPFEEADLPTLTIAEYWGWKIGFPSSLEGATVLDSGINAAEFV  250

Query  670  CPSWFPVGAKSLIHKILDPNPETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAF  491
            CP WF    KS I KILDPNP+TR++IEEIR + WFKK Y PVK+ E E VNLDD+ A F
Sbjct  251  CPFWFSADTKSFIQKILDPNPKTRVKIEEIRKEPWFKKNYFPVKLGEDEQVNLDDVRAVF  310

Query  490  DDTEEEVPNEQCNNEDFGPLALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAK  311
            DD E++   E+    + GPL +NAF++I LS+GLNLS LFDR QD+   QTRF+++KPAK
Sbjct  311  DDIEDQYVAERSEITEGGPLIMNAFEMIALSQGLNLSPLFDRLQDNVKRQTRFVSRKPAK  370

Query  310  VALSTMEVVAQSMGFKTHIRNYKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAG  131
            V +S++E VA+SMG K H RNYK+R+EG+SA+++  F+V+LE+F+VAP+ FMVD+++A G
Sbjct  371  VIISSIEAVAESMGLKVHSRNYKVRLEGVSANRVGPFAVVLEVFEVAPSLFMVDVRRATG  430

Query  130  DSTEFLK  110
            D+ ++ K
Sbjct  431  DTFDYHK  437



>gb|EEE54746.1| hypothetical protein OsJ_02106 [Oryza sativa Japonica Group]
Length=579

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 155/182 (85%), Gaps = 2/182 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            LAD WSCGVILYVL+AGYLPFDEVDLTTLYGKIE AE+S P+WFP GAKSLIH+ILDPNP
Sbjct  393  LADTWSCGVILYVLLAGYLPFDEVDLTTLYGKIESAEYSFPAWFPNGAKSLIHRILDPNP  452

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
            + RIRIEEIRNDEWFKK Y P + IE E+VNLDD+NAAFDD EE+   +   +++ GPL 
Sbjct  453  DKRIRIEEIRNDEWFKKNYEPTREIESEEVNLDDVNAAFDDPEEDA--DHTLDDEAGPLT  510

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            LNAFDLIILS+GLNL+ LFDR QD    Q RFL++KPAKV +S+MEVVAQSMG+KTHIRN
Sbjct  511  LNAFDLIILSQGLNLAALFDRRQDYDKLQNRFLSRKPAKVIMSSMEVVAQSMGYKTHIRN  570

Query  247  YK  242
            YK
Sbjct  571  YK  572



>ref|XP_008242780.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Prunus mume]
Length=437

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/250 (54%), Positives = 177/250 (71%), Gaps = 9/250 (4%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPFDE +L TLY KI  AEFSCP WF   A SLIHKILDPNP+
Sbjct  191  ADVWSCGVILYVLMAGYLPFDETNLPTLYRKINAAEFSCPYWFSPEANSLIHKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            T + I        F+   I V I E  D+ +         ++++   E+  ++D GPL +
Sbjct  251  T-VSI-------LFQHMQILV-ISETIDLKIYTYLFTIGLSQDQYVAERSESKDGGPLLM  301

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPAKV +S +E VA+SM  K H RNY
Sbjct  302  NAFEMITLSQGLNLSALFDRRQDYINRQTRFVSRKPAKVIISNVEAVAESMSLKVHTRNY  361

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+S++K   F+V+LE+++VAP+ FMVD++KAAGD+ E+ KFYKNFC  L+D+IWK
Sbjct  362  KTRLEGISSNKAGQFAVVLEVYEVAPSLFMVDVRKAAGDTLEYHKFYKNFCAKLKDIIWK  421

Query  64   PPDELCKSRI  35
            P + +  S +
Sbjct  422  PKEGMASSNL  431



>ref|XP_010050650.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like, 
partial [Eucalyptus grandis]
Length=330

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/255 (50%), Positives = 169/255 (66%), Gaps = 24/255 (9%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPFDE DL TLY KI  AE+ CP W  +GA SLI ++LDPNP 
Sbjct  97   ADIWSCGVILYVLMAGYLPFDETDLPTLYKKITAAEYVCPIWLSLGATSLIKRLLDPNPR  156

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RI IE IR   WF+K Y+P +  E E+VNLDD+ A FDD +E+   EQ  ++D GPL  
Sbjct  157  NRIGIEGIRKHSWFRKNYMPARCKEDEEVNLDDVRAVFDDIKEQYVAEQSESKDGGPL--  214

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
                                  D    QTRF+++K AKV +S++E VA SMG K H RN+
Sbjct  215  ----------------------DFIKRQTRFVSRKSAKVIISSIEAVAGSMGLKVHTRNF  252

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EGLSA+K   F+ ++E+++VAP+ F+VD++KAAGD+ ++ KFY++FC  LE +IWK
Sbjct  253  KTRLEGLSANKAGQFAAVIEVYEVAPSLFLVDVRKAAGDTLDYHKFYRSFCKKLEHIIWK  312

Query  64   PPDELCKSRITKAKS  20
            P +   K  + + KS
Sbjct  313  PTESNAKHGLLRTKS  327



>ref|XP_001776846.1| predicted protein [Physcomitrella patens]
 gb|EDQ58396.1| predicted protein [Physcomitrella patens]
 gb|ACQ83479.1| CBL-interacting protein kinase 07 [Physcomitrella patens]
Length=441

 Score =   272 bits (696),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 173/245 (71%), Gaps = 3/245 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVIL+VLMAGYLPF+E DL TLY KI+ A F CP+WF  GAKSLI K+LDPN 
Sbjct  186  VADIWSCGVILFVLMAGYLPFNEADLKTLYEKIQHASFLCPAWFSPGAKSLILKMLDPNT  245

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDV-NLDDINAAFDDTEEEVPNEQCNNEDFGPL  431
             TRI +E I N  WFKK Y+P ++ + E+  +LDD+ + FD++EE   ++Q   E  GP 
Sbjct  246  RTRITLEGIYNHPWFKKNYVPARLSDAEEASDLDDVESVFDNSEERFVDDQLVKES-GPS  304

Query  430  ALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIR  251
             +NAF+LI LS+GLNLS LFDR QD    QT F +  PA   +S ME  AQSMGF+   R
Sbjct  305  MMNAFELITLSQGLNLSALFDRRQDHVKRQTCFTSNIPANEIISRMEGAAQSMGFRVETR  364

Query  250  NYKMRVEGLSADKIS-HFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDL  74
             YKMR+EG    KI+ H +V +E+F++AP+ FM++++KA GD+ E+ KFYK FC  ++D+
Sbjct  365  KYKMRLEGRGGGKINQHLAVAIEVFEMAPSVFMIEVRKAMGDTLEYHKFYKTFCDRMKDV  424

Query  73   IWKPP  59
              K P
Sbjct  425  TSKMP  429



>ref|XP_010907283.1| PREDICTED: CBL-interacting protein kinase 24 isoform X2 [Elaeis 
guineensis]
Length=409

 Score =   271 bits (694),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 168/249 (67%), Gaps = 30/249 (12%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +ADVWSCGVILYVLMAGYLPFDE DL TLY K                            
Sbjct  188  VADVWSCGVILYVLMAGYLPFDETDLPTLYRK----------------------------  219

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLA  428
              RI IE I+ND WF++ Y+PV+  E E VNL+D+ A F+D E+    EQ   +D GPL 
Sbjct  220  --RIHIEGIKNDPWFRRNYVPVRHGEEEKVNLEDVQAVFNDIEDHYVTEQVETKDGGPLI  277

Query  427  LNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRN  248
            +NAF++I LS+GL+LS LFDR QD    QTRF+++ PA+  ++T+E VAQSMG K H +N
Sbjct  278  MNAFEMITLSQGLDLSALFDRRQDCVKRQTRFVSRHPARTIIATIEAVAQSMGLKVHSQN  337

Query  247  YKMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIW  68
            YKMR+EG+S++K+  F+V+LE+F+VAP+ FMVD++K AGD+ E+ KFYK  CG LE +IW
Sbjct  338  YKMRLEGVSSNKMGQFTVVLEVFEVAPSLFMVDVRKVAGDTLEYHKFYKILCGKLEHIIW  397

Query  67   KPPDELCKS  41
            +P +   KS
Sbjct  398  RPAEAAAKS  406



>gb|AGY49230.1| CBL-interacting protein kinase 7 [Physcomitrella patens]
Length=443

 Score =   272 bits (696),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 173/245 (71%), Gaps = 3/245 (1%)
 Frame = -1

Query  787  LADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNP  608
            +AD+WSCGVIL+VLMAGYLPF+E DL TLY KI+ A F CP+WF  GAKSLI K+LDPN 
Sbjct  188  VADIWSCGVILFVLMAGYLPFNEADLKTLYEKIQHASFLCPAWFSPGAKSLILKMLDPNT  247

Query  607  ETRIRIEEIRNDEWFKKGYIPVKIIEYEDV-NLDDINAAFDDTEEEVPNEQCNNEDFGPL  431
             TRI +E I N  WFKK Y+P ++ + E+  +LDD+ + FD++EE   ++Q   E  GP 
Sbjct  248  RTRITLEGIYNHPWFKKNYVPARLSDAEEASDLDDVESVFDNSEERFVDDQLVKES-GPS  306

Query  430  ALNAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIR  251
             +NAF+LI LS+GLNLS LFDR QD    QT F +  PA   +S ME  AQSMGF+   R
Sbjct  307  MMNAFELITLSQGLNLSALFDRRQDHVKRQTCFTSNIPANEIISRMEGAAQSMGFRVETR  366

Query  250  NYKMRVEGLSADKIS-HFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDL  74
             YKMR+EG    KI+ H +V +E+F++AP+ FM++++KA GD+ E+ KFYK FC  ++D+
Sbjct  367  KYKMRLEGRGGGKINQHLAVAIEVFEMAPSVFMIEVRKAMGDTLEYHKFYKTFCDRMKDV  426

Query  73   IWKPP  59
              K P
Sbjct  427  TSKMP  431



>gb|ABR17813.1| unknown [Picea sitchensis]
Length=387

 Score =   270 bits (691),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 172/243 (71%), Gaps = 3/243 (1%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVIL+VLMAGYLPFD+ +L TLY KI +A+F+CPSWF   AK LI +ILDPNP+
Sbjct  142  ADLWSCGVILFVLMAGYLPFDDSNLMTLYKKIYKADFTCPSWFSSSAKKLITRILDPNPK  201

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI I EI ++EWFKKGY P K  E EDVNLDDI+A F+D+EE +  E+   E   P  +
Sbjct  202  TRITIPEILDNEWFKKGYKPPKFNEEEDVNLDDIDAVFNDSEEHLVTEKKETE---PELM  258

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF+LI +S+GLNL  LF+        +TRF +++PA   +S +E  A+ +GF    RNY
Sbjct  259  NAFELISMSQGLNLGNLFEMDMGMVKRETRFASKRPANEIVSKIEEAAKPLGFNVQKRNY  318

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KM+++G    +  H +V  E+F+VAP+ +MV+++KA GD+ EF KFYKN    L+D++WK
Sbjct  319  KMKMQGSKTGRKGHLNVATEVFEVAPSLYMVEVRKAGGDTLEFHKFYKNLSAGLKDVVWK  378

Query  64   PPD  56
              D
Sbjct  379  AED  381



>gb|KDO80231.1| hypothetical protein CISIN_1g013421mg [Citrus sinensis]
Length=406

 Score =   271 bits (692),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 154/201 (77%), Gaps = 0/201 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVIL+VLMAGYLPF E DL TLY KI  AEFSCP WF  GA SLIHKILDPNP+
Sbjct  191  ADVWSCGVILFVLMAGYLPFGETDLPTLYKKINAAEFSCPFWFSTGATSLIHKILDPNPK  250

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRIRIE IR   WF+K Y PVK  E E+VNLDD++A FDD E++   EQ  N+  GPL +
Sbjct  251  TRIRIEGIRKHPWFRKNYNPVKCSEEEEVNLDDVHAVFDDIEDQYVAEQSENKVGGPLLM  310

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNL+ LFDR QD    QTRF++++PA+V LS +E VA+S+  K H RNY
Sbjct  311  NAFEMITLSQGLNLAALFDRRQDYVKRQTRFVSRQPAQVILSNIEAVAESLSLKVHTRNY  370

Query  244  KMRVEGLSADKISHFSVILEI  182
            K R+EG+SA+K   F+V+LE+
Sbjct  371  KTRLEGVSANKTGQFAVVLEV  391



>ref|XP_008337394.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Malus domestica]
Length=405

 Score =   271 bits (692),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/241 (54%), Positives = 166/241 (69%), Gaps = 30/241 (12%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPFDE +L TLY K                             
Sbjct  190  ADIWSCGVILYVLMAGYLPFDETNLYTLYSK-----------------------------  220

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             RIRI+ IRND WFKK Y PVK  E E+V+LDD+ A F+D E++   E+   +D GPL +
Sbjct  221  -RIRIDGIRNDPWFKKNYAPVKYREDEEVSLDDVRAVFEDIEDQYIAERSEIKDGGPLLM  279

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPA+V +S +E VA+SM  K H RNY
Sbjct  280  NAFEMITLSQGLNLSALFDRRQDYVNRQTRFVSRKPAQVIISNVEAVAESMSLKVHTRNY  339

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            K R+EG+SA++   F+V+LE+++VAP+ FMVD++KAAGD+ E+ KFYKNFC  LED+IW 
Sbjct  340  KTRLEGISANRTGQFAVVLEVYEVAPSLFMVDVRKAAGDTLEYHKFYKNFCAKLEDIIWN  399

Query  64   P  62
            P
Sbjct  400  P  400



>dbj|BAD95977.1| Ser/Thr protein kinase [Lotus japonicus]
Length=365

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/252 (50%), Positives = 171/252 (68%), Gaps = 30/252 (12%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVL AGYLPF+E DL+TLY +                             
Sbjct  140  ADVWSCGVILYVLKAGYLPFEEADLSTLYRR-----------------------------  170

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             R++I EIR D WF++ Y+P+K+ E E VNLDD+ A FDD E++    Q    + GPL +
Sbjct  171  -RVKIGEIRKDPWFQRNYLPLKLNEDEQVNLDDVQAVFDDIEDQYVPVQSEITEGGPLVM  229

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF+++KPAKV +S+++VVA+SMG K   RNY
Sbjct  230  NAFEMITLSQGLNLSPLFDRHQDYVKRQTRFVSRKPAKVIISSIKVVAESMGLKLQSRNY  289

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMR+EGLSA+K   F+V+LE+++VAP  +MVD++KAAGD+ ++ KFYKN C  LE++IW+
Sbjct  290  KMRIEGLSANKAGQFAVVLEVYEVAPCLYMVDVRKAAGDTLDYHKFYKNLCAKLENIIWR  349

Query  64   PPDELCKSRITK  29
            P + +  S + +
Sbjct  350  PTETMPDSGLLR  361



>ref|XP_004508487.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Cicer arietinum]
Length=416

 Score =   261 bits (668),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/252 (49%), Positives = 172/252 (68%), Gaps = 30/252 (12%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            ADVWSCGVILYVLMAGYLPF+EVDL TL+ +                             
Sbjct  191  ADVWSCGVILYVLMAGYLPFEEVDLPTLFRR-----------------------------  221

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
             R++IEEIR D WF+K Y PVK+ E E VNL+D+ A FDD +++  +E+      GPL +
Sbjct  222  -RMKIEEIRKDPWFQKNYSPVKLREDEQVNLNDVQAVFDDIKDQYVSERSEITKGGPLIM  280

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GLNLS LFDR QD    QTRF++++PAKV +S++E VA+SMG K H R+Y
Sbjct  281  NAFEMITLSQGLNLSPLFDRHQDYVKRQTRFVSREPAKVIISSIEAVAESMGLKAHSRSY  340

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KMR+E + ++K+  F+V+LE+++VAP+ FMVD++KAAGD+ E+ KFYK+ C  LE +IW+
Sbjct  341  KMRIERVFSNKVGQFAVVLEVYEVAPSLFMVDVRKAAGDTLEYHKFYKSLCAKLESIIWR  400

Query  64   PPDELCKSRITK  29
            P +    S +++
Sbjct  401  PAETTSDSGLSR  412



>gb|AFW87208.1| putative CBL-interacting protein kinase family protein [Zea mays]
Length=303

 Score =   258 bits (658),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 159/203 (78%), Gaps = 0/203 (0%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            AD+WSCGVILYVLMAGYLPF+E DL  LY KI  A++SCP WF  GAKSLI +ILDPNP 
Sbjct  72   ADIWSCGVILYVLMAGYLPFEENDLPHLYEKITAAQYSCPYWFSPGAKSLIQRILDPNPR  131

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI IEEIR D WFKK Y+ ++  E E+V+LDD+ A FD+ E++  +++  ++D GPL +
Sbjct  132  TRITIEEIREDPWFKKNYVTIRCGEDENVSLDDVQAIFDNIEDKYVSDEVTHKDGGPLMM  191

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF++I LS+GL+LS LFDR Q+    QTRF+++KPAK  ++T+EVVA+SMG K H RNY
Sbjct  192  NAFEMIALSQGLDLSALFDRQQEFVKRQTRFVSRKPAKTVVATIEVVAESMGLKVHSRNY  251

Query  244  KMRVEGLSADKISHFSVILEIFQ  176
            K+R+EG ++++ S F+V+LE+ +
Sbjct  252  KVRLEGPASNRASQFAVVLEVVK  274



>ref|XP_008233068.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 9-like 
isoform X2 [Prunus mume]
Length=362

 Score =   259 bits (663),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 169/249 (68%), Gaps = 4/249 (2%)
 Frame = -1

Query  784  ADVWSCGVILYVLMAGYLPFDEVDLTTLYGKIERAEFSCPSWFPVGAKSLIHKILDPNPE  605
            +D+WSCGVIL+VLMAGYLPFDE +L  LY KI +AEF CPSWF  GAK LI +ILDPNP 
Sbjct  117  SDIWSCGVILFVLMAGYLPFDEPNLIGLYRKICKAEFLCPSWFSSGAKKLIQRILDPNPV  176

Query  604  TRIRIEEIRNDEWFKKGYIPVKIIEYEDVNLDDINAAFDDTEEEVPNEQCNNEDFGPLAL  425
            TRI I EI  +EWFKK Y P +  E EDVNLDD++A FD+++E+   E+       P+++
Sbjct  177  TRITIPEILENEWFKKDYKPAQFQEEEDVNLDDVDAVFDNSKEKFVTERKEK----PVSM  232

Query  424  NAFDLIILSEGLNLSVLFDRGQDSATHQTRFLTQKPAKVALSTMEVVAQSMGFKTHIRNY  245
            NAF+LI  S+  NL  LF++       +TRF +Q+PA   ++ +E  A+ +GF  H +NY
Sbjct  233  NAFELISRSKSFNLENLFEKQTGHVKRETRFTSQRPANEIMNKIEEAAKPLGFNVHKKNY  292

Query  244  KMRVEGLSADKISHFSVILEIFQVAPTFFMVDIQKAAGDSTEFLKFYKNFCGNLEDLIWK  65
            KM+++G    +  H SV  E+F+VAP+  MV+++K  GD+ EF KFYKNF   L+D++WK
Sbjct  293  KMKLQGDKHGRKGHLSVATEVFEVAPSVHMVELRKTGGDTLEFHKFYKNFSSGLQDIVWK  352

Query  64   PPDELCKSR  38
              +    SR
Sbjct  353  TEETTEGSR  361



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1586636554460