BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6857

Length=817
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009595284.1|  PREDICTED: beta-galactosidase 8                    335   1e-104   Nicotiana tomentosiformis
ref|XP_006340153.1|  PREDICTED: beta-galactosidase 8-like               333   7e-104   Solanum tuberosum [potatoes]
ref|XP_010313192.1|  PREDICTED: TBG5 protein isoform X1                 330   6e-103   Solanum lycopersicum
ref|XP_009766589.1|  PREDICTED: beta-galactosidase 8                    329   2e-102   Nicotiana sylvestris
ref|NP_001234312.1|  TBG5 protein precursor                             329   2e-102   
ref|XP_011089316.1|  PREDICTED: beta-galactosidase 8-like               323   2e-100   Sesamum indicum [beniseed]
ref|XP_002285084.2|  PREDICTED: beta-galactosidase 8                    323   2e-100   Vitis vinifera
emb|CDP07127.1|  unnamed protein product                                320   5e-99    Coffea canephora [robusta coffee]
gb|KDO73224.1|  hypothetical protein CISIN_1g003095mg                   317   9e-99    Citrus sinensis [Valencia orange]
ref|XP_007015421.1|  Beta-galactosidase 8 isoform 1                     318   1e-98    Theobroma cacao [chocolate]
ref|XP_007015424.1|  Beta-galactosidase 8 isoform 4                     317   3e-98    Theobroma cacao [chocolate]
gb|KDO73220.1|  hypothetical protein CISIN_1g003095mg                   317   1e-97    Citrus sinensis [Valencia orange]
ref|XP_002530296.1|  beta-galactosidase, putative                       316   2e-97    Ricinus communis
ref|XP_006424599.1|  hypothetical protein CICLE_v10027805mg             315   5e-97    Citrus clementina
ref|XP_009335064.1|  PREDICTED: beta-galactosidase 8-like isoform X2    310   8e-97    Pyrus x bretschneideri [bai li]
ref|XP_008359158.1|  PREDICTED: putative pentatricopeptide repeat...    305   1e-96    
ref|XP_008363504.1|  PREDICTED: beta-galactosidase 8-like               304   2e-96    Malus domestica [apple tree]
gb|KDO73221.1|  hypothetical protein CISIN_1g003095mg                   312   3e-96    Citrus sinensis [Valencia orange]
dbj|BAD91083.1|  beta-D-galactosidase                                   312   5e-96    Pyrus pyrifolia [sha li]
ref|NP_001289207.1|  beta-galactosidase 8-like precursor                312   5e-96    Pyrus x bretschneideri [bai li]
gb|ACJ83814.1|  unknown                                                 291   2e-95    Medicago truncatula
ref|XP_007207302.1|  hypothetical protein PRUPE_ppa001480mg             310   2e-95    Prunus persica
gb|KHN38778.1|  Beta-galactosidase 8                                    310   3e-95    Glycine soja [wild soybean]
ref|XP_003538213.1|  PREDICTED: beta-galactosidase 8-like               310   3e-95    Glycine max [soybeans]
dbj|BAA13685.1|  AR782                                                  291   3e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008225494.1|  PREDICTED: beta-galactosidase 8                    310   3e-95    Prunus mume [ume]
gb|ACJ86219.1|  unknown                                                 290   4e-95    Medicago truncatula
ref|XP_008366360.1|  PREDICTED: beta-galactosidase 8-like               308   9e-95    Malus domestica [apple tree]
ref|XP_008385297.1|  PREDICTED: beta-galactosidase 8-like               308   1e-94    Malus domestica [apple tree]
ref|XP_009338266.1|  PREDICTED: beta-galactosidase 8-like isoform X2    305   1e-94    Pyrus x bretschneideri [bai li]
ref|XP_002314274.2|  beta-galactosidase family protein                  308   1e-94    Populus trichocarpa [western balsam poplar]
ref|XP_011044378.1|  PREDICTED: beta-galactosidase 8                    308   1e-94    Populus euphratica
ref|XP_010253630.1|  PREDICTED: beta-galactosidase 8                    308   2e-94    Nelumbo nucifera [Indian lotus]
ref|XP_010689565.1|  PREDICTED: beta-galactosidase 8                    307   4e-94    Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KJB55481.1|  hypothetical protein B456_009G078400                    306   6e-94    Gossypium raimondii
ref|XP_010911712.1|  PREDICTED: beta-galactosidase 6-like               286   1e-93    Elaeis guineensis
ref|XP_012064843.1|  PREDICTED: beta-galactosidase 8                    306   1e-93    Jatropha curcas
ref|XP_011089891.1|  PREDICTED: beta-galactosidase 8-like isoform X1    306   1e-93    Sesamum indicum [beniseed]
ref|XP_004505982.1|  PREDICTED: beta-galactosidase 8-like               305   1e-93    Cicer arietinum [garbanzo]
ref|XP_007132236.1|  hypothetical protein PHAVU_011G077600g             305   2e-93    Phaseolus vulgaris [French bean]
ref|XP_009338265.1|  PREDICTED: beta-galactosidase 8-like isoform X1    305   3e-93    Pyrus x bretschneideri [bai li]
gb|EYU18852.1|  hypothetical protein MIMGU_mgv1a001263mg                304   5e-93    Erythranthe guttata [common monkey flower]
ref|XP_011461703.1|  PREDICTED: beta-galactosidase 8                    303   1e-92    Fragaria vesca subsp. vesca
emb|CAC44501.1|  beta-galactosidase                                     303   1e-92    Fragaria x ananassa
ref|XP_008358406.1|  PREDICTED: beta-galactosidase 8-like               303   1e-92    Malus domestica [apple tree]
ref|XP_008463829.1|  PREDICTED: beta-galactosidase 8                    303   2e-92    Cucumis melo [Oriental melon]
gb|KHG08626.1|  Beta-galactosidase 8 -like protein                      302   3e-92    Gossypium arboreum [tree cotton]
ref|XP_002879094.1|  beta-glactosidase 8                                301   4e-92    Arabidopsis lyrata subsp. lyrata
ref|XP_002862517.1|  hypothetical protein ARALYDRAFT_333310             294   5e-92    Arabidopsis lyrata subsp. lyrata
ref|XP_004487127.1|  PREDICTED: beta-galactosidase 8-like               301   5e-92    Cicer arietinum [garbanzo]
ref|XP_010510620.1|  PREDICTED: beta-galactosidase 8-like               301   6e-92    Camelina sativa [gold-of-pleasure]
ref|XP_003597217.1|  Beta-galactosidase                                 300   8e-92    Medicago truncatula
ref|XP_010032010.1|  PREDICTED: beta-galactosidase 8                    301   9e-92    Eucalyptus grandis [rose gum]
ref|XP_007207303.1|  hypothetical protein PRUPE_ppa001480mg             299   2e-91    Prunus persica
ref|XP_008791518.1|  PREDICTED: beta-galactosidase 6 isoform X2         298   3e-91    Phoenix dactylifera
ref|XP_003606403.1|  Beta-galactosidase                                 299   4e-91    Medicago truncatula
ref|XP_008791517.1|  PREDICTED: beta-galactosidase 6 isoform X1         299   4e-91    Phoenix dactylifera
emb|CAB64744.1|  putative beta-galactosidase                            298   7e-91    Arabidopsis thaliana [mouse-ear cress]
ref|NP_850121.1|  beta-galactosidase 8                                  298   8e-91    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189624.1|  beta-galactosidase 8                               298   1e-90    Arabidopsis thaliana [mouse-ear cress]
gb|AAD21482.1|  putative beta-galactosidase                             298   1e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010470077.1|  PREDICTED: beta-galactosidase 8-like               296   7e-90    Camelina sativa [gold-of-pleasure]
ref|XP_007132215.1|  hypothetical protein PHAVU_011G075900g             295   8e-90    Phaseolus vulgaris [French bean]
ref|XP_010414520.1|  PREDICTED: beta-galactosidase 8                    294   9e-90    Camelina sativa [gold-of-pleasure]
gb|KFK32294.1|  hypothetical protein AALP_AA6G223900                    295   1e-89    Arabis alpina [alpine rockcress]
ref|XP_007132205.1|  hypothetical protein PHAVU_011G074900g             295   1e-89    Phaseolus vulgaris [French bean]
ref|XP_004148770.1|  PREDICTED: beta-galactosidase 8                    295   1e-89    Cucumis sativus [cucumbers]
ref|XP_010910537.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    293   4e-89    Elaeis guineensis
gb|KHN21526.1|  Beta-galactosidase 8                                    293   7e-89    Glycine soja [wild soybean]
ref|XP_003543462.1|  PREDICTED: beta-galactosidase 8-like isoform 1     293   7e-89    Glycine max [soybeans]
ref|XP_006409871.1|  hypothetical protein EUTSA_v10016234mg             293   1e-88    Eutrema salsugineum
gb|AES67466.2|  beta-galactosidase-like protein                         292   1e-88    Medicago truncatula
gb|KHN32076.1|  Beta-galactosidase 8                                    283   1e-88    Glycine soja [wild soybean]
ref|XP_003597215.1|  Beta-galactosidase                                 292   2e-88    
ref|XP_006854486.1|  PREDICTED: beta-galactosidase 8                    293   2e-88    Amborella trichopoda
ref|XP_009103690.1|  PREDICTED: beta-galactosidase 8                    292   2e-88    Brassica rapa
emb|CDY15749.1|  BnaC04g15750D                                          291   5e-88    Brassica napus [oilseed rape]
ref|XP_010098210.1|  Beta-galactosidase 8                               291   8e-88    Morus notabilis
ref|XP_003538054.1|  PREDICTED: beta-galactosidase 8-like               290   1e-87    Glycine max [soybeans]
emb|CDY31204.1|  BnaC03g46870D                                          290   1e-87    Brassica napus [oilseed rape]
emb|CDX83288.1|  BnaA03g22180D                                          290   1e-87    Brassica napus [oilseed rape]
ref|XP_003597218.1|  Beta-galactosidase                                 297   1e-87    
emb|CDY04567.1|  BnaA07g13930D                                          289   2e-87    Brassica napus [oilseed rape]
ref|XP_006296187.1|  hypothetical protein CARUB_v10025350mg             288   5e-87    Capsella rubella
ref|XP_007132198.1|  hypothetical protein PHAVU_011G074300g             288   6e-87    Phaseolus vulgaris [French bean]
ref|XP_009133878.1|  PREDICTED: beta-galactosidase 8-like               288   7e-87    Brassica rapa
dbj|BAD20774.2|  beta-galactosidase                                     286   2e-86    Raphanus sativus
gb|AAQ21371.2|  beta-galactosidase                                      282   4e-85    Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_007152042.1|  hypothetical protein PHAVU_004G096800g             282   6e-85    Phaseolus vulgaris [French bean]
ref|XP_003540180.1|  PREDICTED: beta-galactosidase 8-like isoform 1     281   3e-84    Glycine max [soybeans]
gb|ACN25553.1|  unknown                                                 258   1e-82    Zea mays [maize]
gb|ABF95029.1|  Beta-galactosidase precursor, putative, expressed       271   7e-82    Oryza sativa Japonica Group [Japonica rice]
gb|ABF95028.1|  Beta-galactosidase precursor, putative, expressed       271   7e-81    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ24672.1|  hypothetical protein OsJ_08441                          271   1e-80    Oryza sativa Japonica Group [Japonica rice]
sp|Q10NX8.2|BGAL6_ORYSJ  RecName: Full=Beta-galactosidase 6; Shor...    271   1e-80    Oryza sativa Japonica Group [Japonica rice]
gb|ABK24373.1|  unknown                                                 270   3e-80    Picea sitchensis
ref|NP_001049591.1|  Os03g0255100                                       271   3e-80    
gb|EAY89299.1|  hypothetical protein OsI_10800                          270   3e-80    Oryza sativa Indica Group [Indian rice]
ref|XP_006649762.1|  PREDICTED: beta-galactosidase 6-like               267   2e-79    
gb|EMT18371.1|  Beta-galactosidase 6                                    263   1e-78    Aegilops tauschii
ref|XP_010228859.1|  PREDICTED: beta-galactosidase 6                    266   1e-78    Brachypodium distachyon [annual false brome]
ref|XP_004984968.1|  PREDICTED: beta-galactosidase 6-like               266   1e-78    Setaria italica
ref|XP_009398434.1|  PREDICTED: beta-galactosidase 8-like               265   2e-78    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002465536.1|  hypothetical protein SORBIDRAFT_01g040750          265   3e-78    Sorghum bicolor [broomcorn]
gb|ACR35639.1|  unknown                                                 261   4e-78    Zea mays [maize]
gb|KJB55482.1|  hypothetical protein B456_009G078400                    263   6e-78    Gossypium raimondii
dbj|BAJ95568.1|  predicted protein                                      261   7e-77    Hordeum vulgare subsp. vulgare [barley]
tpg|DAA44443.1|  TPA: hypothetical protein ZEAMMB73_968467              261   7e-77    Zea mays [maize]
ref|NP_001146370.1|  beta-galactosidase precursor                       261   8e-77    Zea mays [maize]
dbj|BAJ89450.1|  predicted protein                                      258   2e-76    Hordeum vulgare subsp. vulgare [barley]
ref|XP_009398591.1|  PREDICTED: beta-galactosidase 6-like               256   4e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010521771.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    253   1e-73    Tarenaya hassleriana [spider flower]
gb|KEH39322.1|  beta-galactosidase-like protein                         250   3e-73    Medicago truncatula
gb|EYU18851.1|  hypothetical protein MIMGU_mgv1a001293mg                246   1e-71    Erythranthe guttata [common monkey flower]
gb|EPS63867.1|  beta-galactosidase                                      240   2e-70    Genlisea aurea
gb|EYU40574.1|  hypothetical protein MIMGU_mgv1a001299mg                243   3e-70    Erythranthe guttata [common monkey flower]
gb|EYU18849.1|  hypothetical protein MIMGU_mgv1a001605mg                241   6e-70    Erythranthe guttata [common monkey flower]
gb|EYU18850.1|  hypothetical protein MIMGU_mgv1a001274mg                241   9e-70    Erythranthe guttata [common monkey flower]
ref|XP_008778218.1|  PREDICTED: beta-galactosidase 6-like               228   6e-69    Phoenix dactylifera
ref|XP_003635211.1|  PREDICTED: beta-galactosidase 6                    221   4e-68    Vitis vinifera
gb|ERN14823.1|  hypothetical protein AMTR_s00032p00109160               233   1e-66    Amborella trichopoda
ref|XP_006853356.2|  PREDICTED: beta-galactosidase 8                    234   2e-66    Amborella trichopoda
gb|ABR16628.1|  unknown                                                 229   4e-65    Picea sitchensis
ref|XP_011462809.1|  PREDICTED: beta-galactosidase 9                    224   2e-64    Fragaria vesca subsp. vesca
gb|AFK47105.1|  unknown                                                 209   4e-63    Lotus japonicus
ref|XP_009780201.1|  PREDICTED: beta-galactosidase 9-like               208   8e-63    Nicotiana sylvestris
ref|XP_010921988.1|  PREDICTED: beta-galactosidase 8-like isoform X1    220   4e-62    Elaeis guineensis
ref|XP_010921989.1|  PREDICTED: beta-galactosidase 8-like isoform X2    220   5e-62    Elaeis guineensis
gb|KJB69393.1|  hypothetical protein B456_011G021800                    219   7e-62    Gossypium raimondii
gb|AFG44826.1|  hypothetical protein 2_7725_01                          203   2e-61    Pinus taeda
ref|XP_007025758.1|  Beta-galactosidase 8                               218   2e-61    Theobroma cacao [chocolate]
gb|AEW08372.1|  hypothetical protein 2_7725_01                          202   3e-61    Pinus radiata
gb|AFG44819.1|  hypothetical protein 2_7725_01                          202   3e-61    Pinus taeda
gb|AFB33584.1|  hypothetical protein 2_7725_01                          202   4e-61    Pinus mugo [mountain pine]
ref|XP_010232635.1|  PREDICTED: beta-galactosidase 3                    217   4e-61    
ref|XP_010929758.1|  PREDICTED: beta-galactosidase 15 isoform X3        215   6e-61    Elaeis guineensis
gb|AGR44461.1|  beta-D-galactosidase 2                                  217   6e-61    Pyrus x bretschneideri [bai li]
gb|AFB33583.1|  hypothetical protein 2_7725_01                          201   6e-61    Pinus mugo [mountain pine]
ref|XP_006420948.1|  hypothetical protein CICLE_v10004268mg             216   8e-61    Citrus clementina
gb|AFB33581.1|  hypothetical protein 2_7725_01                          201   9e-61    Pinus mugo [mountain pine]
gb|EEC71891.1|  hypothetical protein OsI_04635                          216   9e-61    Oryza sativa Indica Group [Indian rice]
ref|XP_006493072.1|  PREDICTED: beta-galactosidase 9-like isoform X2    216   1e-60    
ref|XP_002521428.1|  beta-galactosidase, putative                       216   1e-60    
gb|AFG44822.1|  hypothetical protein 2_7725_01                          201   1e-60    Pinus taeda
ref|XP_010316700.1|  PREDICTED: beta-galactosidase 8-like isoform X2    216   1e-60    Solanum lycopersicum
ref|XP_010052369.1|  PREDICTED: beta-galactosidase 6-like isoform X3    215   1e-60    Eucalyptus grandis [rose gum]
ref|XP_010316699.1|  PREDICTED: beta-galactosidase 8-like isoform X1    216   1e-60    Solanum lycopersicum
ref|XP_006493071.1|  PREDICTED: beta-galactosidase 9-like isoform X1    216   2e-60    Citrus sinensis [Valencia orange]
ref|XP_006420947.1|  hypothetical protein CICLE_v10004268mg             216   2e-60    Citrus clementina
ref|XP_010316701.1|  PREDICTED: beta-galactosidase 6-like isoform X3    215   2e-60    Solanum lycopersicum
ref|XP_010052367.1|  PREDICTED: beta-galactosidase 8-like isoform X1    215   3e-60    Eucalyptus grandis [rose gum]
ref|XP_006645100.1|  PREDICTED: beta-galactosidase 3-like               214   4e-60    
ref|XP_010052368.1|  PREDICTED: beta-galactosidase 6-like isoform X2    214   4e-60    Eucalyptus grandis [rose gum]
dbj|BAK02766.1|  predicted protein                                      214   4e-60    Hordeum vulgare subsp. vulgare [barley]
ref|XP_010929757.1|  PREDICTED: beta-galactosidase 15 isoform X2        214   5e-60    Elaeis guineensis
dbj|BAD91079.1|  beta-D-galactosidase                                   214   5e-60    Pyrus pyrifolia [sha li]
ref|XP_010929755.1|  PREDICTED: beta-galactosidase 15 isoform X1        214   7e-60    Elaeis guineensis
ref|NP_001044964.1|  Os01g0875500                                       214   8e-60    
dbj|BAG95687.1|  unnamed protein product                                214   8e-60    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006360940.1|  PREDICTED: beta-galactosidase 9-like               214   9e-60    Solanum tuberosum [potatoes]
dbj|BAE72075.1|  pear beta-galactosidase3                               213   1e-59    Pyrus communis
ref|XP_009617413.1|  PREDICTED: beta-galactosidase 9-like               212   2e-59    Nicotiana tomentosiformis
gb|KCW54087.1|  hypothetical protein EUGRSUZ_I00065                     199   2e-59    Eucalyptus grandis [rose gum]
gb|AEE01408.1|  beta-galactosidase STBG2                                213   2e-59    Solanum lycopersicum
gb|ABK22678.1|  unknown                                                 203   2e-59    Picea sitchensis
ref|XP_009611323.1|  PREDICTED: beta-galactosidase 9                    213   2e-59    Nicotiana tomentosiformis
ref|XP_006347104.1|  PREDICTED: beta-galactosidase 6-like               212   2e-59    Solanum tuberosum [potatoes]
ref|XP_012091518.1|  PREDICTED: beta-galactosidase 8-like               212   3e-59    Jatropha curcas
gb|KGN64739.1|  hypothetical protein Csa_1G085360                       211   3e-59    Cucumis sativus [cucumbers]
ref|XP_008222836.1|  PREDICTED: beta-galactosidase 9                    212   4e-59    Prunus mume [ume]
ref|XP_009789912.1|  PREDICTED: beta-galactosidase 6-like isoform X2    211   5e-59    Nicotiana sylvestris
ref|XP_009789911.1|  PREDICTED: beta-galactosidase 6-like isoform X1    211   6e-59    Nicotiana sylvestris
ref|NP_001234298.2|  beta-galactosidase                                 211   6e-59    Solanum lycopersicum
ref|XP_002976692.1|  hypothetical protein SELMODRAFT_268001             211   6e-59    Selaginella moellendorffii
gb|AAF70821.1|AF154420_1  beta-galactosidase                            211   6e-59    Solanum lycopersicum
ref|XP_007227352.1|  hypothetical protein PRUPE_ppa001149mg             210   2e-58    Prunus persica
gb|KJB72045.1|  hypothetical protein B456_011G155500                    209   2e-58    Gossypium raimondii
ref|XP_008794977.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    209   2e-58    
gb|EMT22873.1|  Beta-galactosidase 3                                    210   2e-58    Aegilops tauschii
ref|XP_010030277.1|  PREDICTED: beta-galactosidase 3-like               199   2e-58    Eucalyptus grandis [rose gum]
gb|EEE53128.1|  hypothetical protein OsJ_35926                          200   2e-58    Oryza sativa Japonica Group [Japonica rice]
gb|EAY82933.1|  hypothetical protein OsI_38150                          200   2e-58    Oryza sativa Indica Group [Indian rice]
gb|KJB72044.1|  hypothetical protein B456_011G155500                    209   2e-58    Gossypium raimondii
ref|XP_002973160.1|  hypothetical protein SELMODRAFT_413650             209   2e-58    Selaginella moellendorffii
gb|KJB72043.1|  hypothetical protein B456_011G155500                    209   3e-58    Gossypium raimondii
ref|NP_001151478.1|  LOC100285111 precursor                             209   3e-58    Zea mays [maize]
gb|AAK62590.1|  At2g32810/F24L7.5                                       206   3e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006645099.1|  PREDICTED: beta-galactosidase 3-like               209   3e-58    
gb|ABA97653.1|  Galactose binding lectin domain containing protei...    200   3e-58    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002456725.1|  hypothetical protein SORBIDRAFT_03g041450          209   3e-58    Sorghum bicolor [broomcorn]
ref|XP_001753645.1|  predicted protein                                  209   3e-58    Physcomitrella patens
ref|XP_010674348.1|  PREDICTED: beta-galactosidase 10                   209   5e-58    Beta vulgaris subsp. vulgaris [Swiss chard]
dbj|BAF31232.1|  beta-D-galactosidase                                   208   7e-58    Persea americana
ref|XP_002317239.1|  beta-galactosidase family protein                  208   8e-58    Populus trichocarpa [western balsam poplar]
tpg|DAA56579.1|  TPA: beta-galactosidase isoform 1                      208   9e-58    Zea mays [maize]
ref|XP_010469543.1|  PREDICTED: beta-galactosidase 9 isoform X2         207   1e-57    Camelina sativa [gold-of-pleasure]
ref|XP_008383809.1|  PREDICTED: beta-galactosidase 8-like               207   1e-57    Malus domestica [apple tree]
ref|XP_010469542.1|  PREDICTED: beta-galactosidase 9 isoform X1         207   1e-57    Camelina sativa [gold-of-pleasure]
ref|XP_008224970.1|  PREDICTED: beta-galactosidase 8-like               207   2e-57    Prunus mume [ume]
ref|XP_011043264.1|  PREDICTED: beta-galactosidase 6-like isoform X1    207   2e-57    Populus euphratica
gb|EMS56907.1|  Beta-galactosidase 15                                   206   2e-57    Triticum urartu
gb|AHG94612.1|  beta-galactosidase                                      207   2e-57    Camellia sinensis [black tea]
dbj|BAB86232.1|  putative beta-D-galactosidase                          206   3e-57    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009418404.1|  PREDICTED: beta-galactosidase 5-like isoform X1    206   3e-57    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009607544.1|  PREDICTED: beta-galactosidase 8-like               206   3e-57    Nicotiana tomentosiformis
ref|XP_009418405.1|  PREDICTED: beta-galactosidase 5-like isoform X2    206   3e-57    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008460809.1|  PREDICTED: beta-galactosidase 10                   206   4e-57    Cucumis melo [Oriental melon]
ref|XP_010907798.1|  PREDICTED: beta-galactosidase 3 isoform X2         206   4e-57    Elaeis guineensis
ref|XP_012092087.1|  PREDICTED: beta-galactosidase 10                   206   4e-57    Jatropha curcas
ref|XP_010907797.1|  PREDICTED: beta-galactosidase 3 isoform X1         206   6e-57    Elaeis guineensis
ref|NP_001235722.1|  lectin                                             200   6e-57    Glycine max [soybeans]
ref|XP_004504354.1|  PREDICTED: beta-galactosidase 9-like               206   6e-57    Cicer arietinum [garbanzo]
ref|XP_002518051.1|  beta-galactosidase, putative                       206   7e-57    Ricinus communis
ref|NP_565755.1|  beta galactosidase 9                                  206   7e-57    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007214621.1|  hypothetical protein PRUPE_ppa001340mg             205   7e-57    Prunus persica
gb|KJB46895.1|  hypothetical protein B456_008G000600                    205   8e-57    Gossypium raimondii
gb|ACC60981.1|  beta-galactosidase 1 precursor                          205   9e-57    Petunia x hybrida [garden petunia]
ref|XP_010413942.1|  PREDICTED: beta-galactosidase 9-like               205   1e-56    Camelina sativa [gold-of-pleasure]
ref|XP_006296364.1|  hypothetical protein CARUB_v10025536mg             205   1e-56    Capsella rubella
ref|XP_010917686.1|  PREDICTED: beta-galactosidase 5-like               205   1e-56    Elaeis guineensis
ref|XP_006410414.1|  hypothetical protein EUTSA_v10016215mg             205   1e-56    Eutrema salsugineum
gb|AGR44464.1|  beta-D-galactosidase 5                                  203   1e-56    Pyrus x bretschneideri [bai li]
gb|AAG12249.1|AF184080_1  beta-galactosidase                            197   1e-56    Prunus armeniaca
ref|XP_011012769.1|  PREDICTED: beta-galactosidase 9                    204   2e-56    Populus euphratica
ref|XP_011022866.1|  PREDICTED: beta-galactosidase 10                   204   2e-56    Populus euphratica
ref|XP_003632537.1|  PREDICTED: beta-galactosidase 10                   204   2e-56    Vitis vinifera
ref|XP_006838689.1|  PREDICTED: beta-galactosidase 5                    204   2e-56    Amborella trichopoda
gb|KGN62231.1|  hypothetical protein Csa_2G337760                       204   2e-56    Cucumis sativus [cucumbers]
ref|XP_006826783.2|  PREDICTED: beta-galactosidase                      204   2e-56    Amborella trichopoda
gb|EMT06783.1|  Beta-galactosidase 15                                   201   2e-56    Aegilops tauschii
ref|XP_004147332.1|  PREDICTED: beta-galactosidase 10                   204   2e-56    Cucumis sativus [cucumbers]
gb|ERM94020.1|  hypothetical protein AMTR_s00136p00108810               203   2e-56    Amborella trichopoda
ref|XP_008799173.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    204   3e-56    
ref|XP_011001114.1|  PREDICTED: beta-galactosidase 8-like               204   3e-56    Populus euphratica
gb|EYU22313.1|  hypothetical protein MIMGU_mgv1a001532mg                203   3e-56    Erythranthe guttata [common monkey flower]
dbj|BAD91082.1|  beta-D-galactosidase                                   203   4e-56    Pyrus pyrifolia [sha li]
ref|XP_004509327.1|  PREDICTED: beta-galactosidase 3-like               203   4e-56    
ref|XP_007034276.1|  Beta galactosidase 9 isoform 3                     202   5e-56    Theobroma cacao [chocolate]
ref|XP_006373075.1|  beta-galactosidase family protein                  203   5e-56    Populus trichocarpa [western balsam poplar]
ref|XP_009390388.1|  PREDICTED: beta-galactosidase 15 isoform X4        202   5e-56    Musa acuminata subsp. malaccensis [pisang utan]
gb|ERM97946.1|  hypothetical protein AMTR_s00117p00061070               191   5e-56    Amborella trichopoda
ref|XP_003595331.1|  Beta-galactosidase                                 203   5e-56    Medicago truncatula
ref|XP_004288998.1|  PREDICTED: beta-galactosidase 15-like              202   6e-56    Fragaria vesca subsp. vesca
emb|CDO99618.1|  unnamed protein product                                202   6e-56    Coffea canephora [robusta coffee]
ref|XP_009390387.1|  PREDICTED: beta-galactosidase 15 isoform X3        202   7e-56    Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW69754.1|  hypothetical protein EUGRSUZ_F031301                    192   1e-55    Eucalyptus grandis [rose gum]
ref|XP_007034274.1|  Beta galactosidase 9 isoform 1                     202   1e-55    Theobroma cacao [chocolate]
ref|XP_008338023.1|  PREDICTED: beta-galactosidase 3-like               202   1e-55    Malus domestica [apple tree]
ref|XP_004287850.1|  PREDICTED: beta-galactosidase 3                    202   1e-55    Fragaria vesca subsp. vesca
ref|XP_009390385.1|  PREDICTED: beta-galactosidase 15 isoform X1        202   1e-55    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390386.1|  PREDICTED: beta-galactosidase 15 isoform X2        202   1e-55    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006351534.1|  PREDICTED: beta-galactosidase 3-like               202   1e-55    Solanum tuberosum [potatoes]
ref|XP_010113483.1|  Beta-galactosidase 3                               202   1e-55    Morus notabilis
ref|XP_010111783.1|  Beta-galactosidase 9                               202   2e-55    Morus notabilis
ref|XP_008337843.1|  PREDICTED: beta-galactosidase 3                    201   2e-55    Malus domestica [apple tree]
ref|NP_001234307.1|  beta-galactosidase, chloroplastic precursor        201   2e-55    
ref|XP_010274045.1|  PREDICTED: beta-galactosidase 9 isoform X2         201   2e-55    Nelumbo nucifera [Indian lotus]
gb|ADO34792.1|  beta-galactosidase STBG7                                201   2e-55    Solanum lycopersicum
ref|XP_010509962.1|  PREDICTED: beta-galactosidase 9-like isoform X2    201   2e-55    Camelina sativa [gold-of-pleasure]
ref|XP_010274044.1|  PREDICTED: beta-galactosidase 9 isoform X1         201   2e-55    Nelumbo nucifera [Indian lotus]
ref|XP_010027569.1|  PREDICTED: beta-galactosidase 10-like              201   3e-55    Eucalyptus grandis [rose gum]
gb|KCW54127.1|  hypothetical protein EUGRSUZ_I00108                     201   3e-55    Eucalyptus grandis [rose gum]
ref|XP_002263382.2|  PREDICTED: beta-galactosidase 3                    201   3e-55    Vitis vinifera
gb|KDP33945.1|  hypothetical protein JCGZ_07516                         195   3e-55    Jatropha curcas
emb|CDX67939.1|  BnaA07g19790D                                          187   3e-55    Brassica napus [oilseed rape]
ref|XP_004970751.1|  PREDICTED: beta-galactosidase 3-like               201   3e-55    Setaria italica
ref|XP_010522389.1|  PREDICTED: beta-galactosidase 9                    201   4e-55    Tarenaya hassleriana [spider flower]
ref|XP_010509960.1|  PREDICTED: beta-galactosidase 9-like isoform X1    201   4e-55    Camelina sativa [gold-of-pleasure]
ref|XP_010932916.1|  PREDICTED: beta-galactosidase 5-like               200   5e-55    Elaeis guineensis
ref|XP_002310540.2|  beta-galactosidase family protein                  200   5e-55    Populus trichocarpa [western balsam poplar]
ref|XP_004985589.1|  PREDICTED: beta-galactosidase 5-like isoform X2    199   6e-55    
ref|XP_008805774.1|  PREDICTED: beta-galactosidase-like isoform X2      200   6e-55    Phoenix dactylifera
ref|XP_012071104.1|  PREDICTED: beta-galactosidase 9 isoform X2         200   7e-55    Jatropha curcas
ref|XP_010245924.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    199   7e-55    Nelumbo nucifera [Indian lotus]
ref|XP_004288329.1|  PREDICTED: beta-galactosidase 15-like              199   7e-55    Fragaria vesca subsp. vesca
ref|XP_010437357.1|  PREDICTED: beta-galactosidase 3-like               189   7e-55    Camelina sativa [gold-of-pleasure]
ref|XP_012071103.1|  PREDICTED: beta-galactosidase 9 isoform X1         200   7e-55    Jatropha curcas
gb|ABV32546.1|  beta-galactosidase protein 1                            199   8e-55    Prunus persica
gb|EPS60900.1|  beta-galactosidase                                      187   9e-55    Genlisea aurea
ref|XP_007204656.1|  hypothetical protein PRUPE_ppa001412mg             199   9e-55    
ref|XP_006843913.1|  PREDICTED: beta-galactosidase 15                   199   9e-55    
ref|XP_009395554.1|  PREDICTED: beta-galactosidase 5                    199   9e-55    
ref|XP_011457728.1|  PREDICTED: beta-galactosidase 3-like               199   1e-54    
ref|XP_007048525.1|  Beta-galactosidase 3                               199   1e-54    
emb|CDX67940.1|  BnaA07g19800D                                          187   1e-54    
ref|XP_004985588.1|  PREDICTED: beta-galactosidase 5-like isoform X1    199   1e-54    
ref|NP_001066673.1|  Os12g0429200                                       199   1e-54    
dbj|BAD91084.1|  beta-D-galactosidase                                   199   1e-54    
ref|XP_009621448.1|  PREDICTED: beta-galactosidase 10                   199   1e-54    
ref|XP_010915229.1|  PREDICTED: beta-galactosidase isoform X2           199   1e-54    
ref|XP_002881245.1|  hypothetical protein ARALYDRAFT_902346             199   1e-54    
ref|XP_010910613.1|  PREDICTED: beta-galactosidase-like                 192   1e-54    
gb|AGR44466.1|  beta-D-galactosidase 7                                  199   2e-54    
ref|XP_010245925.1|  PREDICTED: beta-galactosidase 15-like              198   2e-54    
gb|KHN47945.1|  Beta-galactosidase 9                                    199   2e-54    
emb|CDX98328.1|  BnaC06g16890D                                          187   2e-54    
gb|AAQ62586.1|  putative beta-galactosidase                             199   2e-54    
ref|XP_009407297.1|  PREDICTED: beta-galactosidase 2                    198   3e-54    
ref|XP_009105543.1|  PREDICTED: beta-galactosidase 15-like              190   3e-54    
emb|CDP11164.1|  unnamed protein product                                198   3e-54    
ref|XP_011627921.1|  PREDICTED: beta-galactosidase 10                   198   3e-54    
ref|XP_008438342.1|  PREDICTED: beta-galactosidase 9 isoform X2         197   3e-54    
ref|XP_007225291.1|  hypothetical protein PRUPE_ppa001334mg             198   3e-54    
gb|ERN18154.1|  hypothetical protein AMTR_s00054p00133410               198   3e-54    
ref|XP_008241765.1|  PREDICTED: beta-galactosidase 3                    198   3e-54    
gb|ADD62393.1|  beta-galactosidase 3                                    197   3e-54    
ref|XP_011096438.1|  PREDICTED: beta-galactosidase 8-like               197   4e-54    
emb|CDM85192.1|  unnamed protein product                                197   4e-54    
gb|KHN07882.1|  Beta-galactosidase 7                                    197   4e-54    
ref|XP_009767061.1|  PREDICTED: beta-galactosidase 10                   198   4e-54    
gb|KHN27041.1|  Beta-galactosidase 3                                    197   4e-54    
ref|XP_003548865.1|  PREDICTED: beta-galactosidase 3-like               197   4e-54    
ref|XP_011460272.1|  PREDICTED: beta-galactosidase 8-like               197   5e-54    
gb|AHC32021.1|  beta-galactosidase 3                                    197   5e-54    
ref|XP_002465807.1|  hypothetical protein SORBIDRAFT_01g046160          197   5e-54    
ref|XP_008799994.1|  PREDICTED: beta-galactosidase 5-like               197   6e-54    
ref|XP_011025878.1|  PREDICTED: beta-galactosidase 3                    197   6e-54    
ref|XP_008236954.1|  PREDICTED: beta-galactosidase 3-like               197   6e-54    
emb|CDX67790.1|  BnaA07g18300D                                          197   7e-54    
ref|XP_012076927.1|  PREDICTED: beta-galactosidase-like                 197   7e-54    
ref|XP_002514108.1|  beta-galactosidase, putative                       197   7e-54    
ref|XP_003612093.1|  Beta-galactosidase                                 193   7e-54    
gb|KHG01468.1|  Beta-galactosidase                                      196   7e-54    
ref|XP_008438341.1|  PREDICTED: beta-galactosidase 9 isoform X1         197   7e-54    
ref|XP_009789773.1|  PREDICTED: beta-galactosidase-like                 197   7e-54    
ref|XP_008221339.1|  PREDICTED: beta-galactosidase 5                    197   8e-54    
ref|XP_003541315.2|  PREDICTED: beta-galactosidase-like                 196   9e-54    
ref|NP_001049068.1|  Os03g0165400                                       196   1e-53    
gb|EEE58382.1|  hypothetical protein OsJ_09539                          196   1e-53    
ref|XP_002297749.2|  hypothetical protein POPTR_0001s06310g             196   1e-53    
ref|XP_004962561.1|  PREDICTED: beta-galactosidase 15-like              197   1e-53    
dbj|BAD95183.1|  beta-galactosidase like protein                        186   1e-53    
ref|XP_008242341.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    196   1e-53    
emb|CDY19166.1|  BnaA04g19060D                                          196   1e-53    
gb|AAM22973.1|AF499737_1  beta-galactosidase                            196   1e-53    
gb|KDO75774.1|  hypothetical protein CISIN_1g037925mg                   196   1e-53    
gb|EYU31481.1|  hypothetical protein MIMGU_mgv1a001399mg                196   1e-53    
ref|XP_002310279.2|  beta-galactosidase family protein                  196   2e-53    
emb|CDY23785.1|  BnaC04g43370D                                          196   2e-53    
ref|XP_009141278.1|  PREDICTED: beta-galactosidase 9                    196   2e-53    
ref|XP_006468221.1|  PREDICTED: beta-galactosidase 8-like               196   2e-53    
ref|XP_008809207.1|  PREDICTED: beta-galactosidase 5-like               196   2e-53    
ref|XP_011620343.1|  PREDICTED: beta-galactosidase 9                    196   2e-53    
dbj|BAD95407.1|  galactosidase                                          186   2e-53    
ref|XP_010050189.1|  PREDICTED: beta-galactosidase 15-like              195   2e-53    
ref|XP_011072090.1|  PREDICTED: beta-galactosidase 10                   196   2e-53    
ref|XP_011101986.1|  PREDICTED: beta-galactosidase 9-like               196   2e-53    
emb|CDY36652.1|  BnaA07g04050D                                          194   2e-53    
gb|KCW89294.1|  hypothetical protein EUGRSUZ_A01583                     195   2e-53    
gb|ABY71826.1|  beta-galactosidase                                      195   2e-53    
ref|XP_010650317.1|  PREDICTED: beta-galactosidase 9 isoform X2         195   3e-53    
ref|XP_007040803.1|  Beta-galactosidase 7                               197   3e-53    
gb|AAW47739.1|  beta-galactosidase                                      195   3e-53    
gb|KFK31109.1|  hypothetical protein AALP_AA6G069300                    195   3e-53    
ref|XP_007156097.1|  hypothetical protein PHAVU_003G258300g             195   3e-53    
ref|XP_008793242.1|  PREDICTED: beta-galactosidase                      195   3e-53    
ref|XP_002308268.2|  hypothetical protein POPTR_0006s14680g             195   3e-53    
emb|CAN78072.1|  hypothetical protein VITISV_013292                     195   3e-53    
gb|KHN00504.1|  Beta-galactosidase 3                                    195   4e-53    
ref|NP_001268162.1|  beta-galactosidase BG1-like precursor              195   4e-53    
emb|CBI19767.3|  unnamed protein product                                195   4e-53    
gb|EEC74580.1|  hypothetical protein OsI_10152                          195   4e-53    
ref|XP_011650872.1|  PREDICTED: beta-galactosidase 9 isoform X2         194   4e-53    
ref|XP_003520277.1|  PREDICTED: beta-galactosidase 3-like               195   4e-53    
ref|XP_004512085.1|  PREDICTED: beta-galactosidase 3-like               195   4e-53    
ref|XP_011048837.1|  PREDICTED: beta-galactosidase 5                    194   4e-53    
ref|XP_012077538.1|  PREDICTED: beta-galactosidase 15-like              194   5e-53    
ref|XP_006449235.1|  hypothetical protein CICLE_v10017808mg             194   5e-53    
ref|XP_006663996.1|  PREDICTED: beta-galactosidase 15-like              195   5e-53    
ref|XP_009789452.1|  PREDICTED: beta-galactosidase 3                    194   5e-53    
ref|XP_010649088.1|  PREDICTED: beta-galactosidase 3                    194   5e-53    
ref|XP_009372992.1|  PREDICTED: beta-galactosidase 3-like               194   6e-53    
ref|XP_001775275.1|  predicted protein                                  195   6e-53    
ref|XP_004134374.1|  PREDICTED: beta-galactosidase 9 isoform X1         194   6e-53    
ref|XP_010672619.1|  PREDICTED: beta-galactosidase 5                    194   6e-53    
emb|CDX98326.1|  BnaC06g16870D                                          190   6e-53    
ref|XP_002263385.1|  PREDICTED: beta-galactosidase 9 isoform X1         194   7e-53    
ref|XP_003576603.1|  PREDICTED: beta-galactosidase 15                   194   7e-53    
ref|XP_010999621.1|  PREDICTED: beta-galactosidase 15-like              194   8e-53    
ref|XP_007199661.1|  hypothetical protein PRUPE_ppa001363mg             194   8e-53    
ref|XP_010062625.1|  PREDICTED: beta-galactosidase 1                    194   8e-53    
sp|P45582.1|BGAL_ASPOF  RecName: Full=Beta-galactosidase; Short=L...    194   9e-53    
ref|XP_010069008.1|  PREDICTED: beta-galactosidase 9 isoform X2         193   9e-53    
ref|XP_009396354.1|  PREDICTED: beta-galactosidase 5-like               194   9e-53    
ref|XP_008660537.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    194   9e-53    
gb|KJB17716.1|  hypothetical protein B456_003G011900                    194   1e-52    
gb|EYU35831.1|  hypothetical protein MIMGU_mgv1a022675mg                192   1e-52    
gb|KDO73841.1|  hypothetical protein CISIN_1g036343mg                   193   1e-52    
ref|XP_008227597.1|  PREDICTED: beta-galactosidase 10                   194   1e-52    
ref|XP_008805772.1|  PREDICTED: beta-galactosidase-like isoform X1      193   1e-52    
gb|EEC70952.1|  hypothetical protein OsI_02561                          193   1e-52    
ref|XP_006649450.1|  PREDICTED: beta-galactosidase 5-like               193   1e-52    
ref|XP_003612092.1|  Beta-galactosidase                                 193   1e-52    
ref|XP_009105555.1|  PREDICTED: beta-galactosidase 15-like              191   1e-52    
ref|XP_008465565.1|  PREDICTED: beta-galactosidase 7-like               189   1e-52    
ref|XP_011045966.1|  PREDICTED: beta-galactosidase-like isoform X2      193   1e-52    
ref|XP_008440778.1|  PREDICTED: beta-galactosidase 3                    193   1e-52    
ref|XP_010915228.1|  PREDICTED: beta-galactosidase isoform X1           193   1e-52    
emb|CDY69031.1|  BnaCnng61490D                                          191   1e-52    
emb|CBI17270.3|  unnamed protein product                                195   2e-52    
ref|XP_010275526.1|  PREDICTED: beta-galactosidase 3-like               193   2e-52    
ref|XP_006357461.1|  PREDICTED: beta-galactosidase-like                 193   2e-52    
ref|XP_009145073.1|  PREDICTED: beta-galactosidase 3                    193   2e-52    
ref|XP_008382310.1|  PREDICTED: beta-galactosidase 5-like               193   2e-52    
ref|XP_011083609.1|  PREDICTED: beta-galactosidase 3-like               193   2e-52    
ref|XP_007153611.1|  hypothetical protein PHAVU_003G050100g             193   2e-52    
ref|XP_010069007.1|  PREDICTED: beta-galactosidase 9 isoform X1         193   2e-52    
ref|XP_002981627.1|  hypothetical protein SELMODRAFT_421090             193   2e-52    
dbj|BAF31234.1|  beta-D-galactosidase                                   193   2e-52    
ref|XP_011000544.1|  PREDICTED: beta-galactosidase 15-like              192   2e-52    
ref|NP_001043405.1|  Os01g0580200                                       192   2e-52    
ref|XP_008377189.1|  PREDICTED: beta-galactosidase 5-like               192   2e-52    
ref|XP_011045964.1|  PREDICTED: beta-galactosidase-like isoform X1      193   2e-52    
ref|XP_006475097.1|  PREDICTED: beta-galactosidase 7-like               192   3e-52    
ref|XP_009119501.1|  PREDICTED: beta-galactosidase 15-like              192   3e-52    
gb|AET04139.2|  beta-galactosidase                                      193   3e-52    
gb|EEE54862.1|  hypothetical protein OsJ_02342                          192   3e-52    
ref|XP_003629663.1|  Beta-galactosidase                                 193   3e-52    
ref|XP_002963161.1|  hypothetical protein SELMODRAFT_404798             192   3e-52    
gb|KDP32675.1|  hypothetical protein JCGZ_13673                         192   3e-52    
ref|XP_006646030.1|  PREDICTED: beta-galactosidase 2-like               192   3e-52    
gb|EEC70956.1|  hypothetical protein OsI_02569                          188   4e-52    
gb|KCW79363.1|  hypothetical protein EUGRSUZ_C00782                     192   4e-52    
ref|XP_010050435.1|  PREDICTED: beta-galactosidase 15-like              192   4e-52    
ref|XP_004241849.1|  PREDICTED: beta-galactosidase-like                 192   4e-52    
ref|XP_009628690.1|  PREDICTED: beta-galactosidase 3                    192   4e-52    
ref|XP_004289502.1|  PREDICTED: beta-galactosidase 10                   192   4e-52    
ref|XP_002276918.2|  PREDICTED: beta-galactosidase 15                   192   4e-52    
dbj|BAD91085.1|  beta-D-galactosidase                                   192   4e-52    
ref|XP_012071945.1|  PREDICTED: beta-galactosidase 5                    192   4e-52    
ref|XP_009606115.1|  PREDICTED: beta-galactosidase-like                 192   4e-52    
emb|CDP18451.1|  unnamed protein product                                191   4e-52    
ref|XP_010029731.1|  PREDICTED: beta-galactosidase 3                    192   5e-52    
ref|XP_012078404.1|  PREDICTED: beta-galactosidase 3                    192   5e-52    
ref|XP_004969419.1|  PREDICTED: beta-galactosidase 2-like               191   5e-52    
ref|XP_004149980.1|  PREDICTED: beta-galactosidase 3                    191   6e-52    
ref|XP_010243524.1|  PREDICTED: beta-galactosidase 10 isoform X1        191   6e-52    
ref|XP_007158611.1|  hypothetical protein PHAVU_002G1672001g            187   6e-52    
ref|XP_010243525.1|  PREDICTED: beta-galactosidase 3 isoform X2         191   6e-52    
ref|XP_002867020.1|  hypothetical protein ARALYDRAFT_491000             191   6e-52    
ref|XP_002510455.1|  beta-galactosidase, putative                       191   6e-52    
ref|XP_006400640.1|  hypothetical protein EUTSA_v10012695mg             191   6e-52    
gb|KDO52437.1|  hypothetical protein CISIN_1g0461461mg                  189   6e-52    
ref|XP_008394191.1|  PREDICTED: beta-galactosidase 10                   191   7e-52    
ref|NP_001289210.1|  beta-galactosidase 10 precursor                    191   7e-52    
emb|CDX93659.1|  BnaA06g03890D                                          191   7e-52    
ref|XP_002306893.1|  beta-galactosidase family protein                  191   7e-52    
dbj|BAF31233.1|  beta-D-galactosidase                                   191   7e-52    
ref|XP_006452850.1|  hypothetical protein CICLE_v10010454mg             191   7e-52    
ref|XP_007217046.1|  hypothetical protein PRUPE_ppa001415mg             191   7e-52    
gb|KJB43422.1|  hypothetical protein B456_007G198900                    191   7e-52    
ref|XP_002444074.1|  hypothetical protein SORBIDRAFT_07g006936          177   8e-52    
ref|XP_008674433.1|  PREDICTED: beta-galactosidase 15 isoform X1        191   8e-52    
emb|CDX79397.1|  BnaC06g19060D                                          189   8e-52    
gb|KHN41933.1|  Beta-galactosidase 3                                    191   8e-52    
ref|XP_006425593.1|  hypothetical protein CICLE_v10024881mg             191   9e-52    
gb|KDO71052.1|  hypothetical protein CISIN_1g003044mg                   191   9e-52    
emb|CDX79398.1|  BnaC06g19050D                                          190   9e-52    
ref|XP_007214623.1|  hypothetical protein PRUPE_ppa001345mg             190   9e-52    
gb|EYU32887.1|  hypothetical protein MIMGU_mgv1a001295mg                191   1e-51    
gb|KHN17741.1|  Beta-galactosidase 7                                    191   1e-51    
gb|KJB43419.1|  hypothetical protein B456_007G198900                    191   1e-51    
gb|KJB43424.1|  hypothetical protein B456_007G198900                    191   1e-51    
ref|XP_003538867.1|  PREDICTED: beta-galactosidase 3-like               191   1e-51    
ref|XP_002455836.1|  hypothetical protein SORBIDRAFT_03g025990          190   1e-51    
ref|NP_001234303.1|  beta-galactosidase precursor                       191   1e-51    
emb|CDY72421.1|  BnaCnng77530D                                          183   1e-51    
ref|XP_003566806.1|  PREDICTED: beta-galactosidase 2                    191   1e-51    
emb|CDY71202.1|  BnaC09g54050D                                          186   1e-51    
ref|XP_006340680.1|  PREDICTED: beta-galactosidase 3-like               191   1e-51    
ref|XP_007214624.1|  hypothetical protein PRUPE_ppa001345mg             191   1e-51    
gb|AGW47883.1|  beta-galactosidase precursor                            191   1e-51    
ref|XP_007012844.1|  Beta-galactosidase                                 191   1e-51    
ref|XP_011100972.1|  PREDICTED: beta-galactosidase 3-like               191   1e-51    
ref|XP_002527409.1|  beta-galactosidase, putative                       190   1e-51    
ref|XP_010487145.1|  PREDICTED: beta-galactosidase 1-like               190   1e-51    
ref|XP_009769408.1|  PREDICTED: beta-galactosidase-like                 190   2e-51    
ref|XP_010939579.1|  PREDICTED: beta-galactosidase 2-like               190   2e-51    
ref|XP_010542431.1|  PREDICTED: beta-galactosidase 1-like               190   2e-51    
emb|CBI35944.3|  unnamed protein product                                190   2e-51    
dbj|BAD91080.1|  beta-D-galactosidase                                   190   2e-51    
ref|XP_009622143.1|  PREDICTED: beta-galactosidase-like                 190   2e-51    
ref|XP_008444022.1|  PREDICTED: beta-galactosidase-like                 190   2e-51    
gb|ADO34791.1|  beta-galactosidase STBG6                                190   2e-51    
ref|XP_010465236.1|  PREDICTED: beta-galactosidase 1                    190   2e-51    
ref|NP_001234317.1|  TBG6 protein precursor                             190   2e-51    
ref|XP_010654522.1|  PREDICTED: beta-galactosidase 1                    190   2e-51    
dbj|BAF01862.1|  beta-galactosidase like protein                        188   2e-51    
ref|XP_009390322.1|  PREDICTED: beta-galactosidase-like                 190   2e-51    
ref|XP_011083163.1|  PREDICTED: beta-galactosidase 3                    190   2e-51    
gb|KHN36067.1|  Beta-galactosidase 3                                    190   2e-51    
ref|XP_008437707.1|  PREDICTED: beta-galactosidase 7-like               189   2e-51    
ref|XP_009335672.1|  PREDICTED: beta-galactosidase 5                    190   2e-51    
ref|XP_001756743.1|  predicted protein                                  190   2e-51    
ref|XP_010437358.1|  PREDICTED: beta-galactosidase 3-like               190   2e-51    
ref|XP_008674434.1|  PREDICTED: beta-galactosidase 15 isoform X2        190   2e-51    
ref|XP_003517202.1|  PREDICTED: beta-galactosidase 3-like               190   3e-51    
ref|XP_006601406.1|  PREDICTED: beta-galactosidase 7-like               189   3e-51    
ref|XP_009359758.1|  PREDICTED: beta-galactosidase 15                   190   3e-51    
gb|KDO84694.1|  hypothetical protein CISIN_1g003076mg                   188   3e-51    



>ref|XP_009595284.1| PREDICTED: beta-galactosidase 8 [Nicotiana tomentosiformis]
 ref|XP_009595285.1| PREDICTED: beta-galactosidase 8 [Nicotiana tomentosiformis]
Length=846

 Score =   335 bits (858),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 186/221 (84%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA+FDAP    P  L  + G GKG AWVNGQSIGR+WPTYTASNGGCTDSCNYRG YNS
Sbjct  627  YKASFDAPAGDTPLSLDFT-GMGKGEAWVNGQSIGRFWPTYTASNGGCTDSCNYRGSYNS  685

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL+NCGKPSQ  YHVPRSWL+SSGNV+V+FEE+GG+PTKLSFATRE  S+CSRVSE+H
Sbjct  686  NKCLKNCGKPSQLLYHVPRSWLQSSGNVIVLFEEMGGNPTKLSFATRETSSICSRVSEAH  745

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P+P+D WTSD   +K+ G  LSLECP  +QVIS+IKFASFGTP G CGSFSHG+C S+NA
Sbjct  746  PLPIDKWTSDDDARKKVGPTLSLECPRPDQVISSIKFASFGTPHGACGSFSHGRCTSSNA  805

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS VKKACIG + CSLGVS   FG+PC GVTKSLAVEASC+
Sbjct  806  LSHVKKACIGSKRCSLGVSIDVFGDPCIGVTKSLAVEASCS  846



>ref|XP_006340153.1| PREDICTED: beta-galactosidase 8-like [Solanum tuberosum]
Length=852

 Score =   333 bits (853),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 159/220 (72%), Positives = 183/220 (83%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA+FDAP    P  +  + G GKG AWVNGQSIGR+WPTYTA N GCTD CNYRG YN+
Sbjct  633  YKASFDAPAGDTPLSMDFT-GMGKGEAWVNGQSIGRFWPTYTAPNSGCTDPCNYRGGYNA  691

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL+NCGKPSQ  YHVPRSWLKSSGNVLV+FEE+GGDPTKLSFATRE+ S+CSR+SE+H
Sbjct  692  NKCLKNCGKPSQLLYHVPRSWLKSSGNVLVLFEEMGGDPTKLSFATREIQSVCSRISEAH  751

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P+P+DMW S+   + + G  LSLECP  NQVIS+IKFASFGTPQGTCGSF HG+C S+NA
Sbjct  752  PLPIDMWASEDDARNKSGPTLSLECPHPNQVISSIKFASFGTPQGTCGSFIHGRCSSSNA  811

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+VKKACIG ++CSLGVS   FG PC GV KSLAVEASC
Sbjct  812  LSIVKKACIGSKSCSLGVSINVFGEPCKGVAKSLAVEASC  851



>ref|XP_010313192.1| PREDICTED: TBG5 protein isoform X1 [Solanum lycopersicum]
 ref|XP_010313193.1| PREDICTED: TBG5 protein isoform X1 [Solanum lycopersicum]
 gb|ADO34790.3| beta-galactosidase STBG5 [Solanum lycopersicum]
Length=852

 Score =   330 bits (847),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 157/220 (71%), Positives = 183/220 (83%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA+FDAP    P  +  + G GKG AWVNGQSIGR+WP Y A N GCTD CNYRG YN+
Sbjct  633  YKASFDAPAGDTPLSMDFT-GMGKGEAWVNGQSIGRFWPAYIAPNDGCTDPCNYRGGYNA  691

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL+NCGKPSQ  YHVPRSWLKSSGNVLV+FEE+GGDPTKLSFATRE+ S+CSR+S++H
Sbjct  692  EKCLKNCGKPSQLLYHVPRSWLKSSGNVLVLFEEMGGDPTKLSFATREIQSVCSRISDAH  751

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P+P+DMW S+   +K+ G  LSLECP  NQVIS+IKFASFGTPQGTCGSF HG+C S+NA
Sbjct  752  PLPIDMWASEDDARKKSGPTLSLECPHPNQVISSIKFASFGTPQGTCGSFIHGRCSSSNA  811

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+VKKACIG ++CSLGVS   FG+PC GV KSLAVEASC
Sbjct  812  LSIVKKACIGSKSCSLGVSINAFGDPCKGVAKSLAVEASC  851



>ref|XP_009766589.1| PREDICTED: beta-galactosidase 8 [Nicotiana sylvestris]
Length=846

 Score =   329 bits (843),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 185/221 (84%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA+FDAP    P  L  + G GKG AWVNGQSIGR+WPT TASNGGCTDSCNYRG YNS
Sbjct  627  YKASFDAPAGDTPLSLDFT-GMGKGEAWVNGQSIGRFWPTNTASNGGCTDSCNYRGSYNS  685

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL+NCGKPSQ  YHVPRSWL+S+GNV+V+FEE+GG+PTKLSFATRE  S+CSRVSE+H
Sbjct  686  NKCLKNCGKPSQLLYHVPRSWLQSTGNVIVLFEEMGGNPTKLSFATRETSSICSRVSEAH  745

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P+P+D WTSD   +K+ G  LSLECP  +QVIS++KFASFGTP G CGSFSHG+C S+NA
Sbjct  746  PLPIDKWTSDDDARKKVGPTLSLECPRPDQVISSVKFASFGTPHGACGSFSHGRCTSSNA  805

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS VKKACIG + CS+GVS   FG+PC GVTKSLAVEASC+
Sbjct  806  LSHVKKACIGSKRCSVGVSIDVFGDPCIGVTKSLAVEASCS  846



>ref|NP_001234312.1| TBG5 protein precursor [Solanum lycopersicum]
 gb|AAF70824.1|AF154423_1 putative beta-galactosidase [Solanum lycopersicum]
Length=852

 Score =   329 bits (843),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/220 (71%), Positives = 182/220 (83%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA+FDAP    P  +  + G GKG AWVNGQSIGR+WP Y A N GCTD CNYRG YN+
Sbjct  633  YKASFDAPAGDTPLSMDFT-GMGKGEAWVNGQSIGRFWPAYIAPNDGCTDPCNYRGGYNA  691

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL+NCGKPSQ  YHVPRSWLKSSGNVLV+FEE+GGDPTKLSFATRE+ S+CSR S++H
Sbjct  692  EKCLKNCGKPSQLLYHVPRSWLKSSGNVLVLFEEMGGDPTKLSFATREIQSVCSRTSDAH  751

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P+P+DMW S+   +K+ G  LSLECP  NQVIS+IKFASFGTPQGTCGSF HG+C S+NA
Sbjct  752  PLPIDMWASEDDARKKSGPTLSLECPHPNQVISSIKFASFGTPQGTCGSFIHGRCSSSNA  811

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+VKKACIG ++CSLGVS   FG+PC GV KSLAVEASC
Sbjct  812  LSIVKKACIGSKSCSLGVSINAFGDPCKGVAKSLAVEASC  851



>ref|XP_011089316.1| PREDICTED: beta-galactosidase 8-like [Sesamum indicum]
Length=843

 Score =   323 bits (829),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/220 (71%), Positives = 180/220 (82%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L    G GKG AW+NGQSIGRYWPT  A N GCTDSCNYRG Y+S
Sbjct  624  YKTTFDAPSGSSPLALDF-MGLGKGQAWINGQSIGRYWPTNIAGNSGCTDSCNYRGAYSS  682

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+NCGKPSQ  YHVPRSWLK SGN+LV+FEE+GG+PT+LSFATRE  S+C+R+SE+H
Sbjct  683  SKCLKNCGKPSQQLYHVPRSWLKPSGNILVLFEEMGGNPTQLSFATRETQSICARISENH  742

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P+PVDMWTSD   +K  G  LSL CPL+NQVIS IKFASFGTP+GTCGSFSHG+C S  A
Sbjct  743  PLPVDMWTSDDETRKTAGPILSLACPLANQVISEIKFASFGTPRGTCGSFSHGRCTSKMA  802

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
             SVV+KACIG R+CS+GVS +TFG+PCAG+TKSLAVEASC
Sbjct  803  RSVVEKACIGSRSCSIGVSVSTFGDPCAGITKSLAVEASC  842



>ref|XP_002285084.2| PREDICTED: beta-galactosidase 8 [Vitis vinifera]
 emb|CBI16297.3| unnamed protein product [Vitis vinifera]
Length=846

 Score =   323 bits (829),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/220 (70%), Positives = 180/220 (82%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L    G GKG AWVNGQSIGRYWP Y +SNGGCT SCNYRGPY+S
Sbjct  627  YKTTFDAPAGNDPVALDF-MGMGKGEAWVNGQSIGRYWPAYVSSNGGCTSSCNYRGPYSS  685

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL+NCGKPSQ  YHVPRSWL+ SGN LV+FEE+GGDPT++SFAT++V SLCSRVSE H
Sbjct  686  NKCLKNCGKPSQQLYHVPRSWLQPSGNTLVLFEEIGGDPTQISFATKQVESLCSRVSEYH  745

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P+PVDMW SDL+  ++    LSLECP  NQVIS+IKFASFGTP+GTCGSFSH KC S  A
Sbjct  746  PLPVDMWGSDLTTGRKSSPMLSLECPFPNQVISSIKFASFGTPRGTCGSFSHSKCSSRTA  805

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+V++ACIG ++CS+GVS  TFG+PC+G+ KSLAVEASC
Sbjct  806  LSIVQEACIGSKSCSIGVSIDTFGDPCSGIAKSLAVEASC  845



>emb|CDP07127.1| unnamed protein product [Coffea canephora]
Length=843

 Score =   320 bits (819),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 179/220 (81%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NFDA     P  L +S   GKG AWVNGQSIGRYWPT  A NGGC  SCNYRG +N+
Sbjct  624  YKTNFDAAGGNEPLALDLSS-LGKGEAWVNGQSIGRYWPTNNAPNGGCVSSCNYRGSFNA  682

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL++CGKPSQ  YHVPR WLK SGN+LV+FEE+GGDPT++SFATR++GSLCSRVSESH
Sbjct  683  NKCLKDCGKPSQLLYHVPRDWLKPSGNILVLFEEMGGDPTQISFATRQIGSLCSRVSESH  742

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P+P+D+WTSD    K+ G  + LECP +NQVIS+IKFASFGTP G CGSFSHGKC S NA
Sbjct  743  PVPIDIWTSDQEAAKKAGPTMLLECPSANQVISSIKFASFGTPGGACGSFSHGKCSSKNA  802

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            +S+++KAC+G R C++GVS  TFG+PC G+TK+LAVEASC
Sbjct  803  ISIIQKACVGSRKCNIGVSIATFGDPCVGITKTLAVEASC  842



>gb|KDO73224.1| hypothetical protein CISIN_1g003095mg [Citrus sinensis]
Length=738

 Score =   317 bits (811),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 181/221 (82%), Gaps = 2/221 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG AWVNGQSIGRYWPTY + NGGCTDSCNYRG Y+S
Sbjct  518  YKTTFDAPAGSEPVAIDFT-GMGKGEAWVNGQSIGRYWPTYVSQNGGCTDSCNYRGAYSS  576

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVG-SLCSRVSES  461
            +KCL+NCGKPSQ+ YHVPRSWLKSSGN LV+FEE+GGDPTK+SF T+++G SLCS V++S
Sbjct  577  NKCLKNCGKPSQSLYHVPRSWLKSSGNTLVLFEEIGGDPTKISFVTKQLGSSLCSHVTDS  636

Query  460  HPMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            HP+PVDMW SD   Q++ G  LSLECP  NQVIS+IKFASFGTP GTCGSFS G+C S  
Sbjct  637  HPLPVDMWGSDSKIQRKPGPVLSLECPNPNQVISSIKFASFGTPLGTCGSFSRGRCSSAR  696

Query  280  ALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            +LSVV++AC+G ++CS+GVS  TFG+PC GV KSLAVEASC
Sbjct  697  SLSVVRQACVGSKSCSIGVSVNTFGDPCKGVMKSLAVEASC  737



>ref|XP_007015421.1| Beta-galactosidase 8 isoform 1 [Theobroma cacao]
 ref|XP_007015422.1| Beta-galactosidase 8 isoform 1 [Theobroma cacao]
 ref|XP_007015423.1| Beta-galactosidase 8 isoform 1 [Theobroma cacao]
 gb|EOY33040.1| Beta-galactosidase 8 isoform 1 [Theobroma cacao]
 gb|EOY33041.1| Beta-galactosidase 8 isoform 1 [Theobroma cacao]
 gb|EOY33042.1| Beta-galactosidase 8 isoform 1 [Theobroma cacao]
Length=845

 Score =   318 bits (816),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/220 (70%), Positives = 178/220 (81%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NFDAP    P  L  + G GKG AWVNGQSIGRYWP Y + +GGCTDSCNYRG YNS
Sbjct  626  YKTNFDAPAGNDPIALDFT-GMGKGEAWVNGQSIGRYWPAYVSRSGGCTDSCNYRGSYNS  684

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL+NCGKPSQ  YHVPRSWL+ SGN+LV+FEE+GGDPT+L+FATR++GSLCS VSESH
Sbjct  685  NKCLKNCGKPSQQLYHVPRSWLQPSGNILVLFEELGGDPTQLAFATRQMGSLCSHVSESH  744

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P+PVDMW+SD    +     LSL CP  NQVIS+IKFASFGTP+GTCGSFSHG+C S  A
Sbjct  745  PLPVDMWSSDSKTGRTSSPILSLVCPSPNQVISSIKFASFGTPRGTCGSFSHGRCSSVRA  804

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+V+KAC G   CS+GVS++TFG+PC GV KSLAVE SC
Sbjct  805  LSIVQKACTGSTRCSIGVSTSTFGDPCKGVMKSLAVEVSC  844



>ref|XP_007015424.1| Beta-galactosidase 8 isoform 4 [Theobroma cacao]
 gb|EOY33043.1| Beta-galactosidase 8 isoform 4 [Theobroma cacao]
Length=811

 Score =   317 bits (813),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 178/220 (81%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            Y+ NFDAP    P  L  + G GKG AWVNGQSIGRYWP Y + +GGCTDSCNYRG YNS
Sbjct  592  YQTNFDAPAGNDPIALDFT-GMGKGEAWVNGQSIGRYWPAYVSRSGGCTDSCNYRGSYNS  650

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL+NCGKPSQ  YHVPRSWL+ SGN+LV+FEE+GGDPT+L+FATR++GSLCS VSESH
Sbjct  651  NKCLKNCGKPSQQLYHVPRSWLQPSGNILVLFEELGGDPTQLAFATRQMGSLCSHVSESH  710

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P+PVDMW+SD    +     LSL CP  NQVIS+IKFASFGTP+GTCGSFSHG+C S  A
Sbjct  711  PLPVDMWSSDSKTGRTSSPILSLVCPSPNQVISSIKFASFGTPRGTCGSFSHGRCSSVRA  770

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+V+KAC G   CS+GVS++TFG+PC GV KSLAVE SC
Sbjct  771  LSIVQKACTGSTRCSIGVSTSTFGDPCKGVMKSLAVEVSC  810



>gb|KDO73220.1| hypothetical protein CISIN_1g003095mg [Citrus sinensis]
Length=848

 Score =   317 bits (811),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 181/221 (82%), Gaps = 2/221 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG AWVNGQSIGRYWPTY + NGGCTDSCNYRG Y+S
Sbjct  628  YKTTFDAPAGSEPVAIDFT-GMGKGEAWVNGQSIGRYWPTYVSQNGGCTDSCNYRGAYSS  686

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVG-SLCSRVSES  461
            +KCL+NCGKPSQ+ YHVPRSWLKSSGN LV+FEE+GGDPTK+SF T+++G SLCS V++S
Sbjct  687  NKCLKNCGKPSQSLYHVPRSWLKSSGNTLVLFEEIGGDPTKISFVTKQLGSSLCSHVTDS  746

Query  460  HPMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            HP+PVDMW SD   Q++ G  LSLECP  NQVIS+IKFASFGTP GTCGSFS G+C S  
Sbjct  747  HPLPVDMWGSDSKIQRKPGPVLSLECPNPNQVISSIKFASFGTPLGTCGSFSRGRCSSAR  806

Query  280  ALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            +LSVV++AC+G ++CS+GVS  TFG+PC GV KSLAVEASC
Sbjct  807  SLSVVRQACVGSKSCSIGVSVNTFGDPCKGVMKSLAVEASC  847



>ref|XP_002530296.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF32103.1| beta-galactosidase, putative [Ricinus communis]
Length=842

 Score =   316 bits (809),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/220 (67%), Positives = 183/220 (83%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK +FDAP    P  +  + G GKG AWVNGQSIGRYWPT  + + GC DSCNYRG Y+S
Sbjct  623  YKTSFDAPAGNDPVAIDFT-GMGKGEAWVNGQSIGRYWPTNVSPSSGCADSCNYRGGYSS  681

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL+NCGKPSQT+YH+PRSW+KSSGN+LV+ EE+GGDPT+++FATR+VGSLCS VSESH
Sbjct  682  NKCLKNCGKPSQTFYHIPRSWIKSSGNILVLLEEIGGDPTQIAFATRQVGSLCSHVSESH  741

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVDMW +D  G K+ G  LSL+CP  ++VIS+IKFASFGTP G+CGS+SHGKC ST+A
Sbjct  742  PQPVDMWNTDSEGGKRSGPVLSLQCPHPDKVISSIKFASFGTPHGSCGSYSHGKCSSTSA  801

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+V+KAC+G ++C++GVS  TFG+PC GV KSLAVEASC
Sbjct  802  LSIVQKACVGSKSCNVGVSINTFGDPCRGVKKSLAVEASC  841



>ref|XP_006424599.1| hypothetical protein CICLE_v10027805mg [Citrus clementina]
 ref|XP_006488120.1| PREDICTED: beta-galactosidase 8-like [Citrus sinensis]
 gb|ESR37839.1| hypothetical protein CICLE_v10027805mg [Citrus clementina]
Length=848

 Score =   315 bits (806),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 180/221 (81%), Gaps = 2/221 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG AWVNGQSIGRYWPTY + NGGCTDSCNYRG Y+S
Sbjct  628  YKTTFDAPAGSEPVAIDFT-GMGKGEAWVNGQSIGRYWPTYVSQNGGCTDSCNYRGAYSS  686

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVG-SLCSRVSES  461
            +KCL+NCGKPSQ+ YHVPRSWLKSSGN LV+FEE+GGDPTK+SF T+++G SLCS V++S
Sbjct  687  NKCLKNCGKPSQSLYHVPRSWLKSSGNTLVLFEEIGGDPTKISFVTKQLGSSLCSHVTDS  746

Query  460  HPMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            HP+PVDMW SD   Q++ G  LSLECP  NQVIS+IKFASFGTP GTCGSFS G+C S  
Sbjct  747  HPLPVDMWGSDSKIQRKPGPVLSLECPNPNQVISSIKFASFGTPLGTCGSFSRGRCSSAR  806

Query  280  ALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            +LSVV++AC+G ++C +GVS  TFG+PC GV KSLAVEASC
Sbjct  807  SLSVVRQACVGSKSCIIGVSVNTFGDPCKGVMKSLAVEASC  847



>ref|XP_009335064.1| PREDICTED: beta-galactosidase 8-like isoform X2 [Pyrus x bretschneideri]
Length=697

 Score =   310 bits (795),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 176/220 (80%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA F+AP    P  L  + G GKG AWVNGQSIGRYWPT  A   GC DSCN+RGPY+S
Sbjct  478  YKATFNAPDGSNPVALDFT-GMGKGEAWVNGQSIGRYWPTNNAPTSGCPDSCNFRGPYDS  536

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC +NCGKPSQ  YHVPRSWLK SGN LV+FEE+GGDPT++SFATR++ SLCS VSESH
Sbjct  537  NKCRKNCGKPSQELYHVPRSWLKPSGNTLVLFEEIGGDPTQISFATRQIESLCSHVSESH  596

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W+SD    ++ G  LSLECP  NQVIS+IKFAS+G P GTCGSFSHG+C+ST+A
Sbjct  597  PSPVDTWSSDSKAGRKLGPVLSLECPFPNQVISSIKFASYGKPHGTCGSFSHGQCKSTSA  656

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+V+KAC+G ++CS+ VS  TFG+PC GV KSLAVEASC
Sbjct  657  LSIVQKACVGSKSCSIEVSVKTFGDPCKGVAKSLAVEASC  696



>ref|XP_008359158.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Malus domestica]
Length=499

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 164/200 (82%), Gaps = 0/200 (0%)
 Frame = -1

Query  757  GWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRS  578
            G GKG AWVNGQSIGRYWPT  A   GC DSCN+RGPY+S+KC +NCGKPSQ  YHVPRS
Sbjct  299  GMGKGEAWVNGQSIGRYWPTNNAPTSGCPDSCNFRGPYDSNKCRKNCGKPSQELYHVPRS  358

Query  577  WLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAA  398
            WLK SGN LV+FEE+GGDPT++SFATR++ SLCS VSESHP PVD W+SD    ++ G  
Sbjct  359  WLKPSGNTLVLFEEIGGDPTQISFATRQIESLCSHVSESHPSPVDTWSSDSKAGRKLGPV  418

Query  397  LSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSS  218
            LSLECP  NQVIS+IKFAS+G P GTCGS SHG C+ST+ALS+V+KAC+G ++CS+ VS 
Sbjct  419  LSLECPFPNQVISSIKFASYGKPHGTCGSXSHGHCKSTSALSIVQKACVGSKSCSIEVSV  478

Query  217  TTFGNPCAGVTKSLAVEASC  158
             TFG+PC GV KSLAVEASC
Sbjct  479  KTFGDPCEGVAKSLAVEASC  498



>ref|XP_008363504.1| PREDICTED: beta-galactosidase 8-like [Malus domestica]
Length=503

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 174/220 (79%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA F+AP    P  L  + G GKG AWVNGQSIGRYWPT  +   GC DSC++RGPYNS
Sbjct  284  YKATFNAPDGSNPVALDFT-GMGKGEAWVNGQSIGRYWPTNISPTSGCPDSCDFRGPYNS  342

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC +NCGKPSQ  YHVPRSWLK S N LV+FEE+GGDPT++SFATR++ SLCS VSESH
Sbjct  343  DKCRKNCGKPSQELYHVPRSWLKPSDNTLVLFEEIGGDPTQISFATRQIESLCSHVSESH  402

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
              PVD W+SD    ++ G  LSLECP  NQVIS+IKFAS+G PQGTCGSFSHG+C+S++A
Sbjct  403  LSPVDTWSSDSKVGRKLGPVLSLECPFPNQVISSIKFASYGKPQGTCGSFSHGQCKSSSA  462

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+V+KAC+G ++CS  VS  TFG+PC GV KSLAVEASC
Sbjct  463  LSIVQKACVGSKSCSXEVSVKTFGDPCNGVAKSLAVEASC  502



>gb|KDO73221.1| hypothetical protein CISIN_1g003095mg [Citrus sinensis]
Length=844

 Score =   312 bits (800),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/217 (70%), Positives = 179/217 (82%), Gaps = 2/217 (1%)
 Frame = -1

Query  805  FDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCL  626
            FDAP    P  +  + G GKG AWVNGQSIGRYWPTY + NGGCTDSCNYRG Y+S+KCL
Sbjct  628  FDAPAGSEPVAIDFT-GMGKGEAWVNGQSIGRYWPTYVSQNGGCTDSCNYRGAYSSNKCL  686

Query  625  RNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVG-SLCSRVSESHPMP  449
            +NCGKPSQ+ YHVPRSWLKSSGN LV+FEE+GGDPTK+SF T+++G SLCS V++SHP+P
Sbjct  687  KNCGKPSQSLYHVPRSWLKSSGNTLVLFEEIGGDPTKISFVTKQLGSSLCSHVTDSHPLP  746

Query  448  VDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSV  269
            VDMW SD   Q++ G  LSLECP  NQVIS+IKFASFGTP GTCGSFS G+C S  +LSV
Sbjct  747  VDMWGSDSKIQRKPGPVLSLECPNPNQVISSIKFASFGTPLGTCGSFSRGRCSSARSLSV  806

Query  268  VKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            V++AC+G ++CS+GVS  TFG+PC GV KSLAVEASC
Sbjct  807  VRQACVGSKSCSIGVSVNTFGDPCKGVMKSLAVEASC  843



>dbj|BAD91083.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=842

 Score =   312 bits (799),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 177/220 (80%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA F+AP    P  L  + G GKG AWVNGQSIGRYWPT  A   GC DSCN+RGPY+S
Sbjct  623  YKATFNAPDGSNPVALDFT-GMGKGEAWVNGQSIGRYWPTNNAPTSGCPDSCNFRGPYDS  681

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC +NCGKPSQ  YHVPRSWLK SGN LV+FEE+GGDPT++SFATR++ SLCS VSESH
Sbjct  682  NKCRKNCGKPSQELYHVPRSWLKPSGNTLVLFEEIGGDPTQISFATRQIESLCSHVSESH  741

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W+SD    ++ G  LSLECP  NQVIS+IKFAS+G PQGTCGSFSHG+C+ST+A
Sbjct  742  PSPVDTWSSDSKAGRKLGPVLSLECPFPNQVISSIKFASYGKPQGTCGSFSHGQCKSTSA  801

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+V+KAC+G ++CS+ VS  TFG+PC GV KSLAVEASC
Sbjct  802  LSIVQKACVGSKSCSIEVSVKTFGDPCKGVAKSLAVEASC  841



>ref|NP_001289207.1| beta-galactosidase 8-like precursor [Pyrus x bretschneideri]
 gb|AGR44465.1| beta-D-galactosidase 6 [Pyrus x bretschneideri]
Length=842

 Score =   312 bits (799),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 177/220 (80%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA F+AP    P  L  + G GKG AWVNGQSIGRYWPT  A   GC DSCN+RGPY+S
Sbjct  623  YKATFNAPDGSNPVALDFT-GMGKGEAWVNGQSIGRYWPTNNAPTSGCPDSCNFRGPYDS  681

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC +NCGKPSQ  YHVPRSWLK SGN LV+FEE+GGDPT++SFATR++ SLCS VSESH
Sbjct  682  NKCRKNCGKPSQELYHVPRSWLKPSGNTLVLFEEIGGDPTQISFATRQIESLCSHVSESH  741

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W+SD  G ++ G  LSLECP  NQVIS+IKFAS+G P GTCGSFSHG+C+ST+A
Sbjct  742  PSPVDTWSSDSKGGRKLGPVLSLECPFPNQVISSIKFASYGKPHGTCGSFSHGQCKSTSA  801

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+V+KAC+G ++CS+ VS  TFG+PC GV KSLAVEASC
Sbjct  802  LSIVQKACVGSKSCSIEVSVKTFGDPCKGVAKSLAVEASC  841



>gb|ACJ83814.1| unknown [Medicago truncatula]
Length=200

 Score =   291 bits (744),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 162/199 (81%), Gaps = 0/199 (0%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG AWVNGQSIGRYWPTY ASN GCTDSCNYRGPY S KC +NCGKPSQT YHVPRS+L
Sbjct  2    GKGEAWVNGQSIGRYWPTYVASNAGCTDSCNYRGPYTSSKCRKNCGKPSQTLYHVPRSFL  61

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAALS  392
            K +GN LV+FEE GGDPT++SFAT+++ S+CS VS+SHP  +D+W  D     + G AL 
Sbjct  62   KPNGNTLVLFEENGGDPTQISFATKQLESVCSHVSDSHPPQIDLWNQDTESGGKVGPALL  121

Query  391  LECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSSTT  212
            L CP  NQVIS+IKFAS+GTP GTCG+F  G+C S  ALS+VKKACIG R+CS+GVS+ T
Sbjct  122  LSCPNHNQVISSIKFASYGTPLGTCGNFYRGRCSSNKALSIVKKACIGSRSCSVGVSTDT  181

Query  211  FGNPCAGVTKSLAVEASCA  155
            FG+PC GV KSLAVEA+CA
Sbjct  182  FGDPCRGVPKSLAVEATCA  200



>ref|XP_007207302.1| hypothetical protein PRUPE_ppa001480mg [Prunus persica]
 gb|EMJ08501.1| hypothetical protein PRUPE_ppa001480mg [Prunus persica]
Length=816

 Score =   310 bits (793),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/220 (67%), Positives = 174/220 (79%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA F+AP    P  +  + G GKG AWVNGQSIGRYWPT  +   GC DSCNYRGPY+S
Sbjct  597  YKAKFNAPDGSNPVAIDFT-GLGKGEAWVNGQSIGRYWPTNISPTSGCPDSCNYRGPYDS  655

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC +NCGKPSQ  YHVPRSWLK + N LV+FEE+GGDPT++SFATR++ SLCS VSESH
Sbjct  656  NKCRKNCGKPSQELYHVPRSWLKPNDNTLVLFEEIGGDPTQISFATRQIDSLCSHVSESH  715

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVDMW+ D    ++ G  LSLECP  NQVIS+IKFAS+G P GTCGSFSHG+C+ST A
Sbjct  716  PSPVDMWSPDSKAGRKSGPVLSLECPFPNQVISSIKFASYGKPHGTCGSFSHGQCKSTRA  775

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LSVV+KAC+G R CS+ VS +TFG+PC GV KSLAVEASC
Sbjct  776  LSVVQKACVGSRTCSVEVSVSTFGDPCKGVAKSLAVEASC  815



>gb|KHN38778.1| Beta-galactosidase 8 [Glycine soja]
Length=838

 Score =   310 bits (793),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 176/221 (80%), Gaps = 3/221 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NF AP    P  +  + G GKG AWVNGQSIGRYWPTY + NGGCTDSCNYRG Y+S
Sbjct  621  YKTNFVAPSGSNPVAIDFT-GMGKGEAWVNGQSIGRYWPTYVSPNGGCTDSCNYRGAYSS  679

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+NCGKPSQT YH+PRSWL+   N LV+FEE GGDPT++SFAT+++GS+CS VSESH
Sbjct  680  SKCLKNCGKPSQTLYHIPRSWLQPDSNTLVLFEESGGDPTQISFATKQIGSMCSHVSESH  739

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD+W SD    ++ G  LSLECP  NQ+IS+IKFASFGTP GTCG+F HG+CRS  A
Sbjct  740  PPPVDLWNSDKG--RKVGPVLSLECPYPNQLISSIKFASFGTPYGTCGNFKHGRCRSNKA  797

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+V+KACIG  +C +G+S  TFG+PC GVTKSLAVEASCA
Sbjct  798  LSIVQKACIGSSSCRIGISINTFGDPCKGVTKSLAVEASCA  838



>ref|XP_003538213.1| PREDICTED: beta-galactosidase 8-like [Glycine max]
Length=838

 Score =   310 bits (793),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 176/221 (80%), Gaps = 3/221 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NF AP    P  +  + G GKG AWVNGQSIGRYWPTY + NGGCTDSCNYRG Y+S
Sbjct  621  YKTNFVAPSGSNPVAIDFT-GMGKGEAWVNGQSIGRYWPTYVSPNGGCTDSCNYRGAYSS  679

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+NCGKPSQT YH+PRSWL+   N LV+FEE GGDPT++SFAT+++GS+CS VSESH
Sbjct  680  SKCLKNCGKPSQTLYHIPRSWLQPDSNTLVLFEESGGDPTQISFATKQIGSMCSHVSESH  739

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD+W SD    ++ G  LSLECP  NQ+IS+IKFASFGTP GTCG+F HG+CRS  A
Sbjct  740  PPPVDLWNSDKG--RKVGPVLSLECPYPNQLISSIKFASFGTPYGTCGNFKHGRCRSNKA  797

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+V+KACIG  +C +G+S  TFG+PC GVTKSLAVEASCA
Sbjct  798  LSIVQKACIGSSSCRIGISINTFGDPCKGVTKSLAVEASCA  838



>dbj|BAA13685.1| AR782 [Arabidopsis thaliana]
Length=206

 Score =   291 bits (745),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 170/204 (83%), Gaps = 3/204 (1%)
 Frame = -1

Query  757  GWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRS  578
            G GKG+AWVNGQSIGRYWPT  A NGGCT+SC+YRG Y ++KCL+NCGKPSQT YHVPRS
Sbjct  3    GTGKGIAWVNGQSIGRYWPTSIAGNGGCTESCDYRGSYRANKCLKNCGKPSQTLYHVPRS  62

Query  577  WLKSSGNVLVVFEEVGGDPTKLSFATREVGS-LCSRVSESHPMPVDMWTSD--LSGQKQE  407
            WLK SGN+LV+FEE+GGDPT++SFAT++ GS LC  VS+SHP PVD WTSD  +S + + 
Sbjct  63   WLKPSGNILVLFEEMGGDPTQISFATKQTGSNLCLTVSQSHPPPVDTWTSDSKISNRNRT  122

Query  406  GAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLG  227
               LSL+CP+S QVI +IKFASFGTP+GTCGSF+ G C S+ +LS+V+KACIGLR+C++ 
Sbjct  123  RPVLSLKCPISTQVIFSIKFASFGTPKGTCGSFTQGHCNSSRSLSLVQKACIGLRSCNVE  182

Query  226  VSSTTFGNPCAGVTKSLAVEASCA  155
            VS+  FG PC GV KSLAVEASC+
Sbjct  183  VSTRVFGEPCRGVVKSLAVEASCS  206



>ref|XP_008225494.1| PREDICTED: beta-galactosidase 8 [Prunus mume]
Length=848

 Score =   310 bits (794),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 148/220 (67%), Positives = 172/220 (78%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA F+AP    P  +  + G GKG AWVNGQSIGRYWPT  +   GC DSCNYRGPY+S
Sbjct  629  YKAKFNAPDGSNPVAIDFT-GLGKGEAWVNGQSIGRYWPTNISPTSGCPDSCNYRGPYDS  687

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC +NCGKPSQ  YHVPRSWLK   N+LV+FEE+GGDP ++SFATR++ SLCS VSESH
Sbjct  688  NKCRKNCGKPSQELYHVPRSWLKPDDNILVLFEEIGGDPMQISFATRQIDSLCSHVSESH  747

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVDMWTSD    ++ G  LSLECP  NQVIS+IKFAS+G P GTCGSFSHG+C+S  A
Sbjct  748  PSPVDMWTSDSKAGRKSGPVLSLECPFPNQVISSIKFASYGKPHGTCGSFSHGQCKSNRA  807

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LSVV+KAC+G R CS+ VS  TFG+PC GV KSLAVEASC
Sbjct  808  LSVVQKACVGSRTCSVEVSVNTFGDPCKGVAKSLAVEASC  847



>gb|ACJ86219.1| unknown [Medicago truncatula]
Length=200

 Score =   290 bits (743),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG AWVNGQSIGRYWPTY + N GCTDSCNYRG Y++ KCL+NCGKPSQT YHVPR+WL
Sbjct  2    GKGEAWVNGQSIGRYWPTYISPNSGCTDSCNYRGTYSASKCLKNCGKPSQTLYHVPRAWL  61

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAALS  392
            K   N  V+FEE GGDPTK+SF T+++ S+CS V+ESHP PVD W S+   +++ G  LS
Sbjct  62   KPDSNTFVLFEESGGDPTKISFGTKQIESVCSHVTESHPPPVDTWNSNAESERKVGPVLS  121

Query  391  LECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSSTT  212
            LECP  NQ IS+IKFASFGTP+ TCG+++HG C S  ALS+V+KACIG  +C++GVS  T
Sbjct  122  LECPYPNQAISSIKFASFGTPRRTCGNYNHGSCSSNRALSIVQKACIGSSSCNIGVSINT  181

Query  211  FGNPCAGVTKSLAVEASC  158
            FGNPC GVTKSLAVEA+C
Sbjct  182  FGNPCRGVTKSLAVEAAC  199



>ref|XP_008366360.1| PREDICTED: beta-galactosidase 8-like [Malus domestica]
Length=842

 Score =   308 bits (790),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 174/220 (79%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA F AP    P  L  + G GKG AWVNGQSIGRYWPT  A   GC DSCN+RGPY+S
Sbjct  623  YKATFXAPDGSNPVALDFT-GMGKGEAWVNGQSIGRYWPTNNAPTSGCPDSCNFRGPYDS  681

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC +NCGKPSQ  YHVPRSWLK SGN LV+FEE+GGDPT++SFATR++ SLCS VSESH
Sbjct  682  NKCRKNCGKPSQELYHVPRSWLKPSGNTLVLFEEIGGDPTQISFATRQIESLCSHVSESH  741

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W+SD    ++ G  LSLECP  NQVIS+IKFAS+G P GTCGSFSHG C+ST+A
Sbjct  742  PSPVDTWSSDSKAGRKLGPVLSLECPFPNQVISSIKFASYGKPHGTCGSFSHGHCKSTSA  801

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+V+KAC+G ++CS+ VS  TFG+PC GV KSLAVEASC
Sbjct  802  LSIVQKACVGSKSCSIEVSVKTFGDPCEGVAKSLAVEASC  841



>ref|XP_008385297.1| PREDICTED: beta-galactosidase 8-like [Malus domestica]
Length=842

 Score =   308 bits (790),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 174/220 (79%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA F AP    P  L  + G GKG AWVNGQSIGRYWPT  A   GC DSCN+RGPY+S
Sbjct  623  YKATFGAPDGSNPVALDFT-GMGKGEAWVNGQSIGRYWPTNNAPTSGCPDSCNFRGPYDS  681

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC +NCGKPSQ  YHVPRSWLK SGN LV+FEE+GGDPT++SFATR++ SLCS VSESH
Sbjct  682  NKCRKNCGKPSQELYHVPRSWLKPSGNTLVLFEEIGGDPTQISFATRQIESLCSHVSESH  741

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W+SD    ++ G  LSLECP  NQVIS+IKFAS+G P GTCGSFSHG C+ST+A
Sbjct  742  PSPVDTWSSDSKAGRKLGPVLSLECPFPNQVISSIKFASYGKPHGTCGSFSHGHCKSTSA  801

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+V+KAC+G ++CS+ VS  TFG+PC GV KSLAVEASC
Sbjct  802  LSIVQKACVGSKSCSIEVSVKTFGDPCEGVAKSLAVEASC  841



>ref|XP_009338266.1| PREDICTED: beta-galactosidase 8-like isoform X2 [Pyrus x bretschneideri]
Length=697

 Score =   305 bits (781),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 175/220 (80%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA F+AP    P  L  + G GKG AWVNGQSIGRYWPT  +   GC DSC++RGPYNS
Sbjct  478  YKATFNAPDGSNPVALDFT-GMGKGEAWVNGQSIGRYWPTNISPTSGCPDSCDFRGPYNS  536

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC +NCGKPSQ  YHVPRSWLK S N LV+FEE+GGDPT++SFATR++ SLCS VSESH
Sbjct  537  DKCRKNCGKPSQELYHVPRSWLKPSDNTLVLFEEIGGDPTQISFATRQIESLCSHVSESH  596

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
              PVD W+SD    ++ G  LSLECP  NQVIS+IKFAS+G PQGTCGSFSHG+C+S++A
Sbjct  597  LSPVDTWSSDSKVGRKLGPVLSLECPFPNQVISSIKFASYGKPQGTCGSFSHGQCKSSSA  656

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+V+KAC+G ++CS+ VS  TFG+PC GV KSLAVEASC
Sbjct  657  LSIVQKACVGSKSCSIEVSVKTFGDPCKGVAKSLAVEASC  696



>ref|XP_002314274.2| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE88229.2| beta-galactosidase family protein [Populus trichocarpa]
Length=864

 Score =   308 bits (790),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 182/221 (82%), Gaps = 2/221 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK +F+AP    P  +  S G GKG AWVNGQSIGRYWPT  +   GC++ CNYRG Y+S
Sbjct  646  YKTSFNAPAGNDPIAIDFS-GMGKGEAWVNGQSIGRYWPTKVSPTSGCSN-CNYRGSYSS  703

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+NC KPSQT YHVPRSW++SSGN LV+FEE+GGDPT+++FAT++  SLCS VSESH
Sbjct  704  SKCLKNCAKPSQTLYHVPRSWVESSGNTLVLFEEIGGDPTQIAFATKQSASLCSHVSESH  763

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P+PVDMW+S+   +++ G  LSLECP  NQVIS+IKFASFGTP+GTCGSFSHG+C+ST A
Sbjct  764  PLPVDMWSSNSEAERKAGPVLSLECPFPNQVISSIKFASFGTPRGTCGSFSHGQCKSTRA  823

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+V+KACIG ++CS+G S++TFG+PC GV KSLAVEASCA
Sbjct  824  LSIVQKACIGSKSCSIGASASTFGDPCRGVAKSLAVEASCA  864



>ref|XP_011044378.1| PREDICTED: beta-galactosidase 8 [Populus euphratica]
Length=849

 Score =   308 bits (789),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 180/221 (81%), Gaps = 2/221 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK +F+AP    P  +    G GKG AWVNGQSIGRYWPT  +   GC++ CNYRG Y+S
Sbjct  631  YKTSFNAPAGNDPIAIDF-LGMGKGEAWVNGQSIGRYWPTKVSPTSGCSN-CNYRGSYSS  688

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+NC KPSQT YHVPRSW++SSGN LV+FEE+GGDPT++ FATR+  SLCS VSESH
Sbjct  689  SKCLKNCAKPSQTLYHVPRSWVESSGNTLVLFEEIGGDPTQIVFATRQSASLCSHVSESH  748

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P+PVDMW+S+   +++ G  LSLECP  NQVIS+IKFASFGTP+GTCGSFSHG+C+ST A
Sbjct  749  PLPVDMWSSNSEAERKAGPVLSLECPFPNQVISSIKFASFGTPRGTCGSFSHGQCKSTRA  808

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+VKKACIG ++CS+G S++TFG+PC GV KSLAVEASCA
Sbjct  809  LSIVKKACIGSKSCSIGASASTFGDPCRGVAKSLAVEASCA  849



>ref|XP_010253630.1| PREDICTED: beta-galactosidase 8 [Nelumbo nucifera]
Length=845

 Score =   308 bits (789),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 174/221 (79%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK +FDAP    P  L  + G GKG AWVNGQSIGRYWPTY +   GCTDSC+YRGPYNS
Sbjct  626  YKTSFDAPSGNDPTALDFT-GMGKGEAWVNGQSIGRYWPTYISPQSGCTDSCDYRGPYNS  684

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC +NCGK SQ  YHVPRSW++ SGN LV+FEEVGGDPT++SFATR+ GSLCS VSESH
Sbjct  685  NKCHKNCGKASQNLYHVPRSWIQPSGNTLVLFEEVGGDPTQISFATRQTGSLCSHVSESH  744

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W SD    K+ G  L LECP  NQVIS+I FASFGTP+G CGSF  GKC ST+A
Sbjct  745  PPPVDTWDSDTKTGKKSGPVLQLECPFPNQVISSINFASFGTPRGACGSFKQGKCSSTSA  804

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L++V++AC+G ++CS+ VS  +FG+PC GVTKSLAVEA+CA
Sbjct  805  LAIVQQACVGSKSCSIAVSIDSFGDPCVGVTKSLAVEATCA  845



>ref|XP_010689565.1| PREDICTED: beta-galactosidase 8 [Beta vulgaris subsp. vulgaris]
Length=846

 Score =   307 bits (786),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 148/220 (67%), Positives = 175/220 (80%), Gaps = 2/220 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L  + G GKG AWVNGQSIGRYWP  ++ + GCTD CNY+GPY S
Sbjct  628  YKTLFDAPDGNDPLALDFT-GMGKGEAWVNGQSIGRYWPALSSPDSGCTDYCNYKGPYKS  686

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL+ CGKPSQ  YHVPRSW+K SGNVLVVFEE+GGDPTK+SFAT++VGS+CS VSESH
Sbjct  687  NKCLKKCGKPSQELYHVPRSWVKPSGNVLVVFEEIGGDPTKISFATKQVGSICSHVSESH  746

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVDMW +D +G+K     LSLECP SNQVIS+IKF SFGTPQG+CGS++HG CRS  A
Sbjct  747  PPPVDMWNTDQTGKKSV-PTLSLECPSSNQVISSIKFVSFGTPQGSCGSYAHGTCRSLQA  805

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
              +V+KAC+G R+C++GVS  TFG+PC GV KSLAVEA C
Sbjct  806  QKIVQKACVGARSCNIGVSVATFGDPCIGVKKSLAVEAIC  845



>gb|KJB55481.1| hypothetical protein B456_009G078400 [Gossypium raimondii]
Length=845

 Score =   306 bits (785),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 173/221 (78%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NFDAP    P  L    G GKG AW+NGQSIGRYWP Y ASN GCTDSC+YRGPY++
Sbjct  626  YKTNFDAPTGNDPVALDF-MGMGKGEAWINGQSIGRYWPAYIASNSGCTDSCDYRGPYSA  684

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC +NCGKPSQ  YHVPRSWLK SGN+LV+FEE+GGDPT+L+FATR++GSLCS VS+SH
Sbjct  685  NKCRKNCGKPSQQLYHVPRSWLKPSGNILVLFEEMGGDPTQLAFATRKMGSLCSHVSDSH  744

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P+P+DMW  D   ++     LSL CP  NQVIS+IKFASFGTP GTCGSFSHG+C S  A
Sbjct  745  PLPMDMWGLDSKTRRASNPTLSLSCPSPNQVISSIKFASFGTPLGTCGSFSHGRCSSAKA  804

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
             S+V+K C+G  +CS+ VS+ T G+PC GV KSLAVE SCA
Sbjct  805  HSIVQKVCVGSTSCSIDVSTKTLGDPCKGVKKSLAVEVSCA  845



>ref|XP_010911712.1| PREDICTED: beta-galactosidase 6-like [Elaeis guineensis]
Length=200

 Score =   286 bits (733),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG AWVNGQSIGRYWPTY +S  GCT SCNY+G Y+SDKCL+NCGKPSQ  YHVPRS++
Sbjct  2    GKGEAWVNGQSIGRYWPTYISSPNGCTTSCNYKGSYSSDKCLKNCGKPSQHMYHVPRSFI  61

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAALS  392
            +  GN LV+FEEVGGDPTK+SFATR+ GSLC+ VSESHP P+D W S      + G  + 
Sbjct  62   QPDGNTLVLFEEVGGDPTKISFATRQTGSLCAHVSESHPSPIDDWISSQRKVGKLGPVVH  121

Query  391  LECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSSTT  212
            LECP +NQVIS+IKFASFGTP G+CGS++ G C S +AL+VV++ACIG ++CS+GVS+  
Sbjct  122  LECPYANQVISSIKFASFGTPHGSCGSYNQGNCSSDSALAVVQQACIGAKSCSVGVSTKM  181

Query  211  FGNPCAGVTKSLAVEASCA  155
            FG+PC G+TKSLAVEA+C+
Sbjct  182  FGDPCTGITKSLAVEAACS  200



>ref|XP_012064843.1| PREDICTED: beta-galactosidase 8 [Jatropha curcas]
 gb|KDP44070.1| hypothetical protein JCGZ_05537 [Jatropha curcas]
Length=845

 Score =   306 bits (783),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = -1

Query  757  GWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRS  578
            G GKG AWVNGQSIGRYWPTY + N GCTDSC+YRG YNS+KCL+NC KPSQT YHVPRS
Sbjct  645  GMGKGEAWVNGQSIGRYWPTYVSPNSGCTDSCSYRGSYNSNKCLKNCAKPSQTLYHVPRS  704

Query  577  WLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAA  398
            W+K +GN+LV+FEEVGGDPT+++FATR+  SLCS VSESHP PVDMW +D    K+ G  
Sbjct  705  WVKPNGNILVLFEEVGGDPTQIAFATRQAESLCSHVSESHPQPVDMWNTDSEATKKSGPK  764

Query  397  LSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSS  218
            L LEC   NQVIS+IKFASFGTP GTCGSF HG+C S+NALS+V KAC+G + C++GVS+
Sbjct  765  LLLECQNPNQVISSIKFASFGTPHGTCGSFKHGQCSSSNALSIVHKACVGSKTCNVGVST  824

Query  217  TTFGNPCAGVTKSLAVEASC  158
            +TFG+PC GV KSLAVE  C
Sbjct  825  STFGDPCRGVRKSLAVEVLC  844



>ref|XP_011089891.1| PREDICTED: beta-galactosidase 8-like isoform X1 [Sesamum indicum]
Length=851

 Score =   306 bits (783),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 173/221 (78%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L  S G GKG AW+NGQSIGRYWP YTA + GCTDSCNYRG ++ 
Sbjct  632  YKTTFDAPTGISPVALDFS-GMGKGQAWINGQSIGRYWPKYTAPDSGCTDSCNYRGSFSP  690

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC++NCG+P+Q +YHVPRSWL++S NVLV+FEE+GGDP ++S ATRE GS+CS++ E+H
Sbjct  691  SKCMKNCGQPTQKFYHVPRSWLQASENVLVLFEEMGGDPEQISLATRETGSICSQILETH  750

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            PM VDMWT+D   + + G  LSL CP  NQV+S IKFASFGTP GTCGSFSHG+C S  A
Sbjct  751  PMEVDMWTTDQKSRSRTGPTLSLNCPFPNQVMSEIKFASFGTPHGTCGSFSHGRCSSEKA  810

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+V+K CIG R+C +GVS  TFG+PC G+ KSLAVEASC+
Sbjct  811  LSIVQKTCIGSRSCRIGVSVDTFGDPCRGMIKSLAVEASCS  851



>ref|XP_004505982.1| PREDICTED: beta-galactosidase 8-like [Cicer arietinum]
Length=838

 Score =   305 bits (782),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 148/220 (67%), Positives = 172/220 (78%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NF AP    P  +  + G GKG AWVNGQSIGRYWPTY A + GCTDSC+YRGPY+S
Sbjct  619  YKTNFAAPSGTNPVAIDFT-GMGKGEAWVNGQSIGRYWPTYAAPSSGCTDSCDYRGPYDS  677

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+NCGKPSQT YHVPRSWLK   N LV+FEE GGDPTK+S AT+++ S+CS VSESH
Sbjct  678  GKCLKNCGKPSQTLYHVPRSWLKPDNNTLVLFEESGGDPTKISIATKQIESVCSHVSESH  737

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PV MW  D     + G  LSLECP  NQVI++IKFAS+GTPQGTCG+F+HG+C S  A
Sbjct  738  PPPVSMWNLDTESGTEVGPVLSLECPSPNQVITSIKFASYGTPQGTCGNFNHGRCSSNGA  797

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+V+KACIG  +CS+GVS  TFGNPC GVTKSLAVEA+C
Sbjct  798  LSIVQKACIGSSSCSIGVSINTFGNPCRGVTKSLAVEAAC  837



>ref|XP_007132236.1| hypothetical protein PHAVU_011G077600g [Phaseolus vulgaris]
 gb|ESW04230.1| hypothetical protein PHAVU_011G077600g [Phaseolus vulgaris]
Length=831

 Score =   305 bits (780),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 173/221 (78%), Gaps = 5/221 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NF AP    P  +  + G GKG AWVNGQSIGRYWPTY + NGGC DSCNYRG Y+S
Sbjct  616  YKTNFVAPSGSNPVAIDFT-GMGKGEAWVNGQSIGRYWPTYVSPNGGCADSCNYRGAYSS  674

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+NCGKPSQT YHVPRSWL+   N LV+FEE GGDPT++SFAT+++GS+CS VSESH
Sbjct  675  SKCLKNCGKPSQTLYHVPRSWLQPDSNTLVLFEESGGDPTQISFATKQIGSVCSHVSESH  734

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD+W SD     + G  LSLECP  NQ IS+I+FASFGTP GTCG+F HG+CRS  A
Sbjct  735  PPPVDLWNSD----TKAGPVLSLECPYPNQAISSIQFASFGTPYGTCGNFKHGRCRSNKA  790

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+V+KACIG  +CS+G+S  TFG+PC GV KSLAVEASCA
Sbjct  791  LSIVQKACIGSNSCSVGLSLDTFGDPCKGVAKSLAVEASCA  831



>ref|XP_009338265.1| PREDICTED: beta-galactosidase 8-like isoform X1 [Pyrus x bretschneideri]
Length=842

 Score =   305 bits (780),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 175/220 (80%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA F+AP    P  L  + G GKG AWVNGQSIGRYWPT  +   GC DSC++RGPYNS
Sbjct  623  YKATFNAPDGSNPVALDFT-GMGKGEAWVNGQSIGRYWPTNISPTSGCPDSCDFRGPYNS  681

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC +NCGKPSQ  YHVPRSWLK S N LV+FEE+GGDPT++SFATR++ SLCS VSESH
Sbjct  682  DKCRKNCGKPSQELYHVPRSWLKPSDNTLVLFEEIGGDPTQISFATRQIESLCSHVSESH  741

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
              PVD W+SD    ++ G  LSLECP  NQVIS+IKFAS+G PQGTCGSFSHG+C+S++A
Sbjct  742  LSPVDTWSSDSKVGRKLGPVLSLECPFPNQVISSIKFASYGKPQGTCGSFSHGQCKSSSA  801

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+V+KAC+G ++CS+ VS  TFG+PC GV KSLAVEASC
Sbjct  802  LSIVQKACVGSKSCSIEVSVKTFGDPCKGVAKSLAVEASC  841



>gb|EYU18852.1| hypothetical protein MIMGU_mgv1a001263mg [Erythranthe guttata]
Length=851

 Score =   304 bits (779),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 149/222 (67%), Positives = 173/222 (78%), Gaps = 2/222 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L  + G GKG AW+NGQSIGRYWPT  A + GCTDSCNYRG Y+ 
Sbjct  631  YKTTFDAPSGSSPVALDFT-GMGKGQAWINGQSIGRYWPTNIAPSSGCTDSCNYRGAYSD  689

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC RNCGKPSQ  YHVPRSW+K SGN+LVVFEE GGDPT+LSFATRE  S+CSR+S+SH
Sbjct  690  GKCRRNCGKPSQHLYHVPRSWMKPSGNILVVFEEGGGDPTQLSFATRETESICSRISQSH  749

Query  457  PMPVDMWT-SDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            P+P+D WT S+   +K     LSL CP  NQVIS IKFASFG P+GTCGSFSHG+C S N
Sbjct  750  PIPIDTWTSSNKETRKHTKPTLSLSCPFPNQVISKIKFASFGNPKGTCGSFSHGQCSSKN  809

Query  280  ALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            A ++V+KACIG R+CS+GVS  TFG PCAG++KSLAVEASC+
Sbjct  810  ARTIVEKACIGSRSCSIGVSVNTFGEPCAGISKSLAVEASCS  851



>ref|XP_011461703.1| PREDICTED: beta-galactosidase 8 [Fragaria vesca subsp. vesca]
Length=840

 Score =   303 bits (776),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 172/220 (78%), Gaps = 2/220 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L  + G GKG AWVNGQSIGRYWPT  A   GCTD CNYRG Y++
Sbjct  622  YKTQFDAPGGSNPVALDFT-GMGKGEAWVNGQSIGRYWPTNVAPKTGCTD-CNYRGAYSA  679

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC +NCG PSQ  YHVPRSW+KSSGN LV+FEEVGGDPT+LSFATR+V SLCS VSESH
Sbjct  680  DKCRKNCGMPSQKLYHVPRSWMKSSGNTLVLFEEVGGDPTQLSFATRQVESLCSHVSESH  739

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVDMW+SD     +    LSLECP  NQVIS+IKFAS+G P GTCGSFSHG CRS+ A
Sbjct  740  PSPVDMWSSDSKAGSKSRPRLSLECPFPNQVISSIKFASYGRPSGTCGSFSHGLCRSSRA  799

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+V+KAC+G ++CS+ VS+ TFG+PC G+ KSLAVEASC
Sbjct  800  LSIVQKACVGSKSCSIEVSTNTFGDPCKGLAKSLAVEASC  839



>emb|CAC44501.1| beta-galactosidase [Fragaria x ananassa]
Length=840

 Score =   303 bits (776),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 172/220 (78%), Gaps = 2/220 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L  + G GKG AWVNGQSIGRYWPT  A   GCTD CNYRG Y++
Sbjct  622  YKTQFDAPGGSNPVALDFT-GMGKGEAWVNGQSIGRYWPTNVAPKTGCTD-CNYRGAYSA  679

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC +NCG PSQ  YHVPRSW+KSSGN LV+FEEVGGDPT+LSFATR+V SLCS VSESH
Sbjct  680  DKCRKNCGMPSQKLYHVPRSWMKSSGNTLVLFEEVGGDPTQLSFATRQVESLCSHVSESH  739

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVDMW+SD     +    LSLECP  NQVIS+IKFAS+G P GTCGSFSHG CRS+ A
Sbjct  740  PSPVDMWSSDSKAGSKSRPRLSLECPFPNQVISSIKFASYGRPSGTCGSFSHGSCRSSRA  799

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+V+KAC+G ++CS+ VS+ TFG+PC G+ KSLAVEASC
Sbjct  800  LSIVQKACVGSKSCSIEVSTHTFGDPCKGLAKSLAVEASC  839



>ref|XP_008358406.1| PREDICTED: beta-galactosidase 8-like [Malus domestica]
Length=842

 Score =   303 bits (775),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 174/220 (79%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA F+AP    P  L  + G GKG AWVNGQSIGRYWPT  +   GC DSC++RGPYNS
Sbjct  623  YKATFNAPDGSNPVALDFT-GMGKGEAWVNGQSIGRYWPTNISPTSGCPDSCDFRGPYNS  681

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC +NCGKPSQ  YHVPRSWLK S N LV+FEE+GGDPT++SFATR++ SLCS VSESH
Sbjct  682  DKCRKNCGKPSQELYHVPRSWLKPSDNTLVLFEEIGGDPTQISFATRQIESLCSHVSESH  741

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
              PVD W+SD    ++ G  LSLECP  NQVIS+IKFAS+G PQGTCGSFSHG+C+S++A
Sbjct  742  LSPVDTWSSDSKVGRKLGPVLSLECPFPNQVISSIKFASYGKPQGTCGSFSHGQCKSSSA  801

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+V+KAC+G ++CS  VS  TFG+PC GV KSLAVEASC
Sbjct  802  LSIVQKACVGSKSCSXEVSVKTFGDPCNGVAKSLAVEASC  841



>ref|XP_008463829.1| PREDICTED: beta-galactosidase 8 [Cucumis melo]
Length=844

 Score =   303 bits (775),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 178/220 (81%), Gaps = 3/220 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L  + G+GKG AW+NG SIGRYWP+YTAS G CT  C+Y+G Y++
Sbjct  627  YKTTFDAPAGSDPLALDFT-GFGKGEAWINGHSIGRYWPSYTAS-GQCTSYCDYKGSYSA  684

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCLRNCGKPSQT YHVPRSWLK + N LV+FEE+G DPT+LSFA++++GSLCS VSESH
Sbjct  685  NKCLRNCGKPSQTLYHVPRSWLKPTSNTLVLFEEIGSDPTRLSFASKQLGSLCSHVSESH  744

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PV+MW+SD S Q++ G  LSLECP  NQVIS+IKFASFGTP+GTCGSFSHGKC S NA
Sbjct  745  PAPVEMWSSD-SKQQKTGPVLSLECPSPNQVISSIKFASFGTPRGTCGSFSHGKCSSQNA  803

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+V+KACIG ++CS+ VS   FG+PC G TKSLAVEA C
Sbjct  804  LSIVQKACIGSKSCSVDVSIKAFGDPCRGKTKSLAVEAYC  843



>gb|KHG08626.1| Beta-galactosidase 8 -like protein [Gossypium arboreum]
Length=832

 Score =   302 bits (773),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 171/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NFDAP    P  L    G GKG AW+NGQSIGRYWP Y ASN GCTDSC+YRGPY++
Sbjct  613  YKTNFDAPTGNDPVALDF-MGMGKGEAWINGQSIGRYWPAYIASNSGCTDSCDYRGPYSA  671

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC +NCGKPSQ  YHVPRSWLK SGN+LV+FEE+GGDPT+L+FATR++GSLCS VS+SH
Sbjct  672  NKCRKNCGKPSQQLYHVPRSWLKPSGNILVLFEEMGGDPTQLAFATRKMGSLCSHVSDSH  731

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P+P+ MW  D   ++     LSL CP  NQVIS IKFASFGTP GTCGSFSHG+C S  A
Sbjct  732  PLPMVMWGLDSKTRRASNPTLSLSCPSPNQVISAIKFASFGTPLGTCGSFSHGRCSSAKA  791

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
             S+V+K C+G  +CS+ VS+ T G+PC GV KSLAVE SCA
Sbjct  792  HSIVQKVCVGSTSCSIDVSTRTLGDPCKGVKKSLAVEVSCA  832



>ref|XP_002879094.1| beta-glactosidase 8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55353.1| beta-glactosidase 8 [Arabidopsis lyrata subsp. lyrata]
Length=846

 Score =   301 bits (772),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 149/224 (67%), Positives = 178/224 (79%), Gaps = 4/224 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG+AWVNGQSIGRYWPT  A NGGCTDSC+YRG Y +
Sbjct  624  YKTTFDAPSGSEPVAIDFT-GTGKGIAWVNGQSIGRYWPTSIAGNGGCTDSCDYRGSYRA  682

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGS-LCSRVSES  461
            +KCL+NCGKPSQT YHVPRSWLK SGN LV+FEE+GGDPT++SF T++ GS LC  VS+S
Sbjct  683  NKCLKNCGKPSQTLYHVPRSWLKPSGNTLVLFEEMGGDPTQISFGTKQTGSNLCLMVSQS  742

Query  460  HPMPVDMWTSD--LSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRS  287
            HP PVD WTSD  +S + +    LSL+CP+S QVIS+IKFASFGTPQGTCGSF+HG C S
Sbjct  743  HPPPVDTWTSDSKISNRNRTRPVLSLKCPVSTQVISSIKFASFGTPQGTCGSFTHGHCNS  802

Query  286  TNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            + +LSVV+KACIG R+C++ VS+  FG PC GV KSLAVEASC+
Sbjct  803  SRSLSVVQKACIGSRSCNVEVSTRVFGEPCRGVIKSLAVEASCS  846



>ref|XP_002862517.1| hypothetical protein ARALYDRAFT_333310 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38775.1| hypothetical protein ARALYDRAFT_333310 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   294 bits (752),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 176/224 (79%), Gaps = 4/224 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G  KG+AWVNGQSIGRYWPT  A NGGCTDSC+YRG Y +
Sbjct  312  YKTTFDAPSGSEPVAIDFT-GTVKGIAWVNGQSIGRYWPTSIAGNGGCTDSCDYRGSYRA  370

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGS-LCSRVSES  461
            +KCL+NCGKPSQT YHVPRSWLK SGN LV+FEE+GGDPT++SF T++ GS LC  VS+S
Sbjct  371  NKCLKNCGKPSQTLYHVPRSWLKPSGNTLVLFEEMGGDPTQISFGTKQTGSNLCLTVSQS  430

Query  460  HPMPVDMWTSD--LSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRS  287
            HP PVD WTSD  +S + +    LSL+CP+S QVIS+IKFASFGTP+GTCGSF+ G C S
Sbjct  431  HPPPVDTWTSDSKISNRNRTRPVLSLQCPVSTQVISSIKFASFGTPKGTCGSFTSGSCNS  490

Query  286  TNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            + +LS+V+KACIG R+C++ VS+  FG PC GV KSLAVEASC+
Sbjct  491  SRSLSLVQKACIGSRSCNIEVSTRVFGEPCRGVVKSLAVEASCS  534



>ref|XP_004487127.1| PREDICTED: beta-galactosidase 8-like [Cicer arietinum]
Length=836

 Score =   301 bits (771),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 178/221 (81%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NFDAP    P  +  + G GKG AWVNGQSIGRYWPTY +SN GCTDSCNYRGPY S
Sbjct  617  YKTNFDAPSGSNPVAIDFT-GMGKGEAWVNGQSIGRYWPTYVSSNAGCTDSCNYRGPYTS  675

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC +NCGKPSQT YHVPR WLK + N+LV+FEE GGDP ++SFAT+E+GSLC+ VSESH
Sbjct  676  SKCRKNCGKPSQTLYHVPRFWLKPNDNILVLFEESGGDPAQISFATKELGSLCAHVSESH  735

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P P+D+W SD    ++ G AL L+CP+ NQVIS+IKFAS+GTP GTCG+F HG+C S  A
Sbjct  736  PPPIDLWNSDTESGRKIGPALLLKCPIHNQVISSIKFASYGTPLGTCGNFYHGRCSSNKA  795

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+V+KACIG  +CS+GVS+ TFGNPC GV+KSLAVEA+CA
Sbjct  796  LSIVQKACIGSSSCSVGVSTDTFGNPCKGVSKSLAVEATCA  836



>ref|XP_010510620.1| PREDICTED: beta-galactosidase 8-like [Camelina sativa]
Length=846

 Score =   301 bits (771),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 177/224 (79%), Gaps = 4/224 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG+AWVNGQSIGRYWPT  A N GCTDSC+YRG Y +
Sbjct  624  YKTTFDAPSGSEPVAIDFT-GTGKGIAWVNGQSIGRYWPTSIAGNNGCTDSCDYRGSYRA  682

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVG-SLCSRVSES  461
            +KCL+NCGKPSQT YHVPRSWLK SGN LV+ EE+GGDPT++SF T++ G SLC  VS+S
Sbjct  683  NKCLKNCGKPSQTLYHVPRSWLKPSGNTLVLLEEMGGDPTQISFTTKQTGSSLCLMVSQS  742

Query  460  HPMPVDMWTSD--LSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRS  287
            HP PVD WTSD  +S +K+    LSL CP+S QVIS+IKFASFGTP+GTCGSF+HG C S
Sbjct  743  HPAPVDTWTSDSKISKKKRTRPVLSLHCPVSTQVISSIKFASFGTPKGTCGSFTHGHCNS  802

Query  286  TNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            + +LS+V+KACIGLR+C+L VS+  FG PC GV KSLAVEASC+
Sbjct  803  SRSLSLVQKACIGLRSCNLEVSTRVFGEPCRGVVKSLAVEASCS  846



>ref|XP_003597217.1| Beta-galactosidase [Medicago truncatula]
 gb|AES67468.1| beta-galactosidase-like protein [Medicago truncatula]
Length=833

 Score =   300 bits (769),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 173/221 (78%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NFDAP    P  +  + G GKG AWVNGQSIGRYWPTY ASN GCTDSCNYRGPY S
Sbjct  614  YKTNFDAPSGSNPVAIDFT-GMGKGEAWVNGQSIGRYWPTYVASNAGCTDSCNYRGPYTS  672

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC +NCGKPSQT YHVPRS+LK +GN LV+FEE GGDPT++SFAT+++ S+CS VS+SH
Sbjct  673  SKCRKNCGKPSQTLYHVPRSFLKPNGNTLVLFEENGGDPTQISFATKQLESVCSHVSDSH  732

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P  +D+W  D     + G AL L CP  NQVIS+IKFAS+GTP GTCG+F  G+C S  A
Sbjct  733  PPQIDLWNQDTESGGKVGPALLLSCPNHNQVISSIKFASYGTPLGTCGNFYRGRCSSNKA  792

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+VKKACIG R+CS+GVS+ TFG+PC GV KSLAVEA+CA
Sbjct  793  LSIVKKACIGSRSCSVGVSTDTFGDPCRGVPKSLAVEATCA  833



>ref|XP_010032010.1| PREDICTED: beta-galactosidase 8 [Eucalyptus grandis]
 gb|KCW51399.1| hypothetical protein EUGRSUZ_J00936 [Eucalyptus grandis]
Length=852

 Score =   301 bits (770),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 152/222 (68%), Positives = 170/222 (77%), Gaps = 3/222 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F AP    P  +  S G GKG AWVNGQSIGRYWPT  A   GCTDSCNYRG Y S
Sbjct  631  YKTTFAAPAGDDPVAIDFS-GMGKGEAWVNGQSIGRYWPTNVAPGSGCTDSCNYRGTYGS  689

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL++CGKPSQ  YHVPRSWLK SGN+LV+FEEVGGDPT++SFATR++ SLCS VSESH
Sbjct  690  SKCLKSCGKPSQKLYHVPRSWLKPSGNILVMFEEVGGDPTQISFATRQIQSLCSHVSESH  749

Query  457  PMPVDMWTSDLSGQ--KQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRST  284
            P PVDMW  +   +  K     LSLECP  NQVIS+IKFASFGTPQGTCGSF HGKC S 
Sbjct  750  PSPVDMWNPESESKTGKTSRPTLSLECPRPNQVISSIKFASFGTPQGTCGSFGHGKCSSK  809

Query  283  NALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
             AL+VV+KACIG ++C +GVS   FG+PC GVTKSLAVEASC
Sbjct  810  RALAVVQKACIGSKSCMVGVSIDAFGDPCKGVTKSLAVEASC  851



>ref|XP_007207303.1| hypothetical protein PRUPE_ppa001480mg [Prunus persica]
 gb|EMJ08502.1| hypothetical protein PRUPE_ppa001480mg [Prunus persica]
Length=816

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 169/220 (77%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA F+AP    P  +  + G GKG AWVNGQSIGRYWPT  +   GC DSCNYRGPY+S
Sbjct  597  YKAKFNAPDGSNPVAIDFT-GLGKGEAWVNGQSIGRYWPTNISPTSGCPDSCNYRGPYDS  655

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC +NCGKPSQ  YHVPRSWLK + N LV+FEE+GGDPT++SFATR++ SLCS VSESH
Sbjct  656  NKCRKNCGKPSQELYHVPRSWLKPNDNTLVLFEEIGGDPTQISFATRQIDSLCSHVSESH  715

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVDMW+ D    ++ G  LSLECP  NQVIS+IKFAS+G P GTCGSFSHG+C+ST A
Sbjct  716  PSPVDMWSPDSKAGRKSGPVLSLECPFPNQVISSIKFASYGKPHGTCGSFSHGQCKSTRA  775

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LSVV+KAC+G   CS+  S  TF + C GV KSLAVEASC
Sbjct  776  LSVVQKACVGSTTCSVEFSVNTFSDQCKGVAKSLAVEASC  815



>ref|XP_008791518.1| PREDICTED: beta-galactosidase 6 isoform X2 [Phoenix dactylifera]
Length=804

 Score =   298 bits (764),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 172/221 (78%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NFDAP    P  +  + G GKG AWVNGQSIGRYWPTY +S  GC  SCNY+G YNS
Sbjct  585  YKTNFDAPEGNDPIAIDFT-GMGKGEAWVNGQSIGRYWPTYISSQNGCATSCNYKGTYNS  643

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKCL+NCGKPSQ  YHVPRS+++   N LV+FEE+GGDPTK+SFATR+ GSLC+ VSESH
Sbjct  644  DKCLKNCGKPSQLMYHVPRSFIQPGSNTLVLFEEMGGDPTKISFATRQTGSLCAHVSESH  703

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P P+D W S     ++ G  L LECP  NQVIS+IKFASFGTP G+CG ++HG CRS +A
Sbjct  704  PSPIDAWISSQQKVERLGPVLHLECPYPNQVISSIKFASFGTPHGSCGRYNHGNCRSDSA  763

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L+VV++ACIG ++C +GVS+  FG+PC G+TKSLAVEA+C+
Sbjct  764  LAVVQQACIGAKSCGIGVSTKMFGDPCRGITKSLAVEAACS  804



>ref|XP_003606403.1| Beta-galactosidase [Medicago truncatula]
 gb|AES88600.1| beta-galactosidase [Medicago truncatula]
Length=839

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 142/220 (65%), Positives = 171/220 (78%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NF AP    P  +  + G GKG AWVNGQSIGRYWPTY + N GCTDSCNYRG Y++
Sbjct  620  YKTNFVAPSGSNPVAIDFT-GMGKGEAWVNGQSIGRYWPTYISPNSGCTDSCNYRGTYSA  678

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+NCGKPSQT YHVPR+WLK   N  V+FEE GGDPTK+SF T+++ S+CS V+ESH
Sbjct  679  SKCLKNCGKPSQTLYHVPRAWLKPDSNTFVLFEESGGDPTKISFGTKQIESVCSHVTESH  738

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W S+   +++ G  LSLECP  NQ IS+IKFASFGTP+GTCG+++HG C S  A
Sbjct  739  PPPVDTWNSNAESERKVGPVLSLECPYPNQAISSIKFASFGTPRGTCGNYNHGSCSSNRA  798

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+V+KACIG  +C++GVS  TFGNPC GVTKSLAVEA+C
Sbjct  799  LSIVQKACIGSSSCNIGVSINTFGNPCRGVTKSLAVEAAC  838



>ref|XP_008791517.1| PREDICTED: beta-galactosidase 6 isoform X1 [Phoenix dactylifera]
Length=851

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 172/221 (78%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NFDAP    P  +  + G GKG AWVNGQSIGRYWPTY +S  GC  SCNY+G YNS
Sbjct  632  YKTNFDAPEGNDPIAIDFT-GMGKGEAWVNGQSIGRYWPTYISSQNGCATSCNYKGTYNS  690

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKCL+NCGKPSQ  YHVPRS+++   N LV+FEE+GGDPTK+SFATR+ GSLC+ VSESH
Sbjct  691  DKCLKNCGKPSQLMYHVPRSFIQPGSNTLVLFEEMGGDPTKISFATRQTGSLCAHVSESH  750

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P P+D W S     ++ G  L LECP  NQVIS+IKFASFGTP G+CG ++HG CRS +A
Sbjct  751  PSPIDAWISSQQKVERLGPVLHLECPYPNQVISSIKFASFGTPHGSCGRYNHGNCRSDSA  810

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L+VV++ACIG ++C +GVS+  FG+PC G+TKSLAVEA+C+
Sbjct  811  LAVVQQACIGAKSCGIGVSTKMFGDPCRGITKSLAVEAACS  851



>emb|CAB64744.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=852

 Score =   298 bits (764),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 179/224 (80%), Gaps = 4/224 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG+AWVNGQSIGRYWPT  A NGGCT+SC+YRG Y +
Sbjct  630  YKTTFDAPSGSEPVAIDFT-GTGKGIAWVNGQSIGRYWPTSIAGNGGCTESCDYRGSYRA  688

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGS-LCSRVSES  461
            +KCL+NCGKPSQT YHVPRSWLK SGN+LV+FEE+GGDPT++SFAT++ GS LC  VS+S
Sbjct  689  NKCLKNCGKPSQTLYHVPRSWLKPSGNILVLFEEMGGDPTQISFATKQTGSNLCLTVSQS  748

Query  460  HPMPVDMWTSD--LSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRS  287
            HP PVD WTSD  +S + +    LSL+CP+S QVI +IKFASFGTP+GTCGSF+ G C S
Sbjct  749  HPPPVDTWTSDSKISNRNRTRPVLSLKCPISTQVIFSIKFASFGTPKGTCGSFTQGHCNS  808

Query  286  TNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            + +LS+V+KACIGLR+C++ VS+  FG PC GV KSLAVEASC+
Sbjct  809  SRSLSLVQKACIGLRSCNVEVSTRVFGEPCRGVVKSLAVEASCS  852



>ref|NP_850121.1| beta-galactosidase 8 [Arabidopsis thaliana]
 sp|Q9SCV4.2|BGAL8_ARATH RecName: Full=Beta-galactosidase 8; Short=Lactase 8; AltName: 
Full=Protein AR782; Flags: Precursor [Arabidopsis thaliana]
 gb|AEC08127.1| beta-galactosidase 8 [Arabidopsis thaliana]
Length=852

 Score =   298 bits (764),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 179/224 (80%), Gaps = 4/224 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG+AWVNGQSIGRYWPT  A NGGCT+SC+YRG Y +
Sbjct  630  YKTTFDAPSGSEPVAIDFT-GTGKGIAWVNGQSIGRYWPTSIAGNGGCTESCDYRGSYRA  688

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGS-LCSRVSES  461
            +KCL+NCGKPSQT YHVPRSWLK SGN+LV+FEE+GGDPT++SFAT++ GS LC  VS+S
Sbjct  689  NKCLKNCGKPSQTLYHVPRSWLKPSGNILVLFEEMGGDPTQISFATKQTGSNLCLTVSQS  748

Query  460  HPMPVDMWTSD--LSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRS  287
            HP PVD WTSD  +S + +    LSL+CP+S QVI +IKFASFGTP+GTCGSF+ G C S
Sbjct  749  HPPPVDTWTSDSKISNRNRTRPVLSLKCPISTQVIFSIKFASFGTPKGTCGSFTQGHCNS  808

Query  286  TNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            + +LS+V+KACIGLR+C++ VS+  FG PC GV KSLAVEASC+
Sbjct  809  SRSLSLVQKACIGLRSCNVEVSTRVFGEPCRGVVKSLAVEASCS  852



>ref|NP_001189624.1| beta-galactosidase 8 [Arabidopsis thaliana]
 gb|AEC08128.1| beta-galactosidase 8 [Arabidopsis thaliana]
Length=846

 Score =   298 bits (763),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 179/224 (80%), Gaps = 4/224 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG+AWVNGQSIGRYWPT  A NGGCT+SC+YRG Y +
Sbjct  624  YKTTFDAPSGSEPVAIDFT-GTGKGIAWVNGQSIGRYWPTSIAGNGGCTESCDYRGSYRA  682

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGS-LCSRVSES  461
            +KCL+NCGKPSQT YHVPRSWLK SGN+LV+FEE+GGDPT++SFAT++ GS LC  VS+S
Sbjct  683  NKCLKNCGKPSQTLYHVPRSWLKPSGNILVLFEEMGGDPTQISFATKQTGSNLCLTVSQS  742

Query  460  HPMPVDMWTSD--LSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRS  287
            HP PVD WTSD  +S + +    LSL+CP+S QVI +IKFASFGTP+GTCGSF+ G C S
Sbjct  743  HPPPVDTWTSDSKISNRNRTRPVLSLKCPISTQVIFSIKFASFGTPKGTCGSFTQGHCNS  802

Query  286  TNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            + +LS+V+KACIGLR+C++ VS+  FG PC GV KSLAVEASC+
Sbjct  803  SRSLSLVQKACIGLRSCNVEVSTRVFGEPCRGVVKSLAVEASCS  846



>gb|AAD21482.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=839

 Score =   298 bits (762),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 179/224 (80%), Gaps = 4/224 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG+AWVNGQSIGRYWPT  A NGGCT+SC+YRG Y +
Sbjct  617  YKTTFDAPSGSEPVAIDFT-GTGKGIAWVNGQSIGRYWPTSIAGNGGCTESCDYRGSYRA  675

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGS-LCSRVSES  461
            +KCL+NCGKPSQT YHVPRSWLK SGN+LV+FEE+GGDPT++SFAT++ GS LC  VS+S
Sbjct  676  NKCLKNCGKPSQTLYHVPRSWLKPSGNILVLFEEMGGDPTQISFATKQTGSNLCLTVSQS  735

Query  460  HPMPVDMWTSD--LSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRS  287
            HP PVD WTSD  +S + +    LSL+CP+S QVI +IKFASFGTP+GTCGSF+ G C S
Sbjct  736  HPPPVDTWTSDSKISNRNRTRPVLSLKCPISTQVIFSIKFASFGTPKGTCGSFTQGHCNS  795

Query  286  TNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            + +LS+V+KACIGLR+C++ VS+  FG PC GV KSLAVEASC+
Sbjct  796  SRSLSLVQKACIGLRSCNVEVSTRVFGEPCRGVVKSLAVEASCS  839



>ref|XP_010470077.1| PREDICTED: beta-galactosidase 8-like [Camelina sativa]
 ref|XP_010470078.1| PREDICTED: beta-galactosidase 8-like [Camelina sativa]
Length=849

 Score =   296 bits (757),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 177/224 (79%), Gaps = 4/224 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG+AWVNGQSIGRYWPT  A N GCTDSC+YRG Y++
Sbjct  627  YKTTFDAPSGSEPVAIDFT-GTGKGIAWVNGQSIGRYWPTSIAGNNGCTDSCDYRGSYSA  685

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVG-SLCSRVSES  461
            +KCL+NCGKPSQT YHVPRSWLK S N LV+ EE+GGDPT++SF T++ G SLC  VS+S
Sbjct  686  NKCLKNCGKPSQTLYHVPRSWLKPSENTLVLLEEMGGDPTQISFTTKQTGSSLCLMVSQS  745

Query  460  HPMPVDMWT--SDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRS  287
            HP PVD WT  S +S +K+    LSL+CP+S QVIS+IKFASFGTP+GTCGSF+HG C S
Sbjct  746  HPAPVDTWTSGSKISKKKRTRPVLSLQCPVSTQVISSIKFASFGTPKGTCGSFTHGHCNS  805

Query  286  TNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            + +LS+V+KACIGLR+C+L VS+  FG PC GV K+LAVEASC+
Sbjct  806  SRSLSLVQKACIGLRSCNLEVSTRVFGEPCRGVVKTLAVEASCS  849



>ref|XP_007132215.1| hypothetical protein PHAVU_011G075900g [Phaseolus vulgaris]
 gb|ESW04209.1| hypothetical protein PHAVU_011G075900g [Phaseolus vulgaris]
Length=807

 Score =   295 bits (754),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NF AP    P  +  + G GKG AWVNGQSIGRYWPTY + + GCTDSCNYRG Y +
Sbjct  588  YKTNFLAPSGSNPVAIDFT-GMGKGEAWVNGQSIGRYWPTYASPSSGCTDSCNYRGSYQA  646

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+NCGKPSQT YHVPRSWL+   N LV+FEE GG+P +++FAT+++GS+CS VSESH
Sbjct  647  SKCLQNCGKPSQTLYHVPRSWLRPKSNTLVLFEESGGNPKQITFATKQMGSVCSHVSESH  706

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD+W SD    ++ G  + LECP  NQVIS+IKFASFGTPQGTCG+F HG+C S  A
Sbjct  707  PPPVDLWNSDAESGRKVGPVMLLECPYPNQVISSIKFASFGTPQGTCGNFKHGRCSSNKA  766

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+V+K CIG  +C +G+S  TFG+PC GV KSLAVEASC+
Sbjct  767  LSIVQKGCIGSSSCRIGLSINTFGDPCKGVPKSLAVEASCS  807



>ref|XP_010414520.1| PREDICTED: beta-galactosidase 8 [Camelina sativa]
Length=790

 Score =   294 bits (753),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 175/224 (78%), Gaps = 4/224 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG+AWVNGQSIGRYWPT  A N GCTDSC+YRG Y +
Sbjct  568  YKTTFDAPSGSEPVAIDFT-GTGKGIAWVNGQSIGRYWPTSIAGNNGCTDSCDYRGSYRA  626

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVG-SLCSRVSES  461
            +KCL+NCGKPSQT YHVPRSWLK SGN LV+ EE+GGDPT++SF  ++ G SLC  VS+S
Sbjct  627  NKCLKNCGKPSQTLYHVPRSWLKPSGNTLVLLEEMGGDPTQISFTKKQTGSSLCLMVSQS  686

Query  460  HPMPVDMWTSD--LSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRS  287
            HP PVD WTSD  +S +K+    LSL+CP+S QVIS+IKFASFGTP+GTCGSF+ G C S
Sbjct  687  HPAPVDTWTSDSKISKKKRTRPVLSLQCPVSTQVISSIKFASFGTPKGTCGSFTRGHCNS  746

Query  286  TNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            + +LSVV+KACIGLR+C+L VS+  FG PC GV  SLAVEASC+
Sbjct  747  SRSLSVVQKACIGLRSCNLEVSTRVFGEPCRGVVMSLAVEASCS  790



>gb|KFK32294.1| hypothetical protein AALP_AA6G223900 [Arabis alpina]
Length=836

 Score =   295 bits (755),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/222 (64%), Positives = 173/222 (78%), Gaps = 2/222 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG+AWVNGQSIGRYWPT  A N GCTD CNYRG Y +
Sbjct  616  YKTTFDAPSGSNPVAIDFT-GTGKGIAWVNGQSIGRYWPTSIARNSGCTDPCNYRGSYRA  674

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGS-LCSRVSES  461
            DKCL+NCGKPSQT YHVPRSW+K +GN LV+FEE+GGDPT++SFAT++ GS LC  VS+S
Sbjct  675  DKCLKNCGKPSQTLYHVPRSWIKPNGNTLVLFEEMGGDPTQISFATKQTGSNLCLSVSQS  734

Query  460  HPMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            HP PVD WTSD     +    L L+CP+S QVIS+I FASFGTP+GTCGSFSHG+C S+ 
Sbjct  735  HPPPVDSWTSDSKISNRTRPVLKLKCPVSTQVISSINFASFGTPKGTCGSFSHGRCHSSR  794

Query  280  ALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            +LS+V+KAC+G R+C++ VS+  FG PC GV KSLAVEASC+
Sbjct  795  SLSLVRKACVGSRSCTVEVSTRVFGEPCRGVVKSLAVEASCS  836



>ref|XP_007132205.1| hypothetical protein PHAVU_011G074900g [Phaseolus vulgaris]
 gb|ESW04199.1| hypothetical protein PHAVU_011G074900g [Phaseolus vulgaris]
Length=817

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NF AP    P  +  + G GKG AWVNGQSIGRYWPTY + + GCTDSCNYRG Y +
Sbjct  598  YKTNFLAPSGGNPVAIDFT-GMGKGEAWVNGQSIGRYWPTYASPSSGCTDSCNYRGSYQA  656

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+NCGKPSQT YHVPRSWL+   N LV+FEE GG+P +++FAT+++GS+CS VSESH
Sbjct  657  SKCLQNCGKPSQTLYHVPRSWLRPKSNTLVLFEESGGNPKQITFATKQMGSMCSHVSESH  716

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD+W SD    ++ G  + LECP  NQVIS++KFASFGTPQGTCG+F HG+C S  A
Sbjct  717  PPPVDLWNSDAESGRKVGPVMLLECPYPNQVISSVKFASFGTPQGTCGNFKHGRCSSNKA  776

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+V+K CIG  +C +G+S  TFG+PC GV KSLAVEASC+
Sbjct  777  LSIVQKGCIGSSSCRIGLSINTFGDPCKGVPKSLAVEASCS  817



>ref|XP_004148770.1| PREDICTED: beta-galactosidase 8 [Cucumis sativus]
Length=844

 Score =   295 bits (755),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 178/220 (81%), Gaps = 3/220 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L  + G+GKG AW+NG SIGRYWP+Y AS G CT  C+Y+G Y++
Sbjct  627  YKTTFDAPAGSDPLALDFT-GFGKGEAWINGHSIGRYWPSYIAS-GQCTSYCDYKGAYSA  684

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCLRNCGKPSQT YHVP+SWLK +GN LV+FEE+G DPT+L+FA++++GSLCS VSESH
Sbjct  685  NKCLRNCGKPSQTLYHVPQSWLKPTGNTLVLFEEIGSDPTRLTFASKQLGSLCSHVSESH  744

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PV+MW+SD S Q++ G  LSLECP  +QVIS+IKFASFGTP+GTCGSFSHG+C + NA
Sbjct  745  PPPVEMWSSD-SKQQKTGPVLSLECPSPSQVISSIKFASFGTPRGTCGSFSHGQCSTRNA  803

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+V+KACIG ++CS+ VS   FG+PC G TKSLAVEA C
Sbjct  804  LSIVQKACIGSKSCSIDVSIKAFGDPCRGKTKSLAVEAYC  843



>ref|XP_010910537.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 6-like [Elaeis 
guineensis]
Length=851

 Score =   293 bits (751),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 174/222 (78%), Gaps = 3/222 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*IS-RGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYN  641
            YK NFDAP       + I   G GKG AWVNGQSIGRYWPTY +S  GCT SCNY+G Y+
Sbjct  632  YKTNFDAPEG--NDAIGIDFTGMGKGEAWVNGQSIGRYWPTYISSPNGCTTSCNYKGSYS  689

Query  640  SDKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSES  461
            SDKCL+NCGKPSQ  YHVPRS+++  GN LV+FEEVGGDPTK+SFATR+ GSLC+ VSES
Sbjct  690  SDKCLKNCGKPSQHMYHVPRSFIQPDGNTLVLFEEVGGDPTKISFATRQTGSLCAHVSES  749

Query  460  HPMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            HP P+D W S      + G  + LECP +NQVIS+IKFASFGTP G+CGS++ G C S +
Sbjct  750  HPSPIDDWISSQRKVGKLGPVVHLECPNANQVISSIKFASFGTPHGSCGSYNQGNCSSDS  809

Query  280  ALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            AL+VV++ACIG ++CS+GVS+ TFG+PC G+TKSLAVEA+C+
Sbjct  810  ALAVVQQACIGAKSCSVGVSTKTFGDPCTGITKSLAVEAACS  851



>gb|KHN21526.1| Beta-galactosidase 8 [Glycine soja]
Length=840

 Score =   293 bits (750),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 174/221 (79%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F AP    P  +  + G GKG AWVNGQSIGRYWPTY AS+ GCTDSCNYRGPY++
Sbjct  621  YKTTFAAPSGSDPVAIDFT-GMGKGEAWVNGQSIGRYWPTYVASDAGCTDSCNYRGPYSA  679

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC RNCGKPSQT YHVPRSWLK SGN+LV+FEE GGDPT++SF T++  SLC+ VS+SH
Sbjct  680  SKCRRNCGKPSQTLYHVPRSWLKPSGNILVLFEEKGGDPTQISFVTKQTESLCAHVSDSH  739

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD+W SD    ++ G  LSL CP  NQVIS+IKFAS+GTP GTCG+F HG+C S  A
Sbjct  740  PPPVDLWNSDTESGRKVGPVLSLTCPHDNQVISSIKFASYGTPLGTCGNFYHGRCSSNKA  799

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+V+KACIG  +CS+GVSS TFGNPC GV KSLAVEA+CA
Sbjct  800  LSIVQKACIGSSSCSVGVSSETFGNPCRGVAKSLAVEATCA  840



>ref|XP_003543462.1| PREDICTED: beta-galactosidase 8-like isoform 1 [Glycine max]
Length=840

 Score =   293 bits (750),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 174/221 (79%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F AP    P  +  + G GKG AWVNGQSIGRYWPTY AS+ GCTDSCNYRGPY++
Sbjct  621  YKTTFAAPSGSDPVAIDFT-GMGKGEAWVNGQSIGRYWPTYVASDAGCTDSCNYRGPYSA  679

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC RNCGKPSQT YHVPRSWLK SGN+LV+FEE GGDPT++SF T++  SLC+ VS+SH
Sbjct  680  SKCRRNCGKPSQTLYHVPRSWLKPSGNILVLFEEKGGDPTQISFVTKQTESLCAHVSDSH  739

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD+W SD    ++ G  LSL CP  NQVIS+IKFAS+GTP GTCG+F HG+C S  A
Sbjct  740  PPPVDLWNSDTESGRKVGPVLSLTCPHDNQVISSIKFASYGTPLGTCGNFYHGRCSSNKA  799

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+V+KACIG  +CS+GVSS TFGNPC GV KSLAVEA+CA
Sbjct  800  LSIVQKACIGSSSCSVGVSSETFGNPCRGVAKSLAVEATCA  840



>ref|XP_006409871.1| hypothetical protein EUTSA_v10016234mg [Eutrema salsugineum]
 gb|ESQ51324.1| hypothetical protein EUTSA_v10016234mg [Eutrema salsugineum]
Length=856

 Score =   293 bits (749),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 176/226 (78%), Gaps = 6/226 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG+AWVNGQSIGRYWPT  A N GCTDSC+YRG Y +
Sbjct  632  YKTTFDAPSGSDPVAIDFT-GTGKGIAWVNGQSIGRYWPTSIARNDGCTDSCDYRGTYRA  690

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGS-LCSRVSES  461
            +KCL+NCGKPSQT YHVPRSW+K SGN+LV+ EE+GGDPTK+SFAT++ GS LC  VS++
Sbjct  691  NKCLKNCGKPSQTLYHVPRSWIKPSGNILVLLEEMGGDPTKISFATKQTGSNLCLTVSQT  750

Query  460  HPMPVDMWTSDLSGQ----KQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKC  293
            HP PVD WTSD         +    LSL+CP+S QVIS+I FASFGTP+GTCGSFSHG+C
Sbjct  751  HPAPVDTWTSDSKIHSKISNRTRPVLSLQCPVSTQVISSINFASFGTPKGTCGSFSHGRC  810

Query  292  RSTNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
             S+ +LS+V+KAC+G R+C++ VS+  FG+PC GV KSLAVEASC+
Sbjct  811  SSSRSLSIVQKACVGSRSCNVEVSTRVFGDPCRGVVKSLAVEASCS  856



>gb|AES67466.2| beta-galactosidase-like protein [Medicago truncatula]
Length=843

 Score =   292 bits (748),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NFDAP    P  +  + G GKG AWVNGQSIGRYWPTY ASN  CTDSCNYRGP+  
Sbjct  618  YKTNFDAPSGSNPVAIDFT-GMGKGEAWVNGQSIGRYWPTYVASNADCTDSCNYRGPFTQ  676

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC  NCGKPSQT YHVPRS+LK +GN LV+FEE GGDPT+++FAT+++ SLC+ VS+SH
Sbjct  677  TKCHMNCGKPSQTLYHVPRSFLKPNGNTLVLFEENGGDPTQIAFATKQLESLCAHVSDSH  736

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P  +D+W  D +   + G AL L CP  NQVI +IKFAS+GTP GTCG+F  G+C S  A
Sbjct  737  PPQIDLWNQDTTSWGKVGPALLLNCPNHNQVIFSIKFASYGTPLGTCGNFYRGRCSSNKA  796

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+VKKACIG R+CS+GVS+ TFG+PC GV KSLAVEA+CA
Sbjct  797  LSIVKKACIGSRSCSIGVSTDTFGDPCRGVPKSLAVEATCA  837



>gb|KHN32076.1| Beta-galactosidase 8, partial [Glycine soja]
Length=471

 Score =   283 bits (724),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 159/201 (79%), Gaps = 2/201 (1%)
 Frame = -1

Query  757  GWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRS  578
            G GKG AWVNGQ IGRYWPTY + NGGCTDSCNYRG Y+S KCL+NC KPSQT YHVP+S
Sbjct  273  GMGKGEAWVNGQCIGRYWPTYVSPNGGCTDSCNYRGAYSSSKCLKNCRKPSQTLYHVPQS  332

Query  577  WLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAA  398
            WL+   N LV+FEE GGDPT++SFAT+++GS+CS VSESHP PVD+W SD    ++    
Sbjct  333  WLQPDTNTLVLFEESGGDPTQISFATKQIGSVCSHVSESHPPPVDLWNSDKG--RKVWPV  390

Query  397  LSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSS  218
            L+LECP  NQVIS+IKFASF TP GTCG+F HG CRS  ALS+V+K CIG  +C +G+S 
Sbjct  391  LALECPYPNQVISSIKFASFRTPYGTCGNFKHGWCRSNKALSIVQKVCIGSSSCRIGLSI  450

Query  217  TTFGNPCAGVTKSLAVEASCA  155
             T G+ C GVTKSLAVEASCA
Sbjct  451  NTVGDQCKGVTKSLAVEASCA  471



>ref|XP_003597215.1| Beta-galactosidase [Medicago truncatula]
Length=866

 Score =   292 bits (748),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NFDAP    P  +  + G GKG AWVNGQSIGRYWPTY ASN  CTDSCNYRGP+  
Sbjct  641  YKTNFDAPSGSNPVAIDFT-GMGKGEAWVNGQSIGRYWPTYVASNADCTDSCNYRGPFTQ  699

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC  NCGKPSQT YHVPRS+LK +GN LV+FEE GGDPT+++FAT+++ SLC+ VS+SH
Sbjct  700  TKCHMNCGKPSQTLYHVPRSFLKPNGNTLVLFEENGGDPTQIAFATKQLESLCAHVSDSH  759

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P  +D+W  D +   + G AL L CP  NQVI +IKFAS+GTP GTCG+F  G+C S  A
Sbjct  760  PPQIDLWNQDTTSWGKVGPALLLNCPNHNQVIFSIKFASYGTPLGTCGNFYRGRCSSNKA  819

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+VKKACIG R+CS+GVS+ TFG+PC GV KSLAVEA+CA
Sbjct  820  LSIVKKACIGSRSCSIGVSTDTFGDPCRGVPKSLAVEATCA  860



>ref|XP_006854486.1| PREDICTED: beta-galactosidase 8 [Amborella trichopoda]
 gb|ERN15953.1| hypothetical protein AMTR_s00175p00032740 [Amborella trichopoda]
Length=882

 Score =   293 bits (749),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/220 (65%), Positives = 161/220 (73%), Gaps = 1/220 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NFDAP    P  L ++ G GKG AWVNGQSIGRYWPTY A   GC+D+CNY+G Y S
Sbjct  663  YKTNFDAPDGSDPVALDLT-GLGKGQAWVNGQSIGRYWPTYIAPQSGCSDTCNYQGSYTS  721

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC RNCGKPSQT YHVPR+W + SGN LV+FEE+GGDP ++SFA R  GS+C  VSE H
Sbjct  722  SKCQRNCGKPSQTLYHVPRAWTQPSGNTLVLFEEIGGDPNQISFAMRSFGSMCGHVSELH  781

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W S    +   G  L LECP   QVIS+IKFASFGTPQG CGSF   KC S  A
Sbjct  782  PAPVDAWDSRSEARAMSGPELRLECPSPGQVISSIKFASFGTPQGACGSFRQSKCSSNTA  841

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            LS+V++ACIGLRNCSL VS   FG+PC GVTKSLA+EA C
Sbjct  842  LSIVQEACIGLRNCSLSVSIKKFGDPCKGVTKSLAIEAVC  881



>ref|XP_009103690.1| PREDICTED: beta-galactosidase 8 [Brassica rapa]
Length=852

 Score =   292 bits (747),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/223 (65%), Positives = 169/223 (76%), Gaps = 3/223 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG+AWVNGQSIGRYWPT  A   GC  SCNYRG Y +
Sbjct  631  YKTTFDAPSGSEPVAIDFT-GTGKGIAWVNGQSIGRYWPTSIARTDGCVGSCNYRGTYRN  689

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGS-LCSRVSES  461
            DKCL+NCGKPSQT YHVPRSW+K SGN LV+ EE+GGDPTK+SFAT+  GS LC +VSES
Sbjct  690  DKCLKNCGKPSQTLYHVPRSWIKPSGNTLVLLEEMGGDPTKISFATKHTGSNLCLKVSES  749

Query  460  HPMPVDMWTSDLS-GQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRST  284
            HP PVD WTSD     +   A LSL+CP+S QVIS+I+FASFGTP G+CGSFSHG+C S 
Sbjct  750  HPAPVDTWTSDSKFSNRTSPAVLSLKCPVSTQVISSIRFASFGTPTGSCGSFSHGRCNSA  809

Query  283  NALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
             +LSVV+KAC+G R+C + VS+  FG PC GV KSLAVEA CA
Sbjct  810  RSLSVVQKACVGSRSCKVEVSTRVFGEPCHGVVKSLAVEAVCA  852



>emb|CDY15749.1| BnaC04g15750D [Brassica napus]
Length=844

 Score =   291 bits (744),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 168/222 (76%), Gaps = 2/222 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG+AWVNGQSIGRYWPT  A   GC  SCNYRG Y +
Sbjct  624  YKTTFDAPSGSDPVAIDFT-GTGKGIAWVNGQSIGRYWPTSIARADGCVGSCNYRGTYRN  682

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGS-LCSRVSES  461
            +KCL+NCGKPSQT YHVPRSW+K SGN LV+ EE+GGDPTK+SFAT+  GS LC +VS+S
Sbjct  683  NKCLKNCGKPSQTLYHVPRSWIKPSGNTLVLLEEMGGDPTKISFATKHTGSNLCLKVSQS  742

Query  460  HPMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            HP PVD WTSD     +    LSL+CP+S Q+IS+I FASFGTP GTCGSFSHG+C S  
Sbjct  743  HPAPVDTWTSDFKFSNRTSPVLSLKCPVSTQMISSINFASFGTPTGTCGSFSHGRCSSAR  802

Query  280  ALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            +LSVV+KAC+G R+C + VS+  FG PC GV KSLAVEA+CA
Sbjct  803  SLSVVQKACVGSRSCKVEVSTRVFGEPCRGVVKSLAVEAACA  844



>ref|XP_010098210.1| Beta-galactosidase 8 [Morus notabilis]
 gb|EXB74666.1| Beta-galactosidase 8 [Morus notabilis]
Length=890

 Score =   291 bits (744),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 167/213 (78%), Gaps = 1/213 (0%)
 Frame = -1

Query  814  KANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSD  635
            + +FDAP    P  L ++ G GKG AWVNGQSIGRYWPTY A N GC D+CNYRG +++D
Sbjct  638  QTSFDAPGGSSPVALDLT-GMGKGEAWVNGQSIGRYWPTYIAPNSGCNDNCNYRGAFDAD  696

Query  634  KCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHP  455
            KC +NCGKPSQ  YHVPRSWL+ SGN LV+FEE+GGDP +LSFATRE+ SLCS +SESHP
Sbjct  697  KCHKNCGKPSQELYHVPRSWLRPSGNTLVLFEEIGGDPMQLSFATREIESLCSHISESHP  756

Query  454  MPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNAL  275
             PVDMW+S+   ++Q    LSLECP  NQVIS+IKFASFGTP G+CGSF+HGKC S  AL
Sbjct  757  PPVDMWSSESKSRRQLTPVLSLECPSPNQVISSIKFASFGTPHGSCGSFNHGKCSSARAL  816

Query  274  SVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSL  176
            SVV+K CIG ++C++GVS  TFG+PC G  + L
Sbjct  817  SVVQKTCIGSKSCNIGVSINTFGDPCKGPLQVL  849



>ref|XP_003538054.1| PREDICTED: beta-galactosidase 8-like [Glycine max]
 gb|KHN22059.1| Beta-galactosidase 8 [Glycine soja]
Length=836

 Score =   290 bits (741),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NF AP    P  +  + G GKG AWVNGQSIGRYWPTY +  GGCTDSCNYRG Y++
Sbjct  617  YKTNFVAPSGNNPVAIDFT-GMGKGEAWVNGQSIGRYWPTYASPKGGCTDSCNYRGAYDA  675

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+NCGKPSQT YHVPRSWL+   N LV+FEE GG+P ++SFAT+++GS+CS VSESH
Sbjct  676  SKCLKNCGKPSQTLYHVPRSWLRPDRNTLVLFEESGGNPKQISFATKQIGSVCSHVSESH  735

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W S+    ++    +SLECP  NQV+S+IKFASFGTP GTCG+F HG C S  A
Sbjct  736  PPPVDSWNSNTESGRKVVPVVSLECPYPNQVVSSIKFASFGTPLGTCGNFKHGLCSSNKA  795

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+V+KACIG  +C + +S  TFG+PC GV KSLAVEASCA
Sbjct  796  LSIVQKACIGSSSCRIELSVNTFGDPCKGVAKSLAVEASCA  836



>emb|CDY31204.1| BnaC03g46870D [Brassica napus]
Length=844

 Score =   290 bits (741),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 170/222 (77%), Gaps = 2/222 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG+AWVNGQSIGRYWPT  A N GCTDSCNYRG Y+S
Sbjct  624  YKTTFDAPSGSDPVAIDFT-GTGKGIAWVNGQSIGRYWPTSIARNDGCTDSCNYRGSYSS  682

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGS-LCSRVSES  461
            +KCL+NCGKPSQT YHVPRSW+K SGN LV+ EE+GGDPTK+SFAT++ GS LC  VS+S
Sbjct  683  NKCLKNCGKPSQTLYHVPRSWIKPSGNTLVLLEEMGGDPTKISFATKQTGSGLCLTVSQS  742

Query  460  HPMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            HP PVD W SD     +    LSL+CP+S  VI++I FASFGTP GTCGSFSHG+C S  
Sbjct  743  HPAPVDSWASDSKILNRTSPVLSLKCPVSTHVITSINFASFGTPTGTCGSFSHGRCNSPR  802

Query  280  ALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            +LS+V+KAC+G R+C + VS+  FG+PC  + KSLAVEASC+
Sbjct  803  SLSIVRKACVGSRSCKVEVSTRVFGDPCRSLAKSLAVEASCS  844



>emb|CDX83288.1| BnaA03g22180D [Brassica napus]
Length=845

 Score =   290 bits (741),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 170/222 (77%), Gaps = 2/222 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG+AWVNGQSIGRYWPT  A N GCTDSCNYRG Y+S
Sbjct  625  YKTTFDAPSGSDPVAIDFT-GTGKGIAWVNGQSIGRYWPTSIARNNGCTDSCNYRGSYSS  683

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVG-SLCSRVSES  461
            +KCL+NCGKPSQT YHVPRSW+K SGN LV+ EE+GGDPTK+SFAT++ G SLC  VS+S
Sbjct  684  NKCLKNCGKPSQTLYHVPRSWIKPSGNTLVLLEEMGGDPTKISFATKQTGSSLCLTVSQS  743

Query  460  HPMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            HP PVD W SD     +    LSL+CP+S  VI++I FASFGTP GTCGSFSHG+C S  
Sbjct  744  HPAPVDSWASDSKILNRTSPVLSLKCPVSTHVITSINFASFGTPTGTCGSFSHGRCNSPR  803

Query  280  ALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            +LS+V+KAC+G R+C + VS+  FG+PC  + KSLAVEASC+
Sbjct  804  SLSIVRKACVGSRSCKVEVSTRVFGDPCRSLAKSLAVEASCS  845



>ref|XP_003597218.1| Beta-galactosidase [Medicago truncatula]
Length=2260

 Score =   297 bits (761),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 171/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  817   YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
             YK NFDAP    P ++  + G GKG AWVNGQSIGRYWPTY ASN  CTDSCNYRGP+  
Sbjct  2041  YKTNFDAPSGSNPVVIDFT-GMGKGEAWVNGQSIGRYWPTYVASNVDCTDSCNYRGPFTQ  2099

Query  637   DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
              KC  NCGKPSQT YHVP+S+LK +GN LV+FEE GGDPT++SFAT+++GS+C+ VS+SH
Sbjct  2100  TKCHMNCGKPSQTLYHVPQSFLKPNGNTLVLFEESGGDPTQISFATKQIGSVCAHVSDSH  2159

Query  457   PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
             P  +D+W  D     + G AL L CP  NQVIS+IKFAS+GTP GTCG+F  G+C S   
Sbjct  2160  PPQIDLWNQDTESGGKVGPALLLNCPNHNQVISSIKFASYGTPLGTCGNFYRGRCSSNKT  2219

Query  277   LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
             LS+VKKACIG R+CS+GVS+ TFG+PC GV KSLAVEA+CA
Sbjct  2220  LSIVKKACIGSRSCSIGVSTDTFGDPCKGVPKSLAVEATCA  2260



>emb|CDY04567.1| BnaA07g13930D [Brassica napus]
Length=850

 Score =   289 bits (740),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 168/222 (76%), Gaps = 2/222 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F+AP    P  +  + G GKG+AWVNGQSIGRYWPT  A   GC  SC+YRG Y +
Sbjct  630  YKTTFNAPSGSDPVAIDFT-GTGKGIAWVNGQSIGRYWPTSIARADGCVGSCDYRGTYRN  688

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGS-LCSRVSES  461
            DKCL+NCGKPSQT YHVPRSW+K SGN LV+ EE+GGDPTK+SFAT+  GS LC +VSES
Sbjct  689  DKCLKNCGKPSQTLYHVPRSWIKPSGNTLVLLEEMGGDPTKISFATKHTGSNLCLKVSES  748

Query  460  HPMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            HP PVD WTSD     +    LSL+CP+S QVIS+I+FASFGTP GTCGSF+HG+C S  
Sbjct  749  HPAPVDTWTSDSKFSNRTSPVLSLKCPVSTQVISSIRFASFGTPTGTCGSFNHGRCSSAR  808

Query  280  ALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            +LSVV+KAC+G R+C + VS+  FG PC GV KSLAVEA CA
Sbjct  809  SLSVVQKACVGSRSCKVEVSTRVFGEPCHGVVKSLAVEAVCA  850



>ref|XP_006296187.1| hypothetical protein CARUB_v10025350mg [Capsella rubella]
 gb|EOA29085.1| hypothetical protein CARUB_v10025350mg [Capsella rubella]
Length=846

 Score =   288 bits (737),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 141/224 (63%), Positives = 176/224 (79%), Gaps = 4/224 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F+AP    P  +  + G GKG+AWVNGQSIGRYWPT  A+N GCTDSC+YRG Y +
Sbjct  624  YKTTFNAPSGSEPVAIDFT-GTGKGIAWVNGQSIGRYWPTSIAANNGCTDSCDYRGSYTA  682

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVG-SLCSRVSES  461
             KC++NCGKPSQT YHVPRSWL  SGN LV+ EE+GGDPT++SFAT++ G SLC  VS+S
Sbjct  683  KKCVKNCGKPSQTLYHVPRSWLNPSGNTLVLLEEMGGDPTQISFATKQTGSSLCLTVSQS  742

Query  460  HPMPVDMWTSD--LSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRS  287
            HP PVD WTSD  +S + +    LSL+CP+S  VI++IKFASFGTP+GTCGSF++G C S
Sbjct  743  HPPPVDTWTSDSKISNKHRTRPVLSLKCPVSTHVITSIKFASFGTPKGTCGSFTYGHCSS  802

Query  286  TNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            + +LS+V+KACIGLR+C++ VS+  FG PC GV KSLAVEASC+
Sbjct  803  SRSLSLVQKACIGLRSCNVEVSTRVFGEPCRGVVKSLAVEASCS  846



>ref|XP_007132198.1| hypothetical protein PHAVU_011G074300g [Phaseolus vulgaris]
 gb|ESW04192.1| hypothetical protein PHAVU_011G074300g [Phaseolus vulgaris]
Length=833

 Score =   288 bits (736),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NF AP    P  + ++ G GKG AWVNGQSIGRYWPT  + +GGCTDSC+YRG Y +
Sbjct  614  YKTNFVAPSGSNPVAINMT-GMGKGEAWVNGQSIGRYWPTNASPSGGCTDSCDYRGSYKA  672

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+NCG PSQT YHVPRSWL+   N LV+FEE GG+P +++FAT+++GSLCS +S+SH
Sbjct  673  TKCLKNCGNPSQTLYHVPRSWLRPINNTLVLFEERGGNPKQITFATKQIGSLCSHISDSH  732

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD+W SD     + G  + LECP  NQVIS+IKFASFGTPQG CG+F HG C S  A
Sbjct  733  PPPVDLWNSDAESGSKVGPVMLLECPYPNQVISSIKFASFGTPQGACGNFKHGNCSSKKA  792

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LSVV+K CIG  +C +G+S+  FG+PC GV KSLAVEASCA
Sbjct  793  LSVVQKECIGSSSCRIGLSTNKFGDPCTGVAKSLAVEASCA  833



>ref|XP_009133878.1| PREDICTED: beta-galactosidase 8-like [Brassica rapa]
Length=844

 Score =   288 bits (736),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 169/222 (76%), Gaps = 2/222 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG+AWVNGQSIGRYWPT  A N GCTD CNYRG Y+S
Sbjct  624  YKTTFDAPSGSDPVAIDFT-GTGKGIAWVNGQSIGRYWPTSIARNNGCTDLCNYRGSYSS  682

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVG-SLCSRVSES  461
            +KCL+NCGKPSQT YHVPRSW+K SGN LV+ EE+GGDPTK+SFAT++ G SLC  VS+S
Sbjct  683  NKCLKNCGKPSQTLYHVPRSWIKPSGNTLVLLEEMGGDPTKISFATKQTGSSLCLTVSQS  742

Query  460  HPMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            HP PVD W SD     +    LSL+CP+S  VI++I FASFGTP GTCGSFSHG+C S  
Sbjct  743  HPAPVDSWASDSKILNRTSPVLSLKCPVSTHVITSINFASFGTPTGTCGSFSHGRCNSPR  802

Query  280  ALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            +LS+V+KAC+G R+C + VS+  FG+PC  + KSLAVEASC+
Sbjct  803  SLSIVRKACVGSRSCKVEVSTRVFGDPCRSLAKSLAVEASCS  844



>dbj|BAD20774.2| beta-galactosidase [Raphanus sativus]
Length=851

 Score =   286 bits (733),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 167/222 (75%), Gaps = 2/222 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG+AWVNGQSIGRYWPT  A   GC  SC+YRG Y S
Sbjct  631  YKTTFDAPSGSDPVAIDFT-GTGKGIAWVNGQSIGRYWPTSIARTDGCVGSCDYRGSYRS  689

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGS-LCSRVSES  461
            +KCL+NCGKPSQT YHVPRSW+K SGN LV+ EE+GGDPTK+SFAT++ GS LC  VS+S
Sbjct  690  NKCLKNCGKPSQTLYHVPRSWIKPSGNTLVLLEEMGGDPTKISFATKQTGSNLCLTVSQS  749

Query  460  HPMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            HP PVD W SD     +    LSL+CP+S QVIS+I+FASFGTP GTCGSFS+G C S  
Sbjct  750  HPAPVDTWISDSKFSNRTSPVLSLKCPVSTQVISSIRFASFGTPTGTCGSFSYGHCSSAR  809

Query  280  ALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            +LSVV+KAC+G R+C + VS+  FG PC GV KSLAVEASCA
Sbjct  810  SLSVVQKACVGSRSCKVEVSTRVFGEPCRGVVKSLAVEASCA  851



>gb|AAQ21371.2| beta-galactosidase [Sandersonia aurantiaca]
Length=818

 Score =   282 bits (722),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F+AP    P  +  + G GKG AWVNGQSIGRYWPTY++   GC+ +CNYRGPY++
Sbjct  599  YKTTFNAPDGNDPVAIDFT-GMGKGEAWVNGQSIGRYWPTYSSPQNGCSTACNYRGPYSA  657

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC++NCGKPSQ  YHVPRS+++S  N LV+FEE+GGDPT++S AT+++ SLC+ VSESH
Sbjct  658  SKCIKNCGKPSQILYHVPRSFIQSESNTLVLFEEMGGDPTQISLATKQMTSLCAHVSESH  717

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W S     K+ G  + LECP  NQVIS+IKFASFGTP G CGSF+H +C S + 
Sbjct  718  PAPVDTWLSLQQKGKKSGPTIQLECPYPNQVISSIKFASFGTPSGMCGSFNHSQCSSASV  777

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L+VV+KAC+G + CS+G+SS T G+PC GV KSLAVEA+C+
Sbjct  778  LAVVQKACVGSKRCSVGISSKTLGDPCRGVIKSLAVEAACS  818



>ref|XP_007152042.1| hypothetical protein PHAVU_004G096800g [Phaseolus vulgaris]
 gb|ESW24036.1| hypothetical protein PHAVU_004G096800g [Phaseolus vulgaris]
Length=840

 Score =   282 bits (722),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F AP    P  +  + G  KG AWVNGQSIGRYWPTY AS+ GCTDSCNYRGPY +
Sbjct  621  YKTTFAAPSGTSPVAIDFT-GMSKGEAWVNGQSIGRYWPTYVASDAGCTDSCNYRGPYTA  679

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC RNCGKPSQT YHVPRSWLK SGN LV+FEE GGDPT++SF T+++ SLC+ VS+SH
Sbjct  680  SKCRRNCGKPSQTLYHVPRSWLKPSGNTLVLFEEKGGDPTQISFVTKQIESLCAHVSDSH  739

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PV++W S     ++ G  LSL CP +NQVIS+IKFAS+GTP GTCG+F HG+C S  A
Sbjct  740  PPPVELWNSYTESGREVGPVLSLTCPQNNQVISSIKFASYGTPLGTCGNFYHGRCSSNKA  799

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L +V+KACIG  +CS+GVS  TFG+PC GV KSLAVEA+CA
Sbjct  800  LPIVQKACIGSSSCSVGVSINTFGDPCRGVAKSLAVEATCA  840



>ref|XP_003540180.1| PREDICTED: beta-galactosidase 8-like isoform 1 [Glycine max]
 gb|KHN11209.1| Beta-galactosidase 8 [Glycine soja]
Length=840

 Score =   281 bits (718),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 171/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F AP    P  +  + G GKG AWVNGQ IGRYWPTY AS+  CTDSCNYRGPY++
Sbjct  621  YKTTFSAPSGSDPVAIDFT-GMGKGEAWVNGQRIGRYWPTYVASDASCTDSCNYRGPYSA  679

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC +NC KPSQT YHVPRSWLK SGN+LV+FEE GGDPT++SF T++  SLC+ VS+SH
Sbjct  680  SKCRKNCEKPSQTLYHVPRSWLKPSGNILVLFEERGGDPTQISFVTKQTESLCAHVSDSH  739

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD+W S+    ++ G  LSL CP  NQVIS+IKFAS+GTP GTCG+F HG+C S  A
Sbjct  740  PPPVDLWNSETESGRKVGPVLSLTCPHDNQVISSIKFASYGTPLGTCGNFYHGRCSSNKA  799

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+V+KACIG  +CS+GVSS TFG+PC G+ KSLAVEA+CA
Sbjct  800  LSIVQKACIGSSSCSVGVSSDTFGDPCRGMAKSLAVEATCA  840



>gb|ACN25553.1| unknown [Zea mays]
Length=199

 Score =   258 bits (660),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 157/199 (79%), Gaps = 1/199 (1%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG AWVNGQSIGRYWPT  A   GC +SCNYRG Y+S KCL+ CG+PSQT YHVPRS+L
Sbjct  2    GKGEAWVNGQSIGRYWPTNLAPQSGCVNSCNYRGAYSSSKCLKKCGQPSQTLYHVPRSFL  61

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAALS  392
            +   N LV+FE  GGDP+K+SF  R+ GS+C++VSE+HP  +D W+S    Q+  G AL 
Sbjct  62   QPGSNDLVLFEHFGGDPSKISFVMRQTGSVCAQVSEAHPAQIDSWSSQQPMQRY-GPALR  120

Query  391  LECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSSTT  212
            LECP   QVIS++KFASFGTP GTCGS+SHG+C ST ALS+V++ACIG+ +CS+ VSS  
Sbjct  121  LECPKEGQVISSVKFASFGTPSGTCGSYSHGECSSTQALSIVQEACIGVSSCSVPVSSNY  180

Query  211  FGNPCAGVTKSLAVEASCA  155
            FGNPC GVTKSLAVEA+C+
Sbjct  181  FGNPCTGVTKSLAVEAACS  199



>gb|ABF95029.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95030.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
Length=702

 Score =   271 bits (694),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F AP    P  +  + G GKG AWVNGQSIGRYWPT  A   GC +SCNYRG Y+S
Sbjct  483  YKTKFTAPAGDDPVAIDFT-GMGKGEAWVNGQSIGRYWPTNLAPQSGCVNSCNYRGAYSS  541

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL+ CG+PSQT YHVPRS+L+   N LV+FE+ GGDP+ +SF TR+  S+C+ VSE H
Sbjct  542  NKCLKKCGQPSQTLYHVPRSFLQPGSNDLVLFEQFGGDPSMISFTTRQTSSICAHVSEMH  601

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P  +D W S     + +G AL LECP   QVIS IKFASFGTP GTCG+++HG+C S+ A
Sbjct  602  PAQIDSWISPQQTSQTQGPALRLECPREGQVISNIKFASFGTPSGTCGNYNHGECSSSQA  661

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L+VV++AC+G+ NCS+ VSS  FG+PC+GVTKSL VEA+C+
Sbjct  662  LAVVQEACVGMTNCSVPVSSNNFGDPCSGVTKSLVVEAACS  702



>gb|ABF95028.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
Length=796

 Score =   271 bits (692),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F AP    P  +  + G GKG AWVNGQSIGRYWPT  A   GC +SCNYRG Y+S
Sbjct  577  YKTKFTAPAGDDPVAIDFT-GMGKGEAWVNGQSIGRYWPTNLAPQSGCVNSCNYRGAYSS  635

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL+ CG+PSQT YHVPRS+L+   N LV+FE+ GGDP+ +SF TR+  S+C+ VSE H
Sbjct  636  NKCLKKCGQPSQTLYHVPRSFLQPGSNDLVLFEQFGGDPSMISFTTRQTSSICAHVSEMH  695

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P  +D W S     + +G AL LECP   QVIS IKFASFGTP GTCG+++HG+C S+ A
Sbjct  696  PAQIDSWISPQQTSQTQGPALRLECPREGQVISNIKFASFGTPSGTCGNYNHGECSSSQA  755

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L+VV++AC+G+ NCS+ VSS  FG+PC+GVTKSL VEA+C+
Sbjct  756  LAVVQEACVGMTNCSVPVSSNNFGDPCSGVTKSLVVEAACS  796



>gb|EAZ24672.1| hypothetical protein OsJ_08441 [Oryza sativa Japonica Group]
Length=861

 Score =   271 bits (694),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F AP    P  +  + G GKG AWVNGQSIGRYWPT  A   GC +SCNYRG Y+S
Sbjct  642  YKTKFTAPAGDDPVAIDFT-GMGKGEAWVNGQSIGRYWPTNLAPQSGCVNSCNYRGAYSS  700

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL+ CG+PSQT YHVPRS+L+   N LV+FE+ GGDP+ +SF TR+  S+C+ VSE H
Sbjct  701  NKCLKKCGQPSQTLYHVPRSFLQPGSNDLVLFEQFGGDPSMISFTTRQTSSICAHVSEMH  760

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P  +D W S     + +G AL LECP   QVIS IKFASFGTP GTCG+++HG+C S+ A
Sbjct  761  PAQIDSWISPQQTSQTQGPALRLECPREGQVISNIKFASFGTPSGTCGNYNHGECSSSQA  820

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L+VV++AC+G+ NCS+ VSS  FG+PC+GVTKSL VEA+C+
Sbjct  821  LAVVQEACVGMTNCSVPVSSNNFGDPCSGVTKSLVVEAACS  861



>sp|Q10NX8.2|BGAL6_ORYSJ RecName: Full=Beta-galactosidase 6; Short=Lactase 6; Flags: Precursor 
[Oryza sativa Japonica Group]
Length=858

 Score =   271 bits (693),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F AP    P  +  + G GKG AWVNGQSIGRYWPT  A   GC +SCNYRG Y+S
Sbjct  639  YKTKFTAPAGDDPVAIDFT-GMGKGEAWVNGQSIGRYWPTNLAPQSGCVNSCNYRGAYSS  697

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL+ CG+PSQT YHVPRS+L+   N LV+FE+ GGDP+ +SF TR+  S+C+ VSE H
Sbjct  698  NKCLKKCGQPSQTLYHVPRSFLQPGSNDLVLFEQFGGDPSMISFTTRQTSSICAHVSEMH  757

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P  +D W S     + +G AL LECP   QVIS IKFASFGTP GTCG+++HG+C S+ A
Sbjct  758  PAQIDSWISPQQTSQTQGPALRLECPREGQVISNIKFASFGTPSGTCGNYNHGECSSSQA  817

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L+VV++AC+G+ NCS+ VSS  FG+PC+GVTKSL VEA+C+
Sbjct  818  LAVVQEACVGMTNCSVPVSSNNFGDPCSGVTKSLVVEAACS  858



>gb|ABK24373.1| unknown [Picea sitchensis]
Length=861

 Score =   270 bits (691),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 168/225 (75%), Gaps = 6/225 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NFDAP    P  L +  G GKGVAWVNGQSIGRYWP+Y AS  GCTDSC+YRG Y+S
Sbjct  639  YKTNFDAPSGNDPVALNL-LGMGKGVAWVNGQSIGRYWPSYIASQSGCTDSCDYRGAYSS  697

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC  NCG+PSQ  YHVPRSW++ +GNVLV+FEE+GGDPT++SF TR VGSLC++VSE+H
Sbjct  698  TKCQTNCGQPSQKLYHVPRSWIQPTGNVLVLFEELGGDPTQISFMTRSVGSLCAQVSETH  757

Query  457  PMPVDMW----TSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCR  290
              PVD W    TS L   K + A L L CP S  +I +IKFASFGT +G+CGSF++G C 
Sbjct  758  LPPVDSWKSSATSGLEVNKPK-AELQLHCPSSRHLIKSIKFASFGTSKGSCGSFTYGHCN  816

Query  289  STNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            + + +S+V++ACIG  +CS+ VS   FG+PC G  K+LAVEASC+
Sbjct  817  TNSTMSIVEEACIGRESCSVEVSIEKFGDPCKGTVKNLAVEASCS  861



>ref|NP_001049591.1| Os03g0255100 [Oryza sativa Japonica Group]
 gb|ABF95027.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11505.1| Os03g0255100 [Oryza sativa Japonica Group]
 dbj|BAG90437.1| unnamed protein product [Oryza sativa Japonica Group]
Length=956

 Score =   271 bits (694),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F AP    P  +  + G GKG AWVNGQSIGRYWPT  A   GC +SCNYRG Y+S
Sbjct  737  YKTKFTAPAGDDPVAIDFT-GMGKGEAWVNGQSIGRYWPTNLAPQSGCVNSCNYRGAYSS  795

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL+ CG+PSQT YHVPRS+L+   N LV+FE+ GGDP+ +SF TR+  S+C+ VSE H
Sbjct  796  NKCLKKCGQPSQTLYHVPRSFLQPGSNDLVLFEQFGGDPSMISFTTRQTSSICAHVSEMH  855

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P  +D W S     + +G AL LECP   QVIS IKFASFGTP GTCG+++HG+C S+ A
Sbjct  856  PAQIDSWISPQQTSQTQGPALRLECPREGQVISNIKFASFGTPSGTCGNYNHGECSSSQA  915

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L+VV++AC+G+ NCS+ VSS  FG+PC+GVTKSL VEA+C+
Sbjct  916  LAVVQEACVGMTNCSVPVSSNNFGDPCSGVTKSLVVEAACS  956



>gb|EAY89299.1| hypothetical protein OsI_10800 [Oryza sativa Indica Group]
Length=861

 Score =   270 bits (690),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F AP    P  +  + G GKG AWVNGQSIGRYWPT  A   GC +SCNYRG Y+S
Sbjct  642  YKTKFTAPAGDDPVAIDFT-GMGKGEAWVNGQSIGRYWPTNLAPQSGCVNSCNYRGAYSS  700

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL+ CG+PSQT YHVPRS+L+   N LV+FE+ GGDP+ +SF TR+  S+C+ VSE H
Sbjct  701  NKCLKKCGQPSQTLYHVPRSFLQPGSNDLVLFEQFGGDPSMISFTTRQTSSICAHVSEMH  760

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P  +D W S     +  G AL LECP   QVIS IKFASFGTP GTCG+++HG+C S+ A
Sbjct  761  PAQIDSWISPQQTSQTPGPALRLECPREGQVISNIKFASFGTPSGTCGNYNHGECSSSQA  820

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L+VV++AC+G+ NCS+ VSS  FG+PC+GVTKSL VEA+C+
Sbjct  821  LAVVQEACVGMTNCSVPVSSNNFGDPCSGVTKSLVVEAACS  861



>ref|XP_006649762.1| PREDICTED: beta-galactosidase 6-like [Oryza brachyantha]
Length=793

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 165/221 (75%), Gaps = 4/221 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F AP    P  +  + G GKG AWVNGQSIGRYWPT  A   GC +SCNYRG Y+S
Sbjct  577  YKTKFMAPAGDHPVAIDFT-GMGKGEAWVNGQSIGRYWPTNLAPQSGCVNSCNYRGAYSS  635

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL  CG+PSQT YHVPRS+L+   N LV+FE+ GGDP+ +SF TR+  S+C+ VSE H
Sbjct  636  NKCLNKCGQPSQTLYHVPRSFLQPGSNDLVLFEQFGGDPSMISFTTRQTTSICAHVSEMH  695

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P  +D W   +S  ++ G A+ LECP   QVIS IKFASFGTP GTCG+++HG+C S+ A
Sbjct  696  PAQIDSW---ISQSQRPGPAIRLECPREGQVISNIKFASFGTPSGTCGNYNHGECSSSQA  752

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L+VV++AC+G+RNC++ VSST FG+PC+GVTKSL VEA+C+
Sbjct  753  LAVVQEACVGVRNCTVPVSSTNFGDPCSGVTKSLVVEAACS  793



>gb|EMT18371.1| Beta-galactosidase 6 [Aegilops tauschii]
Length=701

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK+ F  P    P  +  + G GKG AWVNGQSIGRYWPT  A   GC +SCNYRGPY++
Sbjct  482  YKSKFTTPAGDDPVAIDFT-GMGKGEAWVNGQSIGRYWPTNIAPQSGCVNSCNYRGPYSA  540

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC + CG+PSQ  YHVPRS+L+   N +V+FE+ GGDP+K+SF T++  S+C+ VSE H
Sbjct  541  SKCQKKCGQPSQILYHVPRSFLQPGSNDIVLFEQFGGDPSKISFTTKQTESVCAHVSEDH  600

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P  +D W S     ++ G AL LECP   QVIS+IKFASFGTP GTCGS+SHG+C S+ A
Sbjct  601  PDQIDSWISPQQKLQRSGPALRLECPKEGQVISSIKFASFGTPSGTCGSYSHGECSSSQA  660

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L+V ++AC+G+ +CS+ VS+  FG+PC GVTKSL VEA+C+
Sbjct  661  LAVAQEACVGVSSCSVPVSAKNFGDPCRGVTKSLVVEAACS  701



>ref|XP_010228859.1| PREDICTED: beta-galactosidase 6 [Brachypodium distachyon]
Length=852

 Score =   266 bits (679),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK+ F  P    P  +  + G GKG AWVNGQSIGRYWPT  A   GC +SCNYRGPY+S
Sbjct  633  YKSKFTTPAGDDPVAIDFT-GMGKGEAWVNGQSIGRYWPTNLAPQSGCVNSCNYRGPYSS  691

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+ CG+PSQT YHVPRS+L+   N +V+FE+ GGDP+K+SF T++  S+C+ VSE H
Sbjct  692  SKCLKKCGQPSQTLYHVPRSFLQPGSNDIVLFEQFGGDPSKISFTTKQTASVCAHVSEDH  751

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P  +D W S     ++ G AL LECP + QVIS+IKFASFGTP GTCG+++HG+C S  A
Sbjct  752  PDQIDSWISPQQKVQRSGPALRLECPKAGQVISSIKFASFGTPSGTCGNYNHGECSSPQA  811

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L+V ++ACIG+ +CS+ VS+  FG+PC GVTKSL VEA+C+
Sbjct  812  LAVAQEACIGVSSCSVPVSTKNFGDPCTGVTKSLVVEAACS  852



>ref|XP_004984968.1| PREDICTED: beta-galactosidase 6-like [Setaria italica]
Length=850

 Score =   266 bits (679),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F AP    P  +  + G GKG AWVNGQSIGRYWPT  A   GC +SCNYRG Y+S
Sbjct  631  YKTKFTAPAGDDPVAIDFT-GMGKGEAWVNGQSIGRYWPTNLAPQSGCVNSCNYRGSYSS  689

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+ CG+PSQT YHVPRS+L+   N LV+FE+ GGDP+K+SF TR+ GS+C++VSE+H
Sbjct  690  SKCLKKCGQPSQTLYHVPRSFLQPGSNDLVLFEQFGGDPSKISFVTRQTGSVCAQVSEAH  749

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P  +D W S     ++ G  L LECP   QVIS+IKFASFGTP GTCGS+SHG+C ST A
Sbjct  750  PAQIDSWISSQQKMQRSGPELRLECPKEGQVISSIKFASFGTPSGTCGSYSHGECSSTQA  809

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LSVV++ACIG+ +CS+ VSS  FG+PC GVTKSLAVEA+C+
Sbjct  810  LSVVQEACIGVSSCSVPVSSNYFGDPCTGVTKSLAVEAACS  850



>ref|XP_009398434.1| PREDICTED: beta-galactosidase 8-like [Musa acuminata subsp. malaccensis]
Length=854

 Score =   265 bits (678),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 166/222 (75%), Gaps = 6/222 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            Y   FDAP    P  +  + G GKG AWVNG SIGRYWPTYT+   GC  SC+YRGP++ 
Sbjct  638  YMTYFDAPEHDDPVAIDFT-GMGKGEAWVNGHSIGRYWPTYTSPPSGCVQSCDYRGPFSG  696

Query  637  DKCLRNCGKPSQTYYHVPRSWLKS-SGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSES  461
             KC+RNCG+PSQ+ YHVPRS ++  + N LV+FEEVGGDPT +SFA R  GSLC+ VS+S
Sbjct  697  SKCVRNCGQPSQSLYHVPRSLIQQGNTNRLVLFEEVGGDPTLVSFALRAAGSLCAHVSQS  756

Query  460  HPMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            HP PVD     ++  +++ A L LECP S++VIS++KFASFGTP GTCGS+SHG C ST 
Sbjct  757  HPPPVDA----VNTAQKKDAVLHLECPHSDRVISSVKFASFGTPHGTCGSYSHGNCSSTT  812

Query  280  ALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            AL+++++ACIG+R+C + VS+  FG+PC  V KSLAVEASC+
Sbjct  813  ALAILQQACIGVRSCDVKVSTEVFGDPCRDVVKSLAVEASCS  854



>ref|XP_002465536.1| hypothetical protein SORBIDRAFT_01g040750 [Sorghum bicolor]
 gb|EER92534.1| hypothetical protein SORBIDRAFT_01g040750 [Sorghum bicolor]
Length=860

 Score =   265 bits (676),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 157/201 (78%), Gaps = 0/201 (0%)
 Frame = -1

Query  757  GWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRS  578
            G GKG AWVNGQSIGRYWPT  A   GC +SCNYRG YNS+KCL+ CG+PSQT YHVPRS
Sbjct  660  GMGKGEAWVNGQSIGRYWPTNLAPQSGCVNSCNYRGSYNSNKCLKKCGQPSQTLYHVPRS  719

Query  577  WLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAA  398
            +L+   N +V+FE+ GGDP+K+SF  R+ GS+C++VSE HP  +D W S     ++ G  
Sbjct  720  FLQPGSNDIVLFEQFGGDPSKISFVIRQTGSVCAQVSEEHPAQIDSWNSSQQTMQRYGPE  779

Query  397  LSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSS  218
            L LECP   QVIS+IKFASFGTP GTCGS+SHG+C ST ALSVV++ACIG+ +CS+ VSS
Sbjct  780  LRLECPKDGQVISSIKFASFGTPSGTCGSYSHGECSSTQALSVVQEACIGVSSCSVPVSS  839

Query  217  TTFGNPCAGVTKSLAVEASCA  155
              FGNPC GVTKSLAVEA+C+
Sbjct  840  NYFGNPCTGVTKSLAVEAACS  860



>gb|ACR35639.1| unknown [Zea mays]
Length=677

 Score =   261 bits (667),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 158/201 (79%), Gaps = 1/201 (0%)
 Frame = -1

Query  757  GWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRS  578
            G GKG AWVNGQSIGRYWPT  A   GC +SCNYRG Y+S KCL+ CG+PSQT YHVPRS
Sbjct  478  GMGKGEAWVNGQSIGRYWPTNLAPQSGCVNSCNYRGAYSSSKCLKKCGQPSQTLYHVPRS  537

Query  577  WLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAA  398
            +L+   N LV+FE  GGDP+K+SF  R+ GS+C++VSE+HP  +D W+S    Q+  G A
Sbjct  538  FLQPGSNDLVLFEHFGGDPSKISFVMRQTGSVCAQVSEAHPAQIDSWSSQQPMQRY-GPA  596

Query  397  LSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSS  218
            L LECP   QVIS++KFASFGTP GTCGS+SHG+C ST ALS+V++ACIG+ +CS+ VSS
Sbjct  597  LRLECPKEGQVISSVKFASFGTPSGTCGSYSHGECSSTQALSIVQEACIGVSSCSVPVSS  656

Query  217  TTFGNPCAGVTKSLAVEASCA  155
              FGNPC GVTKSLAVEA+C+
Sbjct  657  NYFGNPCTGVTKSLAVEAACS  677



>gb|KJB55482.1| hypothetical protein B456_009G078400 [Gossypium raimondii]
Length=817

 Score =   263 bits (672),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 127/194 (65%), Positives = 151/194 (78%), Gaps = 5/194 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NFDAP    P  L    G GKG AW+NGQSIGRYWP Y ASN GCTDSC+YRGPY++
Sbjct  626  YKTNFDAPTGNDPVALDF-MGMGKGEAWINGQSIGRYWPAYIASNSGCTDSCDYRGPYSA  684

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC +NCGKPSQ  YHVPRSWLK SGN+LV+FEE+GGDPT+L+FATR++GSLCS VS+SH
Sbjct  685  NKCRKNCGKPSQQLYHVPRSWLKPSGNILVLFEEMGGDPTQLAFATRKMGSLCSHVSDSH  744

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P+P+DMW  D   ++     LSL CP  NQVIS+IKFASFGTP GTCGSFSHG+C S  A
Sbjct  745  PLPMDMWGLDSKTRRASNPTLSLSCPSPNQVISSIKFASFGTPLGTCGSFSHGRCSSAKA  804

Query  277  LSVVKKACIGLRNC  236
             S+V+K    +R+C
Sbjct  805  HSIVQK----VRSC  814



>dbj|BAJ95568.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=853

 Score =   261 bits (667),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK+ F AP    P  +  + G GKG AWVNGQSIGRYWPT  A   GC +SCNYRG Y++
Sbjct  634  YKSKFTAPAGDDPVAIDFT-GMGKGEAWVNGQSIGRYWPTNIAPQSGCVNSCNYRGSYSA  692

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+ CG+PSQ  YHVPRS+L+   N +V+FE+ GG+P+K+SF T++  S+C+ VSE H
Sbjct  693  TKCLKKCGQPSQILYHVPRSFLQPGSNDIVLFEQFGGNPSKISFTTKQTESVCAHVSEDH  752

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P  +D W S     ++ G AL LECP   QVIS+IKFASFGTP GTCGS+SHG+C S+ A
Sbjct  753  PDQIDSWVSSQQKLQRSGPALRLECPKEGQVISSIKFASFGTPSGTCGSYSHGECSSSQA  812

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L+V ++AC+G+ +CS+ VS+  FG+PC GVTKSL VEA+C+
Sbjct  813  LAVAQEACVGVSSCSVPVSAKNFGDPCRGVTKSLVVEAACS  853



>tpg|DAA44443.1| TPA: hypothetical protein ZEAMMB73_968467 [Zea mays]
Length=830

 Score =   261 bits (666),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 158/201 (79%), Gaps = 1/201 (0%)
 Frame = -1

Query  757  GWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRS  578
            G GKG AWVNGQSIGRYWPT  A   GC +SCNYRG Y+S KCL+ CG+PSQT YHVPRS
Sbjct  631  GMGKGEAWVNGQSIGRYWPTNLAPQSGCVNSCNYRGAYSSSKCLKKCGQPSQTLYHVPRS  690

Query  577  WLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAA  398
            +L+   N LV+FE  GGDP+K+SF  R+ GS+C++VSE+HP  +D W+S    Q+  G A
Sbjct  691  FLQPGSNDLVLFEHFGGDPSKISFVMRQTGSVCAQVSEAHPAQIDSWSSQQPMQRY-GPA  749

Query  397  LSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSS  218
            L LECP   QVIS++KFASFGTP GTCGS+SHG+C ST ALS+V++ACIG+ +CS+ VSS
Sbjct  750  LRLECPKEGQVISSVKFASFGTPSGTCGSYSHGECSSTQALSIVQEACIGVSSCSVPVSS  809

Query  217  TTFGNPCAGVTKSLAVEASCA  155
              FGNPC GVTKSLAVEA+C+
Sbjct  810  NYFGNPCTGVTKSLAVEAACS  830



>ref|NP_001146370.1| beta-galactosidase precursor [Zea mays]
 gb|ACL53803.1| unknown [Zea mays]
 tpg|DAA44442.1| TPA: beta-galactosidase [Zea mays]
Length=852

 Score =   261 bits (666),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 158/201 (79%), Gaps = 1/201 (0%)
 Frame = -1

Query  757  GWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRS  578
            G GKG AWVNGQSIGRYWPT  A   GC +SCNYRG Y+S KCL+ CG+PSQT YHVPRS
Sbjct  653  GMGKGEAWVNGQSIGRYWPTNLAPQSGCVNSCNYRGAYSSSKCLKKCGQPSQTLYHVPRS  712

Query  577  WLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAA  398
            +L+   N LV+FE  GGDP+K+SF  R+ GS+C++VSE+HP  +D W+S    Q+  G A
Sbjct  713  FLQPGSNDLVLFEHFGGDPSKISFVMRQTGSVCAQVSEAHPAQIDSWSSQQPMQRY-GPA  771

Query  397  LSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSS  218
            L LECP   QVIS++KFASFGTP GTCGS+SHG+C ST ALS+V++ACIG+ +CS+ VSS
Sbjct  772  LRLECPKEGQVISSVKFASFGTPSGTCGSYSHGECSSTQALSIVQEACIGVSSCSVPVSS  831

Query  217  TTFGNPCAGVTKSLAVEASCA  155
              FGNPC GVTKSLAVEA+C+
Sbjct  832  NYFGNPCTGVTKSLAVEAACS  852



>dbj|BAJ89450.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=763

 Score =   258 bits (660),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK+ F AP    P  +  + G GKG AWVNGQSIGRYWPT  A    C +SCNYRG Y++
Sbjct  544  YKSKFTAPAGDDPVAIDFT-GMGKGEAWVNGQSIGRYWPTNIAPQSDCVNSCNYRGSYSA  602

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+ CG+PSQ  YHVPRS+L+   N +V+FE+ GG+P+K+SF T++  S+C+ VSE H
Sbjct  603  TKCLKKCGQPSQILYHVPRSFLQPGSNDIVLFEQFGGNPSKISFTTKQTESVCAHVSEDH  662

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P  +D W S     ++ G AL LECP   QVIS+IKFASFGTP GTCGS+SHG+C S+ A
Sbjct  663  PDQIDSWVSSQQKLQRSGPALRLECPKEGQVISSIKFASFGTPSGTCGSYSHGECSSSQA  722

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L+V ++AC+G+ +CS+ VS+  FG+PC GVTKSL VEA+C+
Sbjct  723  LAVAQEACVGVSSCSVPVSAKNFGDPCRGVTKSLVVEAACS  763



>ref|XP_009398591.1| PREDICTED: beta-galactosidase 6-like [Musa acuminata subsp. malaccensis]
Length=861

 Score =   256 bits (654),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 160/221 (72%), Gaps = 5/221 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG AWVNGQSIGRYWP Y +   GCT SCNYRG ++S
Sbjct  646  YKGYFDAPEGNDPVAIDFT-GMGKGEAWVNGQSIGRYWPAYVSPQTGCTTSCNYRGAFSS  704

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL+NCGKPSQ  YHVPRS ++S  N LV+FEE+ GDPT++SFATR+  SLC  VSESH
Sbjct  705  NKCLKNCGKPSQRLYHVPRSLIQSGKNRLVLFEEMSGDPTQISFATRQTVSLCGHVSESH  764

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P  +D   +  S        L LECP  NQ IS+IKFASFGTP GTCGS++HGKC S +A
Sbjct  765  PALLDAQGTAPSNVPM----LRLECPYPNQKISSIKFASFGTPHGTCGSYNHGKCSSDDA  820

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L+V+++ACIG+++C + VS   FG+PC  V KSLAVEA+C+
Sbjct  821  LAVMQQACIGVQSCDVEVSIKLFGDPCRNVIKSLAVEAACS  861



>ref|XP_010521771.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 8 [Tarenaya 
hassleriana]
Length=874

 Score =   253 bits (645),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/242 (54%), Positives = 166/242 (69%), Gaps = 22/242 (9%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  +  + G GKG+AWVNG+SIGR+WPT  A + GCTDSC+YRG Y S
Sbjct  634  YKTTFDAPAGSDPVAIDFT-GAGKGMAWVNGESIGRFWPTNIARDSGCTDSCDYRGSYRS  692

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVG-SLCSRVSES  461
            +KCL+NCGKPSQ+ YHVPRSW+K SGN LV+  E GGD   +SFAT++ G SLC RVS+S
Sbjct  693  NKCLKNCGKPSQSLYHVPRSWIKESGNTLVLLVEAGGDVAGISFATKQGGSSLCLRVSQS  752

Query  460  HPMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            HP PVD WTS  +  ++    LSL+CP  + VIS+++FASFGTP GTCG FSHG+C S+ 
Sbjct  753  HPPPVDTWTSSSNRTRRTTPVLSLQCPKPDHVISSVEFASFGTPTGTCGGFSHGRCSSSL  812

Query  280  ALSVVK--------------------KACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEAS  161
            ALS +                     +AC+G R+CSL VS++ FG+ C G  K+LAV+AS
Sbjct  813  ALSYMXLYMREDWNYVKTENDVGWMVQACVGSRSCSLPVSTSVFGDACRGTVKTLAVQAS  872

Query  160  CA  155
            C+
Sbjct  873  CS  874



>gb|KEH39322.1| beta-galactosidase-like protein [Medicago truncatula]
Length=801

 Score =   250 bits (639),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK NFDAP    P  +  + G GKG AWVNGQSIGRYWPTY ASN GCTDSCNYRGPY S
Sbjct  614  YKTNFDAPSGSNPVAIDFT-GMGKGEAWVNGQSIGRYWPTYVASNAGCTDSCNYRGPYTS  672

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC +NCGKPSQT YHVPRS+LK +GN LV+FEE GGDPT++SFAT+++ S+CS VS+SH
Sbjct  673  SKCRKNCGKPSQTLYHVPRSFLKPNGNTLVLFEENGGDPTQISFATKQLESVCSHVSDSH  732

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P  +D+W  D     + G AL L CP  NQVIS+IKFAS+GTP GTCG+F  G+C S  A
Sbjct  733  PPQIDLWNQDTESGGKVGPALLLSCPNHNQVISSIKFASYGTPLGTCGNFYRGRCSSNKA  792

Query  277  LSVVKKACI  251
            LS+VKK  I
Sbjct  793  LSIVKKVFI  801



>gb|EYU18851.1| hypothetical protein MIMGU_mgv1a001293mg [Erythranthe guttata]
Length=845

 Score =   246 bits (629),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 151/221 (68%), Gaps = 2/221 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F AP    P  +  + G GKG AWVNGQ IGRYWP+      G   +CNYRG Y+ 
Sbjct  627  YKTTFSAPAGNSPVAIDFT-GMGKGHAWVNGQGIGRYWPSNIVDPNGYCTTCNYRGTYDQ  685

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL NCGKPSQ   HVPRSWLK   NVLV+ EEVGGDPT +SF TREV ++CS+VSES+
Sbjct  686  NKCLANCGKPSQQQNHVPRSWLKQGENVLVLLEEVGGDPTMISFVTREVATVCSKVSESY  745

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P P+D+W+S+   +  +   L LECP  +QVIS  +F SFG P G CG F+HG+CRS  A
Sbjct  746  PPPMDLWSSNYLTRVIK-PTLLLECPSPSQVISQFQFVSFGNPHGGCGGFTHGRCRSKRA  804

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
              VV KAC+G   CS+ V+    GNPCA +TKSLAVEASC+
Sbjct  805  RRVVHKACMGKPKCSIEVTVENLGNPCANITKSLAVEASCS  845



>gb|EPS63867.1| beta-galactosidase, partial [Genlisea aurea]
Length=654

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 153/234 (65%), Gaps = 27/234 (12%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L  + G GKG AWVNGQ IGRYWPTY A + GCTDSCNYRG YNS
Sbjct  435  YKTTFDAPSGSSPVALDFT-GMGKGQAWVNGQGIGRYWPTYIAGSTGCTDSCNYRGSYNS  493

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVG-------SLC  479
            +KCL+NCGKP+Q  YHVPR WL+ +GN LV+ EE GGDPTKLS  TRE G       ++C
Sbjct  494  NKCLKNCGKPTQQLYHVPRYWLRPTGNTLVLIEETGGDPTKLSLVTRETGSSSSSSNNIC  553

Query  478  SRVSESHPMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHG  299
               SE+                  G  LS+ CP  NQVIS I FASFGTPQG+CGSFSHG
Sbjct  554  GLASETI-------------TPAGGGFLSIACPSPNQVISKIIFASFGTPQGSCGSFSHG  600

Query  298  KCRSTNALSVVKKACIGLRNCSLGVSSTTFGNPCAG------VTKSLAVEASCA  155
            +C S    S+++KAC+G R+CS+ VS++ F  PC+        T+SLAVEASC+
Sbjct  601  QCHSRRTHSIIEKACVGSRSCSVEVSASLFREPCSNSSSNGTTTRSLAVEASCS  654



>gb|EYU40574.1| hypothetical protein MIMGU_mgv1a001299mg [Erythranthe guttata]
Length=845

 Score =   243 bits (620),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 152/222 (68%), Gaps = 4/222 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTA-SNGGCTDSCNYRGPYN  641
            YK  F AP    P  +  + G GKG AWVNG  IGRYWP   A SNG C D+CNYRG Y+
Sbjct  625  YKTTFSAPAGNSPVAIDFT-GMGKGHAWVNGHGIGRYWPANVAPSNGNCADTCNYRGSYS  683

Query  640  SDKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSES  461
            ++KCL+ CGKP+Q  YHVPRSWLK +GN LVV EE+GGDPT +SFATRE+G LC +VSE+
Sbjct  684  NNKCLKGCGKPTQQQYHVPRSWLKPTGNTLVVLEEIGGDPTMISFATRELGLLCGKVSEN  743

Query  460  HPMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            +P P+D+W S+   +  +   L LECP  +QVI  ++F SFG P G CG ++HG+CRS  
Sbjct  744  YPAPLDLWDSNYLTRVTK-PTLLLECPSPSQVIKRLQFVSFGNPHGGCGGYTHGRCRSNR  802

Query  280  ALSVVKKACIGLRNCSLGVSSTTFGNP-CAGVTKSLAVEASC  158
            A  V+ +AC G   CS+ V+    G+P C  VTKSLAVEA C
Sbjct  803  ARRVIHRACTGKTKCSIDVTVENLGDPNCGNVTKSLAVEAFC  844



>gb|EYU18849.1| hypothetical protein MIMGU_mgv1a001605mg [Erythranthe guttata]
Length=786

 Score =   241 bits (615),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 150/221 (68%), Gaps = 3/221 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTAS-NGGCTDSCNYRGPYN  641
            YK  F AP    P  +  + G GKG AW+NG  IGRYWP Y +   G CTD+C+YRG Y+
Sbjct  567  YKTQFSAPAGNSPVAIDFT-GMGKGQAWINGNGIGRYWPAYVSPPEGKCTDNCDYRGEYS  625

Query  640  SDKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSES  461
             DKCL+ CGKP+Q  YHVPRSWLK +GN LVV EE+GGDPT +S ATRE+G +C  VSES
Sbjct  626  QDKCLKGCGKPAQQQYHVPRSWLKPTGNTLVVLEEIGGDPTMISIATREIGLICGAVSES  685

Query  460  HPMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            +P P+D+W S+   +  +   L LECP  +QVI  ++F  +G PQG CGSF+ G+CRS  
Sbjct  686  YPAPLDLWDSNYLTRVTK-PTLLLECPYQSQVIKELQFVGYGNPQGKCGSFTQGQCRSNR  744

Query  280  ALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            A +VV K C+G + CS+ ++    G+PC  + K+LAVEA C
Sbjct  745  ATTVVNKYCMGKQKCSIEMTLENLGDPCPDIYKTLAVEAFC  785



>gb|EYU18850.1| hypothetical protein MIMGU_mgv1a001274mg [Erythranthe guttata]
Length=848

 Score =   241 bits (616),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 152/222 (68%), Gaps = 4/222 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTA-SNGGCTDSCNYRGPYN  641
            YK  F AP    P  +  + G GKG AWVNG  IGRYWP   A SNG C D+CNYRG Y+
Sbjct  628  YKTTFSAPAGNSPVAIDFT-GMGKGHAWVNGHGIGRYWPANVAPSNGNCADTCNYRGSYS  686

Query  640  SDKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSES  461
            ++KCL+ CGKP+Q  YHVPRSWLK +GN LVV EE+GGDPT +SFATRE+G +C +VSE+
Sbjct  687  NNKCLKGCGKPTQQQYHVPRSWLKPTGNTLVVLEEIGGDPTMISFATRELGLICGKVSEN  746

Query  460  HPMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            +P P+D+W S+   +  +   L LECP  +QVI  ++F SFG P G CG ++HG+CRS  
Sbjct  747  YPAPLDLWDSNYLTRVTK-PTLLLECPSPSQVIKRLQFVSFGNPHGGCGGYTHGRCRSKR  805

Query  280  ALSVVKKACIGLRNCSLGVSSTTFGNP-CAGVTKSLAVEASC  158
            A  V+ +AC G   CS+ V+    G+P C  VTKSLAVEA C
Sbjct  806  ARRVIHRACTGKTKCSIDVTVENLGDPNCENVTKSLAVEAFC  847



>ref|XP_008778218.1| PREDICTED: beta-galactosidase 6-like, partial [Phoenix dactylifera]
Length=322

 Score =   228 bits (580),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 147/221 (67%), Gaps = 3/221 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK +F  P    P  L +S   GKG AWVNGQSIGRYWP Y + + GC++ C+YRGPY+S
Sbjct  104  YKTSFTPPEGNGPLALNLSS-MGKGQAWVNGQSIGRYWPAYLSPSTGCSEDCDYRGPYDS  162

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL+ CG+P+Q  YH+PRSW+    N+LV+ EE GGDPTK++  T+   ++C+ VSE  
Sbjct  163  NKCLKRCGQPAQILYHIPRSWVHPGKNLLVLHEEFGGDPTKITILTKTGEAVCAHVSELD  222

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W S+ S        L L C     ++  I FASFGTPQG CGSFSHG C S   
Sbjct  223  PPPVDSWKSN-SKATSMNTQLRLSCERGWHIV-LINFASFGTPQGQCGSFSHGTCSSVGV  280

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L +++K CIG  +CS+ VS+  FG+PC GV KSLAVEA C+
Sbjct  281  LPIIQKECIGRESCSVTVSTLEFGDPCPGVPKSLAVEALCS  321



>ref|XP_003635211.1| PREDICTED: beta-galactosidase 6 [Vitis vinifera]
 emb|CBI18606.3| unnamed protein product [Vitis vinifera]
Length=198

 Score =   221 bits (564),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 140/199 (70%), Gaps = 3/199 (2%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG AWVNGQSIGRYWP Y A + GCT +C+YRG Y++ KCLRNCG+P+QT YH+PR+W+
Sbjct  2    GKGQAWVNGQSIGRYWPAYLAPSTGCTTNCDYRGAYDASKCLRNCGQPAQTLYHIPRTWV  61

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAALS  392
             S  N+LV+ EE+GGDP+K+S  TR    +C+ VSE+ P P D W  +L    Q  + + 
Sbjct  62   HSGKNLLVLHEELGGDPSKISLLTRTGQEVCAHVSEADPPPADSWQPNLEFMSQS-SQVR  120

Query  391  LECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSSTT  212
            L C      IS I FASFGTP+G CG+F+ G C + N LSVV++ACIG   C++ VS+  
Sbjct  121  LTCE-QGWHISMINFASFGTPRGHCGTFNPGNCHA-NVLSVVQQACIGQEGCAIPVSTAR  178

Query  211  FGNPCAGVTKSLAVEASCA  155
             G+PC GV KSLA+EA C+
Sbjct  179  LGDPCPGVLKSLAIEALCS  197



>gb|ERN14823.1| hypothetical protein AMTR_s00032p00109160 [Amborella trichopoda]
Length=841

 Score =   233 bits (593),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 150/223 (67%), Gaps = 8/223 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA FDAP    P  L ++   GKG  WVNG  IGRYWP Y A   GC D C+YRG Y++
Sbjct  619  YKATFDAPEGNSPLALNLA-SMGKGQVWVNGLGIGRYWPAYLAPAAGCADPCDYRGTYDA  677

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+NCG+PSQT YHVPRSWL  +GNVLV+ EE+GGDPTK++  TR    +CS  SES 
Sbjct  678  QKCLKNCGQPSQTLYHVPRSWLNPTGNVLVLLEELGGDPTKITIVTRTGQQICSHASESD  737

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQ---VISTIKFASFGTPQGTCGSFSHGKCRS  287
              PVD W  +    K +  A+S E  +S +    IS++ FASFGTPQG CG +SHG C +
Sbjct  738  IPPVDFWDKN----KLDFEAVSPEVRISCERGWQISSVDFASFGTPQGKCGLYSHGSCSA  793

Query  286  TNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
             + LS+V+K C+G  +CS+ VS++  G+PC  V KSLA++A+C
Sbjct  794  KDVLSLVRKTCVGHESCSIPVSASVLGDPCPSVVKSLAIQATC  836



>ref|XP_006853356.2| PREDICTED: beta-galactosidase 8 [Amborella trichopoda]
Length=1124

 Score =   234 bits (596),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 150/223 (67%), Gaps = 8/223 (4%)
 Frame = -1

Query  817   YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
             YKA FDAP    P  L ++   GKG  WVNG  IGRYWP Y A   GC D C+YRG Y++
Sbjct  902   YKATFDAPEGNSPLALNLA-SMGKGQVWVNGLGIGRYWPAYLAPAAGCADPCDYRGTYDA  960

Query  637   DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
              KCL+NCG+PSQT YHVPRSWL  +GNVLV+ EE+GGDPTK++  TR    +CS  SES 
Sbjct  961   QKCLKNCGQPSQTLYHVPRSWLNPTGNVLVLLEELGGDPTKITIVTRTGQQICSHASESD  1020

Query  457   PMPVDMWTSDLSGQKQEGAALSLECPLSNQ---VISTIKFASFGTPQGTCGSFSHGKCRS  287
               PVD W  +    K +  A+S E  +S +    IS++ FASFGTPQG CG +SHG C +
Sbjct  1021  IPPVDFWDKN----KLDFEAVSPEVRISCERGWQISSVDFASFGTPQGKCGLYSHGSCSA  1076

Query  286   TNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
              + LS+V+K C+G  +CS+ VS++  G+PC  V KSLA++A+C
Sbjct  1077  KDVLSLVRKTCVGHESCSIPVSASVLGDPCPSVVKSLAIQATC  1119



>gb|ABR16628.1| unknown [Picea sitchensis]
Length=836

 Score =   229 bits (583),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 151/224 (67%), Gaps = 6/224 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA FDAP    P  L +S   GKG AWVNGQSIGRYWP+Y A  G C+D C+Y G Y  
Sbjct  616  YKAEFDAPAGEDPLGLDLSS-MGKGQAWVNGQSIGRYWPSYLAE-GVCSDGCSYEGTYRP  673

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC  NCG+ SQ +YHVPRSWL+ SGN LV+FEE+GG+P+ +S  TR V S+C+ VSESH
Sbjct  674  HKCDTNCGQSSQRWYHVPRSWLQPSGNTLVLFEEIGGNPSGVSLVTRSVDSVCAHVSESH  733

Query  457  PMPVDMWTSDLSGQKQEGAA--LSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRST  284
               ++ W  + + Q Q+     + L+C    Q IS IKFASFGTPQG CGSF  G C S 
Sbjct  734  SQSINFWRLESTDQVQKLHIPKVHLQCS-KGQRISAIKFASFGTPQGLCGSFQQGDCHSP  792

Query  283  NALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASCA  155
            N+++ ++K C+GLR CSL VS   F G+PC GV K +A+EA C+
Sbjct  793  NSVATIQKKCMGLRKCSLSVSEKIFGGDPCPGVRKGVAIEAVCS  836



>ref|XP_011462809.1| PREDICTED: beta-galactosidase 9 [Fragaria vesca subsp. vesca]
Length=657

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 154/225 (68%), Gaps = 7/225 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FD+P    P  L +    GKG AWVNG  IGRYW T  A   GC + C+YRG YNS
Sbjct  424  YKTYFDSPAGTDPVALNLG-SMGKGQAWVNGHHIGRYW-TLVAPKDGCQEICDYRGAYNS  481

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCGKP+QT+YH+PRSWL++S N+LV+FEE GG+P ++S  +R VG++C++VSESH
Sbjct  482  DKCSTNCGKPTQTWYHIPRSWLQASSNLLVIFEETGGNPFEISINSRAVGTICAQVSESH  541

Query  457  PMPVDMWTS-DLSGQKQEGAALSLECPLSNQ---VISTIKFASFGTPQGTCGSFSHGKCR  290
              PV  W + D   +K      + E  L  Q   +IS+I+FAS+G+PQG C  FS G C 
Sbjct  542  YPPVQKWFNPDFIDKKGRVNDRTPEIHLHCQDGFIISSIEFASYGSPQGHCQKFSQGNCH  601

Query  289  STNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASC  158
            ++N+ S+V +AC+G  NCS+GVS+  F G+PC G+ K+LA+EASC
Sbjct  602  ASNSFSIVSEACLGKNNCSIGVSNLVFGGDPCRGIVKTLAIEASC  646



>gb|AFK47105.1| unknown [Lotus japonicus]
Length=220

 Score =   209 bits (532),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 138/203 (68%), Gaps = 6/203 (3%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG AWVNG  IGRYW T  +   GC   C+YRG YNSDKC  NCGKP+QT YHVPRSWL
Sbjct  2    GKGQAWVNGHHIGRYW-TRVSPKSGCEQVCDYRGAYNSDKCTTNCGKPTQTLYHVPRSWL  60

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVD-MWTSDLSGQKQEGAAL  395
            K+S N+LV+FEE GG+P ++S        +C++VSESH  P+  +  +DL G +    ++
Sbjct  61   KASDNLLVIFEETGGNPFRISVKLHSARIVCAKVSESHYQPLHKLMNADLIGHEVSANSM  120

Query  394  SLECPLSNQ---VISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGV  224
              E  L  Q   +IS+I FAS+G P+G+C SFS G C + +++++V KAC G R+CS+ +
Sbjct  121  IPELHLRCQDGRIISSITFASYGNPEGSCQSFSRGNCHAPSSMAIVSKACQGKRSCSIKI  180

Query  223  SSTTF-GNPCAGVTKSLAVEASC  158
            S T F G+PC GV K+L+VEA C
Sbjct  181  SDTIFGGDPCQGVMKTLSVEARC  203



>ref|XP_009780201.1| PREDICTED: beta-galactosidase 9-like [Nicotiana sylvestris]
Length=213

 Score =   208 bits (530),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 139/203 (68%), Gaps = 6/203 (3%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG AWVNG  IGRYW T  A   GC  +C+YRG YNSDKC  NCG+ +Q +YH+PRSWL
Sbjct  2    GKGQAWVNGNHIGRYW-TLVAPKNGCGRTCDYRGAYNSDKCRTNCGELTQAWYHIPRSWL  60

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWT-SDLSGQ---KQEG  404
            K+  NVLV+FEE    P ++S ATR   ++C++VSE H  P+ MW+ S+  G+     + 
Sbjct  61   KTYNNVLVIFEETDKTPFEISIATRSTETICAQVSEKHYPPLRMWSHSEFDGKLSLMDKT  120

Query  403  AALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGV  224
              + L+C     +IS+I+FAS+G P+G+C  FS GKC + N+LS+V +AC G  +C++G+
Sbjct  121  PEMHLQCD-EGHMISSIEFASYGNPKGSCQKFSQGKCHAANSLSIVSQACKGRNSCTIGI  179

Query  223  SSTTFGNPCAGVTKSLAVEASCA  155
            S+  FG+PC  V K+LAV+A C+
Sbjct  180  SNAVFGDPCRHVVKNLAVQAKCS  202



>ref|XP_010921988.1| PREDICTED: beta-galactosidase 8-like isoform X1 [Elaeis guineensis]
Length=843

 Score =   220 bits (561),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 145/221 (66%), Gaps = 3/221 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK +F  P    P  L +S   GKG AWVNGQSIGRYWP Y + + GC++ C+YRGPY+S
Sbjct  625  YKTSFTPPEGNGPLALNLS-SMGKGQAWVNGQSIGRYWPAYLSPSTGCSEGCDYRGPYDS  683

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL++CG+P+Q  YH+PRSW+    N+LV+ EE+GGDPTK++  T+   + C+ VSE  
Sbjct  684  NKCLKSCGQPAQILYHIPRSWVHPGKNLLVLHEELGGDPTKITILTKTGEAACAHVSELD  743

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W  + +    +   L L C     ++  + FASFG PQG CG FSHG C S   
Sbjct  744  PPPVDSWKPNSTATSMD-PELRLSCEQGWHIV-LVNFASFGMPQGQCGFFSHGTCSSDGV  801

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L +++K CIG  +CS+ VS+  FG+PC GV KSLAVE  C+
Sbjct  802  LPIIQKECIGRESCSVTVSTLEFGDPCPGVPKSLAVEVLCS  842



>ref|XP_010921989.1| PREDICTED: beta-galactosidase 8-like isoform X2 [Elaeis guineensis]
Length=837

 Score =   220 bits (560),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 145/221 (66%), Gaps = 3/221 (1%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK +F  P    P  L +S   GKG AWVNGQSIGRYWP Y + + GC++ C+YRGPY+S
Sbjct  619  YKTSFTPPEGNGPLALNLSS-MGKGQAWVNGQSIGRYWPAYLSPSTGCSEGCDYRGPYDS  677

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL++CG+P+Q  YH+PRSW+    N+LV+ EE+GGDPTK++  T+   + C+ VSE  
Sbjct  678  NKCLKSCGQPAQILYHIPRSWVHPGKNLLVLHEELGGDPTKITILTKTGEAACAHVSELD  737

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W  + +    +   L L C     ++  + FASFG PQG CG FSHG C S   
Sbjct  738  PPPVDSWKPNSTATSMD-PELRLSCEQGWHIV-LVNFASFGMPQGQCGFFSHGTCSSDGV  795

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L +++K CIG  +CS+ VS+  FG+PC GV KSLAVE  C+
Sbjct  796  LPIIQKECIGRESCSVTVSTLEFGDPCPGVPKSLAVEVLCS  836



>gb|KJB69393.1| hypothetical protein B456_011G021800 [Gossypium raimondii]
Length=838

 Score =   219 bits (559),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 148/222 (67%), Gaps = 6/222 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK +F  P    P  L ++   GKG AWVNGQSIGRYWP Y + + GCT++C+YRG Y+S
Sbjct  621  YKVSFLTPQGNGPLALNLTSM-GKGQAWVNGQSIGRYWPAYLSPSEGCTENCDYRGEYDS  679

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC +NCG+P+QT YHVPRSW+    N+LV+ EE+GGDPTK+S  TR    +CS VSE  
Sbjct  680  TKCQKNCGQPAQTLYHVPRSWVHPGQNLLVLHEELGGDPTKISVLTRTGQEICSFVSEDD  739

Query  457  PMPVDMWTSDLS-GQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            P P D W  ++  G +   A L+ E       I++I FASFG+PQG CG+FS G C + N
Sbjct  740  PQPADFWILNMGFGSRSPEARLTCE---QGWHITSINFASFGSPQGNCGAFSVGTCHA-N  795

Query  280  ALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
             L +V+KACIG   CS+ VS+   G+PC GV K+LA+EA C+
Sbjct  796  ILPMVQKACIGEEQCSVPVSTANLGDPCPGVLKTLAIEAMCS  837



>gb|AFG44826.1| hypothetical protein 2_7725_01, partial [Pinus taeda]
Length=157

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 120/158 (76%), Gaps = 5/158 (3%)
 Frame = -1

Query  733  VNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWLKSSGNV  554
            VNG+SIGRYWP+Y AS GGCTDSC+YRG Y+S KCL NCGKPSQ  YHVPRSW++ +GNV
Sbjct  1    VNGKSIGRYWPSYIASQGGCTDSCDYRGAYSSSKCLTNCGKPSQKLYHVPRSWIQPTGNV  60

Query  553  LVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMW----TSDLSGQKQEGAALSLE  386
            LV+FEE+GGDPT++SF  R VG++C+RVSE+H  PV  W    TS L   K +G  L L 
Sbjct  61   LVLFEELGGDPTQISFMARSVGTVCARVSETHLPPVGSWKSSATSGLKVNKPKG-ELQLH  119

Query  385  CPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALS  272
            CP S  +I +IKFASFGTP G CGSF++G C + + +S
Sbjct  120  CPSSGHLIKSIKFASFGTPTGHCGSFTYGHCNTNSTMS  157



>ref|XP_007025758.1| Beta-galactosidase 8 [Theobroma cacao]
 gb|EOY28380.1| Beta-galactosidase 8 [Theobroma cacao]
Length=843

 Score =   218 bits (555),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 145/221 (66%), Gaps = 4/221 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F AP    P  L ++   GKG AWVNGQSIGRYWP Y + + GCT +C+YRG Y+S
Sbjct  626  YKVTFLAPEGKGPLALNLT-SMGKGQAWVNGQSIGRYWPAYLSPSEGCTKNCDYRGEYDS  684

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC +NCG+P+QT YH+PRSW+    N+LV+ EE+GGDPTK+S  TR    +CS VSE  
Sbjct  685  TKCQQNCGQPAQTLYHIPRSWVHPGENLLVLHEELGGDPTKISVLTRTGQEICSLVSEKD  744

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P+P D W  +L    Q   A  L C      I++I FASFG+PQG CG F  G C + + 
Sbjct  745  PLPADSWKPNLGFMSQTPEA-RLTCE-KGWRIASINFASFGSPQGNCGEFRTGICHA-DI  801

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            +S+V+KACIG   CS+ VS+   G+PC G+ KSLA+EA C+
Sbjct  802  ISMVQKACIGQEQCSIPVSTANLGDPCPGILKSLAIEALCS  842



>gb|AEW08372.1| hypothetical protein 2_7725_01, partial [Pinus radiata]
 gb|AFG44821.1| hypothetical protein 2_7725_01, partial [Pinus taeda]
 gb|AFG44823.1| hypothetical protein 2_7725_01, partial [Pinus taeda]
Length=157

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 121/157 (77%), Gaps = 3/157 (2%)
 Frame = -1

Query  733  VNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWLKSSGNV  554
            VNG+SIGRYWP+Y AS GGCTDSC+YRG Y+S KCL NCG+PSQ  YHVPRSW++ +GNV
Sbjct  1    VNGKSIGRYWPSYIASQGGCTDSCDYRGAYSSSKCLTNCGQPSQKLYHVPRSWIQPTGNV  60

Query  553  LVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMW-TSDLSGQK--QEGAALSLEC  383
            LV+FEE+GGDPT++SF  R VG++C+RVSE+H  PV  W +S  SG K  +  A L L C
Sbjct  61   LVLFEELGGDPTQISFMARSVGTVCARVSETHLPPVGSWKSSATSGLKVNKPKAELQLHC  120

Query  382  PLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALS  272
            P S  +I +IKFASFGTP G CGSF++G C + + +S
Sbjct  121  PSSGHLIKSIKFASFGTPTGRCGSFTYGHCNTNSTMS  157



>gb|AFG44819.1| hypothetical protein 2_7725_01, partial [Pinus taeda]
 gb|AFG44820.1| hypothetical protein 2_7725_01, partial [Pinus taeda]
 gb|AFG44824.1| hypothetical protein 2_7725_01, partial [Pinus taeda]
 gb|AFG44825.1| hypothetical protein 2_7725_01, partial [Pinus taeda]
Length=157

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 121/157 (77%), Gaps = 3/157 (2%)
 Frame = -1

Query  733  VNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWLKSSGNV  554
            VNG+SIGRYWP+Y AS GGCTDSC+YRG Y+S KCL NCG+PSQ  YHVPRSW++ +GNV
Sbjct  1    VNGKSIGRYWPSYIASQGGCTDSCDYRGAYSSSKCLTNCGQPSQKLYHVPRSWIQPTGNV  60

Query  553  LVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMW-TSDLSGQK--QEGAALSLEC  383
            LV+FEE+GGDPT++SF  R VG++C+RVSE+H  PV  W +S  SG K  +  A L L C
Sbjct  61   LVLFEELGGDPTQISFMARSVGTVCARVSETHLPPVGSWKSSATSGLKVNKPKAELQLHC  120

Query  382  PLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALS  272
            P S  +I +IKFASFGTP G CGSF++G C + + +S
Sbjct  121  PSSGHLIKSIKFASFGTPTGHCGSFTYGHCNTNSTMS  157



>gb|AFB33584.1| hypothetical protein 2_7725_01, partial [Pinus mugo]
Length=157

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 121/157 (77%), Gaps = 3/157 (2%)
 Frame = -1

Query  733  VNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWLKSSGNV  554
            VNG+SIGRYWP+Y AS  GCTDSC+YRG Y+S KCL NCG+PSQ  YHVPRSW++S+GNV
Sbjct  1    VNGKSIGRYWPSYIASQSGCTDSCDYRGAYSSSKCLTNCGQPSQKLYHVPRSWIQSTGNV  60

Query  553  LVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMW-TSDLSGQK--QEGAALSLEC  383
            LV+FEE+GGDPT++SF  R VG++C+RVSE+H  PV  W +S  SG K  +  A L L C
Sbjct  61   LVLFEELGGDPTQISFMARSVGTVCARVSETHLPPVGSWKSSATSGLKVNKPKAELQLHC  120

Query  382  PLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALS  272
            P S  +I +IKFASFGTP G CGSF++G C + + +S
Sbjct  121  PSSGHLIKSIKFASFGTPTGRCGSFTYGHCNTNSTMS  157



>ref|XP_010232635.1| PREDICTED: beta-galactosidase 3 [Brachypodium distachyon]
Length=846

 Score =   217 bits (553),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 151/223 (68%), Gaps = 4/223 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK N D P    P  + + +  GKG+AW+NG +IGRYWP  ++S+  CT SCNYRGP+N 
Sbjct  626  YKVNVDVPQGDDPVGIDM-QSMGKGLAWLNGNAIGRYWPRTSSSDDRCTPSCNYRGPFNP  684

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC   CGKP+Q +YHVPRSW   SGN LVVFEE GGDPTK++F+ R    +CS VSE++
Sbjct  685  SKCRTGCGKPTQRWYHVPRSWFHPSGNTLVVFEEQGGDPTKITFSRRVATKVCSFVSENY  744

Query  457  P-MPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            P + ++ W   +S   ++ A + L CP   + IS++KFASFG P GTC S+  G+C   +
Sbjct  745  PSIDLESWDKSISDDGKDTAKVQLSCP-KGKNISSVKFASFGDPSGTCRSYQQGRCHHPS  803

Query  280  ALSVVKKACIGLRNCSLGVSSTTFG-NPCAGVTKSLAVEASCA  155
            +LSVV+KAC+ + +C++ +S   FG + C GV K+LA+EA C+
Sbjct  804  SLSVVEKACLNINSCTVSLSDEGFGKDLCPGVAKTLAIEADCS  846



>ref|XP_010929758.1| PREDICTED: beta-galactosidase 15 isoform X3 [Elaeis guineensis]
Length=658

 Score =   215 bits (547),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 146/225 (65%), Gaps = 8/225 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L +    GKG AWVNG SIGRYW +  A   GC  SCNYRG YN 
Sbjct  424  YKTTFDAPEGDDPVALDLG-SMGKGQAWVNGHSIGRYW-SLIAPETGCPKSCNYRGAYNE  481

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC  NCG P+Q++YH+PR+WL+SS N+LV+FEE GG+P K+S       ++C ++SE+H
Sbjct  482  NKCTTNCGLPTQSWYHIPRAWLQSSNNLLVIFEETGGNPLKISLRVHSTKTICGKMSETH  541

Query  457  PMPVDMWTS-DLSGQK----QEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKC  293
              P+  W+  D    K    Q    + L+C     +IS +KFAS+GTP G+C ++S GKC
Sbjct  542  YPPLSTWSHPDFINGKISINQVAPQMHLQCD-DGHMISAVKFASYGTPHGSCQNYSLGKC  600

Query  292  RSTNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
             ++ +LS+V KAC G  NC++ VS+T FG+PC G  K+LAVEA C
Sbjct  601  HASTSLSLVTKACQGKNNCTIEVSNTNFGDPCRGTVKALAVEAEC  645



>gb|AGR44461.1| beta-D-galactosidase 2 [Pyrus x bretschneideri]
Length=895

 Score =   217 bits (553),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 149/225 (66%), Gaps = 7/225 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FD+P    P  L +    GKG AWVNG  IGRYW T  A   GC + C+YRG YNS
Sbjct  662  YKTYFDSPAGTDPVALDLG-SMGKGQAWVNGHHIGRYW-TLVAPEDGCPEICDYRGAYNS  719

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCGKP+QT YHVPRSWL+SS N+LV+ EE GG+P  +S   R  G LC++VSESH
Sbjct  720  DKCSFNCGKPTQTLYHVPRSWLQSSSNLLVILEETGGNPFDISIKLRSAGVLCAQVSESH  779

Query  457  PMPVDMWTS-DLSGQKQEGAALSLECPLSNQ---VISTIKFASFGTPQGTCGSFSHGKCR  290
              PV  W + D   +K     L+ E  L  Q    IS+I+FAS+GTPQG+C  FS G C 
Sbjct  780  YPPVQKWFNPDSVDEKITVNDLTPEVHLQCQDGFTISSIEFASYGTPQGSCLKFSMGNCH  839

Query  289  STNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASC  158
            +TN+LS+V K+C+G  +CS+ +S+ +F G+PC G+ K+LAVEA C
Sbjct  840  ATNSLSIVSKSCLGKNSCSVEISNNSFGGDPCRGIVKTLAVEARC  884



>gb|AFB33583.1| hypothetical protein 2_7725_01, partial [Pinus mugo]
Length=157

 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 120/157 (76%), Gaps = 3/157 (2%)
 Frame = -1

Query  733  VNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWLKSSGNV  554
            VNG+SIGRYWP+Y AS  GCTDSC+YRG Y+S KCL NCG+PSQ  YHVPRSW++S+GNV
Sbjct  1    VNGKSIGRYWPSYIASQSGCTDSCDYRGAYSSSKCLTNCGQPSQKLYHVPRSWIQSTGNV  60

Query  553  LVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMW-TSDLSGQK--QEGAALSLEC  383
            LV+FEE+GGDPT++SF  R VG++C+RVSE+H  PV  W +S  SG K  +  A L L C
Sbjct  61   LVLFEELGGDPTQISFMARSVGTVCARVSETHLPPVGSWKSSATSGLKVNKPKAELQLHC  120

Query  382  PLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALS  272
            P S  +I +IKFASFGTP G CGSF++G C   + +S
Sbjct  121  PSSGHLIKSIKFASFGTPTGRCGSFTYGHCXXXSTMS  157



>ref|XP_006420948.1| hypothetical protein CICLE_v10004268mg [Citrus clementina]
 gb|ESR34188.1| hypothetical protein CICLE_v10004268mg [Citrus clementina]
Length=734

 Score =   216 bits (549),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 146/226 (65%), Gaps = 9/226 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L +    GKG AWVNG  IGRYW T  A  GGC D+C+YRG YNS
Sbjct  501  YKTYFDAPDGIDPVALDLG-SMGKGQAWVNGHHIGRYW-TVVAPKGGCQDTCDYRGAYNS  558

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCG P+QT+YHVPRSWL++S N+LV+FEE GG+P ++S   R    +C +VSESH
Sbjct  559  DKCTTNCGNPTQTWYHVPRSWLQASNNLLVIFEETGGNPFEISVKLRSTRIVCEQVSESH  618

Query  457  PMPVDMWTSDLSGQ-----KQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKC  293
              PV  W++  S        +    + L C     +IS+I+FAS+GTPQG C  FS G C
Sbjct  619  YPPVRKWSNSYSVDGKLSINKMAPEMHLHCQ-DGYIISSIEFASYGTPQGRCQKFSRGNC  677

Query  292  RSTNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASC  158
             +  +LSVV +AC G  +CS+G+++  F G+PC G+ K+LAVEA C
Sbjct  678  HAPMSLSVVSEACQGKSSCSIGITNAVFGGDPCRGIVKTLAVEARC  723



>gb|AFB33581.1| hypothetical protein 2_7725_01, partial [Pinus mugo]
 gb|AFB33582.1| hypothetical protein 2_7725_01, partial [Pinus mugo]
Length=157

 Score =   201 bits (511),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 120/158 (76%), Gaps = 5/158 (3%)
 Frame = -1

Query  733  VNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWLKSSGNV  554
            VNG+SIGRYWP+Y AS  GCTDSC+YRG Y+S KCL NCG+PSQ  YHVPRSW++S+GNV
Sbjct  1    VNGKSIGRYWPSYIASQSGCTDSCDYRGAYSSSKCLTNCGQPSQKLYHVPRSWIQSTGNV  60

Query  553  LVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMW----TSDLSGQKQEGAALSLE  386
            LV+FEE+GGDPT++SF  R VG++C+RVSE+H  PV  W    TS L   K + A L L 
Sbjct  61   LVLFEELGGDPTQISFMARSVGTVCARVSETHLPPVGSWKSSATSVLKVNKPK-AELQLH  119

Query  385  CPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALS  272
            CP S  +I +IKFASFGTP G CGSF++G C + + +S
Sbjct  120  CPSSGHLIKSIKFASFGTPTGRCGSFTYGHCNTNSTMS  157



>gb|EEC71891.1| hypothetical protein OsI_04635 [Oryza sativa Indica Group]
Length=851

 Score =   216 bits (551),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 149/223 (67%), Gaps = 4/223 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK N D P    P  L + +  GKG+AW+NG +IGRYWP  +  +  CT SC+YRG ++ 
Sbjct  631  YKVNVDVPQGDDPVGLDM-QSMGKGLAWLNGNAIGRYWPRISPVSDRCTSSCDYRGTFSP  689

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC R CG+P+Q +YHVPRSW   SGN LV+FEE GGDPTK++F+ R V S+CS VSE +
Sbjct  690  NKCRRGCGQPTQRWYHVPRSWFHPSGNTLVIFEEKGGDPTKITFSRRTVASVCSFVSEHY  749

Query  457  P-MPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            P + ++ W  +     ++ A + L CP   + IS++KFASFG P GTC S+  G C   N
Sbjct  750  PSIDLESWDRNTQNDGRDAAKVQLSCP-KGKSISSVKFASFGNPSGTCRSYQQGSCHHPN  808

Query  280  ALSVVKKACIGLRNCSLGVSSTTFG-NPCAGVTKSLAVEASCA  155
            ++SVV+KAC+ +  C+L +S   FG + C GVTK+LA+EA C+
Sbjct  809  SISVVEKACLNMNGCTLSLSDEGFGEDLCPGVTKTLAIEADCS  851



>ref|XP_006493072.1| PREDICTED: beta-galactosidase 9-like isoform X2 [Citrus sinensis]
Length=762

 Score =   216 bits (549),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 146/226 (65%), Gaps = 9/226 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L +    GKG AWVNG  IGRYW T  A  GGC D+C+YRG YNS
Sbjct  529  YKTYFDAPDGIDPVALDLG-SMGKGQAWVNGHHIGRYW-TVVAPKGGCQDTCDYRGAYNS  586

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCG P+QT+YHVPRSWL++S N+LV+FEE GG+P ++S   R    +C +VSESH
Sbjct  587  DKCTTNCGNPTQTWYHVPRSWLQASNNLLVIFEETGGNPFEISVKLRSTRIVCEQVSESH  646

Query  457  PMPVDMWTSDLSGQ-----KQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKC  293
              PV  W++  S        +    + L C     +IS+I+FAS+GTPQG C  FS G C
Sbjct  647  YPPVRKWSNSYSVDGKLSINKMAPEMHLHCQ-DGYIISSIEFASYGTPQGRCQKFSRGNC  705

Query  292  RSTNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASC  158
             +  +LSVV +AC G  +CS+G+++  F G+PC G+ K+LAVEA C
Sbjct  706  HAPMSLSVVSEACQGKSSCSIGITNAVFGGDPCRGIVKTLAVEARC  751



>ref|XP_002521428.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF40918.1| beta-galactosidase, putative [Ricinus communis]
Length=841

 Score =   216 bits (550),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 143/221 (65%), Gaps = 4/221 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F AP    P  L ++ G GKG AWVNGQSIGRYWP Y + + GC DSC+YRG Y+S
Sbjct  624  YKGTFVAPEGKGPLALNLA-GMGKGQAWVNGQSIGRYWPAYLSPSTGCNDSCDYRGAYDS  682

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+ CG+P+QT YH+PR+W+    N+LV+ EE+GGDP+K+S  TR    +CS VSE  
Sbjct  683  FKCLKKCGQPAQTLYHIPRTWVHPGENLLVLHEELGGDPSKISVLTRTGHEICSIVSEDD  742

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P P D W S  S  K +   + L C      I +I FASFGTP G CG+F+ G C + + 
Sbjct  743  PPPADSWKSS-SEFKSQNPEVRLTCE-QGWHIKSINFASFGTPAGICGTFNPGSCHA-DM  799

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L +V+KACIG   CS+ +S+   G+PC GV K  AVEA C+
Sbjct  800  LDIVQKACIGQEGCSISISAANLGDPCPGVLKRFAVEARCS  840



>gb|AFG44822.1| hypothetical protein 2_7725_01, partial [Pinus taeda]
Length=157

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 120/157 (76%), Gaps = 3/157 (2%)
 Frame = -1

Query  733  VNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWLKSSGNV  554
            VNG+SIGRYWP+Y AS GGCTDSC+YRG Y+S KCL NCG+PSQ  YHVPRSW++ +GNV
Sbjct  1    VNGKSIGRYWPSYIASQGGCTDSCDYRGAYSSSKCLTNCGQPSQKLYHVPRSWIQPTGNV  60

Query  553  LVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMW-TSDLSGQK--QEGAALSLEC  383
            LV+FEE+GGDPT++SF  R VG++C+RVSE+H  PV  W +S  SG K  +  A L L C
Sbjct  61   LVLFEELGGDPTQISFMARSVGTVCARVSETHLPPVGSWKSSATSGLKVNKPKAELQLHC  120

Query  382  PLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALS  272
            P S  +I +IKF SFGTP G CGSF++G C + + +S
Sbjct  121  PSSGHLIKSIKFVSFGTPTGRCGSFTYGHCNTNSTMS  157



>ref|XP_010316700.1| PREDICTED: beta-galactosidase 8-like isoform X2 [Solanum lycopersicum]
Length=842

 Score =   216 bits (550),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 145/221 (66%), Gaps = 4/221 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK +F  P    P  L +S   GKG AWVNGQ IGRYW +Y + + GC+D+C+YRG Y+S
Sbjct  625  YKTSFSPPEGRGPISLNLS-SMGKGQAWVNGQHIGRYWSSYRSPSTGCSDNCDYRGAYDS  683

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+ CG+P+Q  YHVPRSWLK   N+LV+ EE+GGDP+K+SF+TR   ++C+ VSE  
Sbjct  684  WKCLKKCGQPAQVLYHVPRSWLKPEKNLLVLHEELGGDPSKISFSTRSGQTICAHVSELD  743

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W +D     QE  +L L C      I+ + FASFGTP G CG+F  G C   + 
Sbjct  744  PPPVDTWKTDKDQTSQE-PSLQLNCE-QGWTITAVNFASFGTPTGDCGAFIEGSCH-WDV  800

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+V + C+G   CS+ ++    G+PC GV KSLAVEA C+
Sbjct  801  LSIVHQGCVGKSGCSIPITMAKLGDPCPGVQKSLAVEAFCS  841



>ref|XP_010052369.1| PREDICTED: beta-galactosidase 6-like isoform X3 [Eucalyptus grandis]
 ref|XP_010052370.1| PREDICTED: beta-galactosidase 6-like isoform X3 [Eucalyptus grandis]
Length=714

 Score =   215 bits (547),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 150/220 (68%), Gaps = 4/220 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F AP    P  L ++   GKG AWVNGQS+GRYWP Y + + GCTD+C+YRG Y++
Sbjct  498  YKVMFLAPEGTGPLALNLAS-MGKGQAWVNGQSVGRYWPAYLSPSSGCTDNCDYRGSYDA  556

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC ++CG+P+QT YHVPRSW+    N+LV+ EE+GGDP+K+S  TR    LC+ +S++ 
Sbjct  557  SKCQKDCGRPAQTLYHVPRSWIIPGENLLVLHEEIGGDPSKVSVVTRTGQELCAVISQAD  616

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W  + +    +G  + L C  +   I++I+FASFG PQG+CG+F+ G C S  A
Sbjct  617  PAPVDSWKPN-TELMPDGPQVRLSCD-AGWRITSIRFASFGNPQGSCGAFAPGACHSEVA  674

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
             S++++ACIG   CS+ V++ T G+PC  V KSLAVEA C
Sbjct  675  -SLIEQACIGQEACSIPVTANTLGDPCPSVIKSLAVEALC  713



>ref|XP_010316699.1| PREDICTED: beta-galactosidase 8-like isoform X1 [Solanum lycopersicum]
Length=855

 Score =   216 bits (550),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 145/221 (66%), Gaps = 4/221 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK +F  P    P  L +S   GKG AWVNGQ IGRYW +Y + + GC+D+C+YRG Y+S
Sbjct  638  YKTSFSPPEGRGPISLNLS-SMGKGQAWVNGQHIGRYWSSYRSPSTGCSDNCDYRGAYDS  696

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+ CG+P+Q  YHVPRSWLK   N+LV+ EE+GGDP+K+SF+TR   ++C+ VSE  
Sbjct  697  WKCLKKCGQPAQVLYHVPRSWLKPEKNLLVLHEELGGDPSKISFSTRSGQTICAHVSELD  756

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W +D     QE  +L L C      I+ + FASFGTP G CG+F  G C   + 
Sbjct  757  PPPVDTWKTDKDQTSQE-PSLQLNCE-QGWTITAVNFASFGTPTGDCGAFIEGSCH-WDV  813

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+V + C+G   CS+ ++    G+PC GV KSLAVEA C+
Sbjct  814  LSIVHQGCVGKSGCSIPITMAKLGDPCPGVQKSLAVEAFCS  854



>ref|XP_006493071.1| PREDICTED: beta-galactosidase 9-like isoform X1 [Citrus sinensis]
Length=895

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 146/226 (65%), Gaps = 9/226 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L +    GKG AWVNG  IGRYW T  A  GGC D+C+YRG YNS
Sbjct  662  YKTYFDAPDGIDPVALDLG-SMGKGQAWVNGHHIGRYW-TVVAPKGGCQDTCDYRGAYNS  719

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCG P+QT+YHVPRSWL++S N+LV+FEE GG+P ++S   R    +C +VSESH
Sbjct  720  DKCTTNCGNPTQTWYHVPRSWLQASNNLLVIFEETGGNPFEISVKLRSTRIVCEQVSESH  779

Query  457  PMPVDMWTSDLSGQ-----KQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKC  293
              PV  W++  S        +    + L C     +IS+I+FAS+GTPQG C  FS G C
Sbjct  780  YPPVRKWSNSYSVDGKLSINKMAPEMHLHCQ-DGYIISSIEFASYGTPQGRCQKFSRGNC  838

Query  292  RSTNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASC  158
             +  +LSVV +AC G  +CS+G+++  F G+PC G+ K+LAVEA C
Sbjct  839  HAPMSLSVVSEACQGKSSCSIGITNAVFGGDPCRGIVKTLAVEARC  884



>ref|XP_006420947.1| hypothetical protein CICLE_v10004268mg [Citrus clementina]
 gb|ESR34187.1| hypothetical protein CICLE_v10004268mg [Citrus clementina]
Length=902

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 146/226 (65%), Gaps = 9/226 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L +    GKG AWVNG  IGRYW T  A  GGC D+C+YRG YNS
Sbjct  669  YKTYFDAPDGIDPVALDLG-SMGKGQAWVNGHHIGRYW-TVVAPKGGCQDTCDYRGAYNS  726

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCG P+QT+YHVPRSWL++S N+LV+FEE GG+P ++S   R    +C +VSESH
Sbjct  727  DKCTTNCGNPTQTWYHVPRSWLQASNNLLVIFEETGGNPFEISVKLRSTRIVCEQVSESH  786

Query  457  PMPVDMWTSDLSGQ-----KQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKC  293
              PV  W++  S        +    + L C     +IS+I+FAS+GTPQG C  FS G C
Sbjct  787  YPPVRKWSNSYSVDGKLSINKMAPEMHLHCQ-DGYIISSIEFASYGTPQGRCQKFSRGNC  845

Query  292  RSTNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASC  158
             +  +LSVV +AC G  +CS+G+++  F G+PC G+ K+LAVEA C
Sbjct  846  HAPMSLSVVSEACQGKSSCSIGITNAVFGGDPCRGIVKTLAVEARC  891



>ref|XP_010316701.1| PREDICTED: beta-galactosidase 6-like isoform X3 [Solanum lycopersicum]
Length=818

 Score =   215 bits (548),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 136/199 (68%), Gaps = 3/199 (2%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG AWVNGQ IGRYW +Y + + GC+D+C+YRG Y+S KCL+ CG+P+Q  YHVPRSWL
Sbjct  622  GKGQAWVNGQHIGRYWSSYRSPSTGCSDNCDYRGAYDSWKCLKKCGQPAQVLYHVPRSWL  681

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAALS  392
            K   N+LV+ EE+GGDP+K+SF+TR   ++C+ VSE  P PVD W +D     QE  +L 
Sbjct  682  KPEKNLLVLHEELGGDPSKISFSTRSGQTICAHVSELDPPPVDTWKTDKDQTSQE-PSLQ  740

Query  391  LECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSSTT  212
            L C      I+ + FASFGTP G CG+F  G C   + LS+V + C+G   CS+ ++   
Sbjct  741  LNCE-QGWTITAVNFASFGTPTGDCGAFIEGSCH-WDVLSIVHQGCVGKSGCSIPITMAK  798

Query  211  FGNPCAGVTKSLAVEASCA  155
             G+PC GV KSLAVEA C+
Sbjct  799  LGDPCPGVQKSLAVEAFCS  817



>ref|XP_010052367.1| PREDICTED: beta-galactosidase 8-like isoform X1 [Eucalyptus grandis]
 gb|KCW76331.1| hypothetical protein EUGRSUZ_D00703 [Eucalyptus grandis]
Length=847

 Score =   215 bits (547),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 150/220 (68%), Gaps = 4/220 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F AP    P  L ++   GKG AWVNGQS+GRYWP Y + + GCTD+C+YRG Y++
Sbjct  631  YKVMFLAPEGTGPLALNLA-SMGKGQAWVNGQSVGRYWPAYLSPSSGCTDNCDYRGSYDA  689

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC ++CG+P+QT YHVPRSW+    N+LV+ EE+GGDP+K+S  TR    LC+ +S++ 
Sbjct  690  SKCQKDCGRPAQTLYHVPRSWIIPGENLLVLHEEIGGDPSKVSVVTRTGQELCAVISQAD  749

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W  + +    +G  + L C  +   I++I+FASFG PQG+CG+F+ G C S  A
Sbjct  750  PAPVDSWKPN-TELMPDGPQVRLSCD-AGWRITSIRFASFGNPQGSCGAFAPGACHSEVA  807

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
             S++++ACIG   CS+ V++ T G+PC  V KSLAVEA C
Sbjct  808  -SLIEQACIGQEACSIPVTANTLGDPCPSVIKSLAVEALC  846



>ref|XP_006645100.1| PREDICTED: beta-galactosidase 3-like, partial [Oryza brachyantha]
Length=841

 Score =   214 bits (546),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 149/223 (67%), Gaps = 4/223 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK N D P    P  L + +  GKG+AW+NG +IGRYWP  +  +  CT SCNYRG ++ 
Sbjct  621  YKVNVDVPQGDDPVGLDM-QSMGKGLAWLNGNAIGRYWPRISPVSDRCTSSCNYRGTFSP  679

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC   CG+P+Q +YHVPRSW ++SGN LV+FEE GGDPTK++F+ R V S+CS VSE +
Sbjct  680  NKCRTGCGQPTQRWYHVPRSWFRTSGNTLVIFEEKGGDPTKITFSRRTVSSVCSFVSEHY  739

Query  457  P-MPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            P + ++ W        ++ A + L CP   + IS++KFASFG P GTC S+  G C   N
Sbjct  740  PSIDLESWDKSTPNDSRDSAKVQLTCP-KGKNISSVKFASFGNPSGTCRSYQQGSCHHPN  798

Query  280  ALSVVKKACIGLRNCSLGVSSTTFG-NPCAGVTKSLAVEASCA  155
            +LSVV+KAC+ L  C++ +S   FG + C G+TK+LA+EA C+
Sbjct  799  SLSVVEKACLKLNGCTVSLSDKGFGEDLCPGITKTLAIEADCS  841



>ref|XP_010052368.1| PREDICTED: beta-galactosidase 6-like isoform X2 [Eucalyptus grandis]
Length=790

 Score =   214 bits (546),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 150/220 (68%), Gaps = 4/220 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F AP    P  L ++   GKG AWVNGQS+GRYWP Y + + GCTD+C+YRG Y++
Sbjct  574  YKVMFLAPEGTGPLALNLAS-MGKGQAWVNGQSVGRYWPAYLSPSSGCTDNCDYRGSYDA  632

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC ++CG+P+QT YHVPRSW+    N+LV+ EE+GGDP+K+S  TR    LC+ +S++ 
Sbjct  633  SKCQKDCGRPAQTLYHVPRSWIIPGENLLVLHEEIGGDPSKVSVVTRTGQELCAVISQAD  692

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W  + +    +G  + L C  +   I++I+FASFG PQG+CG+F+ G C S  A
Sbjct  693  PAPVDSWKPN-TELMPDGPQVRLSCD-AGWRITSIRFASFGNPQGSCGAFAPGACHSEVA  750

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
             S++++ACIG   CS+ V++ T G+PC  V KSLAVEA C
Sbjct  751  -SLIEQACIGQEACSIPVTANTLGDPCPSVIKSLAVEALC  789



>dbj|BAK02766.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=845

 Score =   214 bits (546),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 150/223 (67%), Gaps = 4/223 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK N D P    P  L + +  GKG+ W+NG +IGRYWP  + +N  CT SC+YRG ++ 
Sbjct  625  YKVNVDVPQGDDPVGLDM-QSMGKGLVWLNGNAIGRYWPRTSPTNDRCTTSCDYRGKFSP  683

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC   CGKP+Q +YHVPRSW   SGN LVVFEE GGDPTK++F+ R   S+CS VSE++
Sbjct  684  NKCRVGCGKPTQRWYHVPRSWFHPSGNTLVVFEEQGGDPTKITFSRRVATSVCSFVSENY  743

Query  457  P-MPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            P + ++ W   +S   +  A + L CP   + IS++KFASFG P GTC S+  G C   +
Sbjct  744  PSIDLESWDKSISDDGRVAAKVQLSCP-KGKNISSVKFASFGDPSGTCRSYQQGSCHHPD  802

Query  280  ALSVVKKACIGLRNCSLGVSSTTFG-NPCAGVTKSLAVEASCA  155
            ++SVV+KAC+ + +C++ +S   FG +PC GVTK+LA+EA C+
Sbjct  803  SVSVVEKACMNMNSCTVSLSDEGFGEDPCPGVTKTLAIEADCS  845



>ref|XP_010929757.1| PREDICTED: beta-galactosidase 15 isoform X2 [Elaeis guineensis]
Length=813

 Score =   214 bits (545),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 146/225 (65%), Gaps = 8/225 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L +    GKG AWVNG SIGRYW +  A   GC  SCNYRG YN 
Sbjct  579  YKTTFDAPEGDDPVALDLG-SMGKGQAWVNGHSIGRYW-SLIAPETGCPKSCNYRGAYNE  636

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC  NCG P+Q++YH+PR+WL+SS N+LV+FEE GG+P K+S       ++C ++SE+H
Sbjct  637  NKCTTNCGLPTQSWYHIPRAWLQSSNNLLVIFEETGGNPLKISLRVHSTKTICGKMSETH  696

Query  457  PMPVDMWTS-DLSGQK----QEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKC  293
              P+  W+  D    K    Q    + L+C     +IS +KFAS+GTP G+C ++S GKC
Sbjct  697  YPPLSTWSHPDFINGKISINQVAPQMHLQCD-DGHMISAVKFASYGTPHGSCQNYSLGKC  755

Query  292  RSTNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
             ++ +LS+V KAC G  NC++ VS+T FG+PC G  K+LAVEA C
Sbjct  756  HASTSLSLVTKACQGKNNCTIEVSNTNFGDPCRGTVKALAVEAEC  800



>dbj|BAD91079.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=903

 Score =   214 bits (546),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 148/225 (66%), Gaps = 7/225 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FD+P    P  L +    GKG AWVNG  IGRYW T  A   GC + C+YRG YNS
Sbjct  662  YKTYFDSPAGTDPVALDLG-SMGKGQAWVNGHHIGRYW-TLVAPEDGCPEICDYRGAYNS  719

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCGKP+QT YHVPRSWL+SS N+LV+ EE GG+P  +S   R  G LC++VSESH
Sbjct  720  DKCSFNCGKPTQTLYHVPRSWLQSSSNLLVILEETGGNPFDISIKLRSAGVLCAQVSESH  779

Query  457  PMPVDMWTS-DLSGQKQEGAALSLECPLSNQ---VISTIKFASFGTPQGTCGSFSHGKCR  290
              PV  W + D   +K     L+ E  L  Q    IS+I+FAS+GTPQG+C  FS G C 
Sbjct  780  YPPVQKWFNPDSVDEKITVNDLTPEMHLQCQDGFTISSIEFASYGTPQGSCQKFSMGNCH  839

Query  289  STNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASC  158
            +TN+ S+V K+C+G  +CS+ +S+ +F G+PC G+ K+LAVEA C
Sbjct  840  ATNSSSIVSKSCLGKNSCSVEISNNSFGGDPCRGIVKTLAVEARC  884



>ref|XP_010929755.1| PREDICTED: beta-galactosidase 15 isoform X1 [Elaeis guineensis]
Length=890

 Score =   214 bits (545),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 146/225 (65%), Gaps = 8/225 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L +    GKG AWVNG SIGRYW +  A   GC  SCNYRG YN 
Sbjct  656  YKTTFDAPEGDDPVALDLG-SMGKGQAWVNGHSIGRYW-SLIAPETGCPKSCNYRGAYNE  713

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC  NCG P+Q++YH+PR+WL+SS N+LV+FEE GG+P K+S       ++C ++SE+H
Sbjct  714  NKCTTNCGLPTQSWYHIPRAWLQSSNNLLVIFEETGGNPLKISLRVHSTKTICGKMSETH  773

Query  457  PMPVDMWTS-DLSGQK----QEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKC  293
              P+  W+  D    K    Q    + L+C     +IS +KFAS+GTP G+C ++S GKC
Sbjct  774  YPPLSTWSHPDFINGKISINQVAPQMHLQCD-DGHMISAVKFASYGTPHGSCQNYSLGKC  832

Query  292  RSTNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
             ++ +LS+V KAC G  NC++ VS+T FG+PC G  K+LAVEA C
Sbjct  833  HASTSLSLVTKACQGKNNCTIEVSNTNFGDPCRGTVKALAVEAEC  877



>ref|NP_001044964.1| Os01g0875500 [Oryza sativa Japonica Group]
 sp|Q5N8X6.1|BGAL3_ORYSJ RecName: Full=Beta-galactosidase 3; Short=Lactase 3; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD82087.1| putative beta-galactosidase [Oryza sativa Japonica Group]
 dbj|BAF06878.1| Os01g0875500 [Oryza sativa Japonica Group]
 gb|EEE55754.1| hypothetical protein OsJ_04267 [Oryza sativa Japonica Group]
Length=851

 Score =   214 bits (544),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 148/223 (66%), Gaps = 4/223 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK N D P    P  L + +  GKG+AW+NG +IGRYWP  +  +  CT SC+YRG ++ 
Sbjct  631  YKVNVDVPQGDDPVGLDM-QSMGKGLAWLNGNAIGRYWPRISPVSDRCTSSCDYRGTFSP  689

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC R CG+P+Q +YHVPRSW   SGN LV+FEE GGDPTK++F+ R V S+CS VSE +
Sbjct  690  NKCRRGCGQPTQRWYHVPRSWFHPSGNTLVIFEEKGGDPTKITFSRRTVASVCSFVSEHY  749

Query  457  P-MPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            P + ++ W  +     ++ A + L CP   + IS++KF SFG P GTC S+  G C   N
Sbjct  750  PSIDLESWDRNTQNDGRDAAKVQLSCP-KGKSISSVKFVSFGNPSGTCRSYQQGSCHHPN  808

Query  280  ALSVVKKACIGLRNCSLGVSSTTFG-NPCAGVTKSLAVEASCA  155
            ++SVV+KAC+ +  C++ +S   FG + C GVTK+LA+EA C+
Sbjct  809  SISVVEKACLNMNGCTVSLSDEGFGEDLCPGVTKTLAIEADCS  851



>dbj|BAG95687.1| unnamed protein product [Oryza sativa Japonica Group]
Length=919

 Score =   214 bits (545),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 148/223 (66%), Gaps = 4/223 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK N D P    P  L + +  GKG+AW+NG +IGRYWP  +  +  CT SC+YRG ++ 
Sbjct  699  YKVNVDVPQGDDPVGLDM-QSMGKGLAWLNGNAIGRYWPRISPVSDRCTSSCDYRGTFSP  757

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC R CG+P+Q +YHVPRSW   SGN LV+FEE GGDPTK++F+ R V S+CS VSE +
Sbjct  758  NKCRRGCGQPTQRWYHVPRSWFHPSGNTLVIFEEKGGDPTKITFSRRTVASVCSFVSEHY  817

Query  457  P-MPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            P + ++ W  +     ++ A + L CP   + IS++KF SFG P GTC S+  G C   N
Sbjct  818  PSIDLESWDRNTQNDGRDAAKVQLSCP-KGKSISSVKFVSFGNPSGTCRSYQQGSCHHPN  876

Query  280  ALSVVKKACIGLRNCSLGVSSTTFG-NPCAGVTKSLAVEASCA  155
            ++SVV+KAC+ +  C++ +S   FG + C GVTK+LA+EA C+
Sbjct  877  SISVVEKACLNMNGCTVSLSDEGFGEDLCPGVTKTLAIEADCS  919



>ref|XP_006360940.1| PREDICTED: beta-galactosidase 9-like [Solanum tuberosum]
Length=892

 Score =   214 bits (544),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 110/225 (49%), Positives = 146/225 (65%), Gaps = 7/225 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L  S   GKG AWVNG  IGRYW T  A N GC  +C+YRG Y+S
Sbjct  660  YKTKFDAPGGTDPVALDFS-SMGKGQAWVNGHHIGRYW-TLVAPNNGCGRTCDYRGAYDS  717

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCG+ +Q +YH+PRSWLK+S NVLV+FEE    P  +S + R   ++C++VSE H
Sbjct  718  DKCRTNCGEITQAWYHIPRSWLKTSNNVLVIFEETDRTPFDISISMRSTETICAQVSEKH  777

Query  457  PMPVDMWTSDLSGQK----QEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCR  290
              P+  W+   S +K     +   + L+C      IS+I+FAS+G+P G+C  FS GKC 
Sbjct  778  YPPLHKWSLSESDRKLSLMDKTPEMHLQCD-EGHTISSIEFASYGSPNGSCQKFSQGKCH  836

Query  289  STNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            + N+LSVV +ACIG  +CS+G+S+  FG+PC  V KSLAV+A C+
Sbjct  837  AANSLSVVSQACIGRTSCSIGISNGVFGDPCRHVVKSLAVQAKCS  881



>dbj|BAE72075.1| pear beta-galactosidase3 [Pyrus communis]
Length=894

 Score =   213 bits (543),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 148/225 (66%), Gaps = 7/225 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FD+P    P  L +    GKG AWVNG  IGRYW T  A   GC + C+YRG Y+S
Sbjct  661  YKTYFDSPAGTDPVALDLG-SMGKGQAWVNGHHIGRYW-TLVAPEDGCPEICDYRGAYDS  718

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCGKP+QT YHVPRSWL+SS N+LV+ EE GG+P  +S   R  G LC++VSESH
Sbjct  719  DKCSFNCGKPTQTLYHVPRSWLQSSSNLLVILEETGGNPFDISIKLRSAGVLCAQVSESH  778

Query  457  PMPVDMWTS-DLSGQKQEGAALSLECPLSNQ---VISTIKFASFGTPQGTCGSFSHGKCR  290
              PV  W + D   +K     L+ E  L  Q    IS+I+FAS+GTPQG+C  FS G C 
Sbjct  779  YPPVQKWFNPDSVDEKITVNDLTPEMHLQCQDGFTISSIEFASYGTPQGSCQKFSMGNCH  838

Query  289  STNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASC  158
            +TN+ S+V K+C+G  +CS+ +S+ +F G+PC GV K+LAVEA C
Sbjct  839  ATNSSSIVSKSCLGKNSCSVEISNISFGGDPCRGVVKTLAVEARC  883



>ref|XP_009617413.1| PREDICTED: beta-galactosidase 9-like, partial [Nicotiana tomentosiformis]
Length=751

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 147/225 (65%), Gaps = 7/225 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            Y+  FDAP    P  L  SR  GKG AWVNG  IGRYW T  A   GC  +C+YRG YNS
Sbjct  519  YRTKFDAPDGTDPVALDFSRM-GKGQAWVNGNHIGRYW-TLVAPKNGCGRTCDYRGAYNS  576

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCG+ +Q +YH+PRSWLK+S NVLV+FEE    P ++S  T    ++C++VSE H
Sbjct  577  DKCRTNCGELTQAWYHIPRSWLKTSNNVLVIFEETDKTPFEISITTHSTETICAQVSEKH  636

Query  457  PMPVDMWT-SDLSGQ---KQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCR  290
              P+ MW+ S+  G+     +   + L+C      IS+I+FAS+G P+G+C  FS GKC 
Sbjct  637  YPPLRMWSHSEFDGKLSLMDKTPEMHLQCD-EGHTISSIEFASYGNPKGSCQKFSQGKCH  695

Query  289  STNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            + N+LS+V +AC G  +C++G+S+  FG+PC  V K+LAV+A C+
Sbjct  696  AANSLSIVSQACKGRNSCTIGISNAVFGDPCRHVVKNLAVQAKCS  740



>gb|KCW54087.1| hypothetical protein EUGRSUZ_I00065 [Eucalyptus grandis]
Length=206

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 134/202 (66%), Gaps = 5/202 (2%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG+AW+NGQ IG YWP   +    C   C+YRG +  DKC+  CG+PSQ +YHVPRSW 
Sbjct  5    GKGLAWLNGQPIGIYWPRLVSFENPCVKGCDYRGTFKPDKCVTGCGEPSQRWYHVPRSWF  64

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHP-MPVDMWTSDLSGQKQEGAA-  398
            K SGN+LV+ EEVGGDPTK++F+ R++ ++CS V+E +P + ++ W  DL+G + +  A 
Sbjct  65   KPSGNILVILEEVGGDPTKVAFSKRKMSTVCSSVAEDYPSIDLESWKPDLNGDRSQDKAP  124

Query  397  -LSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVS  221
               L+CP S   IS + FASFG P G+CGS+S G C    + SVV+KAC+    C++ ++
Sbjct  125  RAHLKCPDSTH-ISAVNFASFGNPVGSCGSYSLGDCHDPLSKSVVEKACLNKNECAIELT  183

Query  220  STTFG-NPCAGVTKSLAVEASC  158
               F  N C G T+ LAVEA C
Sbjct  184  EGNFSKNLCPGSTRKLAVEAVC  205



>gb|AEE01408.1| beta-galactosidase STBG2 [Solanum lycopersicum]
Length=892

 Score =   213 bits (542),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 146/225 (65%), Gaps = 7/225 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L  S   GKG AWVNG  +GRYW T  A N GC  +C+YRG Y+S
Sbjct  660  YKTKFDAPGGTDPVALDFS-SMGKGQAWVNGHHVGRYW-TLVAPNNGCGRTCDYRGAYHS  717

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCG+ +Q +YH+PRSWLK+  NVLV+FEE+   P  +S +TR   ++C++VSE H
Sbjct  718  DKCRTNCGEITQAWYHIPRSWLKTLNNVLVIFEEIDKTPFDISISTRSTETICAQVSEKH  777

Query  457  PMPVDMWTSDLSGQK----QEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCR  290
              P+  W+     +K     +   + L+C      IS+I+FAS+G+P G+C  FS GKC 
Sbjct  778  YPPLHKWSHSEFDRKLSLMDKTPEMHLQCD-EGHTISSIEFASYGSPNGSCQKFSQGKCH  836

Query  289  STNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            + N+LSVV +ACIG  +CS+G+S+  FG+PC  V KSLAV+A C+
Sbjct  837  AANSLSVVSQACIGRTSCSIGISNGVFGDPCRHVVKSLAVQAKCS  881



>gb|ABK22678.1| unknown [Picea sitchensis]
Length=317

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 146/227 (64%), Gaps = 10/227 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA  D P    P +L +S   GKG AW+NG+ IGRYW ++ A  G C+  C+YRG Y+ 
Sbjct  95   YKAVIDVPDGDEPVILDLS-SMGKGQAWINGEHIGRYWISFLAPLGDCS-KCDYRGNYSL  152

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC  NCG+PSQT YHVPRSWL+ +GN+LV+FEE GGDP+K+S  TR + S+C+   E+H
Sbjct  153  HKCATNCGQPSQTLYHVPRSWLRPTGNLLVLFEETGGDPSKVSLLTRSIDSVCAHAFETH  212

Query  457  PMPVDMW-----TSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKC  293
            P  +  W      S++  +  E  +L L+C +  + IS+IKFASFG P+G CG+F  G C
Sbjct  213  PPSIQSWQKTKVNSEVLRENVE-PSLQLDCSVGRR-ISSIKFASFGNPKGVCGNFMKGTC  270

Query  292  RSTNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASCA  155
             S  +   V+KAC+G   CS+  S   F G+ C G  KSLAVEA+C+
Sbjct  271  HSVESEKAVEKACLGQHGCSITNSPKEFGGDACVGTVKSLAVEATCS  317



>ref|XP_009611323.1| PREDICTED: beta-galactosidase 9 [Nicotiana tomentosiformis]
Length=891

 Score =   213 bits (542),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 148/225 (66%), Gaps = 7/225 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            Y+  FDAP    P  L  S   GKG AWVNG  IGRYW T  A   GC  +C+YRG YNS
Sbjct  659  YRTKFDAPGGTDPVALDFS-SLGKGQAWVNGNHIGRYW-TLVAPKNGCGKTCDYRGAYNS  716

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCG+ +Q +YH+PRSWLK+S NVLV+FEE    P ++S +TR   ++C++VSE H
Sbjct  717  DKCRTNCGELTQAWYHIPRSWLKTSNNVLVIFEETDKTPFEISISTRATETICAQVSEKH  776

Query  457  PMPVDMWT-SDLSGQ---KQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCR  290
              P+ MW+ S+  G+     +   + L+C      IS+I+FAS+G P+G+C  FS GKC 
Sbjct  777  YPPLHMWSHSEFDGKLSLMDKTPEMHLQCD-KGHTISSIEFASYGNPKGSCQKFSQGKCH  835

Query  289  STNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            + N+LSVV +AC G  +C++G+S+  FG+PC  V K+LAV+A C+
Sbjct  836  AANSLSVVSQACKGKNSCTIGISNAVFGDPCRHVVKNLAVQAKCS  880



>ref|XP_006347104.1| PREDICTED: beta-galactosidase 6-like [Solanum tuberosum]
Length=842

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 144/221 (65%), Gaps = 4/221 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK +F  P    P  L +S   GKG AWVNG+ IGRYW +Y + + GC+D+C+YRG Y+S
Sbjct  625  YKTSFSPPEGRGPVSLNLS-SMGKGQAWVNGEHIGRYWSSYRSPSTGCSDNCDYRGAYDS  683

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+ CG+P+Q  YHVPRSWLK   N+LV+ EE+GGDP+K+SF+TR    +C+ VSES 
Sbjct  684  WKCLKKCGQPAQVLYHVPRSWLKPGKNLLVLHEELGGDPSKISFSTRSGQKICAHVSESD  743

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W  +     QE  +L L C      I+ + FASFGTP G CG+F  G C   + 
Sbjct  744  PPPVDTWKPNKDLTSQE-PSLQLNCD-QGWTIAAVNFASFGTPTGDCGAFIKGSCH-LDV  800

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+V + C+G   CS+ ++    G+PC GV KSLAVEA C+
Sbjct  801  LSIVHQGCVGKSGCSIPITMAKLGDPCPGVPKSLAVEAFCS  841



>ref|XP_012091518.1| PREDICTED: beta-galactosidase 8-like [Jatropha curcas]
 gb|KDP20900.1| hypothetical protein JCGZ_21371 [Jatropha curcas]
Length=843

 Score =   212 bits (540),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 135/199 (68%), Gaps = 3/199 (2%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG AWVNG SIGRYWP Y + + GCT++C+YRG Y+  KCL+ CG+P+QT YH+PR+W+
Sbjct  647  GKGQAWVNGHSIGRYWPAYLSPSTGCTENCDYRGTYDPSKCLKKCGQPAQTLYHIPRTWI  706

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAALS  392
            +   N+LV+ EE+GGDP+K+S  TR    +CS VSE  P P + W   L  + Q    + 
Sbjct  707  QPGENLLVLHEELGGDPSKISVLTRTGQEICSIVSEDDPPPAESWKPSLDFKSQ-SPEIR  765

Query  391  LECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSSTT  212
            L C      I+TI FASFGTP G CGSF+ G C + + LS+V+KACIG   CS+ +S+  
Sbjct  766  LTCE-QGWRITTINFASFGTPAGYCGSFNLGNCHA-DMLSIVQKACIGRERCSISISAAN  823

Query  211  FGNPCAGVTKSLAVEASCA  155
             G+PC GV K LAVEA C+
Sbjct  824  LGDPCPGVLKRLAVEAFCS  842



>gb|KGN64739.1| hypothetical protein Csa_1G085360 [Cucumis sativus]
Length=738

 Score =   211 bits (538),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 133/167 (80%), Gaps = 8/167 (5%)
 Frame = -1

Query  658  YRGPYNSDKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLC  479
            Y+G  N ++ L +C       YHVP+SWLK +GN LV+FEE+G DPT+L+FA++++GSLC
Sbjct  579  YKG-INLERVLISC------LYHVPQSWLKPTGNTLVLFEEIGSDPTRLTFASKQLGSLC  631

Query  478  SRVSESHPMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHG  299
            S VSESHP PV+MW+SD S Q++ G  LSLECP  +QVIS+IKFASFGTP+GTCGSFSHG
Sbjct  632  SHVSESHPPPVEMWSSD-SKQQKTGPVLSLECPSPSQVISSIKFASFGTPRGTCGSFSHG  690

Query  298  KCRSTNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            +C + NALS+V+KACIG ++CS+ VS   FG+PC G TKSLAVEA C
Sbjct  691  QCSTRNALSIVQKACIGSKSCSIDVSIKAFGDPCRGKTKSLAVEAYC  737



>ref|XP_008222836.1| PREDICTED: beta-galactosidase 9 [Prunus mume]
Length=895

 Score =   212 bits (539),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 117/239 (49%), Positives = 152/239 (64%), Gaps = 13/239 (5%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FD P    P  L +    GKG AWVNG  IGRYW T  A   GC + C+YRG YNS
Sbjct  662  YKTYFDNPAGTDPVALDLG-SMGKGQAWVNGHHIGRYW-TLVAPKDGCQEICDYRGAYNS  719

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC  NCGKP+QT+YH+PRSWL++S N+LV+ EE GG+P ++S   R    +C++VSESH
Sbjct  720  NKCSTNCGKPTQTWYHIPRSWLQASSNLLVILEETGGNPFEISIKLRATRVICAQVSESH  779

Query  457  PMPVDMWTS-DLSGQKQEGAALSLECPLSNQ---VISTIKFASFGTPQGTCGSFSHGKCR  290
              PV  W   D    K     L  E  L  Q   +I++I+FAS+GTPQG+C SF+ G C 
Sbjct  780  YPPVQKWFDPDFIDGKIAVNDLRPEMHLQCQDGMMITSIEFASYGTPQGSCQSFARGNCH  839

Query  289  STNALSVVKKACIGLRNCSLGVSSTTFG-NPCAGVTKSLAVEASCA*GTLCRYL*NAKF  116
            + N+LS+V + C+G  +CS+G+S+  FG +PC GVTK+LAVEA       CR L NA F
Sbjct  840  AANSLSIVSEGCLGKNSCSIGISNLIFGSDPCRGVTKTLAVEAR------CRSLPNAGF  892



>ref|XP_009789912.1| PREDICTED: beta-galactosidase 6-like isoform X2 [Nicotiana sylvestris]
Length=818

 Score =   211 bits (537),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 143/221 (65%), Gaps = 4/221 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA F  P    P  L +S   GKG AWVNGQ +GRYW +Y + + GC+DSC+YRG YNS
Sbjct  601  YKARFSPPEGKGPVSLNLS-SMGKGQAWVNGQHVGRYWSSYRSPSTGCSDSCDYRGAYNS  659

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+ CG+P+Q  YHVPRSWL    N+LV+ EE+GGDP+K+SF+TR    +C  VSES 
Sbjct  660  WKCLKKCGQPAQVLYHVPRSWLTPGKNLLVLHEELGGDPSKISFSTRSGQKICGHVSESD  719

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
              PVD W  +     QE  AL L C      I+ + FASFGTP+G CG+F  G C   + 
Sbjct  720  TPPVDNWKPNKDLASQE-PALRLSCE-KGWNITAVNFASFGTPKGDCGAFIRGSCH-LDV  776

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+V + C+    CS+ +++  FG+PC G+ KSLAVEA C+
Sbjct  777  LSIVHQVCVDKPGCSIPITTAKFGDPCPGIVKSLAVEAFCS  817



>ref|XP_009789911.1| PREDICTED: beta-galactosidase 6-like isoform X1 [Nicotiana sylvestris]
Length=846

 Score =   211 bits (538),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 143/221 (65%), Gaps = 4/221 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA F  P    P  L +S   GKG AWVNGQ +GRYW +Y + + GC+DSC+YRG YNS
Sbjct  629  YKARFSPPEGKGPVSLNLS-SMGKGQAWVNGQHVGRYWSSYRSPSTGCSDSCDYRGAYNS  687

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+ CG+P+Q  YHVPRSWL    N+LV+ EE+GGDP+K+SF+TR    +C  VSES 
Sbjct  688  WKCLKKCGQPAQVLYHVPRSWLTPGKNLLVLHEELGGDPSKISFSTRSGQKICGHVSESD  747

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
              PVD W  +     QE  AL L C      I+ + FASFGTP+G CG+F  G C   + 
Sbjct  748  TPPVDNWKPNKDLASQE-PALRLSCE-KGWNITAVNFASFGTPKGDCGAFIRGSCH-LDV  804

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+V + C+    CS+ +++  FG+PC G+ KSLAVEA C+
Sbjct  805  LSIVHQVCVDKPGCSIPITTAKFGDPCPGIVKSLAVEAFCS  845



>ref|NP_001234298.2| beta-galactosidase [Solanum lycopersicum]
 ref|XP_010326738.1| PREDICTED: beta-galactosidase isoform X1 [Solanum lycopersicum]
Length=892

 Score =   211 bits (538),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 145/225 (64%), Gaps = 7/225 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L  S   GKG AWVNG  +GRYW T  A N GC  +C+YRG Y+S
Sbjct  660  YKTKFDAPGGTDPVALDFS-SMGKGQAWVNGHHVGRYW-TLVAPNNGCGRTCDYRGAYHS  717

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCG+ +Q +YH+PRSWLK+  NVLV+FEE    P  +S +TR   ++C++VSE H
Sbjct  718  DKCRTNCGEITQAWYHIPRSWLKTLNNVLVIFEETDKTPFDISISTRSTETICAQVSEKH  777

Query  457  PMPVDMWTSDLSGQK----QEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCR  290
              P+  W+     +K     +   + L+C      IS+I+FAS+G+P G+C  FS GKC 
Sbjct  778  YPPLHKWSHSEFDRKLSLMDKTPEMHLQCD-EGHTISSIEFASYGSPNGSCQKFSQGKCH  836

Query  289  STNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            + N+LSVV +ACIG  +CS+G+S+  FG+PC  V KSLAV+A C+
Sbjct  837  AANSLSVVSQACIGRTSCSIGISNGVFGDPCRHVVKSLAVQAKCS  881



>ref|XP_002976692.1| hypothetical protein SELMODRAFT_268001 [Selaginella moellendorffii]
 gb|EFJ22361.1| hypothetical protein SELMODRAFT_268001 [Selaginella moellendorffii]
Length=802

 Score =   211 bits (537),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 110/222 (50%), Positives = 139/222 (63%), Gaps = 21/222 (9%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            Y   FDAP    P  L ++   GKG AWVNGQSIGRYWP Y A++  C +SC+YRG Y+ 
Sbjct  600  YMTEFDAPPGDDPVALDLA-SMGKGQAWVNGQSIGRYWPAYKAADSVCPESCDYRGSYDQ  658

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL  CG+ SQ +YHVPRSW+K  GN+LV+FEE GGDP+ + F TR    +C+RV ESH
Sbjct  659  NKCLTGCGQSSQRWYHVPRSWMKPRGNLLVLFEETGGDPSSIDFVTRSTNVICARVYESH  718

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P  V +W                 CP   QVIS I+FAS G P+G+CGSF  G C + + 
Sbjct  719  PASVKLW-----------------CPGEKQVISQIRFASLGNPEGSCGSFKEGSCHTNDL  761

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGV-TKSLAVEASCA  155
             + V+KAC+G R+CSL    TT  + C GV  K LAVEA C+
Sbjct  762  SNTVEKACVGQRSCSLAPDFTT--SACPGVREKFLAVEALCS  801



>gb|AAF70821.1|AF154420_1 beta-galactosidase [Solanum lycopersicum]
Length=892

 Score =   211 bits (538),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 145/225 (64%), Gaps = 7/225 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L  S   GKG AWVNG  +GRYW T  A N GC  +C+YRG Y+S
Sbjct  660  YKTKFDAPGGTDPVALDFS-SMGKGQAWVNGHHVGRYW-TLVAPNNGCGRTCDYRGAYHS  717

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCG+ +Q +YH+PRSWLK+  NVLV+FEE    P  +S +TR   ++C++VSE H
Sbjct  718  DKCRTNCGEITQAWYHIPRSWLKTLNNVLVIFEETDKTPFDISISTRSTETICAQVSEKH  777

Query  457  PMPVDMWTSDLSGQK----QEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCR  290
              P+  W+     +K     +   + L+C      IS+I+FAS+G+P G+C  FS GKC 
Sbjct  778  YPPLHKWSHSEFDRKLSLMDKTPEMHLQCD-EGHTISSIEFASYGSPNGSCQKFSQGKCH  836

Query  289  STNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            + N+LSVV +ACIG  +CS+G+S+  FG+PC  V KSLAV+A C+
Sbjct  837  AANSLSVVSQACIGRTSCSIGISNGVFGDPCRHVVKSLAVQAKCS  881



>ref|XP_007227352.1| hypothetical protein PRUPE_ppa001149mg [Prunus persica]
 gb|EMJ28551.1| hypothetical protein PRUPE_ppa001149mg [Prunus persica]
Length=895

 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/239 (49%), Positives = 151/239 (63%), Gaps = 13/239 (5%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FD P    P  L +    GKG AWVNG  IGRYW T  A   GC + C+YRG YNS
Sbjct  662  YKTYFDNPAGTDPVALDLG-SMGKGQAWVNGHHIGRYW-TLVAPKDGCQEICDYRGAYNS  719

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC  NCGKP+QT+YH+PRSWL++S N+LV+ EE GG+P ++S   R    +C++VSESH
Sbjct  720  NKCSTNCGKPTQTWYHIPRSWLQASSNLLVILEETGGNPFEISIKLRATRVICAQVSESH  779

Query  457  PMPVDMWTS-DLSGQKQEGAALSLECPLSNQ---VISTIKFASFGTPQGTCGSFSHGKCR  290
              PV  W   D    K     L  E  L  Q   +I++I+FAS+GTPQG+C SF+ G C 
Sbjct  780  YPPVQKWFDPDFIDGKIAVNDLRPEMHLQCQDGMMITSIEFASYGTPQGSCQSFARGNCH  839

Query  289  STNALSVVKKACIGLRNCSLGVSSTTFG-NPCAGVTKSLAVEASCA*GTLCRYL*NAKF  116
            + N+LS+V + C+G  +CS+G+S+  FG +PC GV K+LAVEA       CR L NA F
Sbjct  840  AANSLSIVSEGCLGKNSCSIGISNLIFGSDPCRGVIKTLAVEAR------CRSLPNAGF  892



>gb|KJB72045.1| hypothetical protein B456_011G155500 [Gossypium raimondii]
Length=706

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 143/205 (70%), Gaps = 8/205 (4%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG AWVNG  IGRYW   TA   GC DSC+YRG Y S+KC+ NCGKP+QT+YHVPRSWL
Sbjct  494  GKGQAWVNGHHIGRYW-NLTAPKDGCPDSCDYRGAYGSNKCMTNCGKPTQTWYHVPRSWL  552

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTS-DLSGQK----QE  407
            ++S N+LV+FEE+GG+P ++S   R    LC+++SES+  P+  W   DL   K      
Sbjct  553  QASNNLLVIFEEIGGNPFEISVKLRVPRILCAQMSESYYPPLREWLHLDLIDGKVSISDM  612

Query  406  GAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLG  227
               + L+C     +IS+I+FAS+GTP G+C +FS+G C S N+LSV+ +AC+G  +CS+ 
Sbjct  613  KPQIHLQCE-DGHIISSIEFASYGTPHGSCQNFSNGNCHSPNSLSVISEACVGRNSCSVE  671

Query  226  VSSTTFG-NPCAGVTKSLAVEASCA  155
            VS++ FG +PC GV K+LAVEA C 
Sbjct  672  VSNSGFGSDPCRGVLKTLAVEARCV  696



>ref|XP_008794977.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 15-like [Phoenix 
dactylifera]
Length=764

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 144/226 (64%), Gaps = 8/226 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L +    GKG AWVNG SIGRYW +  A   GC+ SCNYRG YN 
Sbjct  530  YKNTFDAPEGDDPVALDLG-SMGKGQAWVNGHSIGRYW-SLIAPETGCSKSCNYRGAYNE  587

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC  NCG P+Q++YH+PR+WL+ S N+LV+FEE GG+P  +S +     ++C +VSE+H
Sbjct  588  KKCTTNCGLPTQSWYHIPRAWLQPSNNLLVIFEETGGNPLNISLSVHSTKTICGKVSETH  647

Query  457  PMPVDMWTS-DLSGQK----QEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKC  293
              P+  W   D    K    +    + L+C     +IS +KFAS+GTP G+C ++S GKC
Sbjct  648  YPPLSTWYHPDFINGKISINEVAPQMHLQCD-DGHMISAVKFASYGTPHGSCQNYSLGKC  706

Query  292  RSTNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
             ++ +LS+V KAC G  NC++ VS+T FG+PC    K+LAVEA CA
Sbjct  707  HASTSLSLVMKACQGKNNCTINVSNTIFGDPCRRTVKTLAVEAECA  752



>gb|EMT22873.1| Beta-galactosidase 3 [Aegilops tauschii]
Length=877

 Score =   210 bits (534),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 145/224 (65%), Gaps = 5/224 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK N D P    P  L + +  GKG+AW+NG +IGRYW   ++S+  CT SCNYRG ++ 
Sbjct  656  YKVNVDVPQGDDPIGLDM-QSMGKGLAWLNGNAIGRYWLRTSSSDDRCTPSCNYRGQFSP  714

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            D C   CGKP+Q +YHVPRSW   SGN LVVFEE GGDPTK++F+ R   S+CS VSES+
Sbjct  715  DNCRTGCGKPTQRWYHVPRSWFHPSGNTLVVFEEQGGDPTKITFSRRVATSVCSFVSESY  774

Query  457  PMPVDM--WTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRST  284
            P  VD+  W  ++S   +  +   L CP   ++IS++ FASFG P GTC S+  G C   
Sbjct  775  PFIVDLESWDKNMSDDGRVASEAQLSCP-EGKIISSVNFASFGDPSGTCRSYQQGSCHHP  833

Query  283  NALSVVKKACIGLRNCSLGVSSTTFG-NPCAGVTKSLAVEASCA  155
            ++LSVVKKAC+    C++ ++   FG + C GV K+LA+E  C+
Sbjct  834  DSLSVVKKACLNNNGCTVSLADKGFGKDLCPGVIKTLAIEVDCS  877



>ref|XP_010030277.1| PREDICTED: beta-galactosidase 3-like [Eucalyptus grandis]
Length=291

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 134/202 (66%), Gaps = 5/202 (2%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG+AW+NGQ IG YWP   +    C   C+YRG +  DKC+  CG+PSQ +YHVPRSW 
Sbjct  90   GKGLAWLNGQPIGIYWPRLVSFENPCVKGCDYRGTFKPDKCVTGCGEPSQRWYHVPRSWF  149

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHP-MPVDMWTSDLSGQKQEGAA-  398
            K SGN+LV+ EEVGGDPTK++F+ R++ ++CS V+E +P + ++ W  DL+G + +  A 
Sbjct  150  KPSGNILVILEEVGGDPTKVAFSKRKMSTVCSSVAEDYPSIDLESWKPDLNGDRSQDKAP  209

Query  397  -LSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVS  221
               L+CP S   IS + FASFG P G+CGS+S G C    + SVV+KAC+    C++ ++
Sbjct  210  RAHLKCPDSTH-ISAVNFASFGNPVGSCGSYSLGDCHDPLSKSVVEKACLNKNECAIELT  268

Query  220  STTFG-NPCAGVTKSLAVEASC  158
               F  N C G T+ LAVEA C
Sbjct  269  EGNFSKNLCPGSTRKLAVEAVC  290



>gb|EEE53128.1| hypothetical protein OsJ_35926 [Oryza sativa Japonica Group]
Length=314

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 130/202 (64%), Gaps = 5/202 (2%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG AWVNG  IGRYW +  A   GC+ SC Y G YN  KC  NCG P+Q +YH+PR WL
Sbjct  103  GKGQAWVNGHLIGRYW-SLVAPESGCSSSCYYPGAYNERKCQSNCGMPTQNWYHIPREWL  161

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAA--  398
            K S N+LV+FEE GGDP+ +S       ++CSR+SE++  P+  W+   SG+    AA  
Sbjct  162  KESDNLLVLFEETGGDPSLISLEAHYAKTVCSRISENYYPPLSAWSHLSSGRASVNAATP  221

Query  397  -LSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVS  221
             L L+C     VIS I FAS+GTP G C +FS G C +++ L +V +AC+G   C++ VS
Sbjct  222  ELRLQCD-DGHVISEITFASYGTPSGGCLNFSKGNCHASSTLDLVTEACVGNTKCAISVS  280

Query  220  STTFGNPCAGVTKSLAVEASCA  155
            +  FG+PC GV K LAVEA C+
Sbjct  281  NDVFGDPCRGVLKDLAVEAKCS  302



>gb|EAY82933.1| hypothetical protein OsI_38150 [Oryza sativa Indica Group]
Length=314

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 130/202 (64%), Gaps = 5/202 (2%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG AWVNG  IGRYW +  A   GC+ SC Y G YN  KC  NCG P+Q +YH+PR WL
Sbjct  103  GKGQAWVNGHLIGRYW-SLVAPESGCSSSCYYPGAYNERKCQSNCGMPTQNWYHIPREWL  161

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAA--  398
            K S N+LV+FEE GGDP+ +S       ++CSR+SE++  P+  W+   SG+    AA  
Sbjct  162  KESDNLLVLFEETGGDPSLISLEAHYAKAVCSRISENYYPPLSAWSHLSSGRASVNAATP  221

Query  397  -LSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVS  221
             L L+C     VIS I FAS+GTP G C +FS G C +++ L +V +AC+G   C++ VS
Sbjct  222  ELRLQCD-DGHVISEITFASYGTPSGGCLNFSKGNCHASSTLDLVTEACVGNTKCAISVS  280

Query  220  STTFGNPCAGVTKSLAVEASCA  155
            +  FG+PC GV K LAVEA C+
Sbjct  281  NDVFGDPCRGVLKDLAVEAKCS  302



>gb|KJB72044.1| hypothetical protein B456_011G155500 [Gossypium raimondii]
Length=853

 Score =   209 bits (533),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 143/205 (70%), Gaps = 8/205 (4%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG AWVNG  IGRYW   TA   GC DSC+YRG Y S+KC+ NCGKP+QT+YHVPRSWL
Sbjct  641  GKGQAWVNGHHIGRYW-NLTAPKDGCPDSCDYRGAYGSNKCMTNCGKPTQTWYHVPRSWL  699

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTS-DLSGQK----QE  407
            ++S N+LV+FEE+GG+P ++S   R    LC+++SES+  P+  W   DL   K      
Sbjct  700  QASNNLLVIFEEIGGNPFEISVKLRVPRILCAQMSESYYPPLREWLHLDLIDGKVSISDM  759

Query  406  GAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLG  227
               + L+C     +IS+I+FAS+GTP G+C +FS+G C S N+LSV+ +AC+G  +CS+ 
Sbjct  760  KPQIHLQCE-DGHIISSIEFASYGTPHGSCQNFSNGNCHSPNSLSVISEACVGRNSCSVE  818

Query  226  VSSTTFG-NPCAGVTKSLAVEASCA  155
            VS++ FG +PC GV K+LAVEA C 
Sbjct  819  VSNSGFGSDPCRGVLKTLAVEARCV  843



>ref|XP_002973160.1| hypothetical protein SELMODRAFT_413650 [Selaginella moellendorffii]
 gb|EFJ25534.1| hypothetical protein SELMODRAFT_413650 [Selaginella moellendorffii]
Length=805

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 138/222 (62%), Gaps = 21/222 (9%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            Y   FDAP    P  L ++   GKG AWVNGQSIGRYWP Y A++  C +SC+YRG Y+ 
Sbjct  603  YMTEFDAPPGDDPVALDLASM-GKGQAWVNGQSIGRYWPAYKAADSVCPESCDYRGSYDQ  661

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL  CG+ SQ +YHVPRSW+K  GN+LV+FEE GGDP+ + F TR    +C+RV ESH
Sbjct  662  NKCLTGCGQSSQRWYHVPRSWMKPRGNLLVLFEETGGDPSSIDFVTRSTNVICARVYESH  721

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P  V +W                 CP   QVIS I+FAS G P+G+CGSF  G C + + 
Sbjct  722  PASVKLW-----------------CPGEKQVISQIRFASLGNPEGSCGSFKEGSCHTNDL  764

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGV-TKSLAVEASCA  155
             + V+KAC+G R+CSL    T   + C GV  K LAVEA C+
Sbjct  765  SNTVEKACVGQRSCSLAPDFTI--SACPGVREKFLAVEALCS  804



>gb|KJB72043.1| hypothetical protein B456_011G155500 [Gossypium raimondii]
Length=890

 Score =   209 bits (533),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 143/205 (70%), Gaps = 8/205 (4%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG AWVNG  IGRYW   TA   GC DSC+YRG Y S+KC+ NCGKP+QT+YHVPRSWL
Sbjct  678  GKGQAWVNGHHIGRYW-NLTAPKDGCPDSCDYRGAYGSNKCMTNCGKPTQTWYHVPRSWL  736

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTS-DLSGQK----QE  407
            ++S N+LV+FEE+GG+P ++S   R    LC+++SES+  P+  W   DL   K      
Sbjct  737  QASNNLLVIFEEIGGNPFEISVKLRVPRILCAQMSESYYPPLREWLHLDLIDGKVSISDM  796

Query  406  GAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLG  227
               + L+C     +IS+I+FAS+GTP G+C +FS+G C S N+LSV+ +AC+G  +CS+ 
Sbjct  797  KPQIHLQCE-DGHIISSIEFASYGTPHGSCQNFSNGNCHSPNSLSVISEACVGRNSCSVE  855

Query  226  VSSTTFG-NPCAGVTKSLAVEASCA  155
            VS++ FG +PC GV K+LAVEA C 
Sbjct  856  VSNSGFGSDPCRGVLKTLAVEARCV  880



>ref|NP_001151478.1| LOC100285111 precursor [Zea mays]
 gb|ACG42995.1| beta-galactosidase precursor [Zea mays]
Length=844

 Score =   209 bits (533),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 146/223 (65%), Gaps = 4/223 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK N D P    P  + + +  GKG+AW+NG +IGRYWP  ++ N  CT SCNYRG +  
Sbjct  624  YKVNVDVPQGDDPVGIDM-QSMGKGLAWLNGNAIGRYWPRTSSINDRCTPSCNYRGTFIP  682

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC   CG+P+Q +YH+PRSW   SGN+LVVFEE GGDPTK++F+ R V S+CS VSE  
Sbjct  683  DKCRTGCGQPTQRWYHIPRSWFHPSGNILVVFEEKGGDPTKITFSRRAVTSVCSFVSEHF  742

Query  457  P-MPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            P + ++ W      +    A   L CP   + IS++KFAS G P GTC S+  G+C   N
Sbjct  743  PSIDLESWDESAMNEGTPPAKAQLSCP-EGKSISSVKFASLGNPSGTCRSYQMGRCHHPN  801

Query  280  ALSVVKKACIGLRNCSLGVSSTTFG-NPCAGVTKSLAVEASCA  155
            +LSVV+KAC+   +C++ ++  +FG + C GVTK+LA+EA C+
Sbjct  802  SLSVVEKACLNTNSCTVSLTDESFGKDLCHGVTKTLAIEADCS  844



>gb|AAK62590.1| At2g32810/F24L7.5 [Arabidopsis thaliana]
 gb|AAN72290.1| At2g32810/F24L7.5 [Arabidopsis thaliana]
Length=585

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 147/226 (65%), Gaps = 7/226 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FD P    P +L +    G+G AWVNGQ IGRYW   +  +G C  +C+YRG YNS
Sbjct  352  YKTYFDPPAGTDPVVLNL-ESMGRGQAWVNGQHIGRYWNIISQKDG-CDRTCDYRGAYNS  409

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCGKP+QT YHVPRSWLK S N+LV+FEE GG+P K+S  T   G LC +VSESH
Sbjct  410  DKCTTNCGKPTQTRYHVPRSWLKPSSNLLVLFEETGGNPFKISVKTVTAGILCGQVSESH  469

Query  457  PMPVDMW-TSDLSGQKQEGAALSLECPL---SNQVISTIKFASFGTPQGTCGSFSHGKCR  290
              P+  W T D         +++ E  L      VIS+I+FAS+GTP+G+C  FS GKC 
Sbjct  470  YPPLRKWSTPDYINGTMSINSVAPEVHLHCEDGHVISSIEFASYGTPRGSCDGFSIGKCH  529

Query  289  STNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASCA  155
            ++N+LS+V +AC G  +C + VS+T F  +PC+G  K+LAV + C+
Sbjct  530  ASNSLSIVSEACKGRNSCFIEVSNTAFISDPCSGTLKTLAVMSRCS  575



>ref|XP_006645099.1| PREDICTED: beta-galactosidase 3-like [Oryza brachyantha]
Length=836

 Score =   209 bits (532),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 147/223 (66%), Gaps = 4/223 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK N D P    P  L + +  GKG+AW+NG +IGRYW   +  + GCT SCNYRG ++ 
Sbjct  616  YKVNVDVPQGDDPVGLDM-QSMGKGLAWLNGNAIGRYWLRTSPVSDGCTSSCNYRGTFSP  674

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC   CG+P+Q +YHVP+SW + SGN LV+FEE GGDPT ++F+ R V S+CS VSE +
Sbjct  675  NKCRTGCGQPTQRWYHVPQSWFRPSGNTLVIFEEKGGDPTNITFSRRTVASVCSFVSEHY  734

Query  457  P-MPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            P + ++ W        ++ A + L CP   + IS++KFASFG P GTC S+  G C   N
Sbjct  735  PSIDLESWDKSTPNDSRDSAKVQLTCP-KGKNISSVKFASFGNPSGTCRSYQQGSCHHPN  793

Query  280  ALSVVKKACIGLRNCSLGVSSTTFG-NPCAGVTKSLAVEASCA  155
            +LSVV+KAC+ L  C++ +S   FG + C G+TK+LA+EA C+
Sbjct  794  SLSVVEKACLKLNGCTVSLSDKGFGEDLCPGITKTLAIEADCS  836



>gb|ABA97653.1| Galactose binding lectin domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=317

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 130/202 (64%), Gaps = 5/202 (2%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG AWVNG  IGRYW +  A   GC+ SC Y G YN  KC  NCG P+Q +YH+PR WL
Sbjct  103  GKGQAWVNGHLIGRYW-SLVAPESGCSSSCYYPGAYNERKCQSNCGMPTQNWYHIPREWL  161

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAA--  398
            K S N+LV+FEE GGDP+ +S       ++CSR+SE++  P+  W+   SG+    AA  
Sbjct  162  KESDNLLVLFEETGGDPSLISLEAHYAKTVCSRISENYYPPLSAWSHLSSGRASVNAATP  221

Query  397  -LSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVS  221
             L L+C     VIS I FAS+GTP G C +FS G C +++ L +V +AC+G   C++ VS
Sbjct  222  ELRLQCD-DGHVISEITFASYGTPSGGCLNFSKGNCHASSTLDLVTEACVGNTKCAISVS  280

Query  220  STTFGNPCAGVTKSLAVEASCA  155
            +  FG+PC GV K LAVEA C+
Sbjct  281  NDVFGDPCRGVLKDLAVEAKCS  302



>ref|XP_002456725.1| hypothetical protein SORBIDRAFT_03g041450 [Sorghum bicolor]
 gb|EES01845.1| hypothetical protein SORBIDRAFT_03g041450 [Sorghum bicolor]
Length=843

 Score =   209 bits (532),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 147/223 (66%), Gaps = 4/223 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK N D P    P  + + +  GKG+ W+NG +IGRYWP  ++ +  CT SC+YRG +N 
Sbjct  623  YKVNVDVPQGDDPVGIDM-QSMGKGLVWLNGNAIGRYWPRTSSIDDRCTPSCDYRGEFNP  681

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC   CG+P+Q +YH+PRSW   SGN+LV+FEE GGDPTK++F+ R V S+CS VSE  
Sbjct  682  NKCRTGCGQPTQRWYHIPRSWFHPSGNILVIFEEKGGDPTKITFSRRAVTSVCSFVSEHF  741

Query  457  P-MPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            P + ++ W    + +    A   L CP+    IS++KFAS GTP GTC S+  G C   N
Sbjct  742  PSIDLESWDGSATNEGTSPAKAQLSCPIGKN-ISSLKFASLGTPSGTCRSYQKGSCHHPN  800

Query  280  ALSVVKKACIGLRNCSLGVSSTTFG-NPCAGVTKSLAVEASCA  155
            +LSVV+KAC+   +C++ +S  +FG + C GVTK+LA+EA C+
Sbjct  801  SLSVVEKACLNTNSCTVSLSDESFGKDLCPGVTKTLAIEADCS  843



>ref|XP_001753645.1| predicted protein [Physcomitrella patens]
 gb|EDQ81397.1| predicted protein [Physcomitrella patens]
Length=929

 Score =   209 bits (533),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 145/230 (63%), Gaps = 12/230 (5%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L +    GKG AWVNG  +GRYWP+  AS  GC+ +C+YRG Y++
Sbjct  651  YKTTFDAPKGTDPVALDLG-SMGKGQAWVNGHHMGRYWPSVLASQSGCS-TCDYRGAYDA  708

Query  637  DKCLRNCGKPSQTY-----YHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSR  473
            DKC  NCGKPSQ +     YH+PR+WL+ S N+LV+FEE+GGD +K+S  TR   ++C+ 
Sbjct  709  DKCRTNCGKPSQRWQYVDMYHIPRAWLQLSNNLLVLFEEIGGDVSKVSLVTRSAPAVCTH  768

Query  472  VSESHPMPVDMW--TSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHG  299
            V ES P PV  W   S +           LEC ++ Q I  IKFASFG P+G+CG+F  G
Sbjct  769  VHESQPPPVLFWPANSSMDAMSSRSGEAVLEC-IAGQHIRHIKFASFGNPKGSCGNFQRG  827

Query  298  KCRSTNALSVVKKACIGLRNCSLGVSSTTFG--NPCAGVTKSLAVEASCA  155
             C +  +L V +KAC+G+  CS+ V   TFG  +PC  V+KSLAV+  C+
Sbjct  828  TCHAMKSLEVARKACMGMHRCSIPVQWQTFGEFDPCPDVSKSLAVQVFCS  877



>ref|XP_010674348.1| PREDICTED: beta-galactosidase 10 [Beta vulgaris subsp. vulgaris]
Length=851

 Score =   209 bits (531),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 131/201 (65%), Gaps = 3/201 (1%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG+AW+NG+ IGRYWP  ++ +  C D C+YRG ++ +KC   CG+P+Q +YHVPRSW 
Sbjct  652  GKGLAWLNGEEIGRYWPRKSSKHDACVDHCDYRGKFSPNKCSTGCGEPTQRWYHVPRSWF  711

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHP-MPVDMWTSDLSGQKQEGAAL  395
            KSSGN LV+FEE GGDPT++ F+ R+   +CS +SE HP + V+ WT+       + A  
Sbjct  712  KSSGNELVIFEETGGDPTQIRFSKRKTSGVCSLMSEDHPSISVESWTTATKDTNDKKATA  771

Query  394  SLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSST  215
             L CP SN  +S IKFASFG P G CGS+SHG C    + SVV+K C+    CS+ +S  
Sbjct  772  QLRCP-SNTRVSAIKFASFGNPMGACGSYSHGDCHDPESASVVEKMCLNRSECSIELSKE  830

Query  214  TFG-NPCAGVTKSLAVEASCA  155
             F    C G  K LAVEA C+
Sbjct  831  NFNFGSCPGKIKRLAVEAVCS  851



>dbj|BAF31232.1| beta-D-galactosidase [Persea americana]
Length=889

 Score =   208 bits (530),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 147/226 (65%), Gaps = 10/226 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L +    GKG AWVNG SIGRYW +  A   GC  SC+YRG Y+ 
Sbjct  657  YKTFFDAPQGKDPVSLYLG-SMGKGQAWVNGHSIGRYW-SLVAPVDGC-QSCDYRGAYHE  713

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC  NCGKP+Q++YH+PRSWL+ S N+LV+FEE GG+P ++S       S+C++VSESH
Sbjct  714  SKCATNCGKPTQSWYHIPRSWLQPSKNLLVIFEETGGNPLEISVKLHSTSSICTKVSESH  773

Query  457  PMPVDMWT-SDLSGQK----QEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKC  293
              P+ +W+  D+   K         + L+C  + Q IS+I FASFGTPQG+C  FS G C
Sbjct  774  YPPLHLWSHKDIVNGKVSISNAVPEIHLQCD-NGQRISSIMFASFGTPQGSCQRFSQGDC  832

Query  292  RSTNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASC  158
             + N+ SVV +AC G  NCS+GVS+  F G+PC GV K+LAVEA C
Sbjct  833  HAPNSFSVVSEACQGRNNCSIGVSNKVFGGDPCRGVVKTLAVEAKC  878



>ref|XP_002317239.1| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE97851.1| beta-galactosidase family protein [Populus trichocarpa]
Length=849

 Score =   208 bits (529),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 105/221 (48%), Positives = 141/221 (64%), Gaps = 4/221 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA   AP    P  L ++   GKG AW+NGQSIGRYW  Y + + GCTD+C+YRG YNS
Sbjct  632  YKATIIAPEGNGPLALNLA-SMGKGQAWINGQSIGRYWSAYLSPSAGCTDNCDYRGAYNS  690

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC + CG+P+QT YH+PR+W+    N+LV+ EE+GGDP+++S  TR    +CS VSE  
Sbjct  691  FKCQKKCGQPAQTLYHIPRTWVHPGENLLVLHEELGGDPSQISLLTRTGQDICSIVSEDD  750

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P P D W  +L    Q    + L C      I+ I FASFGTP+G CG+F+ G C + + 
Sbjct  751  PPPADSWKPNLEFMSQS-PEVRLTCEHGWH-IAAINFASFGTPEGKCGTFTPGNCHA-DM  807

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L++V+KACIG   CS+ +S+   G+PC GV K   VEA C+
Sbjct  808  LTIVQKACIGHERCSIPISAAKLGDPCPGVVKRFVVEALCS  848



>tpg|DAA56579.1| TPA: beta-galactosidase isoform 1 [Zea mays]
 tpg|DAA56580.1| TPA: beta-galactosidase isoform 2 [Zea mays]
Length=844

 Score =   208 bits (529),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 146/223 (65%), Gaps = 4/223 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK N D P    P  + + +  GKG+AW+NG +IGRYWP  ++ N  CT SCNYRG +  
Sbjct  624  YKVNVDVPQGDDPVGIDM-QSMGKGLAWLNGNAIGRYWPRTSSINDRCTPSCNYRGTFIP  682

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC   CG+P+Q +YH+PRSW   SGN+LVVFEE GGDPTK++F+ R V S+CS VSE  
Sbjct  683  DKCRTGCGQPTQRWYHIPRSWFHPSGNILVVFEEKGGDPTKITFSRRAVTSVCSFVSEHF  742

Query  457  P-MPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            P + ++ W      +    A   L CP   + IS++KFAS G P GTC S+  G+C   N
Sbjct  743  PSIDLESWDESAMTEGTPPAKAQLFCP-EGKSISSVKFASLGNPSGTCRSYQMGRCHHPN  801

Query  280  ALSVVKKACIGLRNCSLGVSSTTFG-NPCAGVTKSLAVEASCA  155
            +LSVV+KAC+   +C++ ++  +FG + C GVTK+LA+EA C+
Sbjct  802  SLSVVEKACLNTNSCTVSLTDESFGKDLCPGVTKTLAIEADCS  844



>ref|XP_010469543.1| PREDICTED: beta-galactosidase 9 isoform X2 [Camelina sativa]
Length=849

 Score =   207 bits (528),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 150/227 (66%), Gaps = 9/227 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FD P    P +L +    GKG AWVNG  IGRYW   +  +G C  +C+YRG YNS
Sbjct  616  YKTYFDTPDGTDPVVLDL-ESMGKGQAWVNGHHIGRYWNIISQKDG-CEKACDYRGAYNS  673

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCG+P+QT YHVPRSWLK S N+LV+FEE GG+P K+S  T   G LC +VSESH
Sbjct  674  DKCTTNCGQPTQTRYHVPRSWLKPSSNLLVIFEETGGNPFKISVKTVTAGILCGQVSESH  733

Query  457  PMPVDMWTSD--LSGQKQEGAA---LSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKC  293
              P+  W++   ++G    G+    + L C     VIS+I+FAS+GTP+G+C  FS GKC
Sbjct  734  YPPLRKWSTPDYMNGTMSIGSVAPEVHLHCE-DGHVISSIEFASYGTPRGSCHRFSIGKC  792

Query  292  RSTNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASCA  155
             ++N++S+V +AC G  +C + VS+T F  +PC+G+ K+LAV A C+
Sbjct  793  HASNSISIVSEACKGRNSCFIEVSNTAFRSDPCSGILKTLAVMARCS  839



>ref|XP_008383809.1| PREDICTED: beta-galactosidase 8-like [Malus domestica]
Length=850

 Score =   207 bits (528),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 149/225 (66%), Gaps = 10/225 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTD--SCNYRGPY  644
            YK +F AP    P  L ++   GKG AWVNGQS+GRYW  Y + + GC +   C+YRG Y
Sbjct  631  YKVSFLAPEGKGPLALNLA-SMGKGQAWVNGQSVGRYWQAYLSPSTGCVNGSDCDYRGAY  689

Query  643  NSDKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSE  464
            N+ KCLRNCG+P+QT YH+PR+W+ +  N+LV+ EE+GGDP+K+S  T+    +C+ VSE
Sbjct  690  NASKCLRNCGQPAQTLYHIPRTWVHTGDNLLVLHEELGGDPSKISLRTKTGQEICAHVSE  749

Query  463  SHPMPVDMW--TSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCR  290
            + P P   W   S+L  Q  E   + L C      I++I FASFGTP G CG+F+ G C 
Sbjct  750  TDPPPASSWKPNSELISQNPE---VQLTCE-RGWSITSINFASFGTPIGNCGTFASGAC-  804

Query  289  STNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            S + LS+V++AC+G   CS+ +S+ T G+PC GV KSLAVEA C+
Sbjct  805  SADILSIVQQACLGQEGCSIPISAATLGDPCPGVLKSLAVEAICS  849



>ref|XP_010469542.1| PREDICTED: beta-galactosidase 9 isoform X1 [Camelina sativa]
Length=889

 Score =   207 bits (528),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 150/227 (66%), Gaps = 9/227 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FD P    P +L +    GKG AWVNG  IGRYW   +  +G C  +C+YRG YNS
Sbjct  656  YKTYFDTPDGTDPVVLDL-ESMGKGQAWVNGHHIGRYWNIISQKDG-CEKACDYRGAYNS  713

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCG+P+QT YHVPRSWLK S N+LV+FEE GG+P K+S  T   G LC +VSESH
Sbjct  714  DKCTTNCGQPTQTRYHVPRSWLKPSSNLLVIFEETGGNPFKISVKTVTAGILCGQVSESH  773

Query  457  PMPVDMWTSD--LSGQKQEGAA---LSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKC  293
              P+  W++   ++G    G+    + L C     VIS+I+FAS+GTP+G+C  FS GKC
Sbjct  774  YPPLRKWSTPDYMNGTMSIGSVAPEVHLHCE-DGHVISSIEFASYGTPRGSCHRFSIGKC  832

Query  292  RSTNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASCA  155
             ++N++S+V +AC G  +C + VS+T F  +PC+G+ K+LAV A C+
Sbjct  833  HASNSISIVSEACKGRNSCFIEVSNTAFRSDPCSGILKTLAVMARCS  879



>ref|XP_008224970.1| PREDICTED: beta-galactosidase 8-like [Prunus mume]
Length=850

 Score =   207 bits (527),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 148/225 (66%), Gaps = 10/225 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTD--SCNYRGPY  644
            YK  F AP    P +L ++   GKG AWVNGQSIGRYWP Y + + GCT+   C+YRG Y
Sbjct  631  YKVAFLAPEGKGPLVLNLA-SMGKGQAWVNGQSIGRYWPAYLSPSSGCTNGSDCDYRGAY  689

Query  643  NSDKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSE  464
            +  KCL+NCG+P+QT YH+PR+W+    N+LV+ EE+GGDP+K+S  T+    +C+ VSE
Sbjct  690  DPTKCLKNCGQPAQTLYHIPRTWVHIGENLLVLHEELGGDPSKISLRTKTGQEICAHVSE  749

Query  463  SHPMPVDMW--TSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCR  290
            + P P D W   S+   Q  E   + L C      I++I FASFGTP G CG+F+ G C 
Sbjct  750  TDPPPADSWKPNSEFISQNPE---VQLTCE-RGWYITSINFASFGTPIGKCGTFALGACN  805

Query  289  STNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            + + LS+V++AC+G   CS+ +S+ T G+PC GV K LAVEA C+
Sbjct  806  A-DILSIVQQACLGQERCSIPISTATLGDPCPGVLKCLAVEALCS  849



>ref|XP_011043264.1| PREDICTED: beta-galactosidase 6-like isoform X1 [Populus euphratica]
Length=817

 Score =   207 bits (527),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 140/220 (64%), Gaps = 4/220 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA   AP    P  L ++   GKG AW+NGQSIGRYW  Y +   GCTD+C+YRG YNS
Sbjct  600  YKATILAPEGNGPLALNLA-SMGKGQAWINGQSIGRYWSAYLSPLTGCTDNCDYRGAYNS  658

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC + CG+P+QT YH+PR+W+    N+LV+ EE+GGDP+++S  TR    +CS VSE  
Sbjct  659  FKCQKKCGQPAQTLYHIPRTWVHPGENLLVLHEELGGDPSQISLLTRTGQDICSIVSEDD  718

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W  +L    Q    + L C      I+ I FASFGTP+G CG+F+ G C + + 
Sbjct  719  PPPVDSWKPNLEFMSQT-PEVRLTCEHGWH-IAAINFASFGTPEGKCGTFTPGNCHA-DM  775

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            L++V+KACIG   CS+ +S+   G+PC GV K   VEA C
Sbjct  776  LTIVQKACIGHEGCSIPISAAKLGDPCPGVVKRFVVEALC  815



>gb|EMS56907.1| Beta-galactosidase 15 [Triticum urartu]
Length=666

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 141/224 (63%), Gaps = 6/224 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  + +    GKG AWVNG  IGRYW +  A   GC+ SCNY G Y+ 
Sbjct  434  YKTMFDAPKGTDPVAIYLG-SMGKGQAWVNGHLIGRYW-SLVAPESGCSSSCNYPGAYSE  491

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC  NCG P+Q++YH+PR WL+ S N+LV+FEE GGDP+K+S       ++CSR+SES+
Sbjct  492  SKCQSNCGMPTQSWYHIPREWLQESDNLLVLFEETGGDPSKISLEVHYTKTICSRISESY  551

Query  457  PMPVDMWTSDLSGQ---KQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRS  287
              P+  W+   SG+         L L C     +I+ I FAS+GTP G C +FS GKC +
Sbjct  552  YPPLSAWSRLTSGRVLVDTIAPELRLRCD-DGHLITKITFASYGTPSGGCQNFSEGKCHA  610

Query  286  TNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            ++ L++V +AC+G   C++ VS+  FG+PC GV K LAVEA C+
Sbjct  611  SSTLALVSEACVGNNECAISVSNDVFGDPCRGVLKDLAVEAECS  654



>gb|AHG94612.1| beta-galactosidase [Camellia sinensis]
Length=892

 Score =   207 bits (527),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/226 (49%), Positives = 142/226 (63%), Gaps = 7/226 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L +    GKG AWVNG  IGRYW T  A   GC + C+YRG YNS
Sbjct  658  YKTYFDAPVGTEPVALNL-ESMGKGQAWVNGHHIGRYW-TLVAPKDGCQEICDYRGTYNS  715

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC   CGKP+Q +YHVPRSWL++S N+LV+FEE GG+P ++S  +    ++C++VSESH
Sbjct  716  DKCTTGCGKPTQIWYHVPRSWLQTSNNLLVLFEETGGNPFQISIQSHSTDTICAQVSESH  775

Query  457  PMPVDMWTS-DLSGQKQEGAALSLECPL---SNQVISTIKFASFGTPQGTCGSFSHGKCR  290
              P+ MW+  D    K   + L  E  L       IS+I+FAS+GTP G+C  F  G C 
Sbjct  776  HPPLRMWSHPDFVNGKISASELIPEMNLQCDDGYTISSIEFASYGTPGGSCQKFFRGNCH  835

Query  289  STNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASCA  155
            S N+LSVV +AC G  +C +G+S+  F G+PC G  K+L VEA C 
Sbjct  836  SPNSLSVVSQACQGRNSCCVGISNAVFGGDPCHGTVKTLVVEAKCV  881



>dbj|BAB86232.1| putative beta-D-galactosidase [Oryza sativa Japonica Group]
Length=774

 Score =   206 bits (525),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/232 (45%), Positives = 148/232 (64%), Gaps = 13/232 (6%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK N D P    P  L + +  GKG+AW+NG +IGRYWP  +  +  CT SC+YRG ++ 
Sbjct  545  YKVNVDVPQGDDPVGLDM-QSMGKGLAWLNGNAIGRYWPRISPVSDRCTSSCDYRGTFSP  603

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC R CG+P+Q +YHVPRSW   SGN LV+FEE GGDPTK++F+ R V S+CS VSE +
Sbjct  604  NKCRRGCGQPTQRWYHVPRSWFHPSGNTLVIFEEKGGDPTKITFSRRTVASVCSFVSEHY  663

Query  457  P-MPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            P + ++ W  +     ++ A + L CP   + IS++KF SFG P GTC S+  G C   N
Sbjct  664  PSIDLESWDRNTQNDGRDAAKVQLSCP-KGKSISSVKFVSFGNPSGTCRSYQQGSCHHPN  722

Query  280  ALSVVKK---------ACIGLRNCSLGVSSTTFG-NPCAGVTKSLAVEASCA  155
            ++SVV+K         AC+ +  C++ +S   FG + C GVTK+LA+EA C+
Sbjct  723  SISVVEKGTLGWAHRRACLNMNGCTVSLSDEGFGEDLCPGVTKTLAIEADCS  774



>ref|XP_009418404.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=860

 Score =   206 bits (525),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 146/224 (65%), Gaps = 8/224 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            Y+A FDAP    P  L +    GKG  W+NGQSIGRYW  Y A NG C +SC+Y G Y S
Sbjct  635  YRAYFDAPDGNDPLALDMG-SMGKGQVWINGQSIGRYWTAY-APNGDC-NSCSYIGTYRS  691

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC  NCG+P+Q +YHVPRSWL+ + N+LV+FEEVGGD TK+S   R V S+C+ VSE H
Sbjct  692  PKCQSNCGQPTQRWYHVPRSWLQPTRNLLVIFEEVGGDATKISMMKRSVSSVCADVSEWH  751

Query  457  PMPVDMWTSDLSGQKQE--GAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRST  284
            P  +  W  +  GQ +E     + L C    Q IS IKFAS+GTP GTCG+F  G C S 
Sbjct  752  PT-IKNWDIESDGQPEEYHKPKVHLRCA-PGQSISAIKFASYGTPLGTCGNFQQGACHSP  809

Query  283  NALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASCA  155
            N+ ++++K CIG   C++ +S+T F G+PC  V K +AVEA C+
Sbjct  810  NSYTILEKNCIGQERCAVVISTTNFGGDPCPNVMKRVAVEAICS  853



>ref|XP_009607544.1| PREDICTED: beta-galactosidase 8-like [Nicotiana tomentosiformis]
Length=842

 Score =   206 bits (525),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 146/221 (66%), Gaps = 8/221 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA+F  P    P  L +S    KG AWVNGQ +GRYW +Y + + GC+D+C+YRG YNS
Sbjct  629  YKASFSPPEGKGPVSLNLS-SMDKGQAWVNGQHVGRYWSSYRSPSTGCSDNCDYRGAYNS  687

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL+ CG+P+Q  YHVPR+WL    N+LV+ EE+GGDP+K+SF++R   ++C  VSES 
Sbjct  688  WKCLKKCGQPAQVLYHVPRNWLTPGKNLLVLHEELGGDPSKISFSSRIGQNICGHVSESD  747

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P PVD W  +     ++ A+L L C      I+ + FASFGTP+G CG+F  G C   + 
Sbjct  748  PPPVDTWKPN-----KDLASLRLSCE-QGWNITALNFASFGTPKGDCGAFIIGSCH-LDV  800

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            LS+V + C+G   C + +S+  FG+PC G+ KSLAVEA C+
Sbjct  801  LSIVHQDCVGKPGCLIPISTAKFGDPCPGIVKSLAVEAFCS  841



>ref|XP_009418405.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   206 bits (524),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 146/224 (65%), Gaps = 8/224 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            Y+A FDAP    P  L +    GKG  W+NGQSIGRYW  Y A NG C +SC+Y G Y S
Sbjct  622  YRAYFDAPDGNDPLALDMG-SMGKGQVWINGQSIGRYWTAY-APNGDC-NSCSYIGTYRS  678

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC  NCG+P+Q +YHVPRSWL+ + N+LV+FEEVGGD TK+S   R V S+C+ VSE H
Sbjct  679  PKCQSNCGQPTQRWYHVPRSWLQPTRNLLVIFEEVGGDATKISMMKRSVSSVCADVSEWH  738

Query  457  PMPVDMWTSDLSGQKQE--GAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRST  284
            P  +  W  +  GQ +E     + L C    Q IS IKFAS+GTP GTCG+F  G C S 
Sbjct  739  PT-IKNWDIESDGQPEEYHKPKVHLRC-APGQSISAIKFASYGTPLGTCGNFQQGACHSP  796

Query  283  NALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASCA  155
            N+ ++++K CIG   C++ +S+T F G+PC  V K +AVEA C+
Sbjct  797  NSYTILEKNCIGQERCAVVISTTNFGGDPCPNVMKRVAVEAICS  840



>ref|XP_008460809.1| PREDICTED: beta-galactosidase 10 [Cucumis melo]
Length=843

 Score =   206 bits (524),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 133/200 (67%), Gaps = 3/200 (2%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG+AW+NG+ IGRYWP  ++ +  C   C+YRG +  DKCL  CG+P+Q +YHVPRSW 
Sbjct  646  GKGLAWLNGEEIGRYWPRKSSIHDVCVQKCDYRGKFRPDKCLTGCGEPTQRWYHVPRSWF  705

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAALS  392
            K SGN+LV+FEE GGDPT++  + R+V S+CS + E HP  ++ W+     +++  A + 
Sbjct  706  KPSGNILVIFEEKGGDPTQIRLSKRKVLSICSHLGEGHP-SIESWSGTEKVERKSKATVH  764

Query  391  LECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSSTT  212
            L+CP  N  I+ IKFASFGTPQG+CGS+S G C   N++S+V+K C+    C + +    
Sbjct  765  LKCP-DNSRIAKIKFASFGTPQGSCGSYSIGDCHDPNSISLVEKVCLNRNECRIELGEEG  823

Query  211  FGN-PCAGVTKSLAVEASCA  155
            F    C   TK LAVEA C+
Sbjct  824  FNRGLCPTATKKLAVEAMCS  843



>ref|XP_010907798.1| PREDICTED: beta-galactosidase 3 isoform X2 [Elaeis guineensis]
Length=817

 Score =   206 bits (523),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 138/202 (68%), Gaps = 5/202 (2%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG AW+NG++IGRYWP  ++ +  C  SCNYRG +  DKC   CG+P+Q +YHVPRSW 
Sbjct  618  GKGQAWLNGKAIGRYWPRTSSIHDECAPSCNYRGKFFPDKCRTGCGEPTQRWYHVPRSWF  677

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEG--AA  398
            + SGNVLV+FEE GGDPT+++F+ R V  LC  VS  HP  VD+ +SD S +   G  AA
Sbjct  678  QPSGNVLVIFEERGGDPTRITFSRRRVIGLCGFVSTEHP-SVDLESSDQSIKSNSGDKAA  736

Query  397  LSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSS  218
            + L CP    +IS+I FASFG P GTC S+  G C   N++SVV+KAC+    C++ +S 
Sbjct  737  VHLTCP-EGMLISSITFASFGNPSGTCRSYRKGSCHYPNSISVVEKACLHENQCAVSLSE  795

Query  217  TTFGNP-CAGVTKSLAVEASCA  155
             +FGN  C  + K+LA+EA+C+
Sbjct  796  DSFGNDLCPSMVKTLAIEAACS  817



>ref|XP_012092087.1| PREDICTED: beta-galactosidase 10 [Jatropha curcas]
 gb|KDP44674.1| hypothetical protein JCGZ_19489 [Jatropha curcas]
Length=843

 Score =   206 bits (524),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 136/201 (68%), Gaps = 3/201 (1%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG+AW+NG+ IGRYWP  ++ +  C   C+YRG +   KC   CGKP+Q +YHVPRSW 
Sbjct  644  GKGLAWLNGEEIGRYWPRKSSVHDKCVQECDYRGKFMPGKCRTGCGKPTQRWYHVPRSWF  703

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMP-VDMWTSDLSGQKQEGAAL  395
            K SGN+LV+FEE GGDPTK+ F+ R++  +C+ V+E +PM  +D++    +G     A+ 
Sbjct  704  KPSGNILVIFEEKGGDPTKIVFSRRKISGVCALVAEDYPMANLDLYQKAGNGNFNYKASA  763

Query  394  SLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSST  215
             L+CP  N +IS++KFASFG+P GTCGS+S G+C   N++SVV+K C+   +C + V+  
Sbjct  764  HLKCP-KNSLISSVKFASFGSPTGTCGSYSKGECHDPNSISVVEKVCLNKNDCIIEVTEE  822

Query  214  TFGN-PCAGVTKSLAVEASCA  155
             F    C   TK LAVEA C+
Sbjct  823  NFTKGLCPDTTKKLAVEAVCS  843



>ref|XP_010907797.1| PREDICTED: beta-galactosidase 3 isoform X1 [Elaeis guineensis]
Length=852

 Score =   206 bits (523),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 138/202 (68%), Gaps = 5/202 (2%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG AW+NG++IGRYWP  ++ +  C  SCNYRG +  DKC   CG+P+Q +YHVPRSW 
Sbjct  653  GKGQAWLNGKAIGRYWPRTSSIHDECAPSCNYRGKFFPDKCRTGCGEPTQRWYHVPRSWF  712

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEG--AA  398
            + SGNVLV+FEE GGDPT+++F+ R V  LC  VS  HP  VD+ +SD S +   G  AA
Sbjct  713  QPSGNVLVIFEERGGDPTRITFSRRRVIGLCGFVSTEHP-SVDLESSDQSIKSNSGDKAA  771

Query  397  LSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSS  218
            + L CP    +IS+I FASFG P GTC S+  G C   N++SVV+KAC+    C++ +S 
Sbjct  772  VHLTCP-EGMLISSITFASFGNPSGTCRSYRKGSCHYPNSISVVEKACLHENQCAVSLSE  830

Query  217  TTFGNP-CAGVTKSLAVEASCA  155
             +FGN  C  + K+LA+EA+C+
Sbjct  831  DSFGNDLCPSMVKTLAIEAACS  852



>ref|NP_001235722.1| lectin [Glycine max]
 gb|ACK36970.1| lectin [Glycine max]
Length=447

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 145/225 (64%), Gaps = 7/225 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FD P    P  L   +  GKG AWVNGQ IGRYW T  +   GC   C+YRG YNS
Sbjct  209  YKTYFDVPGGIDPVALDF-KSMGKGQAWVNGQHIGRYW-TRVSPKSGCQQVCDYRGAYNS  266

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCGKP+QT YHVPRSWLK++ N+LV+ EE GG+P ++S        +C++VSES+
Sbjct  267  DKCSTNCGKPTQTLYHVPRSWLKATNNLLVILEETGGNPFEISVKLHSSRIICAQVSESN  326

Query  457  PMPVD-MWTSDLSGQKQEGAALSLECPLSNQ---VISTIKFASFGTPQGTCGSFSHGKCR  290
              P+  +  +DL G++     +  E  L  Q    IS++ FASFGTP G+C +FS G C 
Sbjct  327  YPPLQKLVNADLIGEEVSANNMIPELHLHCQQGHTISSVAFASFGTPGGSCQNFSRGNCH  386

Query  289  STNALSVVKKACIGLRNCSLGVSSTTFG-NPCAGVTKSLAVEASC  158
            + +++S+V +AC G R+CS+ +S + FG +PC GV K+L+VEA C
Sbjct  387  APSSMSIVSEACQGKRSCSIKISDSAFGVDPCPGVVKTLSVEARC  431



>ref|XP_004504354.1| PREDICTED: beta-galactosidase 9-like [Cicer arietinum]
Length=896

 Score =   206 bits (523),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 144/227 (63%), Gaps = 10/227 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L      GKG AWVNG  IGRYW T  +   GC   C+YRG YNS
Sbjct  662  YKTYFDAPGGIDPVALDF-ESMGKGQAWVNGHHIGRYW-TRVSPKSGCEQVCDYRGAYNS  719

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCGKP+QT YHVPRSWLK+S N LV+ EE GG+P  +S        +C++VS+S+
Sbjct  720  DKCTTNCGKPTQTLYHVPRSWLKASNNFLVLLEETGGNPFGISVKLHSSSIVCAQVSQSY  779

Query  457  PMPVD-MWTSDLSGQKQEGA-----ALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGK  296
              P+  +  +DL GQ+Q  +      + L C     +IS+I FASFGTP G+C SFS G 
Sbjct  780  YPPLQKLVNADLIGQQQVSSNDMIPEMQLRC-RDGHIISSISFASFGTPGGSCHSFSRGN  838

Query  295  CRSTNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASC  158
            C + N+ S+V KAC+G R+CS+ +SS  F G+PC GV K+L+VEA C
Sbjct  839  CHAPNSSSIVSKACLGKRSCSIKISSAVFGGDPCQGVVKTLSVEARC  885



>ref|XP_002518051.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF44184.1| beta-galactosidase, putative [Ricinus communis]
Length=897

 Score =   206 bits (523),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 110/226 (49%), Positives = 144/226 (64%), Gaps = 8/226 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L +    GKG AWVN   IGRYW T  A   GC   C+YRG YNS
Sbjct  665  YKTYFDAPSGADPVALDLG-SMGKGQAWVNDHHIGRYW-TLVAPEEGC-QKCDYRGAYNS  721

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC  NCGKP+Q +YH+PRSWL+ S N+LV+FEE GG+P ++S   R    +C++VSE+H
Sbjct  722  EKCRTNCGKPTQIWYHIPRSWLQPSNNLLVIFEETGGNPFEISIKLRSASVVCAQVSETH  781

Query  457  PMPVDMWT-SDLSGQKQEGAALSLECPLSNQ---VISTIKFASFGTPQGTCGSFSHGKCR  290
              P+  W  +D       G  ++ E  L  Q   VIS+I+FAS+GTPQG+C  FS G C 
Sbjct  782  YPPLQRWIHTDFIYGNVSGKDMTPEIQLRCQDGYVISSIEFASYGTPQGSCQKFSRGNCH  841

Query  289  STNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASCA  155
            + N+LSVV KAC G   C++ +S+  F G+PC G+ K+LAVEA C+
Sbjct  842  APNSLSVVSKACQGRDTCNIAISNAVFGGDPCRGIVKTLAVEAKCS  887



>ref|NP_565755.1| beta galactosidase 9 [Arabidopsis thaliana]
 sp|Q9SCV3.1|BGAL9_ARATH RecName: Full=Beta-galactosidase 9; Short=Lactase 9; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB64745.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAC04500.2| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEC08744.1| beta galactosidase 9 [Arabidopsis thaliana]
Length=887

 Score =   206 bits (523),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 147/226 (65%), Gaps = 7/226 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FD P    P +L +    G+G AWVNGQ IGRYW   +  +G C  +C+YRG YNS
Sbjct  654  YKTYFDPPAGTDPVVLNL-ESMGRGQAWVNGQHIGRYWNIISQKDG-CDRTCDYRGAYNS  711

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCGKP+QT YHVPRSWLK S N+LV+FEE GG+P K+S  T   G LC +VSESH
Sbjct  712  DKCTTNCGKPTQTRYHVPRSWLKPSSNLLVLFEETGGNPFKISVKTVTAGILCGQVSESH  771

Query  457  PMPVDMW-TSDLSGQKQEGAALSLECPL---SNQVISTIKFASFGTPQGTCGSFSHGKCR  290
              P+  W T D         +++ E  L      VIS+I+FAS+GTP+G+C  FS GKC 
Sbjct  772  YPPLRKWSTPDYINGTMSINSVAPEVHLHCEDGHVISSIEFASYGTPRGSCDGFSIGKCH  831

Query  289  STNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASCA  155
            ++N+LS+V +AC G  +C + VS+T F  +PC+G  K+LAV + C+
Sbjct  832  ASNSLSIVSEACKGRNSCFIEVSNTAFISDPCSGTLKTLAVMSRCS  877



>ref|XP_007214621.1| hypothetical protein PRUPE_ppa001340mg [Prunus persica]
 gb|EMJ15820.1| hypothetical protein PRUPE_ppa001340mg [Prunus persica]
Length=849

 Score =   205 bits (522),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 147/225 (65%), Gaps = 10/225 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTD--SCNYRGPY  644
            YK  F AP    P  L ++   GKG AWVNGQSIGRYWP Y + + GCT+   C+YRG Y
Sbjct  630  YKVAFLAPEGKGPLALNLA-SMGKGQAWVNGQSIGRYWPAYLSPSSGCTNGSDCDYRGAY  688

Query  643  NSDKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSE  464
            +  KCL+NCG+P+QT YH+PR+W+    N+LV+ EE+GGDP+K+S  T+    +C+ VSE
Sbjct  689  DPSKCLKNCGQPAQTLYHIPRTWVHIGENLLVLHEELGGDPSKISLRTKTGQEICAHVSE  748

Query  463  SHPMPVDMW--TSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCR  290
            + P P D W   S+   Q  E   + L C      I++I FASFGTP G CG+F+ G C 
Sbjct  749  TDPPPADSWKPNSEFISQNPE---VQLTCERGWH-ITSINFASFGTPIGKCGTFALGACN  804

Query  289  STNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            + + LS+V++AC+G   CS+ +S+ T G+PC GV K LAVEA C+
Sbjct  805  A-DILSIVQQACLGQEGCSIPISTATLGDPCPGVPKCLAVEALCS  848



>gb|KJB46895.1| hypothetical protein B456_008G000600 [Gossypium raimondii]
 gb|KJB46896.1| hypothetical protein B456_008G000600 [Gossypium raimondii]
Length=845

 Score =   205 bits (522),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 133/200 (67%), Gaps = 5/200 (3%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG+AW+NG+ IGRYWP  ++ +  C + C+YRG +  DKCL  CG+P+Q +YHVPRSW 
Sbjct  650  GKGLAWLNGEEIGRYWPIKSSEHEKCVEECDYRGKFFPDKCLTGCGEPTQRWYHVPRSWF  709

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAALS  392
            K SGN+LV+FEE GGDPTK++F+ R++  LCS ++E  PM VD       G  +  +A  
Sbjct  710  KPSGNILVIFEEKGGDPTKITFSKRKISGLCSLIAEDFPM-VDQAPVRKGGSGK--SAAH  766

Query  391  LECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSSTT  212
            L+CP  N +IS +KFASFG P G CGS+S GKC   N+   V+K C+G   C++ ++   
Sbjct  767  LKCP-KNTLISNVKFASFGNPTGKCGSYSMGKCHDPNSTLAVEKVCLGKNECAIELTEEN  825

Query  211  FGN-PCAGVTKSLAVEASCA  155
            F    C G TK LA+EA C+
Sbjct  826  FDKGLCPGTTKRLAIEAVCS  845



>gb|ACC60981.1| beta-galactosidase 1 precursor [Petunia x hybrida]
Length=842

 Score =   205 bits (521),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 142/224 (63%), Gaps = 8/224 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F+AP    P  L ++   GKG  W+NGQSIGRYWP Y AS  G  D+CNY GP+N 
Sbjct  624  YKTTFNAPAGNEPLALDMNSM-GKGQVWINGQSIGRYWPGYKAS--GTCDACNYAGPFNE  680

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KCL NCG  SQ +YHVPRSWL  +GN+LVVFEE GGDP  +S   RE+ S+C+ ++E  
Sbjct  681  KKCLSNCGDASQRWYHVPRSWLHPTGNLLVVFEEWGGDPNGISLVKRELASVCADINEWQ  740

Query  457  PMPVDMWTSDLSGQ--KQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRST  284
            P  V+ W    SG+  K       L C  S Q I++IKFASFGTPQG CGSFS G C + 
Sbjct  741  PQLVN-WQLQASGKVDKPLRPKAHLSC-TSGQKITSIKFASFGTPQGVCGSFSEGSCHAH  798

Query  283  NALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASCA  155
            ++    +K CIG  +C++ V+   F G+PC  V K L+VEA C+
Sbjct  799  HSYDAFEKYCIGQESCTVPVTPEIFGGDPCPSVMKKLSVEAVCS  842



>ref|XP_010413942.1| PREDICTED: beta-galactosidase 9-like [Camelina sativa]
Length=889

 Score =   205 bits (522),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 146/226 (65%), Gaps = 7/226 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FD P    P +L +    GKG AWVNG  IGRYW   +  +G C  +C+YRG YNS
Sbjct  656  YKTYFDTPDGTDPVVLDL-ESMGKGQAWVNGHHIGRYWNIISQKDG-CEKACDYRGAYNS  713

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCG+P+QT YHVPRSWLK S N+LV+FEE GG+P K+S  T   G LC +VSESH
Sbjct  714  DKCTTNCGQPTQTRYHVPRSWLKPSSNLLVLFEETGGNPFKISVKTVTAGILCGQVSESH  773

Query  457  PMPVDMW-TSDLSGQKQEGAALSLECPL---SNQVISTIKFASFGTPQGTCGSFSHGKCR  290
              P+  W T D         +++ E  L      VIS+I+FAS+GTP+G+C  FS GKC 
Sbjct  774  YPPLRKWSTPDYMNGTMSIDSVAPEVHLHCEDGHVISSIEFASYGTPRGSCHRFSIGKCH  833

Query  289  STNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASCA  155
            ++N+LS+V +AC G  +C + VS+T F  +PC+G+ K+L V A C+
Sbjct  834  ASNSLSIVSEACKGRNSCFIEVSNTAFRSDPCSGILKTLTVMARCS  879



>ref|XP_006296364.1| hypothetical protein CARUB_v10025536mg [Capsella rubella]
 gb|EOA29262.1| hypothetical protein CARUB_v10025536mg [Capsella rubella]
Length=887

 Score =   205 bits (521),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 145/226 (64%), Gaps = 7/226 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FD P    P +L +    GKG AWVNG  IGRYW   ++   GC   C+YRG YNS
Sbjct  654  YKTYFDTPDGTDPVVLDL-ESMGKGQAWVNGHHIGRYW-NISSQKDGCERGCDYRGAYNS  711

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCGKP+QT YHVPRSWLK S N+LV+FEE GG+P K+S  T   G LC +VSE H
Sbjct  712  DKCTTNCGKPTQTRYHVPRSWLKPSSNLLVLFEETGGNPFKISVKTVTAGILCGQVSELH  771

Query  457  PMPVDMW-TSDLSGQKQEGAALSLECPL---SNQVISTIKFASFGTPQGTCGSFSHGKCR  290
              P+  W T D         +++ E  L      VIS+I+FAS+GTP+G+C  FS GKC 
Sbjct  772  YPPLRKWSTPDYMNGTMLINSVAPEVHLHCEDGHVISSIEFASYGTPRGSCDKFSIGKCH  831

Query  289  STNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASCA  155
            ++N+LS+V +AC G  +C + VS+T F  +PC+G+ K+LAV A C+
Sbjct  832  ASNSLSIVSEACKGRNSCFIEVSNTAFRSDPCSGILKTLAVMAQCS  877



>ref|XP_010917686.1| PREDICTED: beta-galactosidase 5-like [Elaeis guineensis]
Length=849

 Score =   205 bits (521),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 145/224 (65%), Gaps = 8/224 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            Y+A FDAP    P  L +    GKG AW+NGQSIGRYW  + A NG C + CNY G Y S
Sbjct  624  YRAYFDAPAGDDPLALDMGS-MGKGQAWINGQSIGRYWSLW-APNGDC-NGCNYAGTYRS  680

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC   CG+P+Q +YHVPRSWL+ + N+LVVFEE+GGD TK+SF  + V  +C+ VSE H
Sbjct  681  PKCQSGCGQPTQRWYHVPRSWLQPTQNLLVVFEELGGDATKISFVKKSVSGVCADVSEWH  740

Query  457  PMPVDMWTSDLSGQKQEG--AALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRST  284
            PM +  W  +  GQ +E     + L C    Q IS IKFASFGTP GTCG+F  G C S 
Sbjct  741  PM-IKNWHIESYGQPEEHHKPKVHLRCA-PGQSISAIKFASFGTPLGTCGNFEQGACHSP  798

Query  283  NALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASCA  155
            N+ S ++K CIG + C++ +S+  F G+PC  V K +AVEA C+
Sbjct  799  NSHSTLEKKCIGQQRCAVTISTDNFGGDPCPNVMKRVAVEAICS  842



>ref|XP_006410414.1| hypothetical protein EUTSA_v10016215mg [Eutrema salsugineum]
 gb|ESQ51867.1| hypothetical protein EUTSA_v10016215mg [Eutrema salsugineum]
Length=895

 Score =   205 bits (521),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 147/234 (63%), Gaps = 7/234 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FD P    P +L +    GKG AWVNG  IGRYW   +  +G C  +C+YRG YNS
Sbjct  659  YKTYFDTPGGTDPVVLDL-ESMGKGQAWVNGHHIGRYWNIISQKDG-CDRTCDYRGAYNS  716

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            DKC  NCGKP+QT YHVPRSWLK S N+LV+FEE GG+P K+S  T     LC +VSESH
Sbjct  717  DKCTTNCGKPTQTRYHVPRSWLKPSSNLLVLFEETGGNPFKISVKTVTAAILCGQVSESH  776

Query  457  PMPVDMW-TSDLSGQKQEGAALSLECPL---SNQVISTIKFASFGTPQGTCGSFSHGKCR  290
              P+  W T D         +++ E  L      VIS+I+FAS+GTP+G+C  FS GKC 
Sbjct  777  YPPLRKWSTPDFKNGTMSINSVAPEVHLRCEEGHVISSIEFASYGTPRGSCEKFSTGKCH  836

Query  289  STNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASCA*GTLCRYL  131
            ++ +LS+V +AC G  +C + VS+T F  +PC+G  K+LAV A C+     R+L
Sbjct  837  ASKSLSIVSEACQGRNSCFIEVSNTAFRSDPCSGTLKTLAVMARCSPSQDTRHL  890



>gb|AGR44464.1| beta-D-galactosidase 5, partial [Pyrus x bretschneideri]
Length=697

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 137/204 (67%), Gaps = 7/204 (3%)
 Frame = -1

Query  760  RGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPR  581
             G GKG  W+NGQSIGRYW  +  +NG C + C+Y G +   KC   CGKP+Q YYHVPR
Sbjct  486  EGMGKGQIWINGQSIGRYWTAF--ANGNC-NGCSYAGGFRPTKCQSGCGKPTQRYYHVPR  542

Query  580  SWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQE--  407
            SWLK + N+LV+FEE+GGDP+++S   R V S+CS V+E HP  +  W  +  G+ ++  
Sbjct  543  SWLKPTQNLLVLFEELGGDPSRISLVKRAVSSVCSEVAEYHPT-IKNWHIESYGKVEDFH  601

Query  406  GAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLG  227
               + L C    Q IS+IKFASFGTP GTCGS+  G C +T + SVV+K CIG + C++ 
Sbjct  602  SPKVHLRCN-PGQAISSIKFASFGTPLGTCGSYQEGTCHATTSYSVVQKKCIGKQRCAVT  660

Query  226  VSSTTFGNPCAGVTKSLAVEASCA  155
            +S++ FG+PC  V K L+VEA CA
Sbjct  661  ISNSNFGDPCPKVLKRLSVEAVCA  684



>gb|AAG12249.1|AF184080_1 beta-galactosidase [Prunus armeniaca]
Length=376

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 148/226 (65%), Gaps = 9/226 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA F+AP    P  L + R  GKG  W+NGQSIGRYW  Y  +NG C+  C+Y G +  
Sbjct  147  YKAYFNAPGGDEPLALDM-RSMGKGQVWINGQSIGRYWMAY--ANGDCS-LCSYIGTFRP  202

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC   CG+P+Q +YHVPRSWLK + N++V+FEE+GGDP+K++   R V  +C+ + E H
Sbjct  203  TKCQLGCGQPTQRWYHVPRSWLKPTKNLMVMFEELGGDPSKITLVKRSVAGVCADLQEHH  262

Query  457  P--MPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRST  284
            P     D+ + + S    + A + L+C +  Q IS+IKFASFGTP GTCGSF  G C +T
Sbjct  263  PNAEKFDIDSHEESKTLHQ-AQVHLQC-VPGQSISSIKFASFGTPTGTCGSFQQGTCHAT  320

Query  283  NALSVVKKACIGLRNCSLGVSSTTFG-NPCAGVTKSLAVEASCA*G  149
            N+ ++V+K CIG  +C + VS++ FG +PC  V K L+VEA C+ G
Sbjct  321  NSHAIVEKNCIGRESCLVTVSNSIFGTDPCPNVLKRLSVEAVCSTG  366



>ref|XP_011012769.1| PREDICTED: beta-galactosidase 9 [Populus euphratica]
Length=891

 Score =   204 bits (520),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/224 (49%), Positives = 147/224 (66%), Gaps = 7/224 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L +    GKG AWVNG  IGRYW T  +   GC  SC+YRG YNS
Sbjct  660  YKTFFDAPSGVDPVALDLG-SMGKGQAWVNGHHIGRYW-TVVSPKDGC-GSCDYRGAYNS  716

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC  NCG P+QT+YHVPR+WL++S N+LV+FEE GG+P ++S   R    +C++VSESH
Sbjct  717  GKCRTNCGNPTQTWYHVPRAWLEASNNLLVLFEETGGNPFEISVKLRSAKVICAQVSESH  776

Query  457  PMPVDMWT-SDLSGQKQEGAALSLECPLSNQ---VISTIKFASFGTPQGTCGSFSHGKCR  290
              P+  W+ +DL+G       ++ E  L  Q   ++S+I+FAS+GTP+G+C  FS G C 
Sbjct  777  YPPLRKWSRADLTGGNISRNDMTPEMRLKCQDGHIMSSIEFASYGTPKGSCQKFSRGNCH  836

Query  289  STNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            ++N+ SVV +AC G   C + +S+  FG+PC GV K+LAVEA C
Sbjct  837  ASNSSSVVTEACQGKNKCDIAISNAVFGDPCRGVIKTLAVEARC  880



>ref|XP_011022866.1| PREDICTED: beta-galactosidase 10 [Populus euphratica]
Length=841

 Score =   204 bits (520),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 137/202 (68%), Gaps = 5/202 (2%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG+AW+NG+ IGRYWP  ++ +  C   C+YRG +  DKC   CG+P+Q +YHVPRSW 
Sbjct  642  GKGLAWLNGEEIGRYWPRKSSVHEKCVTECDYRGKFMPDKCFTGCGQPTQRWYHVPRSWF  701

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEG--AA  398
            K SGN+LV+FEE GGDP K++F+ R++ S+C+ ++E +P   D  +   +G K     A+
Sbjct  702  KPSGNLLVIFEEKGGDPEKITFSRRKMSSICALIAEDYP-SADRKSLQETGSKNSNSRAS  760

Query  397  LSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSS  218
            + LECP  N VIS +KFASFGTP G CGS+S G+C   N++SVV+KAC+    C++ ++ 
Sbjct  761  VHLECP-QNAVISAVKFASFGTPSGKCGSYSEGECHDPNSISVVEKACLNKTECAIELTE  819

Query  217  TTFGN-PCAGVTKSLAVEASCA  155
              F    C  +T+ LAVEA C+
Sbjct  820  ENFNKGLCPDLTRRLAVEAVCS  841



>ref|XP_003632537.1| PREDICTED: beta-galactosidase 10 [Vitis vinifera]
 emb|CBI21600.3| unnamed protein product [Vitis vinifera]
Length=847

 Score =   204 bits (520),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 133/201 (66%), Gaps = 3/201 (1%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG+AW+NG+ IGRYWP  ++ +  C   C+YRG +  +KC   CG+P+Q +YHVPRSW 
Sbjct  648  GKGLAWLNGEEIGRYWPRKSSIHDKCVQECDYRGKFMPNKCSTGCGEPTQRWYHVPRSWF  707

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHP-MPVDMWTSDLSGQKQEGAAL  395
            K SGN+LV+FEE GGDPTK+ F+ R+   +C+ VSE HP   ++ W  D +   +  A +
Sbjct  708  KPSGNILVIFEEKGGDPTKIRFSRRKTTGVCALVSEDHPTYELESWHKDANENNKNKATI  767

Query  394  SLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSST  215
             L+CP  N  IS++KFAS+GTP G CGS+S G C   N+ SVV+K CI   +C++ ++  
Sbjct  768  HLKCP-ENTHISSVKFASYGTPTGKCGSYSQGDCHDPNSASVVEKLCIRKNDCAIELAEK  826

Query  214  TFG-NPCAGVTKSLAVEASCA  155
             F  + C   TK LAVEA C+
Sbjct  827  NFSKDLCPSTTKKLAVEAVCS  847



>ref|XP_006838689.1| PREDICTED: beta-galactosidase 5 [Amborella trichopoda]
 gb|ERN01258.1| hypothetical protein AMTR_s00002p00246870 [Amborella trichopoda]
Length=843

 Score =   204 bits (519),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 142/225 (63%), Gaps = 7/225 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA FDAP    P  L +     KG  WVNGQSIGRYWP Y A  G C  +C+Y G Y  
Sbjct  620  YKAYFDAPAGDDPLALDMGT-MHKGQVWVNGQSIGRYWPAYLA-QGQC-GACDYTGTYRP  676

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC   CG P+Q +YHVPRSWL+ +GN+L+VFEE+GGD + +S   R V S+C+ VSE H
Sbjct  677  NKCQTGCGHPTQRWYHVPRSWLQPTGNLLIVFEEIGGDVSGISLGRRSVESVCADVSEFH  736

Query  457  PMPVDMWTSDLSGQKQE--GAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRST  284
            P+ V  W  +  G+ Q      + L C    Q IS IKFASFGTP GTCGSF  G C S 
Sbjct  737  PV-VKNWHIESYGRAQPVIKPKVHLHCS-PGQSISAIKFASFGTPLGTCGSFQQGACHSP  794

Query  283  NALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA*G  149
            N+  V++K CIG + CS+ +S+  FG+PC  + K +AVEA C+ G
Sbjct  795  NSHDVLQKKCIGRQRCSVTISTNIFGDPCPNIMKRVAVEAVCSAG  839



>gb|KGN62231.1| hypothetical protein Csa_2G337760 [Cucumis sativus]
Length=832

 Score =   204 bits (519),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 134/200 (67%), Gaps = 3/200 (2%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG+AW+NG+ IGRYWPT ++ +  C   C+YRG +  DKCL  CG+P+Q +YHVPRSW 
Sbjct  634  GKGLAWLNGEEIGRYWPTKSSIHDVCVQKCDYRGKFRPDKCLTGCGEPTQRWYHVPRSWF  693

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAALS  392
            K SGN+LV+FEE GGDPT++  + R+V  +C+ + E HP  ++ W+   + +++  A + 
Sbjct  694  KPSGNILVIFEEKGGDPTQIRLSKRKVLGICAHLGEGHP-SIESWSEAENVERKSKATVD  752

Query  391  LECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSSTT  212
            L+CP  N  I+ IKFASFGTPQG+CGS+S G C   N++S+V+K C+    C + +    
Sbjct  753  LKCP-DNGRIAKIKFASFGTPQGSCGSYSIGDCHDPNSISLVEKVCLNRNECRIELGEEG  811

Query  211  FGN-PCAGVTKSLAVEASCA  155
            F    C   +K LAVEA C+
Sbjct  812  FNKGLCPTASKKLAVEAMCS  831



>ref|XP_006826783.2| PREDICTED: beta-galactosidase [Amborella trichopoda]
Length=815

 Score =   204 bits (519),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 142/223 (64%), Gaps = 8/223 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA F+AP    P  L +    GKG  W+NGQSIGRYWP YTA  G C D C+Y G YN 
Sbjct  597  YKATFNAPGGDEPLALDMGS-MGKGQVWINGQSIGRYWPAYTAK-GSCGD-CSYSGTYNE  653

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
              C  NCG+PSQ +YHVPR WL  +GN+LVVFEE GGDP+ +S   R VGS+C+ VSE H
Sbjct  654  KNCQSNCGEPSQRWYHVPRPWLNPTGNLLVVFEEWGGDPSGISLVKRSVGSVCADVSEWH  713

Query  457  PMPVDMWTSDLSG--QKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRST  284
             + +  W     G  ++ + A + L C    Q I++IKFASFGTPQG CG+F  G C S 
Sbjct  714  -LTIKNWHIKTYGKPERLQRAKVHLGCD-QGQTITSIKFASFGTPQGACGNFQQGACHSP  771

Query  283  NALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASC  158
            N+ +V +K C+G + C++ +S   F G+PC  V K +AVEA C
Sbjct  772  NSYAVFQKKCVGQQACAVTISPDVFGGDPCFSVMKRVAVEAIC  814



>gb|EMT06783.1| Beta-galactosidase 15 [Aegilops tauschii]
Length=544

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/224 (46%), Positives = 140/224 (63%), Gaps = 6/224 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  + +    GKG AWVNG  IGRYW +  A   GC  SCNY G Y+ 
Sbjct  312  YKTMFDAPKGTDPVAIYLG-SMGKGQAWVNGNLIGRYW-SLVAPESGCPTSCNYPGAYSE  369

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC  NCG P+Q++YH+PR WL+ S N+LV+FEE GGDP+K+S   +   ++CSR+SES+
Sbjct  370  SKCQSNCGMPAQSWYHIPREWLQESDNLLVLFEETGGDPSKISLEVQYTKTICSRISESY  429

Query  457  PMPVDMWTSDLSGQ---KQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRS  287
              P+  W+   SG+         L L C     +I+ I FAS+GTP G C +FS GKC +
Sbjct  430  YPPLSAWSRLTSGRVLVDTIAPELRLRCD-DGHLITKITFASYGTPSGGCQNFSEGKCHA  488

Query  286  TNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            ++ L++V +AC+G   C++ VS+  FG+PC  V K LAVEA C+
Sbjct  489  SSTLALVSEACVGNNECAISVSNDVFGDPCRRVVKDLAVEAECS  532



>ref|XP_004147332.1| PREDICTED: beta-galactosidase 10 [Cucumis sativus]
Length=844

 Score =   204 bits (519),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 134/200 (67%), Gaps = 3/200 (2%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG+AW+NG+ IGRYWPT ++ +  C   C+YRG +  DKCL  CG+P+Q +YHVPRSW 
Sbjct  646  GKGLAWLNGEEIGRYWPTKSSIHDVCVQKCDYRGKFRPDKCLTGCGEPTQRWYHVPRSWF  705

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAALS  392
            K SGN+LV+FEE GGDPT++  + R+V  +C+ + E HP  ++ W+   + +++  A + 
Sbjct  706  KPSGNILVIFEEKGGDPTQIRLSKRKVLGICAHLGEGHP-SIESWSEAENVERKSKATVD  764

Query  391  LECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSSTT  212
            L+CP  N  I+ IKFASFGTPQG+CGS+S G C   N++S+V+K C+    C + +    
Sbjct  765  LKCP-DNGRIAKIKFASFGTPQGSCGSYSIGDCHDPNSISLVEKVCLNRNECRIELGEEG  823

Query  211  FGN-PCAGVTKSLAVEASCA  155
            F    C   +K LAVEA C+
Sbjct  824  FNKGLCPTASKKLAVEAMCS  843



>gb|ERM94020.1| hypothetical protein AMTR_s00136p00108810 [Amborella trichopoda]
Length=755

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 142/223 (64%), Gaps = 8/223 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA F+AP    P  L +    GKG  W+NGQSIGRYWP YTA  G C D C+Y G YN 
Sbjct  537  YKATFNAPGGDEPLALDMGS-MGKGQVWINGQSIGRYWPAYTA-KGSCGD-CSYSGTYNE  593

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
              C  NCG+PSQ +YHVPR WL  +GN+LVVFEE GGDP+ +S   R VGS+C+ VSE H
Sbjct  594  KNCQSNCGEPSQRWYHVPRPWLNPTGNLLVVFEEWGGDPSGISLVKRSVGSVCADVSEWH  653

Query  457  PMPVDMWTSDLSG--QKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRST  284
             + +  W     G  ++ + A + L C    Q I++IKFASFGTPQG CG+F  G C S 
Sbjct  654  -LTIKNWHIKTYGKPERLQRAKVHLGCD-QGQTITSIKFASFGTPQGACGNFQQGACHSP  711

Query  283  NALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASC  158
            N+ +V +K C+G + C++ +S   F G+PC  V K +AVEA C
Sbjct  712  NSYAVFQKKCVGQQACAVTISPDVFGGDPCFSVMKRVAVEAIC  754



>ref|XP_008799173.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 3 [Phoenix 
dactylifera]
Length=852

 Score =   204 bits (518),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 132/201 (66%), Gaps = 3/201 (1%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG AW+NG++IGRYWP  ++ +  C  SCNYRG +  DKC   CG+P+Q +YHVPRSW 
Sbjct  652  GKGQAWLNGKAIGRYWPVTSSIHDECAPSCNYRGKFFPDKCRTGCGEPTQRWYHVPRSWF  711

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHP-MPVDMWTSDLSGQKQEGAAL  395
            + SGN+LV+FEE GGDPTK++F+ R V  LC  VS  +P M ++ W   +     + AA+
Sbjct  712  QPSGNILVIFEEKGGDPTKITFSRRRVIGLCGFVSTDYPSMDLESWDQSIRSNNGDKAAV  771

Query  394  SLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSST  215
             L+CP    +IS+I FASFG P GTC S+  G C   N+ SVV+KAC     C++ +S  
Sbjct  772  HLKCP-EGMLISSITFASFGNPSGTCRSYRQGSCHYPNSFSVVEKACRHKSQCAVSLSED  830

Query  214  TFGNP-CAGVTKSLAVEASCA  155
             FGN  C  + K LAVEA+C+
Sbjct  831  NFGNDLCPSMVKMLAVEAACS  851



>ref|XP_011001114.1| PREDICTED: beta-galactosidase 8-like [Populus euphratica]
Length=847

 Score =   204 bits (518),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/221 (48%), Positives = 140/221 (63%), Gaps = 4/221 (2%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA   AP    P  L ++R  GKG AW+NGQSIGRYW  Y + + GCTD+C+YRG Y+ 
Sbjct  624  YKATILAPEGNGPLALNLAR-MGKGQAWINGQSIGRYWSAYLSPSTGCTDNCDYRGAYDP  682

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC + CG+P+QT YH+PR+W+    N+LV+ EE+GGDP+K+S  T    ++CS VSE  
Sbjct  683  FKCQKKCGQPAQTLYHIPRTWVHPGENLLVLHEELGGDPSKISLLTPTGQNICSIVSEDD  742

Query  457  PMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNA  278
            P P D W  +L    Q    + L C      I+ I FASFGTP+G CG+ S G C S + 
Sbjct  743  PPPADSWKPNLEFMSQN-PEVRLACG-QGWFIAAINFASFGTPEGHCGTVSPGNCHS-DM  799

Query  277  LSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
            L++V+KAC G   CS+ +S+   G+PC GV K  AVEA C+
Sbjct  800  LTIVQKACFGQEGCSIPISAAKLGDPCPGVVKRFAVEALCS  840



>gb|EYU22313.1| hypothetical protein MIMGU_mgv1a001532mg [Erythranthe guttata]
Length=801

 Score =   203 bits (517),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/206 (47%), Positives = 135/206 (66%), Gaps = 8/206 (4%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG+AW+NG  IGRYWP   + N  C   C+YRG +  +KC   CG+P+Q +YHVPRSW 
Sbjct  597  GKGLAWLNGNEIGRYWPIKASINEKCVQKCDYRGKFMPNKCNTGCGEPTQRWYHVPRSWF  656

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQ------KQ  410
            K SGN LV+FEE GGDPT++ F+ R+V S+C+ +S+ HP+  DM  S   G+      K+
Sbjct  657  KPSGNTLVIFEEKGGDPTQIRFSKRKVSSVCAHISQDHPLSEDMIESLQKGETGYPYKKK  716

Query  409  EGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSL  230
               +L+L+CP+S Q IS +KFASFG P G CG+++ G+C   N++S+V+KAC+    C +
Sbjct  717  ASVSLNLKCPVSTQ-ISDVKFASFGDPVGNCGAYAVGECHDPNSVSMVQKACLNRNECQV  775

Query  229  GVSSTTFG-NPCAGVTKSLAVEASCA  155
             +S   F    C  + K LAVEA C+
Sbjct  776  ELSGENFDIELCPNLVKKLAVEAVCS  801



>dbj|BAD91082.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=854

 Score =   203 bits (517),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 137/204 (67%), Gaps = 7/204 (3%)
 Frame = -1

Query  760  RGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPR  581
             G GKG  W+NGQSIGRYW  +  +NG C + C+Y G +   KC   CGKP+Q YYHVPR
Sbjct  643  EGMGKGQIWINGQSIGRYWTAF--ANGNC-NGCSYAGGFRPTKCQSGCGKPTQRYYHVPR  699

Query  580  SWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQE--  407
            SWLK + N+LV+FEE+GGDP+++S   R V S+CS V+E HP  +  W  +  G+ ++  
Sbjct  700  SWLKPTQNLLVLFEELGGDPSRISLVKRAVSSVCSEVAEYHPT-IKNWHIESYGKVEDFH  758

Query  406  GAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLG  227
               + L C    Q IS+IKFASFGTP GTCGS+  G C +T + SVV+K CIG + C++ 
Sbjct  759  SPKVHLRCN-PGQAISSIKFASFGTPLGTCGSYQEGTCHATTSYSVVQKKCIGKQRCAVT  817

Query  226  VSSTTFGNPCAGVTKSLAVEASCA  155
            +S++ FG+PC  V K L+VEA CA
Sbjct  818  ISNSNFGDPCPKVLKRLSVEAVCA  841



>ref|XP_004509327.1| PREDICTED: beta-galactosidase 3-like [Cicer arietinum]
Length=851

 Score =   203 bits (517),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 109/224 (49%), Positives = 145/224 (65%), Gaps = 9/224 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            +K NFDAP    P  L +  G GKG  W+NGQSIGRYW  +  +NG C D CNY G +  
Sbjct  626  HKTNFDAPEGDEPLALDM-EGMGKGQIWINGQSIGRYWTAF--ANGNCND-CNYAGSFRP  681

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC   CG+P+Q +YHVPRSWLK + N+LV+FEE+GG+P+K+S   R V S+C+ VSE H
Sbjct  682  QKCQLGCGQPTQRWYHVPRSWLKPTQNLLVIFEELGGNPSKISLVKRSVSSVCADVSEYH  741

Query  457  PMPVDMWTSDLSGQKQEGAA--LSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRST  284
            P  +  W  D  G+ +E  A  + L C    Q IS+IKFASFGTP GTCG++  G C S 
Sbjct  742  PN-IKNWHIDSYGKSEEFHAPKVHLHCS-PGQTISSIKFASFGTPLGTCGNYEQGACHSP  799

Query  283  NALSVVKKACIGLRNCSLGVSSTTFG-NPCAGVTKSLAVEASCA  155
             + ++++K C+G   C + VS++ FG +PC  V K L+VEA CA
Sbjct  800  TSYAILEKKCLGKPRCVVTVSNSNFGQDPCPRVMKRLSVEAVCA  843



>ref|XP_007034276.1| Beta galactosidase 9 isoform 3 [Theobroma cacao]
 gb|EOY05202.1| Beta galactosidase 9 isoform 3 [Theobroma cacao]
Length=697

 Score =   202 bits (514),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 147/230 (64%), Gaps = 15/230 (7%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA FDAP    P    +    GKG AWVNG  IGRYW    A   GC+ SC+YRG YN 
Sbjct  464  YKAYFDAPDGKEPVAFDLG-SMGKGQAWVNGHHIGRYW-NLVAPKDGCSKSCDYRGAYNP  521

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC+ NCGKP+Q++YH+PRSWL+++ N+LV+FEE GG+P ++S   R    LC++VSESH
Sbjct  522  NKCMTNCGKPTQSWYHIPRSWLQATNNLLVIFEENGGNPFEISVKLRVPRILCAQVSESH  581

Query  457  PMPVDMWTS--------DLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSH  302
               +  W           +S  K E   + L+C     +IS+I+FAS+GTP G+C +FS 
Sbjct  582  YPRLQKWFHPDVIHGKVSISDMKPE---IHLQCE-EGHIISSIEFASYGTPHGSCQNFSE  637

Query  301  GKCRSTNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASCA  155
            G C S N+LS+V KAC G  +C + VS++ F G+PC G+ K+LA+EA C 
Sbjct  638  GNCHSQNSLSMVSKACKGRNSCVIEVSNSGFGGDPCRGIVKTLAIEARCV  687



>ref|XP_006373075.1| beta-galactosidase family protein [Populus trichocarpa]
 gb|ERP50872.1| beta-galactosidase family protein [Populus trichocarpa]
Length=891

 Score =   203 bits (517),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 109/224 (49%), Positives = 146/224 (65%), Gaps = 7/224 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L +    GKG AWVNG  IGRYW T  +   GC  SC+YRG Y+S
Sbjct  660  YKTFFDAPSGVDPVALDLG-SMGKGQAWVNGHHIGRYW-TVVSPKDGC-GSCDYRGAYSS  716

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC  NCG P+QT+YHVPR+WL++S N+LVVFEE GG+P ++S   R    +C++VSESH
Sbjct  717  GKCRTNCGNPTQTWYHVPRAWLEASNNLLVVFEETGGNPFEISVKLRSAKVICAQVSESH  776

Query  457  PMPVDMWT-SDLSGQKQEGAALSLECPLSNQ---VISTIKFASFGTPQGTCGSFSHGKCR  290
              P+  W+ +DL+G       ++ E  L  Q   ++S+I+FAS+GTP G+C  FS G C 
Sbjct  777  YPPLRKWSRADLTGGNISRNDMTPEMHLKCQDGHIMSSIEFASYGTPNGSCQKFSRGNCH  836

Query  289  STNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            ++N+ SVV +AC G   C + +S+  FG+PC GV K+LAVEA C
Sbjct  837  ASNSSSVVTEACQGKNKCDIAISNAVFGDPCRGVIKTLAVEARC  880



>ref|XP_009390388.1| PREDICTED: beta-galactosidase 15 isoform X4 [Musa acuminata subsp. 
malaccensis]
Length=732

 Score =   202 bits (514),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 141/224 (63%), Gaps = 6/224 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L +    GKG AWVNG  IGRYW T  A   GC D C+YRG Y+ 
Sbjct  501  YKTTFDAPEGDDPIALDLG-SMGKGQAWVNGHGIGRYW-TLVAPKNGCRDYCDYRGAYHE  558

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC  NCG P+Q++YHVPR WL++S N+LV+FEE  G+P K+S       ++C+RV E+ 
Sbjct  559  NKCTTNCGLPTQSWYHVPREWLQASNNLLVIFEETSGNPWKISLRMHSTVTICARVWETD  618

Query  457  PMPVDMWTS-DLSGQKQEGAALSLECPL---SNQVISTIKFASFGTPQGTCGSFSHGKCR  290
              P+  W+  D   +K     ++ E  L      VIS I FAS+GTP G+C  FS GKC 
Sbjct  619  YPPLSTWSHPDFVNRKNLIDEVAPEMHLRCDEGHVISAITFASYGTPSGSCRKFSGGKCH  678

Query  289  STNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            + ++LSVV +AC G  NC++ VS+ TFG+PC   TK+LAVEA+C
Sbjct  679  AASSLSVVTEACQGRNNCTITVSNRTFGDPCRRTTKALAVEATC  722



>gb|ERM97946.1| hypothetical protein AMTR_s00117p00061070 [Amborella trichopoda]
Length=238

 Score =   191 bits (486),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 142/224 (63%), Gaps = 10/224 (4%)
 Frame = -1

Query  811  ANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDK  632
            A FDAP    P  L +    GKG AWVNG SIGRYW +  A   GC   C+YRG Y+  K
Sbjct  8    AYFDAPKGTSPVALDLG-SMGKGEAWVNGHSIGRYW-SLVAPKDGC-QKCDYRGAYHESK  64

Query  631  CLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPM  452
            C  NCG+ +Q +YH+PRSWL++S N+LV+FEE+GG+P ++S       ++C++V ESH  
Sbjct  65   CTTNCGQVTQRWYHIPRSWLQASDNLLVLFEEIGGNPLEISINLHATQTICAKVLESHYP  124

Query  451  PVDMWTSD--LSGQ---KQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRS  287
            P+D+W+    +SG+   +     LSL C    Q IS I FASFG P G C +F +G C +
Sbjct  125  PLDIWSHPDFISGKFLYQYVSPQLSLRCD-DGQKISAITFASFGDPYGNCQNFRYGTCHA  183

Query  286  TNALSVVKKACIGLRNCSLGVSSTTFG-NPCAGVTKSLAVEASC  158
             N+L++V KAC G  +C+L VS+  FG +PC G  KSLAVEA C
Sbjct  184  PNSLAIVSKACEGRSSCTLNVSNQAFGHDPCQGKLKSLAVEAKC  227



>ref|XP_003595331.1| Beta-galactosidase [Medicago truncatula]
 gb|AES65582.1| beta-galactosidase-like protein [Medicago truncatula]
Length=830

 Score =   203 bits (516),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 108/224 (48%), Positives = 140/224 (63%), Gaps = 25/224 (11%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDS-CNYRGPYN  641
            YK  F AP    P ++ + +G GKG AWVNG S+GRYWP+Y A   GC+D  C+YRG YN
Sbjct  628  YKTTFKAPLESDPIVVDL-QGMGKGYAWVNGHSLGRYWPSYNADEDGCSDDPCDYRGEYN  686

Query  640  SDKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSES  461
              KC+ NCGKPSQ +YHVPR +++   N LV+FEE+GG+P++++F T  VGS C+   E+
Sbjct  687  DTKCVSNCGKPSQRWYHVPRDFIEDGVNTLVLFEEIGGNPSQINFQTVIVGSACANAYEN  746

Query  460  HPMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
                                  +LE     + IS IKFASFG PQGTCG+F+ G C S N
Sbjct  747  K---------------------TLELSCHGRSISDIKFASFGNPQGTCGAFTKGSCESNN  785

Query  280  -ALSVVKKACIGLRNCSLGVSSTTFG-NPCAGVTKSLAVEASCA  155
             ALS+V+KAC+G  +CS+ VS  TFG   C  + K LAVEA CA
Sbjct  786  EALSLVQKACVGKESCSIDVSEKTFGATNCGNMVKRLAVEAVCA  829



>ref|XP_004288998.1| PREDICTED: beta-galactosidase 15-like [Fragaria vesca subsp. 
vesca]
Length=823

 Score =   202 bits (515),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 141/222 (64%), Gaps = 24/222 (11%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCT-DSCNYRGPYN  641
            YK  F AP    P ++ + +G GKG AWVNG SIGRYWP+Y A   GC+ ++C+YRG Y+
Sbjct  624  YKTTFKAPLGTEPVVVDL-QGLGKGHAWVNGHSIGRYWPSYLAPEDGCSVEACDYRGTYD  682

Query  640  SDKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSES  461
            ++KC+ NCGKP+Q +YHVPRS+L+   N LV+FEE GG+P+ ++F T  VG++C+   E+
Sbjct  683  NNKCVFNCGKPTQRWYHVPRSFLQDDENTLVLFEEFGGNPSYVNFQTIRVGTICANAYEN  742

Query  460  HPMPVDMWTSDLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTN  281
            H                     +LE     + IS IKFASFG P+GTCGSF  G C S  
Sbjct  743  H---------------------TLELACQGRSISAIKFASFGNPEGTCGSFKEGTCDSKT  781

Query  280  ALSVVKKACIGLRNCSLGVSSTTFGN-PCAGVTKSLAVEASC  158
            ALS+++K C+G   CS+ VS + FG+  C G+ K LAVEA C
Sbjct  782  ALSILQKECVGKEACSIDVSESMFGSTTCGGIVKRLAVEAVC  823



>emb|CDO99618.1| unnamed protein product [Coffea canephora]
Length=850

 Score =   202 bits (515),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 135/199 (68%), Gaps = 3/199 (2%)
 Frame = -1

Query  751  GKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPRSWL  572
            GKG AWVNG+SIGRYWP Y + + GCTD+C+YRG YN+ KCL+ CG+P+QT YH+PR WL
Sbjct  654  GKGQAWVNGRSIGRYWPAYHSPSTGCTDNCDYRGSYNAWKCLKKCGQPTQTLYHIPRHWL  713

Query  571  KSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQEGAALS  392
             +  N+LV+ EE+GGDP+K+S  TR    +C+ +SE+   P D W   + G   E   + 
Sbjct  714  HAGENILVLHEEIGGDPSKISLVTRTGQEICASLSEADLPPSDTWNPKV-GFSSEVPQVR  772

Query  391  LECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLGVSSTT  212
            L C      I++I+FASFGTP+G CG++  G C + N  S+ ++AC+G + CS+ V +  
Sbjct  773  LTCDQGWH-IASIRFASFGTPEGDCGAYMQGSCHA-NVTSIYQQACVGKQQCSVPVFAAN  830

Query  211  FGNPCAGVTKSLAVEASCA  155
             G+PC GV K +AV+A C+
Sbjct  831  LGDPCPGVLKRVAVQALCS  849



>ref|XP_009390387.1| PREDICTED: beta-galactosidase 15 isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=805

 Score =   202 bits (514),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 141/224 (63%), Gaps = 6/224 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L +    GKG AWVNG  IGRYW T  A   GC D C+YRG Y+ 
Sbjct  574  YKTTFDAPEGDDPIALDLG-SMGKGQAWVNGHGIGRYW-TLVAPKNGCRDYCDYRGAYHE  631

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC  NCG P+Q++YHVPR WL++S N+LV+FEE  G+P K+S       ++C+RV E+ 
Sbjct  632  NKCTTNCGLPTQSWYHVPREWLQASNNLLVIFEETSGNPWKISLRMHSTVTICARVWETD  691

Query  457  PMPVDMWTS-DLSGQKQEGAALSLECPL---SNQVISTIKFASFGTPQGTCGSFSHGKCR  290
              P+  W+  D   +K     ++ E  L      VIS I FAS+GTP G+C  FS GKC 
Sbjct  692  YPPLSTWSHPDFVNRKNLIDEVAPEMHLRCDEGHVISAITFASYGTPSGSCRKFSGGKCH  751

Query  289  STNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            + ++LSVV +AC G  NC++ VS+ TFG+PC   TK+LAVEA+C
Sbjct  752  AASSLSVVTEACQGRNNCTITVSNRTFGDPCRRTTKALAVEATC  795



>gb|KCW69754.1| hypothetical protein EUGRSUZ_F031301, partial [Eucalyptus grandis]
Length=291

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/224 (47%), Positives = 141/224 (63%), Gaps = 8/224 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  F+AP    P  L +     KG  W+NGQS+GRYWP Y AS  G  +SCNY G +N 
Sbjct  73   YKTIFNAPGGSAPLALDMDSM-SKGQVWINGQSLGRYWPAYKAS--GTCNSCNYTGTFNE  129

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KCL NCG+ SQ +YH+PRSWL  +GN+LVV EE GG+P  +S   RE+ S+CS + E  
Sbjct  130  NKCLSNCGEASQRWYHIPRSWLYPTGNLLVVLEEWGGEPNGISLVKREIDSVCSDIFEWQ  189

Query  457  PMPVDMWTSDLSGQ--KQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRST  284
            P  ++ W    SG+  K     + L C    Q IS+I+FASFGTP+GTCGSF  G C + 
Sbjct  190  PTLMN-WQMQASGKVTKPLRPKVHLWCSPGQQ-ISSIRFASFGTPEGTCGSFRQGSCHAF  247

Query  283  NALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASCA  155
            ++  V ++ C+GL +CS+ V+   F G+PC  V K L+VEA C+
Sbjct  248  HSYDVFERTCLGLNSCSVTVAPEIFGGDPCPNVMKKLSVEAVCS  291



>ref|XP_007034274.1| Beta galactosidase 9 isoform 1 [Theobroma cacao]
 gb|EOY05200.1| Beta galactosidase 9 isoform 1 [Theobroma cacao]
Length=890

 Score =   202 bits (514),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 147/230 (64%), Gaps = 15/230 (7%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YKA FDAP    P    +    GKG AWVNG  IGRYW    A   GC+ SC+YRG YN 
Sbjct  657  YKAYFDAPDGKEPVAFDLG-SMGKGQAWVNGHHIGRYW-NLVAPKDGCSKSCDYRGAYNP  714

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC+ NCGKP+Q++YH+PRSWL+++ N+LV+FEE GG+P ++S   R    LC++VSESH
Sbjct  715  NKCMTNCGKPTQSWYHIPRSWLQATNNLLVIFEENGGNPFEISVKLRVPRILCAQVSESH  774

Query  457  PMPVDMWTS--------DLSGQKQEGAALSLECPLSNQVISTIKFASFGTPQGTCGSFSH  302
               +  W           +S  K E   + L+C     +IS+I+FAS+GTP G+C +FS 
Sbjct  775  YPRLQKWFHPDVIHGKVSISDMKPE---IHLQCE-EGHIISSIEFASYGTPHGSCQNFSE  830

Query  301  GKCRSTNALSVVKKACIGLRNCSLGVSSTTF-GNPCAGVTKSLAVEASCA  155
            G C S N+LS+V KAC G  +C + VS++ F G+PC G+ K+LA+EA C 
Sbjct  831  GNCHSQNSLSMVSKACKGRNSCVIEVSNSGFGGDPCRGIVKTLAIEARCV  880



>ref|XP_008338023.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
 ref|XP_008367947.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
Length=853

 Score =   202 bits (514),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 137/204 (67%), Gaps = 7/204 (3%)
 Frame = -1

Query  760  RGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNSDKCLRNCGKPSQTYYHVPR  581
             G GKG  W+NGQSIGRYW  +  +NG C + C+Y G +   KC   CGKP+Q YYHVPR
Sbjct  642  EGMGKGQIWINGQSIGRYWTAF--ANGNC-NGCSYAGGFRPTKCQLGCGKPTQRYYHVPR  698

Query  580  SWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESHPMPVDMWTSDLSGQKQE--  407
            SWLK + N+LV+FEE+GGDP+++S   R V S+CS V+E HP  +  W  +  G+ ++  
Sbjct  699  SWLKPTQNLLVLFEELGGDPSRISLVKRAVSSVCSEVAEYHPT-IKNWHIESYGKVEDFH  757

Query  406  GAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRSTNALSVVKKACIGLRNCSLG  227
               + L C    Q IS+IKFASFGTP GTCGS+  G C +T + SV++K CIG + C++ 
Sbjct  758  SPKVHLRCN-PGQAISSIKFASFGTPLGTCGSYQEGTCHATTSYSVLQKKCIGKQRCAVT  816

Query  226  VSSTTFGNPCAGVTKSLAVEASCA  155
            +S++ FG+PC  V K L+VEA CA
Sbjct  817  ISNSNFGDPCPKVLKRLSVEAVCA  840



>ref|XP_004287850.1| PREDICTED: beta-galactosidase 3 [Fragaria vesca subsp. vesca]
Length=853

 Score =   202 bits (514),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 147/223 (66%), Gaps = 8/223 (4%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            +K+ FDAP    P  L +  G GKG  W+NGQS+GRYW  +  +NG C + C+Y G +  
Sbjct  624  HKSIFDAPEGDEPLALDM-EGMGKGQIWINGQSVGRYWTAF--ANGDC-NGCSYAGGFKP  679

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
             KC   CG+P+Q YYHVPRSWLK + N+LV+FEE+GGDP+++S   R V ++C+ V+E H
Sbjct  680  TKCQTGCGQPTQRYYHVPRSWLKPTQNLLVIFEELGGDPSRVSIVKRSVSTVCAEVAEYH  739

Query  457  PMPVDMWTSDLSGQKQE--GAALSLECPLSNQVISTIKFASFGTPQGTCGSFSHGKCRST  284
            P  +  W  +  G+ Q+     + L C    Q IS+IKFASFGTP GTCG++  G C ++
Sbjct  740  PT-IKNWHIESYGKVQDFHSPKVHLRCN-PGQSISSIKFASFGTPFGTCGTYQQGSCHAS  797

Query  283  NALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASCA  155
             + SV++K CIG + C++ +S+T FG+PC  V K L+VEA CA
Sbjct  798  TSYSVIEKKCIGKQRCAVTISNTNFGDPCPKVLKRLSVEAVCA  840



>ref|XP_009390385.1| PREDICTED: beta-galactosidase 15 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=888

 Score =   202 bits (514),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 141/224 (63%), Gaps = 6/224 (3%)
 Frame = -1

Query  817  YKANFDAPWR**PRLL*ISRGWGKGVAWVNGQSIGRYWPTYTASNGGCTDSCNYRGPYNS  638
            YK  FDAP    P  L +    GKG AWVNG  IGRYW T  A   GC D C+YRG Y+ 
Sbjct  657  YKTTFDAPEGDDPIALDLG-SMGKGQAWVNGHGIGRYW-TLVAPKNGCRDYCDYRGAYHE  714

Query  637  DKCLRNCGKPSQTYYHVPRSWLKSSGNVLVVFEEVGGDPTKLSFATREVGSLCSRVSESH  458
            +KC  NCG P+Q++YHVPR WL++S N+LV+FEE  G+P K+S       ++C+RV E+ 
Sbjct  715  NKCTTNCGLPTQSWYHVPREWLQASNNLLVIFEETSGNPWKISLRMHSTVTICARVWETD  774

Query  457  PMPVDMWTS-DLSGQKQEGAALSLECPL---SNQVISTIKFASFGTPQGTCGSFSHGKCR  290
              P+  W+  D   +K     ++ E  L      VIS I FAS+GTP G+C  FS GKC 
Sbjct  775  YPPLSTWSHPDFVNRKNLIDEVAPEMHLRCDEGHVISAITFASYGTPSGSCRKFSGGKCH  834

Query  289  STNALSVVKKACIGLRNCSLGVSSTTFGNPCAGVTKSLAVEASC  158
            + ++LSVV +AC G  NC++ VS+ TFG+PC   TK+LAVEA+C
Sbjct  835  AASSLSVVTEACQGRNNCTITVSNRTFGDPCRRTTKALAVEATC  878



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1724604950500