BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6826

Length=694
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009628354.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    172   2e-50   Nicotiana tomentosiformis
ref|XP_008386160.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    176   5e-50   Malus domestica [apple tree]
ref|XP_006362955.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    176   7e-50   
gb|KDO74061.1|  hypothetical protein CISIN_1g0225552mg                  173   1e-49   Citrus sinensis [apfelsine]
ref|XP_006451886.1|  hypothetical protein CICLE_v10009061mg             173   1e-49   
ref|XP_009784749.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    175   1e-49   Nicotiana sylvestris
ref|XP_009356824.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    175   2e-49   Pyrus x bretschneideri [bai li]
ref|XP_009351030.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    174   5e-49   Pyrus x bretschneideri [bai li]
ref|XP_009789468.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    173   6e-49   Nicotiana sylvestris
ref|XP_006451890.1|  hypothetical protein CICLE_v10009061mg             173   8e-49   Citrus clementina [clementine]
gb|KFK35754.1|  hypothetical protein AALP_AA4G032100                    173   8e-49   Arabis alpina [alpine rockcress]
ref|XP_004248267.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    172   1e-48   Solanum lycopersicum
ref|XP_010060550.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    173   1e-48   Eucalyptus grandis [rose gum]
ref|XP_008366929.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    172   2e-48   Malus domestica [apple tree]
ref|XP_008226639.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    172   2e-48   Prunus mume [ume]
ref|XP_002316900.1|  cytidylyltransferase family protein                172   2e-48   Populus trichocarpa [western balsam poplar]
ref|XP_011029470.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    172   2e-48   Populus euphratica
emb|CDP05912.1|  unnamed protein product                                171   4e-48   Coffea canephora [robusta coffee]
ref|XP_010242912.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    171   4e-48   Nelumbo nucifera [Indian lotus]
ref|XP_006392844.1|  hypothetical protein EUTSA_v10011698mg             171   4e-48   Eutrema salsugineum [saltwater cress]
ref|XP_002517281.1|  cmp-2-keto-3-deoctulosonate (cmp-kdo) cytidy...    171   6e-48   Ricinus communis
gb|EYU44936.1|  hypothetical protein MIMGU_mgv1a0108732mg               165   8e-48   Erythranthe guttata [common monkey flower]
emb|CDY47563.1|  BnaC03g69060D                                          170   1e-47   Brassica napus [oilseed rape]
ref|XP_009107014.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    169   2e-47   Brassica rapa
emb|CDY02531.1|  BnaA08g01380D                                          169   2e-47   
ref|XP_006305471.1|  hypothetical protein CARUB_v10009902mg             169   2e-47   Capsella rubella
ref|XP_008225094.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    170   2e-47   Prunus mume [ume]
ref|XP_002894417.1|  cytidylyltransferase family                        169   3e-47   Arabidopsis lyrata subsp. lyrata
ref|XP_010694996.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    169   3e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004295148.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    169   3e-47   Fragaria vesca subsp. vesca
ref|XP_009606581.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    169   3e-47   Nicotiana tomentosiformis
ref|NP_175708.2|  3-deoxy-manno-octulosonate cytidylyltransferase       169   4e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004514100.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    168   6e-47   Cicer arietinum [garbanzo]
ref|XP_012084951.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    168   9e-47   Jatropha curcas
gb|KJB61818.1|  hypothetical protein B456_009G389800                    167   1e-46   Gossypium raimondii
ref|XP_010545826.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    167   1e-46   Tarenaya hassleriana [spider flower]
ref|XP_010272461.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    167   1e-46   Nelumbo nucifera [Indian lotus]
ref|XP_007133176.1|  hypothetical protein PHAVU_011G157900g             167   2e-46   Phaseolus vulgaris [French bean]
ref|XP_010479831.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    167   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_002284913.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    167   2e-46   Vitis vinifera
ref|XP_010500927.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    167   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_007211713.1|  hypothetical protein PRUPE_ppa009339mg             167   2e-46   Prunus persica
ref|XP_010462154.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    167   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_007021424.1|  Nucleotide-diphospho-sugar transferases supe...    167   3e-46   
ref|XP_008452260.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    166   3e-46   Cucumis melo [Oriental melon]
gb|KEH41941.1|  3-deoxy-manno-octulosonate cytidylyltransferase         172   3e-46   Medicago truncatula
emb|CAN62581.1|  hypothetical protein VITISV_036570                     166   4e-46   Vitis vinifera
ref|XP_007213820.1|  hypothetical protein PRUPE_ppa009246mg             166   5e-46   Prunus persica
ref|XP_002534236.1|  cmp-2-keto-3-deoctulosonate (cmp-kdo) cytidy...    166   6e-46   Ricinus communis
ref|XP_010924427.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    165   9e-46   Elaeis guineensis
ref|XP_009124898.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    164   1e-45   Brassica rapa
emb|CAN72248.1|  hypothetical protein VITISV_008336                     163   2e-45   Vitis vinifera
ref|XP_010919659.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    164   2e-45   Elaeis guineensis
ref|XP_002263680.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    164   2e-45   Vitis vinifera
ref|XP_010919652.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    164   2e-45   Elaeis guineensis
ref|XP_003540098.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    164   2e-45   Glycine max [soybeans]
ref|XP_011004626.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    163   5e-45   Populus euphratica
gb|ABK23054.1|  unknown                                                 163   6e-45   Picea sitchensis
ref|NP_001056314.1|  Os05g0561500                                       163   8e-45   
ref|XP_006654782.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    163   8e-45   Oryza brachyantha
ref|XP_009406254.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    162   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004961235.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    162   2e-44   Setaria italica
emb|CDY69672.1|  BnaA05g35640D                                          162   2e-44   Brassica napus [oilseed rape]
ref|XP_003526068.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    162   3e-44   Glycine max [soybeans]
ref|XP_008809046.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    162   4e-44   Phoenix dactylifera
dbj|BAK04151.1|  predicted protein                                      161   4e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006370268.1|  cytidylyltransferase family protein                160   4e-44   Populus trichocarpa [western balsam poplar]
ref|XP_003567908.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    160   6e-44   Brachypodium distachyon [annual false brome]
ref|XP_011098319.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    161   6e-44   
gb|KHN37186.1|  3-deoxy-manno-octulosonate cytidylyltransferase         160   7e-44   Glycine soja [wild soybean]
ref|XP_011082674.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    160   7e-44   Sesamum indicum [beniseed]
gb|EEC79690.1|  hypothetical protein OsI_20971                          160   8e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_006849964.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    160   8e-44   Amborella trichopoda
ref|NP_001105657.1|  CMP-KDO synthetase1 precursor                      157   9e-43   Zea mays [maize]
gb|ACG42455.1|  3-deoxy-manno-octulosonate cytidylyltransferase         157   1e-42   Zea mays [maize]
ref|XP_010910968.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    155   1e-42   Elaeis guineensis
ref|XP_004133708.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    157   1e-42   Cucumis sativus [cucumbers]
gb|ERN06581.1|  hypothetical protein AMTR_s00058p00143650               153   6e-42   Amborella trichopoda
emb|CDY55874.1|  BnaC06g41770D                                          159   9e-42   Brassica napus [oilseed rape]
ref|XP_010108191.1|  3-deoxy-manno-octulosonate cytidylyltransferase    154   1e-41   
ref|XP_002441511.1|  hypothetical protein SORBIDRAFT_09g028380          153   5e-41   Sorghum bicolor [broomcorn]
emb|CAB89847.1|  CMP-KDO synthetase                                     150   1e-40   Zea mays [maize]
ref|XP_006377770.1|  hypothetical protein POPTR_0011s12080g             150   4e-40   
gb|EPS72950.1|  hypothetical protein M569_01801                         149   7e-40   Genlisea aurea
gb|KGN56240.1|  hypothetical protein Csa_3G104930                       142   3e-37   Cucumis sativus [cucumbers]
ref|XP_002981117.1|  hypothetical protein SELMODRAFT_113793             136   5e-35   
ref|XP_001784950.1|  predicted protein                                  137   6e-35   
ref|XP_002982588.1|  hypothetical protein SELMODRAFT_116934             134   2e-34   
gb|AAL06487.1|AF411798_1  F14G24.28/F14G24.28                           127   7e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009124899.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    122   2e-29   Brassica rapa
gb|KDO74063.1|  hypothetical protein CISIN_1g0225552mg                  119   6e-29   Citrus sinensis [apfelsine]
gb|EMT25203.1|  hypothetical protein F775_52244                         117   5e-28   
ref|XP_006451889.1|  hypothetical protein CICLE_v10009061mg             117   9e-28   
ref|XP_010231033.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    118   1e-27   Brachypodium distachyon [annual false brome]
ref|XP_007508518.1|  3-deoxy-manno-octulosonate cytidylyltransferase    117   2e-27   Bathycoccus prasinos
gb|EMS68844.1|  3-deoxy-manno-octulosonate cytidylyltransferase         115   2e-27   Triticum urartu
ref|XP_005843072.1|  hypothetical protein CHLNCDRAFT_33280              115   6e-27   Chlorella variabilis
ref|XP_008810228.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    113   2e-26   Phoenix dactylifera
gb|ACN28946.1|  unknown                                                 110   5e-26   Zea mays [maize]
ref|XP_005648194.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...    112   9e-26   Coccomyxa subellipsoidea C-169
gb|KDD75573.1|  cytidylyltransferase                                    111   1e-25   Helicosporidium sp. ATCC 50920
gb|AFW81112.1|  hypothetical protein ZEAMMB73_836886                    110   2e-25   
gb|KCW67327.1|  hypothetical protein EUGRSUZ_F01114                     107   1e-24   Eucalyptus grandis [rose gum]
ref|XP_011396550.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   5e-23   Auxenochlorella protothecoides
ref|WP_032125452.1|  3-deoxy-manno-octulosonate cytidylyltransferase  96.7    2e-20   Candidatus Protochlamydia massiliensis
emb|CCB91546.1|  3-deoxy-manno-octulosonate cytidylyltransferase      90.5    3e-18   Waddlia chondrophila 2032/99
ref|WP_013182177.1|  3-deoxy-manno-octulosonate cytidylyltransferase  90.5    4e-18   Waddlia chondrophila
ref|WP_044044912.1|  3-deoxy-manno-octulosonate cytidylyltransferase  88.2    2e-17   
sp|Q6MD00.1|KDSB_PARUW  RecName: Full=3-deoxy-manno-octulosonate ...  88.2    3e-17   Candidatus Protochlamydia amoebophila UWE25
ref|WP_013925075.1|  3-deoxy-manno-octulosonate cytidylyltransferase  87.4    4e-17   Parachlamydia acanthamoebae
ref|WP_006339767.1|  3-deoxy-manno-octulosonate cytidylyltransferase  87.4    5e-17   Parachlamydia acanthamoebae
ref|WP_041017103.1|  hypothetical protein                             86.3    9e-17   Criblamydia sequanensis
gb|KIC72214.1|  3-deoxy-manno-octulosonate cytidylyltransferase       86.3    1e-16   Candidatus Protochlamydia amoebophila
ref|WP_039357883.1|  3-deoxy-manno-octulosonate cytidylyltransferase  86.3    1e-16   
ref|WP_042280529.1|  3-deoxy-manno-octulosonate cytidylyltransferase  85.5    2e-16   
ref|WP_021169307.1|  3-deoxy-manno-octulosonate cytidylyltransferase  84.7    3e-16   Sporomusa
ref|WP_044882342.1|  3-deoxy-manno-octulosonate cytidylyltransferase  84.7    4e-16   Neochlamydia sp. EPS4
gb|KIC73798.1|  3-deoxy-manno-octulosonate cytidylyltransferase       84.7    4e-16   Neochlamydia sp. EPS4
ref|WP_042238826.1|  3-deoxy-manno-octulosonate cytidylyltransferase  83.2    1e-15   Neochlamydia sp. S13
ref|WP_039384606.1|  3-deoxy-manno-octulosonate cytidylyltransferase  82.4    2e-15   Neochlamydia sp. TUME1
ref|WP_023053353.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  81.3    6e-15   Megasphaera sp. BV3C16-1
ref|WP_006789384.1|  3-deoxy-manno-octulosonate cytidylyltransferase  80.9    7e-15   Anaeroglobus geminatus
ref|WP_042102883.1|  3-deoxy-manno-octulosonate cytidylyltransferase  80.1    1e-14   Parachlamydiaceae bacterium HS-T3
ref|WP_016483970.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  79.3    2e-14   Chthonomonas calidirosea
ref|WP_008701006.1|  3-deoxy-manno-octulosonate cytidylyltransferase  79.0    3e-14   Fusobacterium nucleatum
ref|WP_008691589.1|  3-deoxy-manno-octulosonate cytidylyltransferase  78.6    4e-14   Fusobacterium nucleatum
ref|WP_023040060.1|  3-deoxy-manno-octulosonate cytidylyltransferase  78.6    4e-14   Fusobacterium nucleatum
ref|WP_007392951.1|  3-deoxy-manno-octulosonate cytidylyltransferase  78.6    4e-14   Megasphaera sp. UPII 135-E
ref|WP_008801252.1|  3-deoxy-manno-octulosonate cytidylyltransferase  78.6    4e-14   Fusobacterium gonidiaformans
ref|WP_044950976.1|  3-deoxy-manno-octulosonate cytidylyltransferase  78.2    7e-14   Acidobacteriaceae bacterium KBS 96
ref|WP_008798334.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...  77.8    8e-14   Fusobacterium
ref|WP_032836063.1|  3-deoxy-manno-octulosonate cytidylyltransferase  77.8    8e-14   Fusobacterium
ref|WP_005898010.1|  3-deoxy-manno-octulosonate cytidylyltransferase  77.8    8e-14   Fusobacterium nucleatum
ref|WP_005912467.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...  77.4    8e-14   Fusobacterium
ref|WP_005888288.1|  3-deoxy-manno-octulosonate cytidylyltransferase  77.4    8e-14   Fusobacterium
ref|WP_008795418.1|  3-deoxy-manno-octulosonate cytidylyltransferase  77.4    9e-14   Fusobacterium nucleatum
ref|WP_004097334.1|  3-deoxy-manno-octulosonate cytidylyltransferase  77.4    1e-13   Acetonema longum
ref|WP_006940965.1|  3-deoxy-manno-octulosonate cytidylyltransferase  77.4    1e-13   Megasphaera micronuciformis
gb|EFD81876.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase     76.6    2e-13   
ref|WP_023036679.1|  3-deoxy-manno-octulosonate cytidylyltransferase  76.3    2e-13   Fusobacterium nucleatum
ref|WP_013300580.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  76.3    2e-13   Parvularcula bermudensis
ref|WP_029599951.1|  3-deoxy-manno-octulosonate cytidylyltransferase  76.3    3e-13   Fusobacterium nucleatum
ref|WP_005952137.1|  3-deoxy-manno-octulosonate cytidylyltransferase  76.3    3e-13   Fusobacterium
ref|WP_009353664.1|  3-deoxy-manno-octulosonate cytidylyltransferase  75.9    3e-13   Veillonella sp. oral taxon 780
ref|WP_029493966.1|  3-deoxy-manno-octulosonate cytidylyltransferase  75.9    3e-13   Fusobacterium hwasookii
ref|WP_005915010.1|  3-deoxy-manno-octulosonate cytidylyltransferase  75.9    3e-13   Fusobacterium hwasookii
ref|WP_029492366.1|  3-deoxy-manno-octulosonate cytidylyltransferase  75.9    3e-13   Fusobacterium hwasookii
ref|WP_029757650.1|  3-deoxy-manno-octulosonate cytidylyltransferase  75.9    3e-13   Fusobacterium nucleatum
ref|WP_022070061.1|  3-deoxy-manno-octulosonate cytidylyltransferase  75.9    3e-13   
ref|WP_022198711.1|  3-deoxy-manno-octulosonate cytidylyltransferase  75.9    3e-13   Akkermansia muciniphila
ref|WP_012419228.1|  3-deoxy-manno-octulosonate cytidylyltransferase  75.9    4e-13   Akkermansia muciniphila
ref|WP_004376083.1|  3-deoxy-manno-octulosonate cytidylyltransferase  75.9    4e-13   Prevotella oris
ref|WP_027890144.1|  3-deoxy-manno-octulosonate cytidylyltransferase  75.5    4e-13   Megamonas hypermegale
ref|WP_022397535.1|  3-deoxy-manno-octulosonate cytidylyltransferase  75.5    4e-13   Akkermansia muciniphila
ref|WP_031930055.1|  3-deoxy-manno-octulosonate cytidylyltransferase  75.5    5e-13   Akkermansia muciniphila
ref|WP_018499034.1|  3-deoxy-manno-octulosonate cytidylyltransferase  75.1    5e-13   Leptotrichia wadei
ref|WP_023041210.1|  3-deoxy-manno-octulosonate cytidylyltransferase  75.1    6e-13   Fusobacterium nucleatum
ref|WP_011016663.1|  3-deoxy-manno-octulosonate cytidylyltransferase  75.1    6e-13   Fusobacterium nucleatum
ref|WP_005903438.1|  3-deoxy-manno-octulosonate cytidylyltransferase  75.1    6e-13   Fusobacterium nucleatum
gb|EEV87699.1|  hypothetical protein HMPREF0198_2231                  72.8    6e-13   Cardiobacterium hominis ATCC 15826
emb|CDZ81480.1|  3-deoxy-manno-octulosonate cytidylyltransferase      75.1    6e-13   Candidatus Rubidus massiliensis
ref|WP_032846284.1|  3-deoxy-manno-octulosonate cytidylyltransferase  75.1    6e-13   Fusobacterium sp. CM22
ref|WP_038673945.1|  3-deoxy-manno-octulosonate cytidylyltransferase  74.7    7e-13   Pelosinus sp. UFO1
ref|WP_008566021.1|  3-deoxy-manno-octulosonate cytidylyltransferase  75.1    7e-13   Prevotella maculosa
ref|WP_040355896.1|  3-deoxy-manno-octulosonate cytidylyltransferase  72.8    7e-13   
ref|WP_009646350.1|  3-deoxy-manno-octulosonate cytidylyltransferase  74.7    8e-13   Selenomonas sp. CM52
ref|WP_021589283.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  74.7    8e-13   Prevotella baroniae
ref|WP_027444530.1|  3-deoxy-manno-octulosonate cytidylyltransferase  74.7    8e-13   Prevotella baroniae
gb|EGQ75432.1|  3-deoxy-manno-octulosonate cytidylyltransferase       74.7    8e-13   Fusobacterium nucleatum subsp. animalis ATCC 51191
ref|WP_006190698.1|  3-deoxy-manno-octulosonate cytidylyltransferase  74.7    8e-13   Selenomonas sputigena
ref|WP_005886566.1|  3-deoxy-manno-octulosonate cytidylyltransferase  74.7    9e-13   Fusobacterium mortiferum
ref|WP_006556419.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  74.7    9e-13   Veillonella seminalis
ref|WP_004370973.1|  3-deoxy-manno-octulosonate cytidylyltransferase  74.3    1e-12   Prevotella oris
ref|WP_026738165.1|  3-deoxy-manno-octulosonate cytidylyltransferase  74.3    1e-12   Leptotrichia goodfellowii
ref|WP_029598986.1|  3-deoxy-manno-octulosonate cytidylyltransferase  74.3    1e-12   Fusobacterium nucleatum
ref|WP_004336679.1|  3-deoxy-manno-octulosonate cytidylyltransferase  74.3    1e-12   Prevotella bivia
ref|WP_026747761.1|  3-deoxy-manno-octulosonate cytidylyltransferase  74.3    1e-12   Leptotrichia trevisanii
ref|WP_018920860.1|  3-deoxy-manno-octulosonate cytidylyltransferase  74.3    1e-12   Prevotella oris
ref|WP_044504519.1|  3-deoxy-manno-octulosonate cytidylyltransferase  74.3    1e-12   Megasphaera massiliensis
ref|WP_008821758.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.9    1e-12   Fusobacterium periodonticum
ref|WP_018451254.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.9    1e-12   Leptotrichia shahii
ref|WP_023039082.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.9    1e-12   Fusobacterium nucleatum
ref|WP_021720674.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.9    1e-12   
ref|WP_027339486.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.9    2e-12   Halonatronum saccharophilum
ref|WP_022121184.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.9    2e-12   Prevotella copri
ref|WP_009144992.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.9    2e-12   Phascolarctobacterium succinatutens
ref|WP_009422816.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.9    2e-12   Fusobacterium sp. oral taxon 370
ref|WP_021840892.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.9    2e-12   
ref|WP_022437378.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.9    2e-12   
ref|WP_005970484.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.6    2e-12   Fusobacterium periodonticum
ref|WP_036862020.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.6    2e-12   Prevotella bivia
ref|WP_005908738.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.6    2e-12   Fusobacterium nucleatum
ref|WP_010522394.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.6    2e-12   Aquimarina agarivorans
ref|WP_015837883.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.6    2e-12   Geobacter sp. M21
ref|WP_035904850.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.6    2e-12   Fusobacterium necrophorum
ref|WP_005963337.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.6    2e-12   Fusobacterium necrophorum
ref|WP_021746106.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  73.6    2e-12   Leptotrichia wadei
ref|WP_029545960.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.6    2e-12   Selenomonas ruminantium
ref|WP_040637138.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.2    2e-12   Mitsuokella sp. oral taxon 131
ref|WP_012030648.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.2    3e-12   Dichelobacter nodosus
gb|ERL04986.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase     73.2    3e-12   Mitsuokella sp. oral taxon 131 str. W9106
ref|WP_005954817.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.2    3e-12   Fusobacterium necrophorum
ref|WP_005967304.1|  3-deoxy-manno-octulosonate cytidylyltransferase  73.2    3e-12   Fusobacterium periodonticum
gb|ETI35980.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase     73.2    3e-12   Phytophthora parasitica P1569
ref|WP_021766458.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  73.2    3e-12   Leptotrichia sp. oral taxon 215
ref|XP_008896315.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  73.2    3e-12   Phytophthora parasitica INRA-310
ref|WP_035937413.1|  3-deoxy-manno-octulosonate cytidylyltransferase  72.8    4e-12   Fusobacterium necrophorum
ref|WP_012647355.1|  3-deoxy-manno-octulosonate cytidylyltransferase  72.8    4e-12   Geobacter daltonii
ref|WP_004512092.1|  3-deoxy-manno-octulosonate cytidylyltransferase  72.8    4e-12   Geobacter metallireducens
ref|WP_041262700.1|  3-deoxy-manno-octulosonate cytidylyltransferase  72.8    4e-12   Geobacter bemidjiensis
ref|WP_013446517.1|  3-deoxy-manno-octulosonate cytidylyltransferase  72.8    4e-12   Paludibacter propionicigenes
sp|B5E8N2.2|KDSB_GEOBB  RecName: Full=3-deoxy-manno-octulosonate ...  72.8    4e-12   Geobacter bemidjiensis Bem
ref|WP_008451097.1|  3-deoxy-manno-octulosonate cytidylyltransferase  72.8    4e-12   Prevotella amnii
ref|WP_019035633.1|  3-deoxy-manno-octulosonate cytidylyltransferase  72.8    4e-12   Prevotella amnii
ref|WP_007939017.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...  72.4    4e-12   Pelosinus
ref|WP_022818764.1|  3-deoxy-manno-octulosonate cytidylyltransferase  72.4    5e-12   Fusobacterium russii
ref|WP_024992681.1|  3-deoxy-manno-octulosonate cytidylyltransferase  72.4    5e-12   Prevotella amnii
ref|WP_013279112.1|  3-deoxy-manno-octulosonate cytidylyltransferase  72.4    5e-12   Acetohalobium arabaticum
ref|WP_007952084.1|  3-deoxy-manno-octulosonate cytidylyltransferase  72.4    5e-12   Pelosinus fermentans
ref|WP_026560968.1|  3-deoxy-manno-octulosonate cytidylyltransferase  72.4    5e-12   Bacillus sp. J37
ref|WP_007290534.1|  3-deoxy-manno-octulosonate cytidylyltransferase  72.0    6e-12   Thermosinus carboxydivorans
ref|WP_005957718.1|  3-deoxy-manno-octulosonate cytidylyltransferase  72.0    6e-12   Fusobacterium necrophorum
ref|WP_020700515.1|  hypothetical protein                             72.0    7e-12   Selenomonas bovis
ref|WP_011687872.1|  3-deoxy-manno-octulosonate cytidylyltransferase  72.0    8e-12   Candidatus Solibacter usitatus
ref|WP_031585671.1|  3-deoxy-manno-octulosonate cytidylyltransferase  72.0    8e-12   Selenomonas bovis
ref|WP_007390720.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...  72.0    8e-12   Megasphaera
ref|WP_013265234.1|  3-deoxy-manno-octulosonate cytidylyltransferase  72.0    8e-12   Prevotella melaninogenica
ref|WP_007958966.1|  3-deoxy-manno-octulosonate cytidylyltransferase  71.6    8e-12   Pelosinus fermentans
ref|WP_028571361.1|  3-deoxy-manno-octulosonate cytidylyltransferase  71.6    9e-12   Desulfonatronum lacustre
ref|XP_007511142.1|  3-deoxy-manno-octulosonate cytidylyltransferase  72.8    1e-11   Bathycoccus prasinos
ref|WP_025839275.1|  3-deoxy-manno-octulosonate cytidylyltransferase  71.6    1e-11   Prevotella scopos
ref|WP_026687436.1|  3-deoxy-manno-octulosonate cytidylyltransferase  71.6    1e-11   Azovibrio restrictus
gb|ERK55527.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase     71.6    1e-11   Leptotrichia sp. oral taxon 879 str. F0557
ref|WP_005641144.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...  71.6    1e-11   Parabacteroides merdae
ref|WP_039901259.1|  3-deoxy-manno-octulosonate cytidylyltransferase  71.2    1e-11   Leptotrichia sp. oral taxon 879
ref|WP_011939821.1|  3-deoxy-manno-octulosonate cytidylyltransferase  71.2    1e-11   Geobacter uraniireducens
ref|WP_033171540.1|  3-deoxy-manno-octulosonate cytidylyltransferase  71.2    1e-11   Selenomonas sp. ND2010
ref|WP_005976139.1|  3-deoxy-manno-octulosonate cytidylyltransferase  71.2    1e-11   Fusobacterium ulcerans
ref|WP_006846719.1|  3-deoxy-manno-octulosonate cytidylyltransferase  71.2    1e-11   Prevotella copri
ref|WP_005651239.1|  3-deoxy-manno-octulosonate cytidylyltransferase  71.6    1e-11   Parabacteroides merdae
ref|WP_005998140.1|  3-deoxy-manno-octulosonate cytidylyltransferase  71.2    1e-11   Desulfuromonas acetoxidans
ref|WP_007554984.1|  3-deoxy-manno-octulosonate cytidylyltransferase  71.2    1e-11   Dialister micraerophilus
ref|WP_024821769.1|  3-deoxy-manno-octulosonate cytidylyltransferase  71.2    1e-11   Aminobacterium mobile
ref|WP_026839838.1|  3-deoxy-manno-octulosonate cytidylyltransferase  71.2    1e-11   Geobacter bremensis
ref|WP_040635630.1|  3-deoxy-manno-octulosonate cytidylyltransferase  71.2    1e-11   Mitsuokella multacida
gb|EEX68850.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase     70.9    2e-11   Mitsuokella multacida DSM 20544
ref|WP_021826121.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  70.9    2e-11   Prevotella salivae
ref|WP_026766858.1|  3-deoxy-manno-octulosonate cytidylyltransferase  70.9    2e-11   Selenomonas ruminantium
ref|WP_003322448.1|  3-deoxy-manno-octulosonate cytidylyltransferase  70.9    2e-11   Bacillus alcalophilus
ref|WP_015328007.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  70.9    2e-11   Halobacteroides halobius
ref|WP_004698512.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...  70.5    2e-11   Veillonella
ref|WP_006805864.1|  3-deoxy-manno-octulosonate cytidylyltransferase  70.9    2e-11   Leptotrichia hofstadii
ref|WP_018716775.1|  hypothetical protein                             70.5    2e-11   Arhodomonas aquaeolei
ref|WP_037353189.1|  3-deoxy-manno-octulosonate cytidylyltransferase  70.5    2e-11   Selenomonas sp. FC4001
ref|WP_026746876.1|  3-deoxy-manno-octulosonate cytidylyltransferase  70.5    2e-11   Leptotrichia hofstadii
ref|WP_006808248.1|  3-deoxy-manno-octulosonate cytidylyltransferase  70.5    3e-11   Leptotrichia goodfellowii
ref|WP_014324004.1|  3-deoxy-manno-octulosonate cytidylyltransferase  70.5    3e-11   Desulfovibrio desulfuricans
ref|WP_026759481.1|  3-deoxy-manno-octulosonate cytidylyltransferase  70.5    3e-11   Selenomonas ruminantium
ref|WP_008150585.1|  3-deoxy-manno-octulosonate cytidylyltransferase  70.5    3e-11   Parabacteroides johnsonii
ref|WP_008155288.1|  3-deoxy-manno-octulosonate cytidylyltransferase  70.5    3e-11   Parabacteroides johnsonii
ref|XP_002905178.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  70.5    3e-11   Phytophthora infestans T30-4
ref|WP_028856155.1|  3-deoxy-manno-octulosonate cytidylyltransferase  70.1    3e-11   Psychrilyobacter atlanticus
ref|WP_004695494.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...  70.1    3e-11   Veillonella
ref|WP_031388127.1|  3-deoxy-manno-octulosonate cytidylyltransferase  70.1    3e-11   Desulfonatronum thiodismutans
ref|WP_008822529.1|  3-deoxy-manno-octulosonate cytidylyltransferase  70.1    4e-11   Prevotella histicola
ref|WP_041876148.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.8    4e-11   
ref|WP_007555736.1|  3-deoxy-manno-octulosonate cytidylyltransferase  69.7    5e-11   Dialister micraerophilus
ref|WP_023949906.1|  3-deoxy-manno-octulosonate cytidylyltransferase  69.3    5e-11   Helicobacter fennelliae
emb|CBL29028.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase    69.7    5e-11   Fretibacterium fastidiosum
ref|WP_028896296.1|  3-deoxy-manno-octulosonate cytidylyltransferase  69.7    5e-11   Prevotella sp. HUN102
ref|WP_004586691.1|  CTP:CMP-3-deoxy-D-manno-octulosonate transfe...  69.7    5e-11   Pseudoalteromonas agarivorans
ref|WP_007133365.1|  3-deoxy-manno-octulosonate cytidylyltransferase  69.3    6e-11   Prevotella salivae
ref|WP_036375698.1|  3-deoxy-manno-octulosonate cytidylyltransferase  69.3    6e-11   Mitsuokella jalaludinii
ref|WP_028130356.1|  3-deoxy-manno-octulosonate cytidylyltransferase  69.3    6e-11   Selenomonas sp. AE3005
ref|WP_014425719.1|  3-deoxy-manno-octulosonate cytidylyltransferase  69.3    6e-11   Selenomonas ruminantium
ref|WP_024033541.1|  3-deoxy-manno-octulosonate cytidylyltransferase  69.3    6e-11   Pseudoalteromonas
ref|WP_027406022.1|  3-deoxy-manno-octulosonate cytidylyltransferase  69.3    7e-11   Anaerovibrio sp. RM50
ref|WP_015770248.1|  3-deoxy-manno-octulosonate cytidylyltransferase  69.3    7e-11   Leptotrichia buccalis
ref|WP_036202231.1|  3-deoxy-manno-octulosonate cytidylyltransferase  69.3    7e-11   Megasphaera elsdenii
ref|WP_014015057.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...  69.3    7e-11   
ref|WP_038125218.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.9    7e-11   
ref|WP_004350578.1|  3-deoxy-manno-octulosonate cytidylyltransferase  69.3    7e-11   
ref|WP_045504937.1|  3-deoxy-manno-octulosonate cytidylyltransferase  69.3    7e-11   
ref|WP_031495272.1|  3-deoxy-manno-octulosonate cytidylyltransferase  69.3    7e-11   
ref|XP_009521392.1|  hypothetical protein PHYSODRAFT_258613           69.3    7e-11   
ref|WP_005381737.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...  68.9    7e-11   
ref|WP_021769547.1|  hypothetical protein                             69.3    7e-11   
ref|WP_027450077.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.9    7e-11   
ref|WP_035260112.1|  3-deoxy-manno-octulosonate cytidylyltransferase  69.3    8e-11   
ref|WP_009661485.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.9    8e-11   
ref|WP_015416544.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.9    8e-11   
ref|WP_014245101.1|  3-deoxy-manno-octulosonate cytidylyltransferase  69.3    8e-11   
ref|WP_036924858.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.9    8e-11   
ref|WP_028255055.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.9    8e-11   
ref|WP_006307606.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.9    9e-11   
ref|WP_044418052.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.9    9e-11   
ref|WP_018124350.1|  hypothetical protein                             68.9    9e-11   
ref|WP_026761639.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.6    1e-10   
ref|WP_021965211.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.9    1e-10   
ref|WP_009349745.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.6    1e-10   
ref|WP_021718208.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.6    1e-10   
ref|WP_038011916.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.6    1e-10   
ref|WP_009657376.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.6    1e-10   
gb|ENO76526.1|  3-deoxy-manno-octulosonate cytidylyltransferase       68.6    1e-10   
gb|ETJ14600.1|  3-deoxy-manno-octulosonate cytidylyltransferase       68.6    1e-10   
ref|WP_005865386.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...  68.6    1e-10   
ref|WP_005855678.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...  68.6    1e-10   
ref|WP_034527937.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...  68.6    1e-10   
gb|EFI07282.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase     68.6    1e-10   
ref|WP_036878960.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.6    1e-10   
ref|WP_034531370.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.6    1e-10   
ref|WP_005387289.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.2    1e-10   
gb|KEJ86014.1|  3-deoxy-manno-octulosonate cytidylyltransferase       68.6    1e-10   
gb|EEY84280.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase     68.6    1e-10   
gb|ETJ14179.1|  3-deoxy-manno-octulosonate cytidylyltransferase       68.2    1e-10   
gb|EEU51150.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase     68.6    1e-10   
sp|A6L9D4.1|KDSB_PARD8  RecName: Full=3-deoxy-manno-octulosonate ...  68.6    1e-10   
ref|WP_015436838.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.6    1e-10   
ref|WP_018361689.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.6    1e-10   
ref|WP_018998790.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.2    1e-10   
ref|WP_013515196.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.2    2e-10   
ref|WP_016339926.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.2    2e-10   
ref|WP_026577932.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.2    2e-10   
ref|WP_008539761.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.2    2e-10   
gb|EFF66664.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase     67.8    2e-10   
ref|WP_025000116.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.2    2e-10   
ref|WP_009010765.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.2    2e-10   
ref|WP_027397645.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.2    2e-10   
ref|WP_023050946.1|  hypothetical protein                             68.2    2e-10   
ref|WP_022228079.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.2    2e-10   
ref|WP_036854429.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.2    2e-10   
ref|WP_004359829.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.2    2e-10   
ref|WP_026473865.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.2    2e-10   
ref|WP_040381169.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.8    2e-10   
ref|WP_022026966.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.8    2e-10   
ref|WP_006980629.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.8    2e-10   
ref|WP_011791505.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.2    2e-10   
ref|WP_015719749.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.2    2e-10   
ref|WP_036872014.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.2    2e-10   
ref|WP_010940373.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.2    2e-10   
ref|WP_023058445.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  67.8    2e-10   
ref|WP_012807186.1|  3-deoxy-manno-octulosonate cytidylyltransferase  68.2    2e-10   
ref|WP_036866622.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.8    2e-10   
ref|WP_008124132.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.8    2e-10   
ref|WP_022326567.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.8    2e-10   
gb|EEW96695.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase     67.8    2e-10   
ref|WP_024998653.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.8    2e-10   
ref|WP_023399431.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  67.8    2e-10   
ref|WP_007657616.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.8    2e-10   
ref|WP_005376552.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.8    2e-10   
ref|WP_010800182.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...  67.8    2e-10   
ref|WP_027952312.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.8    3e-10   
ref|WP_020676497.1|  hypothetical protein                             67.8    3e-10   
ref|WP_005843304.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.8    3e-10   
ref|WP_006695852.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.4    3e-10   
ref|WP_013048870.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.4    3e-10   
ref|WP_022111576.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.4    3e-10   
ref|WP_013553682.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.4    3e-10   
ref|WP_006986584.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.4    3e-10   
ref|WP_027291363.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.4    3e-10   
ref|WP_013741769.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.4    3e-10   
ref|WP_039876353.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.4    3e-10   
ref|WP_026879077.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.4    3e-10   
ref|WP_009227767.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.4    3e-10   
ref|WP_013065425.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...  67.4    4e-10   
ref|WP_016402547.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.0    4e-10   
ref|WP_025071887.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.4    4e-10   
ref|WP_010942541.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.4    4e-10   
ref|WP_022660786.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.0    4e-10   
ref|WP_018248154.1|  hypothetical protein                             67.0    4e-10   
ref|WP_022150268.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.8    4e-10   
ref|WP_006948451.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.0    5e-10   
ref|WP_004353460.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.6    5e-10   
ref|WP_025067580.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.6    5e-10   
ref|WP_038152641.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.6    5e-10   
ref|WP_041970489.1|  3-deoxy-manno-octulosonate cytidylyltransferase  67.0    5e-10   
ref|WP_044112569.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.6    5e-10   
gb|ENO75074.1|  3-deoxy-manno-octulosonate cytidylyltransferase       66.2    5e-10   
ref|WP_039741360.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.6    6e-10   
ref|WP_039609884.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.6    6e-10   
ref|WP_034357853.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.6    6e-10   
ref|WP_013886125.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  66.6    6e-10   
gb|EGD01033.1|  3-deoxy-manno-octulosonate cytidylyltransferase       63.9    6e-10   
ref|WP_041097692.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.6    6e-10   
ref|WP_027937071.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.6    6e-10   
ref|WP_013387524.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.6    6e-10   
ref|WP_040554099.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.6    6e-10   
ref|WP_025079053.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.6    6e-10   
ref|WP_013537472.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  66.6    6e-10   
ref|WP_027129194.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.2    7e-10   
ref|WP_014810733.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.2    8e-10   
ref|WP_002927701.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.6    8e-10   
ref|WP_015946004.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.6    8e-10   
gb|EGC19908.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase     66.6    8e-10   
emb|CDA84086.1|  3-deoxy-manno-octulosonate cytidylyltransferase      66.2    8e-10   
ref|WP_037983289.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.2    8e-10   
ref|WP_036926964.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.2    8e-10   
ref|WP_039209436.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.2    8e-10   
ref|WP_044656145.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.2    8e-10   
ref|WP_044017399.1|  3-deoxy-manno-octulosonate cytidylyltransferase  66.2    9e-10   
ref|WP_015903714.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.9    9e-10   
gb|EFV42643.2|  3-deoxy-D-manno-octulosonate cytidylyltransferase     65.9    9e-10   
ref|WP_045089745.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.9    1e-09   
ref|WP_019600726.1|  hypothetical protein                             65.9    1e-09   
gb|AEA20529.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase     66.6    1e-09   
gb|EOA03343.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase     67.4    1e-09   
emb|CBJ50292.1|  3-deoxy-manno-octulosonate cytidylyltransferase      66.2    1e-09   
ref|WP_009656071.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.9    1e-09   
ref|WP_008954900.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.9    1e-09   
ref|WP_038117007.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.9    1e-09   
emb|CCA84861.1|  3-deoxy-manno-octulosonate cytidylyltransferase      66.2    1e-09   
ref|WP_039644280.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.9    1e-09   
ref|WP_021666316.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  65.9    1e-09   
ref|WP_004379492.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.9    1e-09   
ref|WP_022251544.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.9    1e-09   
ref|WP_014088230.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.9    1e-09   
ref|WP_014258366.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.9    1e-09   
ref|WP_020769889.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  65.9    1e-09   
ref|WP_029566995.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.5    1e-09   
ref|WP_035291745.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.9    1e-09   
ref|WP_034350570.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.9    1e-09   
ref|WP_002645211.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.9    1e-09   
ref|WP_045845535.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.9    1e-09   
ref|WP_021716793.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.5    1e-09   
ref|WP_021854314.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.5    1e-09   
ref|WP_033147792.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.5    1e-09   
ref|WP_028903552.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.5    1e-09   
gb|KKB50181.1|  3-deoxy-manno-octulosonate cytidylyltransferase       65.5    1e-09   
ref|WP_009352624.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.5    1e-09   
ref|WP_005030549.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...  65.5    2e-09   
ref|WP_038061861.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.5    2e-09   
ref|WP_009752731.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.5    2e-09   
ref|WP_044130301.1|  3-deoxy-manno-octulosonate cytidylyltransferase  63.9    2e-09   
ref|WP_015346754.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  65.5    2e-09   
ref|WP_028728574.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.5    2e-09   
ref|WP_008017090.1|  hypothetical protein                             63.9    2e-09   
ref|WP_019140346.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.5    2e-09   
ref|WP_010588184.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.5    2e-09   
ref|WP_028905245.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.5    2e-09   
ref|WP_022669592.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.5    2e-09   
ref|WP_025071280.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.5    2e-09   
dbj|GAE83453.1|  3-deoxy-manno-octulosonate cytidylyltransferase      62.4    2e-09   
ref|WP_045166938.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.5    2e-09   
ref|WP_011238688.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.5    2e-09   
ref|WP_010381494.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.5    2e-09   
ref|WP_007526125.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.5    2e-09   
ref|WP_026336657.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.1    2e-09   
ref|WP_033367227.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.1    2e-09   
ref|WP_019209050.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.1    2e-09   
ref|WP_028258167.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.1    2e-09   
ref|WP_019428347.1|  hypothetical protein                             65.1    2e-09   
ref|WP_004364767.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  65.1    2e-09   
ref|WP_023925511.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  65.1    2e-09   
ref|WP_027370464.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.1    2e-09   
ref|WP_004325838.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.1    2e-09   
ref|WP_007573809.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.1    2e-09   
ref|WP_031481979.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.7    3e-09   
ref|WP_021948137.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.1    3e-09   
ref|WP_019100470.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.1    3e-09   
ref|WP_043591981.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.1    3e-09   
ref|WP_006692950.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.7    3e-09   
ref|WP_035068056.1|  3-deoxy-manno-octulosonate cytidylyltransferase  65.1    3e-09   
ref|WP_004295822.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.7    3e-09   
ref|WP_014708535.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.7    3e-09   
ref|WP_046003806.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.7    3e-09   
ref|WP_022042039.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.7    3e-09   
ref|WP_005675958.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.7    3e-09   
ref|WP_021671570.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  64.7    3e-09   
ref|WP_028912446.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.7    3e-09   
ref|WP_044108622.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.7    3e-09   
ref|WP_005681000.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.7    3e-09   
gb|EMG37825.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase     64.3    3e-09   
ref|WP_032847344.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...  64.7    3e-09   
gb|EQB62962.1|  3-deoxy-manno-octulosonate cytidylyltransferase       64.7    3e-09   
ref|WP_004318144.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...  64.7    3e-09   
ref|WP_004303421.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...  64.7    3e-09   
ref|WP_018702913.1|  hypothetical protein                             64.3    3e-09   
ref|WP_038498980.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.7    3e-09   
ref|WP_011288932.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.7    4e-09   
ref|WP_022021301.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.7    4e-09   
ref|WP_021684524.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  64.3    4e-09   
ref|WP_018968408.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.7    4e-09   
ref|WP_027175307.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.3    4e-09   
ref|WP_024989588.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.3    4e-09   
ref|WP_044080070.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.7    4e-09   
ref|WP_020466987.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.7    4e-09   
ref|WP_040595914.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.3    4e-09   
ref|WP_034393117.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.7    4e-09   
ref|WP_045701909.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.3    4e-09   
ref|WP_022315991.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...  64.3    4e-09   
ref|WP_020001110.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...  64.3    4e-09   
gb|EIJ47196.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase     65.9    4e-09   
ref|WP_009235946.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.3    4e-09   
ref|WP_008860453.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.3    4e-09   
gb|EGQ12686.1|  3-deoxy-manno-octulosonate cytidylyltransferase       64.3    4e-09   
ref|WP_028898683.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.3    4e-09   
ref|WP_028325919.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.3    4e-09   
ref|WP_034933321.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.3    4e-09   
ref|WP_010182479.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.3    4e-09   
ref|WP_015923610.1|  3-deoxy-manno-octulosonate cytidylyltransferase  64.3    4e-09   



>ref|XP_009628354.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like, 
partial [Nicotiana tomentosiformis]
Length=134

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNP FPYLLHLGIQSYDTKFLKIYPEL PTPLQL+EDLEQLKVLENGY+
Sbjct  43   RGLIPYNKSGKVNPQFPYLLHLGIQSYDTKFLKIYPELTPTPLQLEEDLEQLKVLENGYK  102

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHE HGVD PEDV+KI  FMRERNL+
Sbjct  103  MKVIKVDHETHGVDTPEDVEKIERFMRERNLA  134



>ref|XP_008386160.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Malus domestica]
 ref|XP_008349984.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Malus domestica]
Length=295

 Score =   176 bits (447),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/92 (90%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGK NP FPYLLHLGIQSYDTKFLKIYPELQPTPLQL+EDLEQLKVLENGY+
Sbjct  204  RGLIPFNKSGKANPQFPYLLHLGIQSYDTKFLKIYPELQPTPLQLEEDLEQLKVLENGYK  263

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVDAPEDV+KI   MRERNLS
Sbjct  264  MKVIKVDHEAHGVDAPEDVEKIESLMRERNLS  295



>ref|XP_006362955.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Solanum tuberosum]
Length=294

 Score =   176 bits (446),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNP FPYLLHLGIQSYDTKFLKIYPEL PTPLQL+EDLEQLKVLENGY+
Sbjct  203  RGLIPYNKSGKVNPQFPYLLHLGIQSYDTKFLKIYPELTPTPLQLEEDLEQLKVLENGYK  262

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV+KI +FMRERN++
Sbjct  263  MKVIKVDHEAHGVDTPEDVEKIEQFMRERNMA  294



>gb|KDO74061.1| hypothetical protein CISIN_1g0225552mg, partial [Citrus sinensis]
Length=217

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNP FPYLLHLGIQSYD+ FLKIYP L PTPLQL+EDLEQLKVLENGY+
Sbjct  126  RGLIPYNKSGKVNPQFPYLLHLGIQSYDSNFLKIYPGLHPTPLQLEEDLEQLKVLENGYK  185

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVDAPEDV+KI  FMRERNLS
Sbjct  186  MKVIKVDHEAHGVDAPEDVEKIESFMRERNLS  217



>ref|XP_006451886.1| hypothetical protein CICLE_v10009061mg [Citrus clementina]
 gb|ESR65126.1| hypothetical protein CICLE_v10009061mg [Citrus clementina]
 gb|KDO74062.1| hypothetical protein CISIN_1g0225552mg [Citrus sinensis]
Length=215

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNP FPYLLHLGIQSYD+ FLKIYP L PTPLQL+EDLEQLKVLENGY+
Sbjct  124  RGLIPYNKSGKVNPQFPYLLHLGIQSYDSNFLKIYPGLHPTPLQLEEDLEQLKVLENGYK  183

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVDAPEDV+KI  FMRERNLS
Sbjct  184  MKVIKVDHEAHGVDAPEDVEKIESFMRERNLS  215



>ref|XP_009784749.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Nicotiana sylvestris]
Length=297

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNP FPYLLHLGIQSYDTKFLKIYPEL PTPLQL+EDLEQLKVLENGY+
Sbjct  206  RGLIPYNKSGKVNPQFPYLLHLGIQSYDTKFLKIYPELTPTPLQLEEDLEQLKVLENGYK  265

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHE HGVD PEDV+KI  FMRERNL+
Sbjct  266  MKVIKVDHETHGVDTPEDVEKIERFMRERNLA  297



>ref|XP_009356824.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Pyrus x bretschneideri]
Length=296

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGK NP FPYLLHLGIQSYDTKFLKIYPELQPTPLQL+EDLEQLKVLENGY+
Sbjct  205  RGLIPFNKSGKANPQFPYLLHLGIQSYDTKFLKIYPELQPTPLQLEEDLEQLKVLENGYK  264

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV+KI   MRERNLS
Sbjct  265  MKVIKVDHEAHGVDTPEDVEKIESLMRERNLS  296



>ref|XP_009351030.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Pyrus x bretschneideri]
Length=295

 Score =   174 bits (440),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGK NP FPYLLHLGIQSYDTKFLKIYPELQPTPLQL+EDLEQLKVLENGY+
Sbjct  204  RGLIPFNKSGKANPQFPYLLHLGIQSYDTKFLKIYPELQPTPLQLEEDLEQLKVLENGYK  263

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVDAPEDV+KI   MRE NLS
Sbjct  264  MKVIKVDHEAHGVDAPEDVEKIESLMREMNLS  295



>ref|XP_009789468.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nicotiana sylvestris]
Length=285

 Score =   173 bits (439),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNP FPYLLHLGIQSYD+KFLKIYPEL+PTPLQL+EDLEQLKVLENGY+
Sbjct  194  RGLIPYNKSGKVNPQFPYLLHLGIQSYDSKFLKIYPELEPTPLQLEEDLEQLKVLENGYK  253

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHE HGVD PED+ KI  FMRERNLS
Sbjct  254  MKVIKVDHETHGVDTPEDIDKIERFMRERNLS  285



>ref|XP_006451890.1| hypothetical protein CICLE_v10009061mg [Citrus clementina]
 ref|XP_006464742.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Citrus sinensis]
 gb|ESR65130.1| hypothetical protein CICLE_v10009061mg [Citrus clementina]
Length=295

 Score =   173 bits (439),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNP FPYLLHLGIQSYD+ FLKIYP L PTPLQL+EDLEQLKVLENGY+
Sbjct  204  RGLIPYNKSGKVNPQFPYLLHLGIQSYDSNFLKIYPGLHPTPLQLEEDLEQLKVLENGYK  263

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVDAPEDV+KI  FMRERNLS
Sbjct  264  MKVIKVDHEAHGVDAPEDVEKIESFMRERNLS  295



>gb|KFK35754.1| hypothetical protein AALP_AA4G032100 [Arabis alpina]
Length=295

 Score =   173 bits (439),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNPDFPY+LHLGIQS+D+KFLK+Y ELQPTPLQL+EDLEQLKVLENGY+
Sbjct  204  RGLIPYNKSGKVNPDFPYMLHLGIQSFDSKFLKVYSELQPTPLQLEEDLEQLKVLENGYK  263

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV+KI   MRERNLS
Sbjct  264  MKVIKVDHEAHGVDTPEDVEKIESLMRERNLS  295



>ref|XP_004248267.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Solanum lycopersicum]
Length=296

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNK GKVNP FPYLLHLGIQSYDTKFLKIYPEL PTPLQL+EDLEQLKVLENGY+
Sbjct  205  RGLIPYNKLGKVNPQFPYLLHLGIQSYDTKFLKIYPELTPTPLQLEEDLEQLKVLENGYK  264

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV+KI +FMRERN++
Sbjct  265  MKVIKVDHEAHGVDIPEDVEKIEQFMRERNMA  296



>ref|XP_010060550.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Eucalyptus grandis]
 gb|KCW67331.1| hypothetical protein EUGRSUZ_F01118 [Eucalyptus grandis]
Length=305

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGKVNP FPYLLHLGIQSYD+KFLKIYPELQPTPLQL+EDLEQLKVLENGY+
Sbjct  214  RGLIPHNKSGKVNPKFPYLLHLGIQSYDSKFLKIYPELQPTPLQLEEDLEQLKVLENGYK  273

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDVQKI  +M ERNLS
Sbjct  274  MKVIKVDHEAHGVDTPEDVQKIESYMLERNLS  305



>ref|XP_008366929.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Malus domestica]
Length=290

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGK NP FPYLLHLGIQSYDTKFLKIYPELQPTPLQL+EDLEQLKVLENGY+
Sbjct  199  RGLIPFNKSGKANPQFPYLLHLGIQSYDTKFLKIYPELQPTPLQLEEDLEQLKVLENGYK  258

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV+KI   M ERNLS
Sbjct  259  MKVIKVDHEAHGVDTPEDVEKIESLMCERNLS  290



>ref|XP_008226639.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Prunus mume]
Length=299

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGK NP FPY+LHLGIQSYDT+FLKIYP+L+PTPLQL+EDLEQLKVLENGY+
Sbjct  208  RGLIPFNKSGKANPQFPYMLHLGIQSYDTRFLKIYPQLEPTPLQLEEDLEQLKVLENGYK  267

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVDAPEDV+KI   MRERNLS
Sbjct  268  MKVIKVDHEAHGVDAPEDVEKIESLMRERNLS  299



>ref|XP_002316900.1| cytidylyltransferase family protein [Populus trichocarpa]
 gb|EEE97512.1| cytidylyltransferase family protein [Populus trichocarpa]
Length=293

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNP FPYLLHLGIQSYD KFLKIYPELQPTPLQL+EDLEQLKVLENGY+
Sbjct  202  RGLIPYNKSGKVNPQFPYLLHLGIQSYDAKFLKIYPELQPTPLQLEEDLEQLKVLENGYK  261

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV+KI   MRE+NLS
Sbjct  262  MKVIKVDHEAHGVDIPEDVEKIETLMREQNLS  293



>ref|XP_011029470.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Populus euphratica]
Length=293

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNP FPYLLHLGIQSYD KFLKIYPELQPTPLQL+EDLEQLKVLENGY+
Sbjct  202  RGLIPYNKSGKVNPQFPYLLHLGIQSYDAKFLKIYPELQPTPLQLEEDLEQLKVLENGYK  261

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV+KI   MRE+NLS
Sbjct  262  MKVIKVDHEAHGVDIPEDVEKIETLMREQNLS  293



>emb|CDP05912.1| unnamed protein product [Coffea canephora]
Length=298

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKS  VNP FPYLLHLGIQSYD+KFLKIYPEL PTPLQL+EDLEQLKVLENGY+
Sbjct  207  RGLIPFNKSANVNPQFPYLLHLGIQSYDSKFLKIYPELTPTPLQLEEDLEQLKVLENGYK  266

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVDAPEDV+KI  FMRERNLS
Sbjct  267  MKVIKVDHEAHGVDAPEDVEKIEHFMRERNLS  298



>ref|XP_010242912.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nelumbo nucifera]
Length=299

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGK+NP FPYLLHLGIQSYD+KFLKIYPEL PTPLQL+EDLEQLKVLENGY+
Sbjct  208  RGLIPYNKSGKLNPKFPYLLHLGIQSYDSKFLKIYPELPPTPLQLEEDLEQLKVLENGYK  267

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDH+AHGVDAPEDV+KI   MRERNLS
Sbjct  268  MKVIKVDHDAHGVDAPEDVEKIEALMRERNLS  299



>ref|XP_006392844.1| hypothetical protein EUTSA_v10011698mg [Eutrema salsugineum]
 gb|ESQ30130.1| hypothetical protein EUTSA_v10011698mg [Eutrema salsugineum]
Length=291

 Score =   171 bits (433),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNPDFPY+LHLGIQS+D+KFLK+Y ELQPTPLQL+EDLEQLKVLENGY+
Sbjct  200  RGLIPYNKSGKVNPDFPYMLHLGIQSFDSKFLKVYSELQPTPLQLEEDLEQLKVLENGYK  259

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD P+D++KI   MRERNLS
Sbjct  260  MKVIKVDHEAHGVDTPDDIEKIESLMRERNLS  291



>ref|XP_002517281.1| cmp-2-keto-3-deoctulosonate (cmp-kdo) cytidyltransferase, putative 
[Ricinus communis]
 gb|EEF45074.1| cmp-2-keto-3-deoctulosonate (cmp-kdo) cytidyltransferase, putative 
[Ricinus communis]
Length=294

 Score =   171 bits (433),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/91 (88%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGK+NP FPYLLHLGIQSYD KFLKIYPELQPTPLQL+EDLEQLKVLENGY+
Sbjct  203  RGLIPYNKSGKINPQFPYLLHLGIQSYDAKFLKIYPELQPTPLQLEEDLEQLKVLENGYK  262

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            MKVIKVDHEAHGVDAPEDV+KI   MRE N+
Sbjct  263  MKVIKVDHEAHGVDAPEDVEKIERLMREHNV  293



>gb|EYU44936.1| hypothetical protein MIMGU_mgv1a0108732mg, partial [Erythranthe 
guttata]
 gb|EYU44937.1| hypothetical protein MIMGU_mgv1a0108732mg, partial [Erythranthe 
guttata]
Length=131

 Score =   165 bits (418),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/91 (87%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSG VNP FPYLLHLGIQSYD+KFLKIYPEL PTPLQL+EDLEQLKVLENGY+
Sbjct  40   RGLIPFNKSGTVNPRFPYLLHLGIQSYDSKFLKIYPELPPTPLQLEEDLEQLKVLENGYK  99

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            MKVIKVDHEAHGVD PEDV KI ++MRERNL
Sbjct  100  MKVIKVDHEAHGVDVPEDVAKIEQYMRERNL  130



>emb|CDY47563.1| BnaC03g69060D [Brassica napus]
Length=289

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNPDFPY+LHLGIQS+D+KFLK+Y ELQPTPLQL+EDLEQLKVLENGY+
Sbjct  198  RGLIPYNKSGKVNPDFPYMLHLGIQSFDSKFLKVYSELQPTPLQLEEDLEQLKVLENGYK  257

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            MKVIKVDHEAHGVD P+DV+KI   MRERNL
Sbjct  258  MKVIKVDHEAHGVDTPDDVEKIESLMRERNL  288



>ref|XP_009107014.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Brassica rapa]
Length=289

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNPDFPY+LHLGIQS+D+KFLK+Y ELQPTPLQL+EDLEQLKVLENGY+
Sbjct  198  RGLIPYNKSGKVNPDFPYMLHLGIQSFDSKFLKVYSELQPTPLQLEEDLEQLKVLENGYK  257

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            MKVIKVDHEAHGVD P+DV+KI   MRERNL
Sbjct  258  MKVIKVDHEAHGVDTPDDVEKIESLMRERNL  288



>emb|CDY02531.1| BnaA08g01380D [Brassica napus]
Length=291

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNPDFPY+LHLGIQS+D+KFLK+Y ELQPTPLQL+EDLEQLKVLENGY+
Sbjct  200  RGLIPYNKSGKVNPDFPYMLHLGIQSFDSKFLKVYSELQPTPLQLEEDLEQLKVLENGYK  259

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            MKVIKVDHEAHGVD P+DV+KI   MRERNL
Sbjct  260  MKVIKVDHEAHGVDTPDDVEKIESLMRERNL  290



>ref|XP_006305471.1| hypothetical protein CARUB_v10009902mg [Capsella rubella]
 gb|EOA38369.1| hypothetical protein CARUB_v10009902mg [Capsella rubella]
Length=292

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNPDFPY+LHLGIQS+D+KFLK+Y ELQPTPLQ +EDLEQLKVLENGY+
Sbjct  201  RGLIPYNKSGKVNPDFPYMLHLGIQSFDSKFLKVYSELQPTPLQQEEDLEQLKVLENGYK  260

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD P+DV+KI   MRERNLS
Sbjct  261  MKVIKVDHEAHGVDTPDDVEKIESLMRERNLS  292



>ref|XP_008225094.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Prunus mume]
Length=296

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKS KVNP FPYLLHLGIQSYD KFL+ YPEL PTPLQL+EDLEQLKVLENGY+
Sbjct  205  RGLIPYNKSAKVNPRFPYLLHLGIQSYDAKFLRKYPELAPTPLQLEEDLEQLKVLENGYK  264

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV+KI  FMRERNLS
Sbjct  265  MKVIKVDHEAHGVDTPEDVEKIESFMRERNLS  296



>ref|XP_002894417.1| cytidylyltransferase family [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70676.1| cytidylyltransferase family [Arabidopsis lyrata subsp. lyrata]
Length=293

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNPDFPY+LHLGIQS+D+KFLK+Y ELQPTPLQ +EDLEQLKVLENGY+
Sbjct  202  RGLIPYNKSGKVNPDFPYMLHLGIQSFDSKFLKVYSELQPTPLQQEEDLEQLKVLENGYK  261

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD P+DV+KI   MRERNLS
Sbjct  262  MKVIKVDHEAHGVDTPDDVEKIESLMRERNLS  293



>ref|XP_010694996.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=298

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNPDFPY+LHLGIQSYD +FLKIYP+LQPTPLQL+EDLEQLKVLENGY+
Sbjct  207  RGLIPYNKSGKVNPDFPYMLHLGIQSYDAEFLKIYPDLQPTPLQLEEDLEQLKVLENGYK  266

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            +KVIKV+HEAHGVD PEDV+KI  +MRE+NLS
Sbjct  267  LKVIKVEHEAHGVDVPEDVEKIERYMREKNLS  298



>ref|XP_004295148.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=301

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGK NP FPY+LHLGIQSYDTKFLKIY EL+PTPLQL+EDLEQLKVLENGYR
Sbjct  210  RGLIPFNKSGKANPQFPYMLHLGIQSYDTKFLKIYRELKPTPLQLEEDLEQLKVLENGYR  269

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV+KI   MRERN+S
Sbjct  270  MKVIKVDHEAHGVDTPEDVEKIEALMRERNIS  301



>ref|XP_009606581.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Nicotiana tomentosiformis]
Length=296

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNP FPYLLHLGIQSYD+KFLKIYPEL+PTPLQL+EDLEQLKVLENGY+
Sbjct  205  RGLIPYNKSGKVNPQFPYLLHLGIQSYDSKFLKIYPELEPTPLQLEEDLEQLKVLENGYK  264

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHE HGVD PED+ K+  FM ERNLS
Sbjct  265  MKVIKVDHETHGVDTPEDINKVERFMLERNLS  296



>ref|NP_175708.2| 3-deoxy-manno-octulosonate cytidylyltransferase [Arabidopsis 
thaliana]
 sp|Q9C920.1|KDSB_ARATH RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase, 
mitochondrial; AltName: Full=CMP-2-keto-3-deoxyoctulosonic 
acid synthase; Short=AtCKS; Short=CMP-KDO synthase; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG52266.1|AC019018_3 putative deoxyoctulonosic acid synthetase; 116195-114393 [Arabidopsis 
thaliana]
 emb|CAD43603.1| putative CMP-KDO synthetase [Arabidopsis thaliana]
 dbj|BAH20217.1| AT1G53000 [Arabidopsis thaliana]
 gb|AEE32875.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Arabidopsis 
thaliana]
Length=290

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNPDFPY+LHLGIQS+D+KFLK+Y ELQPTPLQ +EDLEQLKVLENGY+
Sbjct  199  RGLIPYNKSGKVNPDFPYMLHLGIQSFDSKFLKVYSELQPTPLQQEEDLEQLKVLENGYK  258

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD P+DV+KI   MRERN+S
Sbjct  259  MKVIKVDHEAHGVDTPDDVEKIESLMRERNMS  290



>ref|XP_004514100.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Cicer arietinum]
Length=304

 Score =   168 bits (426),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGKVN  FPYLLHLGIQSYDTKFLKIYP+LQPTPLQL+EDLEQLKVLENGY+
Sbjct  213  RGLIPFNKSGKVNQQFPYLLHLGIQSYDTKFLKIYPDLQPTPLQLEEDLEQLKVLENGYK  272

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDH+AHGVD PEDV+KI   MR+RNLS
Sbjct  273  MKVIKVDHDAHGVDTPEDVEKIEALMRQRNLS  304



>ref|XP_012084951.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Jatropha curcas]
 gb|KDP27047.1| hypothetical protein JCGZ_20982 [Jatropha curcas]
Length=296

 Score =   168 bits (425),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVN  FPYLLHLGIQSYD KFLKIYPEL+PTPLQL+EDLEQLKVLENGY+
Sbjct  205  RGLIPYNKSGKVNQQFPYLLHLGIQSYDAKFLKIYPELEPTPLQLEEDLEQLKVLENGYK  264

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKV+KVDHEAHGVD P+DV+KI   MRERNLS
Sbjct  265  MKVMKVDHEAHGVDTPDDVEKIETLMRERNLS  296



>gb|KJB61818.1| hypothetical protein B456_009G389800 [Gossypium raimondii]
Length=296

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKS KVNP FPY+LHLGIQSYD+KFL+IYP+LQPTPLQL+EDLEQLKVLENGY+
Sbjct  205  RGLIPFNKSAKVNPQFPYMLHLGIQSYDSKFLQIYPKLQPTPLQLEEDLEQLKVLENGYK  264

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKV+HEAHGVD PEDV+KI   MRERNLS
Sbjct  265  MKVIKVEHEAHGVDTPEDVEKIESLMRERNLS  296



>ref|XP_010545826.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Tarenaya hassleriana]
Length=295

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNPDFPY+LHLGIQS+D++FLK+Y ELQPTPLQ +EDLEQLKVLENGY+
Sbjct  204  RGLIPYNKSGKVNPDFPYMLHLGIQSFDSRFLKVYSELQPTPLQQEEDLEQLKVLENGYK  263

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKV+HEAHGVD PEDV KI   MRERNLS
Sbjct  264  MKVIKVEHEAHGVDTPEDVSKIESLMRERNLS  295



>ref|XP_010272461.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nelumbo nucifera]
 ref|XP_010272462.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nelumbo nucifera]
 ref|XP_010272463.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nelumbo nucifera]
 ref|XP_010272464.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nelumbo nucifera]
 ref|XP_010272465.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nelumbo nucifera]
 ref|XP_010272466.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nelumbo nucifera]
 ref|XP_010272467.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nelumbo nucifera]
 ref|XP_010272468.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nelumbo nucifera]
Length=298

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGK NP FPYLLHLGIQSYD+KFL+IYPEL PTPLQL+EDLEQLKVLENGY+
Sbjct  207  RGLIPYNKSGKFNPMFPYLLHLGIQSYDSKFLRIYPELPPTPLQLEEDLEQLKVLENGYK  266

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDH+AHGVD PEDV+KI   MRERNLS
Sbjct  267  MKVIKVDHDAHGVDTPEDVEKIEALMRERNLS  298



>ref|XP_007133176.1| hypothetical protein PHAVU_011G157900g [Phaseolus vulgaris]
 gb|ESW05170.1| hypothetical protein PHAVU_011G157900g [Phaseolus vulgaris]
Length=301

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGKVNP FPYLLHLGIQSYD KFL+IYP+LQPTPLQL+EDLEQLKVLENGY+
Sbjct  210  RGLIPFNKSGKVNPKFPYLLHLGIQSYDAKFLRIYPDLQPTPLQLEEDLEQLKVLENGYK  269

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKV+HEAHGVD PEDV K+   MRERNLS
Sbjct  270  MKVIKVNHEAHGVDTPEDVGKLESLMRERNLS  301



>ref|XP_010479831.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Camelina sativa]
Length=292

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNPDFPY+LHLG+QS+D+KFLK+Y ELQPTPLQ +EDLEQLKVLENGY+
Sbjct  201  RGLIPYNKSGKVNPDFPYMLHLGLQSFDSKFLKVYSELQPTPLQQEEDLEQLKVLENGYK  260

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD P+DV+KI   MRERN+S
Sbjct  261  MKVIKVDHEAHGVDTPDDVEKIESLMRERNMS  292



>ref|XP_002284913.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Vitis vinifera]
 emb|CBI20312.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSG+VN  FPYLLHLGIQSYDTKFL+IYP+L PTPLQL+EDLEQLKVLENGY+
Sbjct  206  RGLIPFNKSGEVNQQFPYLLHLGIQSYDTKFLRIYPDLPPTPLQLEEDLEQLKVLENGYK  265

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV KI  FMRERNLS
Sbjct  266  MKVIKVDHEAHGVDTPEDVDKIESFMRERNLS  297



>ref|XP_010500927.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Camelina sativa]
Length=294

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNPDFPY+LHLG+QS+D+KFLK+Y ELQPTPLQ +EDLEQLKVLENGY+
Sbjct  203  RGLIPYNKSGKVNPDFPYMLHLGLQSFDSKFLKVYAELQPTPLQQEEDLEQLKVLENGYK  262

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD P+DV+KI   MRERN+S
Sbjct  263  MKVIKVDHEAHGVDTPDDVEKIESLMRERNMS  294



>ref|XP_007211713.1| hypothetical protein PRUPE_ppa009339mg [Prunus persica]
 gb|EMJ12912.1| hypothetical protein PRUPE_ppa009339mg [Prunus persica]
Length=296

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKS KVNP FPYLLHLGIQSYD KFL+ YPEL PTPLQL+EDLEQLKVLENGY+
Sbjct  205  RGLIPYNKSAKVNPRFPYLLHLGIQSYDAKFLRKYPELAPTPLQLEEDLEQLKVLENGYK  264

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV+KI  FM+ERNLS
Sbjct  265  MKVIKVDHEAHGVDTPEDVEKIESFMQERNLS  296



>ref|XP_010462154.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Camelina sativa]
Length=292

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNPDFPY+LHLG+QS+D+KFLK+Y ELQPTPLQ +EDLEQLKVLENG++
Sbjct  201  RGLIPYNKSGKVNPDFPYMLHLGLQSFDSKFLKVYSELQPTPLQQEEDLEQLKVLENGFK  260

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD+P+DV+KI   MRERNLS
Sbjct  261  MKVIKVDHEAHGVDSPDDVEKIESLMRERNLS  292



>ref|XP_007021424.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
 ref|XP_007021425.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
 ref|XP_007021426.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY12949.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY12950.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY12951.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
Length=301

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGL+P+NKS KVNP FPYLLHLGIQSYD++FLKIYP+LQPTPLQL+EDLEQLKVLENGY+
Sbjct  210  RGLVPFNKSAKVNPHFPYLLHLGIQSYDSEFLKIYPKLQPTPLQLEEDLEQLKVLENGYK  269

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV+KI   MRE NLS
Sbjct  270  MKVIKVDHEAHGVDTPEDVEKIESLMRENNLS  301



>ref|XP_008452260.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Cucumis melo]
Length=297

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGKVN  FPYLLHLGIQSYD+KFL IYPEL+PTPLQL+EDLEQLKVLE+GY+
Sbjct  206  RGLIPFNKSGKVNLQFPYLLHLGIQSYDSKFLSIYPELEPTPLQLEEDLEQLKVLEHGYK  265

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV+KI  FM+ERNL+
Sbjct  266  MKVIKVDHEAHGVDVPEDVEKIESFMKERNLA  297



>gb|KEH41941.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Medicago truncatula]
Length=596

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGKVN  FPYLLHLGIQSYDTKFLKIYP+LQPTPLQL+EDLEQLKVLENGY+
Sbjct  505  RGLIPFNKSGKVNQQFPYLLHLGIQSYDTKFLKIYPDLQPTPLQLEEDLEQLKVLENGYK  564

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV+KI   MR+RNLS
Sbjct  565  MKVIKVDHEAHGVDTPEDVEKIEALMRQRNLS  596



>emb|CAN62581.1| hypothetical protein VITISV_036570 [Vitis vinifera]
Length=297

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSG+VN  FPYLLHLGIQSYDTKFL+IYP+L PTPLQL+EDLEQLKVLENGY+
Sbjct  206  RGLIPFNKSGEVNQXFPYLLHLGIQSYDTKFLRIYPDLPPTPLQLEEDLEQLKVLENGYK  265

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV KI  FMRERNLS
Sbjct  266  MKVIKVDHEAHGVDTPEDVDKIESFMRERNLS  297



>ref|XP_007213820.1| hypothetical protein PRUPE_ppa009246mg [Prunus persica]
 gb|EMJ15019.1| hypothetical protein PRUPE_ppa009246mg [Prunus persica]
Length=300

 Score =   166 bits (420),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGK NP FPY+LHLGIQSYDT FLKIYP+L+PTPLQL+EDLEQLKVLENGY+
Sbjct  209  RGLIPFNKSGKANPQFPYMLHLGIQSYDTGFLKIYPQLEPTPLQLEEDLEQLKVLENGYK  268

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVDAPEDV+KI   M +RNLS
Sbjct  269  MKVIKVDHEAHGVDAPEDVEKIESLMLQRNLS  300



>ref|XP_002534236.1| cmp-2-keto-3-deoctulosonate (cmp-kdo) cytidyltransferase, putative 
[Ricinus communis]
 gb|EEF28143.1| cmp-2-keto-3-deoctulosonate (cmp-kdo) cytidyltransferase, putative 
[Ricinus communis]
Length=290

 Score =   166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGL+PYNKSGKVN  FPYLLHLGIQSYD KFLKIY ELQPTPLQL+EDLEQLKVLENGY+
Sbjct  199  RGLVPYNKSGKVNAQFPYLLHLGIQSYDAKFLKIYSELQPTPLQLEEDLEQLKVLENGYK  258

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            MKVIKVDHEAHGVD PED++KI   MRERN+
Sbjct  259  MKVIKVDHEAHGVDTPEDIEKIERLMRERNV  289



>ref|XP_010924427.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Elaeis guineensis]
Length=297

 Score =   165 bits (418),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGKVNP FPYLLHLGIQS+D+KFL+IYP+L PTPLQL+EDLEQLKVLENGY+
Sbjct  206  RGLIPFNKSGKVNPQFPYLLHLGIQSFDSKFLRIYPQLPPTPLQLEEDLEQLKVLENGYK  265

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDH+AHGVD PEDV+KI   MRERN+S
Sbjct  266  MKVIKVDHDAHGVDTPEDVEKIEALMRERNIS  297



>ref|XP_009124898.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
isoform X1 [Brassica rapa]
Length=290

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSG VNP+FPY+LHLGIQS+D+KFL +Y ELQPTPLQ++EDLEQLKVLENGY+
Sbjct  199  RGLIPFNKSGGVNPEFPYMLHLGIQSFDSKFLNVYSELQPTPLQVEEDLEQLKVLENGYK  258

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV+KI   MRERNLS
Sbjct  259  MKVIKVDHEAHGVDTPEDVEKIESLMRERNLS  290



>emb|CAN72248.1| hypothetical protein VITISV_008336 [Vitis vinifera]
Length=264

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNP FPY LHLGIQSYD +FL+IYPEL PTPLQL+EDLEQLKVLENGY+
Sbjct  173  RGLIPYNKSGKVNPHFPYFLHLGIQSYDAQFLRIYPELSPTPLQLEEDLEQLKVLENGYK  232

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDH+AHGVD PEDV+KI   MR +NLS
Sbjct  233  MKVIKVDHDAHGVDTPEDVEKIEALMRAQNLS  264



>ref|XP_010919659.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=295

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNP FPYLLHLGIQS+D+KFL+IYP+L PTPLQL+EDLEQLKVLENGY+
Sbjct  204  RGLIPYNKSGKVNPQFPYLLHLGIQSFDSKFLRIYPQLPPTPLQLEEDLEQLKVLENGYK  263

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDH+AHGVD PEDV+KI   MRER++S
Sbjct  264  MKVIKVDHDAHGVDTPEDVEKIEALMRERSIS  295



>ref|XP_002263680.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Vitis vinifera]
 emb|CBI23963.3| unnamed protein product [Vitis vinifera]
Length=293

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNP FPY LHLGIQSYD +FL+IYPEL PTPLQL+EDLEQLKVLENGY+
Sbjct  202  RGLIPYNKSGKVNPHFPYFLHLGIQSYDAQFLRIYPELSPTPLQLEEDLEQLKVLENGYK  261

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDH+AHGVD PEDV+KI   MR +NLS
Sbjct  262  MKVIKVDHDAHGVDTPEDVEKIEALMRAQNLS  293



>ref|XP_010919652.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=296

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNP FPYLLHLGIQS+D+KFL+IYP+L PTPLQL+EDLEQLKVLENGY+
Sbjct  205  RGLIPYNKSGKVNPQFPYLLHLGIQSFDSKFLRIYPQLPPTPLQLEEDLEQLKVLENGYK  264

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDH+AHGVD PEDV+KI   MRER++S
Sbjct  265  MKVIKVDHDAHGVDTPEDVEKIEALMRERSIS  296



>ref|XP_003540098.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Glycine max]
 gb|KHN04396.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Glycine soja]
Length=306

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSG VN  FPYLLHLGIQSYD KFL IYP+LQPTPLQL+EDLEQLKVLENGY+
Sbjct  215  RGLIPFNKSGMVNQQFPYLLHLGIQSYDAKFLNIYPDLQPTPLQLEEDLEQLKVLENGYK  274

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV KI   MRERNLS
Sbjct  275  MKVIKVDHEAHGVDTPEDVGKIESLMRERNLS  306



>ref|XP_011004626.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Populus euphratica]
 ref|XP_011004627.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Populus euphratica]
 ref|XP_011004628.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Populus euphratica]
Length=291

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNK+GK NP FPY+LHLGIQSYDTKFL IYPEL+PTPLQL+EDLEQLKVLENGY+
Sbjct  200  RGLIPYNKTGKFNPQFPYMLHLGIQSYDTKFLNIYPELRPTPLQLEEDLEQLKVLENGYK  259

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV+KI   MRE++ S
Sbjct  260  MKVIKVDHEAHGVDIPEDVEKIETLMREQSFS  291



>gb|ABK23054.1| unknown [Picea sitchensis]
Length=290

 Score =   163 bits (412),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGL+P+NK+GKVNP+FPY LHLGIQSYD KFL IYP+L PTPLQL+EDLEQLKVLENGY+
Sbjct  199  RGLVPFNKTGKVNPNFPYHLHLGIQSYDAKFLGIYPQLHPTPLQLEEDLEQLKVLENGYK  258

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD P D+ KI  FMRERN+S
Sbjct  259  MKVIKVDHEAHGVDVPSDIAKIEAFMRERNIS  290



>ref|NP_001056314.1| Os05g0561500 [Oryza sativa Japonica Group]
 gb|AAU10647.1| putative 3-deoxy-manno-octulosonate cytidylyltransferase [Oryza 
sativa Japonica Group]
 dbj|BAF18228.1| Os05g0561500 [Oryza sativa Japonica Group]
 dbj|BAG88112.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64681.1| hypothetical protein OsJ_19536 [Oryza sativa Japonica Group]
Length=297

 Score =   163 bits (412),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGKVNP FPYLLHLGI  +D+KFLKIYPEL PTPLQL+EDLEQLKVLENGYR
Sbjct  206  RGLIPFNKSGKVNPQFPYLLHLGIAGFDSKFLKIYPELPPTPLQLEEDLEQLKVLENGYR  265

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            MKVIKVDH+AHGVDAPEDV+KI   MR RN+
Sbjct  266  MKVIKVDHDAHGVDAPEDVEKIEALMRARNI  296



>ref|XP_006654782.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Oryza brachyantha]
Length=299

 Score =   163 bits (412),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGKVNP FPYLLHLGI  +D+KFLKIYPEL PTPLQL+EDLEQLKVLENGYR
Sbjct  208  RGLIPFNKSGKVNPQFPYLLHLGIAGFDSKFLKIYPELPPTPLQLEEDLEQLKVLENGYR  267

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            MKVIKVDH+AHGVDAPEDV+KI   MR RN+
Sbjct  268  MKVIKVDHDAHGVDAPEDVEKIEALMRARNI  298



>ref|XP_009406254.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=295

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGKVNP FPYLLHLGIQS+D KFLKIYP+L PTPLQL+EDLEQLKVLENGY+
Sbjct  204  RGLIPFNKSGKVNPQFPYLLHLGIQSFDAKFLKIYPQLPPTPLQLEEDLEQLKVLENGYK  263

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKV+H+AHGVD PEDV KI   MRERN++
Sbjct  264  MKVIKVNHDAHGVDTPEDVAKIEALMRERNIA  295



>ref|XP_004961235.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Setaria italica]
Length=297

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP NKSGKVNP++PYLLHLGI  +D+KFL IYPEL PTPLQL+EDLEQLKVLENGYR
Sbjct  206  RGLIPSNKSGKVNPNYPYLLHLGISGFDSKFLMIYPELSPTPLQLEEDLEQLKVLENGYR  265

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            MKVIKVDH+AHGVDAPEDV+KI E MR RN+
Sbjct  266  MKVIKVDHDAHGVDAPEDVEKIEELMRARNI  296



>emb|CDY69672.1| BnaA05g35640D [Brassica napus]
Length=290

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NK G VNP+FPY+LHLGIQS+D+KFL +Y ELQPTPLQ++EDLEQLKVLENGY+
Sbjct  199  RGLIPFNKYGGVNPEFPYMLHLGIQSFDSKFLNVYSELQPTPLQVEEDLEQLKVLENGYK  258

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV+KI   MRERNLS
Sbjct  259  MKVIKVDHEAHGVDTPEDVEKIESLMRERNLS  290



>ref|XP_003526068.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Glycine max]
Length=305

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGKVN  FPYLLHLGIQSYD KFL IYP L+PTPLQL+EDLEQLKVLENGY+
Sbjct  214  RGLIPFNKSGKVNQQFPYLLHLGIQSYDAKFLNIYPNLRPTPLQLEEDLEQLKVLENGYK  273

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKV HEAHGVD PEDV KI   MRERNLS
Sbjct  274  MKVIKVHHEAHGVDTPEDVGKIESLMRERNLS  305



>ref|XP_008809046.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Phoenix dactylifera]
 ref|XP_008809123.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Phoenix dactylifera]
Length=330

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNP FPYLLHLGIQSYD+KFL+IYP+L PTPLQL+EDLEQLKVLENGY+
Sbjct  239  RGLIPYNKSGKVNPQFPYLLHLGIQSYDSKFLRIYPQLPPTPLQLEEDLEQLKVLENGYK  298

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            MKVIKV H+AHGVD PEDV+KI   MR+RN+
Sbjct  299  MKVIKVQHDAHGVDTPEDVEKIETLMRQRNI  329



>dbj|BAK04151.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=293

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP NKSGKVNP FPYLLHLGI  +D+KFLKIYP+L PTPLQL+EDLEQLKVLENGYR
Sbjct  202  RGLIPSNKSGKVNPHFPYLLHLGISGFDSKFLKIYPQLTPTPLQLEEDLEQLKVLENGYR  261

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            MKVIKVDH+AHGVDAPEDV+KI   MR RN+
Sbjct  262  MKVIKVDHDAHGVDAPEDVEKIEALMRARNI  292



>ref|XP_006370268.1| cytidylyltransferase family protein [Populus trichocarpa]
 gb|ERP66837.1| cytidylyltransferase family protein [Populus trichocarpa]
Length=290

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNK+GKVN  FPY+LHLGIQSYDTKFLKIYPEL+ TPLQL+EDLEQLKVLENGY+
Sbjct  199  RGLIPYNKTGKVNTQFPYMLHLGIQSYDTKFLKIYPELRSTPLQLEEDLEQLKVLENGYK  258

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV+K+   MRE++ S
Sbjct  259  MKVIKVDHEAHGVDIPEDVEKLETLMREQSFS  290



>ref|XP_003567908.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
isoform X2 [Brachypodium distachyon]
Length=290

 Score =   160 bits (405),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGK NP FPY LHLGI  +D+KFLKIYP+L PTPLQL+EDLEQLKVLENGYR
Sbjct  199  RGLIPFNKSGKANPQFPYHLHLGISCFDSKFLKIYPQLAPTPLQLEEDLEQLKVLENGYR  258

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            MKVIKVDH+AHGVDAPEDV+KI   MR RN+
Sbjct  259  MKVIKVDHDAHGVDAPEDVEKIEALMRARNI  289



>ref|XP_011098319.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Sesamum indicum]
Length=332

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSG VNP FPYLLHLGIQSYD+KFLKIY EL PTPLQ++EDLEQLKVLENGY+
Sbjct  241  RGLIPFNKSGNVNPRFPYLLHLGIQSYDSKFLKIYSELPPTPLQMEEDLEQLKVLENGYK  300

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHE+HGVD PEDV KI  +MR+RNL 
Sbjct  301  MKVIKVDHESHGVDVPEDVDKIEHYMRQRNLC  332



>gb|KHN37186.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Glycine soja]
Length=301

 Score =   160 bits (405),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGKVN  FPYLLHLGIQSYD KFL IYP L+PTPLQL+EDLEQLKVLENGY+
Sbjct  210  RGLIPFNKSGKVNQLFPYLLHLGIQSYDAKFLNIYPNLRPTPLQLEEDLEQLKVLENGYK  269

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKV HEAHGVD PEDV KI   MRERNLS
Sbjct  270  MKVIKVHHEAHGVDTPEDVGKIESLMRERNLS  301



>ref|XP_011082674.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Sesamum indicum]
Length=299

 Score =   160 bits (405),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGKVNP FPYLLHLGIQS+D+KFLKIYPEL PTPLQ++EDLEQLKVLENGY+
Sbjct  208  RGLIPFNKSGKVNPQFPYLLHLGIQSFDSKFLKIYPELLPTPLQMEEDLEQLKVLENGYK  267

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            MKVIKVDH++HGVD P+DV KI  +MRE NL
Sbjct  268  MKVIKVDHDSHGVDVPDDVDKIERYMREHNL  298



>gb|EEC79690.1| hypothetical protein OsI_20971 [Oryza sativa Indica Group]
Length=297

 Score =   160 bits (405),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGKVNP FPYLLHLGI  +D+KFLKIYPEL PTPLQL+EDLEQLKVLENGYR
Sbjct  206  RGLIPFNKSGKVNPQFPYLLHLGIAGFDSKFLKIYPELPPTPLQLEEDLEQLKVLENGYR  265

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            MKVIKVDH+AHGVDAPEDV+KI   M  RN+
Sbjct  266  MKVIKVDHDAHGVDAPEDVEKIEALMHARNI  296



>ref|XP_006849964.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Amborella trichopoda]
 gb|ERN11545.1| hypothetical protein AMTR_s00022p00147990 [Amborella trichopoda]
Length=288

 Score =   160 bits (404),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSG+VNP FPYLLHLGIQSYD+KFL+IYP+L PT LQL+EDLEQLKVLENGY+
Sbjct  197  RGLIPYNKSGEVNPKFPYLLHLGIQSYDSKFLRIYPQLPPTLLQLEEDLEQLKVLENGYK  256

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDH+AHG+D P DV+KI   MRERN+S
Sbjct  257  MKVIKVDHDAHGIDTPADVEKIEALMRERNIS  288



>ref|NP_001105657.1| CMP-KDO synthetase1 precursor [Zea mays]
 emb|CAB89846.1| CMP-KDO synthetase [Zea mays]
 gb|AFW81111.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Zea mays]
Length=298

 Score =   157 bits (398),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSG  NP +PYLLHLGI  +D+KFLKIYPEL PTPLQ++EDLEQLKVLENGYR
Sbjct  207  RGLIPFNKSGNANPKYPYLLHLGIAGFDSKFLKIYPELPPTPLQMEEDLEQLKVLENGYR  266

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            MKVIKVDH+AHGVDAPEDV+KI   MR RN+
Sbjct  267  MKVIKVDHDAHGVDAPEDVEKIEALMRTRNI  297



>gb|ACG42455.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Zea mays]
Length=298

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSG  NP +PYLLHLGI  +D+KFLKIYPEL PTPLQ++EDLEQLKVLENGYR
Sbjct  207  RGLIPFNKSGNANPKYPYLLHLGIAGFDSKFLKIYPELPPTPLQMEEDLEQLKVLENGYR  266

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            MKVIKVDH+AHGVDAPEDV+KI   MR RN+
Sbjct  267  MKVIKVDHDAHGVDAPEDVEKIEALMRTRNI  297



>ref|XP_010910968.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Elaeis guineensis]
Length=220

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNP FPYLLHLGIQSYD+KFL+IY +L PTPLQL+EDLEQLKVLENGY+
Sbjct  129  RGLIPYNKSGKVNPQFPYLLHLGIQSYDSKFLRIYRQLPPTPLQLEEDLEQLKVLENGYK  188

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            MKVIKV H+A GVD PEDV+KI   MR RN+
Sbjct  189  MKVIKVQHDARGVDTPEDVEKIETLMRRRNI  219



>ref|XP_004133708.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Cucumis sativus]
Length=297

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGKVN  +PYLLHLGIQS+D+KFL +YPEL+ TPLQL+EDLEQLKVLE+GY+
Sbjct  206  RGLIPFNKSGKVNLQYPYLLHLGIQSFDSKFLSMYPELESTPLQLEEDLEQLKVLEHGYK  265

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKV+HEAHGVD PEDV KI  FM+ERNL+
Sbjct  266  MKVIKVEHEAHGVDVPEDVDKIESFMKERNLA  297



>gb|ERN06581.1| hypothetical protein AMTR_s00058p00143650 [Amborella trichopoda]
Length=227

 Score =   153 bits (387),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R L+P NKSG+VNP FPYLLHLGIQSYD+ FLKIYP+L PTPLQL+EDLEQLKVLENGY+
Sbjct  116  RSLLPCNKSGEVNPKFPYLLHLGIQSYDSNFLKIYPQLLPTPLQLEEDLEQLKVLENGYK  175

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDH+AH VD P DV+KI   M ERN+S
Sbjct  176  MKVIKVDHDAHCVDTPADVEKIGALMWERNIS  207



>emb|CDY55874.1| BnaC06g41770D [Brassica napus]
Length=481

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSG VN DFPY+LHLGIQS+D+KFLK+Y ELQPTPLQL+EDLEQLKVLENGY+
Sbjct  202  RGLIPYNKSGGVNLDFPYMLHLGIQSFDSKFLKVYSELQPTPLQLEEDLEQLKVLENGYK  261

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMR  433
            MKVIKVDHEAHGVD PEDV+KI   MR
Sbjct  262  MKVIKVDHEAHGVDTPEDVEKIESLMR  288



>ref|XP_010108191.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Morus notabilis]
 gb|EXC18116.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Morus notabilis]
Length=305

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVN +FPYLLHLGIQSYD KFL+ YPEL  TPLQ +EDLEQLK+LE+GY+
Sbjct  214  RGLIPYNKSGKVNLNFPYLLHLGIQSYDAKFLRKYPELSSTPLQEEEDLEQLKILEHGYK  273

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV KI   MR++NLS
Sbjct  274  MKVIKVDHEAHGVDTPEDVDKIESLMRQKNLS  305



>ref|XP_002441511.1| hypothetical protein SORBIDRAFT_09g028380 [Sorghum bicolor]
 gb|EES19941.1| hypothetical protein SORBIDRAFT_09g028380 [Sorghum bicolor]
Length=296

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSG VNP + YLLHLGI  +D+KFLKIYPEL PTPLQ++EDLEQLKVLEN YR
Sbjct  205  RGLIPFNKSGNVNPKYLYLLHLGISGFDSKFLKIYPELPPTPLQMEEDLEQLKVLENSYR  264

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            MKVIKVDH+AHGVDAPEDV+KI   MR RN+
Sbjct  265  MKVIKVDHDAHGVDAPEDVEKIEALMRARNI  295



>emb|CAB89847.1| CMP-KDO synthetase [Zea mays]
Length=236

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSG  NP +PYLLHLGI  +D+KFLKIYPEL PTPLQ++EDLEQLKVLENGYR
Sbjct  151  RGLIPFNKSGNANPKYPYLLHLGIAGFDSKFLKIYPELPPTPLQMEEDLEQLKVLENGYR  210

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFM  436
            MKVIKVDH+AHGVDAPEDV+KI   M
Sbjct  211  MKVIKVDHDAHGVDAPEDVEKIEALM  236



>ref|XP_006377770.1| hypothetical protein POPTR_0011s12080g [Populus trichocarpa]
 gb|ERP55567.1| hypothetical protein POPTR_0011s12080g [Populus trichocarpa]
Length=285

 Score =   150 bits (379),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 79/92 (86%), Gaps = 8/92 (9%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNP FPYLLHLGIQ        IYPELQPTPLQL+EDLEQLKVLENGY+
Sbjct  202  RGLIPYNKSGKVNPQFPYLLHLGIQ--------IYPELQPTPLQLEEDLEQLKVLENGYK  253

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV+KI   MRE+NLS
Sbjct  254  MKVIKVDHEAHGVDIPEDVEKIETLMREQNLS  285



>gb|EPS72950.1| hypothetical protein M569_01801, partial [Genlisea aurea]
Length=281

 Score =   149 bits (377),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGK NP FPY LHLGIQS+D+KFLKIY EL P+PLQ++EDLEQLKVLENGY+
Sbjct  194  RGLIPFNKSGKFNPRFPYSLHLGIQSFDSKFLKIYSELPPSPLQVEEDLEQLKVLENGYK  253

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRE  430
            MKVIKVDH+ HGVD PEDV+KI ++MRE
Sbjct  254  MKVIKVDHDTHGVDVPEDVEKIEKYMRE  281



>gb|KGN56240.1| hypothetical protein Csa_3G104930 [Cucumis sativus]
Length=276

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -2

Query  672  KSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYRMKVIKVD  493
            KSGKVN  +PYLLHLGIQS+D+KFL +YPEL+ TPLQL+EDLEQLKVLE+GY+MKVIKV+
Sbjct  192  KSGKVNLQYPYLLHLGIQSFDSKFLSMYPELESTPLQLEEDLEQLKVLEHGYKMKVIKVE  251

Query  492  HEAHGVDAPEDVQKIVEFMRERNLS  418
            HEAHGVD PEDV KI  FM+ERNL+
Sbjct  252  HEAHGVDVPEDVDKIESFMKERNLA  276



>ref|XP_002981117.1| hypothetical protein SELMODRAFT_113793 [Selaginella moellendorffii]
 gb|EFJ17818.1| hypothetical protein SELMODRAFT_113793 [Selaginella moellendorffii]
Length=255

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGL+P+NK G  N  FPYLLHLGIQ YD  FL +YP + PT LQL+EDLEQLKV+ENGY+
Sbjct  164  RGLLPFNKKGVANDKFPYLLHLGIQCYDAHFLSMYPLIAPTALQLEEDLEQLKVIENGYK  223

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            +KVIKVDH+AHGVD+P D+  I   MR RN++
Sbjct  224  IKVIKVDHDAHGVDSPGDIASIESLMRGRNIA  255



>ref|XP_001784950.1| predicted protein [Physcomitrella patens]
 gb|EDQ50258.1| predicted protein [Physcomitrella patens]
Length=290

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGL+P NK G  NPDFPY+LHLG+Q YD KFLK+Y  + P+PLQL+EDLEQLKVLENG++
Sbjct  199  RGLLPSNKKGIPNPDFPYMLHLGVQCYDAKFLKVYASMPPSPLQLEEDLEQLKVLENGFK  258

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KVIKVDHEAHGVD P D+ K+   MR  ++
Sbjct  259  LKVIKVDHEAHGVDTPGDIAKVEAVMRAHHM  289



>ref|XP_002982588.1| hypothetical protein SELMODRAFT_116934 [Selaginella moellendorffii]
 gb|EFJ16341.1| hypothetical protein SELMODRAFT_116934 [Selaginella moellendorffii]
Length=254

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGL+P+NK G  N  FPYLLHLGIQ YD  FL +YP + PT LQL+EDLEQLKV+ENGY+
Sbjct  163  RGLLPFNKKGVANDKFPYLLHLGIQCYDAHFLSMYPLIAPTALQLEEDLEQLKVIENGYK  222

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            +KVI VDH+AHGVD+P D+  I   MR RN++
Sbjct  223  IKVINVDHDAHGVDSPGDIASIESLMRGRNIA  254



>gb|AAL06487.1|AF411798_1 F14G24.28/F14G24.28 [Arabidopsis thaliana]
 gb|AAN18046.1| At1g53000/F14G24.28 [Arabidopsis thaliana]
Length=74

 Score =   127 bits (320),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  639  LLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYRMKVIKVDHEAHGVDAPED  460
            +LHLGIQS+D+KFLK+Y ELQPTPLQ +EDLEQLKVLENGY+MKVIKVDHEAHGVD P+D
Sbjct  1    MLHLGIQSFDSKFLKVYSELQPTPLQQEEDLEQLKVLENGYKMKVIKVDHEAHGVDTPDD  60

Query  459  VQKIVEFMRERNLS  418
            V+KI   MRERN+S
Sbjct  61   VEKIESLMRERNMS  74



>ref|XP_009124899.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
isoform X2 [Brassica rapa]
Length=271

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 68/92 (74%), Gaps = 19/92 (21%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSG VNP+FPY+LHLGIQ                   ++EDLEQLKVLENGY+
Sbjct  199  RGLIPFNKSGGVNPEFPYMLHLGIQ-------------------VEEDLEQLKVLENGYK  239

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            MKVIKVDHEAHGVD PEDV+KI   MRERNLS
Sbjct  240  MKVIKVDHEAHGVDTPEDVEKIESLMRERNLS  271



>gb|KDO74063.1| hypothetical protein CISIN_1g0225552mg, partial [Citrus sinensis]
Length=199

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNP FPYLLHLGIQSYD+ FLKIYP L PTPLQL+EDLEQLKVLENGY+
Sbjct  126  RGLIPYNKSGKVNPQFPYLLHLGIQSYDSNFLKIYPGLHPTPLQLEEDLEQLKVLENGYK  185

Query  513  MKV  505
            MKV
Sbjct  186  MKV  188



>gb|EMT25203.1| hypothetical protein F775_52244 [Aegilops tauschii]
Length=240

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGKVNP FPYLLHLGI  +D+KFLKIYP+L PTPLQL+EDLEQLKVLENGY+
Sbjct  166  RGLIPFNKSGKVNPHFPYLLHLGISGFDSKFLKIYPQLAPTPLQLEEDLEQLKVLENGYK  225

Query  513  MKVIKVDHEAH  481
            MK  K + +  
Sbjct  226  MKFFKANQDTE  236



>ref|XP_006451889.1| hypothetical protein CICLE_v10009061mg [Citrus clementina]
 gb|ESR65129.1| hypothetical protein CICLE_v10009061mg [Citrus clementina]
Length=281

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVNP FPYLLHLGIQSYD+ FLKIYP L PTPLQL+EDLEQLKVLENGY+
Sbjct  204  RGLIPYNKSGKVNPQFPYLLHLGIQSYDSNFLKIYPGLHPTPLQLEEDLEQLKVLENGYK  263

Query  513  MKVIKV  496
            MK  K+
Sbjct  264  MKNPKI  269



>ref|XP_010231033.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
isoform X1 [Brachypodium distachyon]
Length=364

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGK NP FPY LHLGI  +D+KFLKIYP+L PTPLQL+EDLEQLKVLENGYR
Sbjct  199  RGLIPFNKSGKANPQFPYHLHLGISCFDSKFLKIYPQLAPTPLQLEEDLEQLKVLENGYR  258

Query  513  MKVIKVDHEAHGV  475
            MK +   H   G 
Sbjct  259  MKGLGCKHACVGA  271



>ref|XP_007508518.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Bathycoccus 
prasinos]
 emb|CCO20135.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Bathycoccus 
prasinos]
Length=321

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RG++P NK G+V+  F Y LHLG+Q YD +FLK++P +  TP+Q+QEDLEQLKV+ENGY+
Sbjct  229  RGMLPNNKKGEVDTSFDYWLHLGLQCYDREFLKLFPIMPATPMQMQEDLEQLKVIENGYK  288

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRE  430
            +KVI+V+H AHGVD PEDV  I + + E
Sbjct  289  IKVIRVNHCAHGVDEPEDVASIEKIIAE  316



>gb|EMS68844.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Triticum urartu]
Length=215

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSGKVNP FPYLLHLGI  +D+KFLKIYP+L PTPLQL+EDLEQLKVLENGY+
Sbjct  122  RGLIPFNKSGKVNPHFPYLLHLGISGFDSKFLKIYPQLAPTPLQLEEDLEQLKVLENGYK  181

Query  513  MKVIK  499
            MK  +
Sbjct  182  MKACQ  186



>ref|XP_005843072.1| hypothetical protein CHLNCDRAFT_33280 [Chlorella variabilis]
 gb|EFN50970.1| hypothetical protein CHLNCDRAFT_33280 [Chlorella variabilis]
Length=303

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 68/97 (70%), Gaps = 6/97 (6%)
 Frame = -2

Query  693  RGLIPYNKSGKVNP------DFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKV  532
            RG++P NK G+V        D PYLLHLG+Q YD  FL+ Y ++  TPLQ+ EDLEQLK+
Sbjct  206  RGVLPSNKDGEVRSYPAPWHDKPYLLHLGLQCYDRAFLRQYCKMAATPLQMMEDLEQLKI  265

Query  531  LENGYRMKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            LENGYRMKV+ VDH AHGVD PEDV  I   M ++ L
Sbjct  266  LENGYRMKVVVVDHSAHGVDLPEDVASIEAIMGQQRL  302



>ref|XP_008810228.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Phoenix dactylifera]
Length=270

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIPYNKSGKVN  FPYLLHLGIQS+D+KFL+IYP+L  TPLQL+EDLEQLKVLENGY+
Sbjct  206  RGLIPYNKSGKVNLQFPYLLHLGIQSFDSKFLRIYPQLPSTPLQLEEDLEQLKVLENGYK  265

Query  513  MKVI  502
            MKV+
Sbjct  266  MKVM  269



>gb|ACN28946.1| unknown [Zea mays]
Length=202

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSG  NP +PYLLHLGI  +D+KFLKIYPEL PTPLQ++EDLEQLKVLENGYR
Sbjct  129  RGLIPFNKSGNANPKYPYLLHLGIAGFDSKFLKIYPELPPTPLQMEEDLEQLKVLENGYR  188

Query  513  MK  508
            MK
Sbjct  189  MK  190



>ref|XP_005648194.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE23650.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=284

 Score =   112 bits (279),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 67/98 (68%), Gaps = 6/98 (6%)
 Frame = -2

Query  693  RGLIPYNKSGKVNP------DFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKV  532
            RG++P NK G V P        PYLLHLG+  +D  FL  Y  + PTPL L EDLEQLKV
Sbjct  187  RGMLPANKDGVVRPFPAPFQHQPYLLHLGLACFDRAFLAQYCRMPPTPLMLMEDLEQLKV  246

Query  531  LENGYRMKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            LENGY++KVI VDH+AHGVD PEDV  I + MRE  LS
Sbjct  247  LENGYKIKVIVVDHKAHGVDEPEDVAVIEQKMRELGLS  284



>gb|KDD75573.1| cytidylyltransferase [Helicosporidium sp. ATCC 50920]
Length=273

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 68/98 (69%), Gaps = 6/98 (6%)
 Frame = -2

Query  693  RGLIPYNKSGKVN------PDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKV  532
            RG +P NK G          D PYLLHLGIQ YD +FL  Y E++PTPL + EDLEQLKV
Sbjct  174  RGALPSNKEGVARKFPQPWADKPYLLHLGIQCYDRRFLDRYCEMEPTPLMMMEDLEQLKV  233

Query  531  LENGYRMKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            +ENGY++KV++V+H AHGVD PEDV  I   +R++  +
Sbjct  234  IENGYKIKVVQVEHSAHGVDLPEDVASIEAILRQQEAA  271



>gb|AFW81112.1| hypothetical protein ZEAMMB73_836886 [Zea mays]
Length=280

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            RGLIP+NKSG  NP +PYLLHLGI  +D+KFLKIYPEL PTPLQ++EDLEQLKVLENGYR
Sbjct  207  RGLIPFNKSGNANPKYPYLLHLGIAGFDSKFLKIYPELPPTPLQMEEDLEQLKVLENGYR  266

Query  513  MK  508
            MK
Sbjct  267  MK  268



>gb|KCW67327.1| hypothetical protein EUGRSUZ_F01114 [Eucalyptus grandis]
Length=191

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 66/84 (79%), Gaps = 8/84 (10%)
 Frame = -2

Query  669  SGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYRMKVIKVDH  490
            SGKV+P FP LLHL IQSYD+KFLKIYPELQPT LQL+EDLEQLKVLENGY+MKVIKVDH
Sbjct  116  SGKVDPKFP-LLHLEIQSYDSKFLKIYPELQPTLLQLEEDLEQLKVLENGYKMKVIKVDH  174

Query  489  EAHGVDAPEDVQKIVEFMRERNLS  418
                      ++KI  +M E NLS
Sbjct  175  GMI-------LKKIESYMLEGNLS  191



>ref|XP_011396550.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Auxenochlorella 
protothecoides]
 gb|KFM23676.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Auxenochlorella 
protothecoides]
Length=287

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 61/88 (69%), Gaps = 6/88 (7%)
 Frame = -2

Query  693  RGLIPYNKSGKVNP------DFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKV  532
            RG++P+NK G V        + PYLLHLG+Q YD  FL  Y ++  TPL   EDLEQLKV
Sbjct  179  RGVLPHNKDGVVRSYPAPWTEKPYLLHLGLQCYDRAFLSKYCKMPATPLMAMEDLEQLKV  238

Query  531  LENGYRMKVIKVDHEAHGVDAPEDVQKI  448
            LENGY+MKV++V H AHGVD PEDV  I
Sbjct  239  LENGYKMKVVEVSHSAHGVDVPEDVASI  266



>ref|WP_032125452.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Chlamydia sp. 
'Diamant']
Length=254

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP NK     P   Y  HLG+ +Y   F+  Y +L PTPLQL+EDLEQLKVLE+GYR
Sbjct  162  RTLIPSNKRQCFEPQTSYFRHLGLYAYRPAFVLEYQQLSPTPLQLEEDLEQLKVLEHGYR  221

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERN  424
            +KV  VDH + GVD PED+ KI +++ ++N
Sbjct  222  IKVAVVDHVSIGVDTPEDIHKIEQWLCKQN  251



>emb|CCB91546.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Waddlia chondrophila 
2032/99]
Length=245

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP   SGK  PD  Y  HLGI  Y   FL  Y EL+ TPLQL EDLEQLKVLE+G++
Sbjct  160  RSLIPGGHSGKWEPDTTYYKHLGIYGYRKDFLFHYAELETTPLQLAEDLEQLKVLEHGFK  219

Query  513  MKVIKVDHEAHGVDAPEDVQKI  448
            +KV  VD  + GVD PED+ K+
Sbjct  220  IKVAVVDSHSIGVDTPEDLIKV  241



>ref|WP_013182177.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Waddlia chondrophila]
 gb|ADI38464.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Waddlia chondrophila 
WSU 86-1044]
Length=245

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP   SGK  PD  Y  HLGI  Y   FL  Y EL+ TPLQL EDLEQLKVLE+G++
Sbjct  160  RSLIPGGHSGKWEPDTTYYKHLGIYGYRKDFLFHYAELETTPLQLAEDLEQLKVLEHGFK  219

Query  513  MKVIKVDHEAHGVDAPEDVQKI  448
            +KV  VD  + GVD PED+ K+
Sbjct  220  IKVAVVDSHSIGVDTPEDLIKV  241



>ref|WP_044044912.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Candidatus Protochlamydia 
amoebophila]
Length=254

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP NK+        Y  HLG+  Y   F+  Y +L  TPLQL+EDLEQLKVLE+GYR
Sbjct  162  RALIPSNKTNSFKNGAIYFRHLGLYVYRPSFIINYQKLPSTPLQLEEDLEQLKVLEHGYR  221

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERN  424
            +KV  VD    GVD PED+ K+ E++ ++N
Sbjct  222  IKVAIVDQANIGVDTPEDIHKVEEWLCKQN  251



>sp|Q6MD00.1|KDSB_PARUW RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-2-keto-3-deoxyoctulosonic acid synthase; 
Short=CKS; Short=CMP-KDO synthase [Candidatus Protochlamydia 
amoebophila UWE25]
 emb|CAF23549.1| probable 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO 
synthetase) [Candidatus Protochlamydia amoebophila UWE25]
Length=259

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP NK+        Y  HLG+  Y   F+  Y +L  TPLQL+EDLEQLKVLE+GYR
Sbjct  167  RALIPSNKTNSFKNGAIYFRHLGLYVYRPSFIINYQKLPSTPLQLEEDLEQLKVLEHGYR  226

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERN  424
            +KV  VD    GVD PED+ K+ E++ ++N
Sbjct  227  IKVAIVDQANIGVDTPEDIHKVEEWLCKQN  256



>ref|WP_013925075.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parachlamydia 
acanthamoebae]
 emb|CCB86574.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parachlamydia 
acanthamoebae UV-7]
Length=264

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP +K     P+  Y  H+G+  Y T FL +Y +L  TPLQL EDLEQLK+LE+GYR
Sbjct  164  RALIPSSKKQGYQPETRYYRHIGVYGYRTDFLLLYTKLPSTPLQLSEDLEQLKILEHGYR  223

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            +K + VD  + GVD P D++K+   + ++N S
Sbjct  224  IKTVVVDSISIGVDEPADIKKVEYLLCKQNTS  255



>ref|WP_006339767.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parachlamydia 
acanthamoebae]
 gb|EFB42772.1| hypothetical protein pah_c002o003 [Parachlamydia acanthamoebae 
str. Hall's coccus]
Length=264

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP +K     P+  Y  H+G+  Y T FL +Y +L  TPLQL EDLEQLK+LE+GYR
Sbjct  164  RALIPSSKKQGYQPETRYYRHIGVYGYRTDFLLLYTKLPSTPLQLSEDLEQLKILEHGYR  223

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            +K + VD  + GVD P D++K+   + ++N S
Sbjct  224  IKTVVVDSISIGVDEPADIKKVEYLLCKQNTS  255



>ref|WP_041017103.1| hypothetical protein [Criblamydia sequanensis]
 emb|CDR33655.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Criblamydia 
sequanensis CRIB-18]
Length=252

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R  IP +K+ +VN + PY  H+G+ +Y   FL IYP L  TPLQ+ EDLEQLK LE+GY+
Sbjct  165  RSPIPSHKTERVNKNIPYHKHIGLYAYRKDFLLIYPYLTSTPLQISEDLEQLKALEHGYK  224

Query  513  MKVIKVDHEAHGVDAPED  460
            + +  VDH+  G+D PED
Sbjct  225  IHITLVDHDTKGIDTPED  242



>gb|KIC72214.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Candidatus Protochlamydia 
amoebophila]
Length=263

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP NK+        Y  HLG+  Y   F+  Y +L  TPLQL+EDLEQLKVLE+GYR
Sbjct  171  RALIPSNKTNSFKNGAIYFRHLGLYVYRPSFIIDYQKLPSTPLQLEEDLEQLKVLEHGYR  230

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERN  424
            +KV  V+    GVD PED+ K+ E++ ++N
Sbjct  231  IKVAIVEQANIGVDTPEDIHKVEEWLCKQN  260



>ref|WP_039357883.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Candidatus Protochlamydia 
amoebophila]
Length=254

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP NK+        Y  HLG+  Y   F+  Y +L  TPLQL+EDLEQLKVLE+GYR
Sbjct  162  RALIPSNKTNSFKNGAIYFRHLGLYVYRPSFIIDYQKLPSTPLQLEEDLEQLKVLEHGYR  221

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERN  424
            +KV  V+    GVD PED+ K+ E++ ++N
Sbjct  222  IKVAIVEQANIGVDTPEDIHKVEEWLCKQN  251



>ref|WP_042280529.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Candidatus Protochlamydia 
sp. R18]
Length=254

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP NK+        Y  HLG+  Y   F+  Y +L  TPLQL+EDLEQLKVLE+GYR
Sbjct  162  RALIPSNKTNSFKNGAIYFRHLGLYVYRPSFIIDYQKLPSTPLQLEEDLEQLKVLEHGYR  221

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERN  424
            +K+  V+    GVD PED+ K+ E++ ++N
Sbjct  222  IKIAIVEQANIGVDTPEDIHKVEEWLCKQN  251



>ref|WP_021169307.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Sporomusa ovata]
 gb|EQB26493.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Sporomusa ovata 
DSM 2662]
Length=247

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDF-PYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGY  517
            R LIPY +S K+     P   H+GI +Y  +FL  Y  L PTPL+  E LEQL+ LE+GY
Sbjct  156  RSLIPYPRSNKLPGGLLPVYKHIGIYAYRREFLLNYAALIPTPLEQMESLEQLRALEHGY  215

Query  516  RMKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            ++KV+K D ++ GVD PED++K+ E+ R  NL
Sbjct  216  KIKVLKTDFKSIGVDTPEDLEKVNEYFRRCNL  247



>ref|WP_044882342.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Neochlamydia 
sp. EPS4]
Length=259

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP N S K +P   Y  H+GI  +  +FL  Y +L  TPLQL EDLEQLKVLE+GY+
Sbjct  166  RSLIPSNPSAKFDPRMAYFKHIGIYGFRREFLFTYGKLGTTPLQLAEDLEQLKVLEHGYK  225

Query  513  MKVIKVDHEAHGVDAPEDVQKI  448
            +K   V+  +  VD PED++KI
Sbjct  226  IKTAVVETASLSVDHPEDIKKI  247



>gb|KIC73798.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Neochlamydia 
sp. EPS4]
Length=264

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP N S K +P   Y  H+GI  +  +FL  Y +L  TPLQL EDLEQLKVLE+GY+
Sbjct  171  RSLIPSNPSAKFDPRMAYFKHIGIYGFRREFLFTYGKLGTTPLQLAEDLEQLKVLEHGYK  230

Query  513  MKVIKVDHEAHGVDAPEDVQKI  448
            +K   V+  +  VD PED++KI
Sbjct  231  IKTAVVETASLSVDHPEDIKKI  252



>ref|WP_042238826.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Neochlamydia 
sp. S13]
Length=259

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP N S K +P   Y  H+GI  +  +FL  Y +L  TPLQL EDLEQLKVLE+GY+
Sbjct  166  RSLIPSNPSAKFDPRTVYFKHIGIYGFRREFLFTYGKLGTTPLQLAEDLEQLKVLEHGYK  225

Query  513  MKVIKVDHEAHGVDAPEDVQKI  448
            +K   V+  +  VD PED++KI
Sbjct  226  IKTAIVESASLSVDHPEDIKKI  247



>ref|WP_039384606.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Neochlamydia 
sp. TUME1]
 gb|KIC76398.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Neochlamydia 
sp. TUME1]
Length=259

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP N S K +P   Y  H+GI  +  +FL  Y +L  TPLQL EDLEQLKVLE+GY+
Sbjct  166  RSLIPSNPSAKFDPRTVYFKHIGIYGFRREFLFTYGKLGTTPLQLAEDLEQLKVLEHGYK  225

Query  513  MKVIKVDHEAHGVDAPEDVQKI  448
            +K   V   +  VD PED++KI
Sbjct  226  IKAAIVGSASLSVDHPEDIKKI  247



>ref|WP_023053353.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Megasphaera 
sp. BV3C16-1]
 gb|ERT60470.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Megasphaera 
sp. BV3C16-1]
Length=246

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIPY ++       P   H+GI +Y   FL  Y  + PTPL+  E LEQL+VLENGY+
Sbjct  156  RSLIPYGRNPYTAGSRP-CKHIGIYAYGRDFLLKYANMAPTPLESAESLEQLRVLENGYK  214

Query  513  MKVIKVDHEAHGVDAPEDVQKI-VEFMRER  427
            +KVIK  H   G+D PED+Q+I   F +E+
Sbjct  215  IKVIKTAHRFIGIDTPEDLQRIRAYFAKEK  244



>ref|WP_006789384.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Anaeroglobus 
geminatus]
 gb|EHM43002.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Anaeroglobus 
geminatus F0357]
Length=245

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIPY +      + PY  H+G  +Y   FL  Y  + P+PL+  E LEQL+VLENGY+
Sbjct  156  RSLIPYPRHDFTKKNRPYK-HIGFYAYKRDFLLQYAAMAPSPLEEAESLEQLRVLENGYK  214

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERN  424
            +KVIK  H   GVD PEDV +I E+  + N
Sbjct  215  IKVIKTGHSFIGVDTPEDVVRIREYFAKEN  244



>ref|WP_042102883.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parachlamydiaceae 
bacterium HS-T3]
Length=251

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP   + +   D+ Y  H+G+ +Y  +FLK Y  L  TPLQ+ E+LEQLKVLE GY+
Sbjct  159  RTLIPAGIAKEFQADYIYYKHIGLYAYRREFLKTYTSLPQTPLQIAENLEQLKVLEWGYK  218

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            +KV  V+  A  V+ PED++K+  ++ +++LS
Sbjct  219  IKVAVVESTALEVNYPEDIKKVEHYLCKQSLS  250



>ref|WP_016483970.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Chthonomonas 
calidirosea]
 emb|CCW36461.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Chthonomonas 
calidirosea T49]
Length=249

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R  IPY +     P  P + H+G+ +Y  +FL+++  L+PTPL+  E LEQL+ LE GYR
Sbjct  159  RSRIPYPRQ---EPSLPVMQHIGLYAYRNRFLQLFTTLEPTPLECTESLEQLRALEWGYR  215

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMR  433
            +++++V+     VD PED++K+ + ++
Sbjct  216  IRMVRVERAPIAVDTPEDLEKVRQLLK  242



>ref|WP_008701006.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum]
 gb|EEO42366.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum subsp. animalis 7_1]
 gb|EHG18515.2| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum subsp. polymorphum F0401]
 gb|ERT40810.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum CTI-1]
Length=245

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 59/91 (65%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NENIAYFKHIGIYGYKRDFVIEYSKMSATPLEETESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E+++++++F+R+ N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVIKFIRKNNI  243



>ref|WP_008691589.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum]
 gb|EGN66098.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum subsp. animalis 11_3_2]
Length=245

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NENIAYFKHIGIYGYKRDFVIEYSKMSATPLEETESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ F+R+ N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVITFIRKNNI  243



>ref|WP_023040060.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum]
 gb|ERT35935.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum CTI-3]
Length=245

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NENIAYFKHIGIYGYKRDFVIEYSKMSATPLEETESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ F+R+ N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVITFIRKNNI  243



>ref|WP_007392951.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Megasphaera 
sp. UPII 135-E]
 gb|EGS32743.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Megasphaera 
sp. UPII 135-E]
Length=245

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIPY +    N   PY  H+GI +Y  +FL  Y ++  TP +  E LEQL+VLENGY 
Sbjct  156  RSLIPYPRQAYGNQCQPYK-HVGIYAYRYRFLLQYAQMAQTPAEKTESLEQLRVLENGYT  214

Query  513  MKVIKVDHEAHGVDAPEDVQKI  448
            +KVIK +H+  GVD PED+Q++
Sbjct  215  IKVIKTNHQFIGVDTPEDLQRV  236



>ref|WP_008801252.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
gonidiaformans]
 gb|EFS21182.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Fusobacterium 
gonidiaformans 3-1-5R]
 gb|EFS27946.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Fusobacterium 
gonidiaformans ATCC 25563]
Length=247

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 3/96 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R ++PY +  K N D  Y  H+GI  Y   F+  Y  +  TPL+  E LEQL+VLENGY+
Sbjct  155  RSILPYPR--KENIDL-YYKHIGIYGYTRNFVLEYAAMASTPLESSESLEQLRVLENGYQ  211

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS**NY  406
            +KV++  H++ GVD  ED++K+ +++ ER ++  NY
Sbjct  212  IKVLETSHQSVGVDTQEDLEKVCKWIEERGITIENY  247



>ref|WP_044950976.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Acidobacteriaceae 
bacterium KBS 96]
Length=257

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 55/82 (67%), Gaps = 1/82 (1%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R  IPYN+    +P   Y  H+G+  Y  +FL  YP+L   PL+  E LEQL+ LENGYR
Sbjct  163  RSPIPYNRDSNGDPG-SYFKHVGLYVYRREFLLRYPDLTIGPLENAERLEQLRALENGYR  221

Query  513  MKVIKVDHEAHGVDAPEDVQKI  448
            ++V++ D+E+ GVD PED++++
Sbjct  222  IRVVETDYESLGVDTPEDLERL  243



>ref|WP_008798334.1| MULTISPECIES: 3-deoxy-manno-octulosonate cytidylyltransferase 
[Fusobacterium]
 gb|EEW95385.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum subsp. animalis 3_1_33]
 gb|EUB38436.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Fusobacterium 
sp. CM1]
Length=245

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NENIAYFKHIGIYGYKRDFVIEYSKMSITPLEETESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ F+R+ N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVITFIRKNNI  243



>ref|WP_032836063.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
sp. OBRC1]
 gb|EUB29690.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Fusobacterium 
sp. OBRC1]
Length=245

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NENISYFKHIGIYGYKRDFVIEYSKMLATPLEETESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ ++RE N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVINYIRENNI  243



>ref|WP_005898010.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum]
 gb|EDK89271.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum subsp. polymorphum ATCC 10953]
 gb|ETZ27964.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum 13_3C]
Length=245

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NENISYFKHIGIYGYKRDFVIEYSKMLATPLEETESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ ++RE N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVINYIRENNI  243



>ref|WP_005912467.1| MULTISPECIES: 3-deoxy-manno-octulosonate cytidylyltransferase 
[Fusobacterium]
 gb|EJG09477.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum subsp. fusiforme ATCC 51190]
 gb|ERT45856.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum CTI-7]
 gb|ETT09718.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Fusobacterium 
sp. CM21]
Length=245

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NENISYFKHIGIYGYKRDFVIDYSKMSATPLEETESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ +++E N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVINYIKENNI  243



>ref|WP_005888288.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum]
 gb|EAA24972.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum subsp. vincentii ATCC 49256]
 gb|EEO39634.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum subsp. vincentii 4_1_13]
 gb|EEU32216.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum subsp. vincentii 3_1_36A2]
 gb|EFG34686.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum subsp. vincentii 3_1_27]
 gb|EMP16830.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum CC53]
Length=245

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NENISYFKHIGIYGYKRDFVIDYSKMSATPLEETESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ +++E N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVINYIKENNI  243



>ref|WP_008795418.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum]
 gb|EGN65330.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum subsp. animalis 21_1A]
Length=245

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 59/91 (65%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NENIAYFKHIGIYGYKRDFVIEYSKMSATPLEETESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E+++++++F+++ N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVIKFIKKNNI  243



>ref|WP_004097334.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Acetonema longum]
 gb|EGO62931.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Acetonema longum 
DSM 6540]
Length=242

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R L+PY ++   N    +  H+GI +Y   FL  Y     TPL+  E LEQL+ LE+GYR
Sbjct  156  RSLVPYPRAASGNTT--WYKHIGIYAYRRDFLLRYASFSATPLEQAESLEQLRALEHGYR  213

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRER  427
            +KV++ D ++ GVD PED+ K+   +R R
Sbjct  214  IKVLETDFQSVGVDTPEDLAKVNALLRAR  242



>ref|WP_006940965.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Megasphaera 
micronuciformis]
 gb|EFQ04932.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Megasphaera 
micronuciformis F0359]
Length=245

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 55/91 (60%), Gaps = 1/91 (1%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIPY +        PY  H+GI +Y   FL  Y  ++ TPL+  E LEQL+VLENGY+
Sbjct  156  RSLIPYPRHDYTVQHGPYK-HIGIYAYRRAFLLEYANMEVTPLEATESLEQLRVLENGYK  214

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KVIK  H   G+D PEDV ++ E+  +  +
Sbjct  215  IKVIKTTHTFIGIDTPEDVDRVREYFAKEKV  245



>gb|EFD81876.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum subsp. animalis D11]
Length=216

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 59/91 (65%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  127  RSVIPYPRK---NENIAYFKHIGIYGYKRDFVIEYSKMSITPLEETESLEQLRVLENGYK  183

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E+++++++F+++ N+
Sbjct  184  IKVLETTHSLIGVDTQENLEQVIKFIKKNNI  214



>ref|WP_023036679.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum]
 gb|ERT48993.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum CTI-6]
Length=245

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NENISYFKHIGIYGYKRDFVIEYSKMLATPLEETESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ +++E N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVINYIKENNI  243



>ref|WP_013300580.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Parvularcula 
bermudensis]
 gb|ADM09606.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Parvularcula 
bermudensis HTCC2503]
Length=263

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 56/92 (61%), Gaps = 2/92 (2%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R  +P+ ++    P    LLHLG+ ++  + L+I+P L PTPL+  E LEQL++LE+G+R
Sbjct  164  RAAVPFVRTAP--PQAQPLLHLGLYAFSAQSLQIFPTLTPTPLEQTESLEQLRILEHGHR  221

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            + V  VDH A G+D P D    V    +R+ S
Sbjct  222  IAVGLVDHHAPGIDTPADYAAFVARHAQRSPS  253



>ref|WP_029599951.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum]
Length=245

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NENISYFKHIGIYGYKRDFVIEYSKMLATPLEETESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ +++E N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVINYIKENNI  243



>ref|WP_005952137.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
varium]
 gb|EES65198.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Fusobacterium 
varium ATCC 27725]
Length=246

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 61/91 (67%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +S  +     Y  H+GI  Y  +F+  Y +++ TPL+L E LEQL+VLENGY+
Sbjct  156  RSVIPYPRSLDLKN---YYKHIGIYGYKREFVMEYSKMESTPLELSESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KVI+  ++  GVD  +++ K+ E++RE N+
Sbjct  213  IKVIETPYKIIGVDTQDELDKVREYIREHNI  243



>ref|WP_009353664.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Veillonella 
sp. oral taxon 780]
 gb|EGS34776.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Veillonella 
sp. oral taxon 780 str. F0422]
Length=243

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 55/88 (63%), Gaps = 3/88 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP+ +   V    P L H+G+  Y+ +FL  Y +++PTP +L E LEQL+ LENGY 
Sbjct  156  RSLIPHPRHAFV---VPPLKHVGMYGYNRQFLLTYAKMEPTPAELTESLEQLRALENGYT  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRE  430
            ++VI  D    GVD PED++++ E   +
Sbjct  213  IRVITTDQRFVGVDTPEDLERVNEIFHQ  240



>ref|WP_029493966.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
hwasookii]
Length=245

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N    Y  H+GI +Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NEAISYFKHIGIYAYKRDFVIEYSKMIATPLEETESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ +++E N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVINYIKENNI  243



>ref|WP_005915010.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
hwasookii]
 gb|EJU08497.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
hwasookii ChDC F128]
Length=245

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N    Y  H+GI +Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NEAISYFKHIGIYAYKRDFVIEYSKMIATPLEETESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ +++E N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVINYIKENNI  243



>ref|WP_029492366.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
hwasookii]
Length=245

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N    Y  H+GI +Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NEAISYFKHIGIYAYKRDFVIEYSKMIATPLEETESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ +++E N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVINYIKENNI  243



>ref|WP_029757650.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum]
Length=245

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N    Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NESIAYFKHIGIYGYKRDFVIDYSKMLATPLEETESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ +++E N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVINYIKENNI  243



>ref|WP_022070061.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
sp. CAG:649]
 emb|CDA07561.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
sp. CAG:649]
Length=245

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IP     + N +  Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIP---CPRKNENIAYFKHIGIYGYKRDFVIEYSKMSATPLEETESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ F+R+ N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVITFIRKNNI  243



>ref|WP_022198711.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Akkermansia 
muciniphila CAG:154]
 emb|CDB55843.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Akkermansia 
muciniphila CAG:154]
Length=249

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +  +V P    L HLGI +Y   FL+ Y    PTPL+  E LEQL+ LENG R
Sbjct  163  RSVIPYARHPRVAPP---LRHLGIYAYRRDFLENYVRWAPTPLEQTESLEQLRALENGAR  219

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFM  436
            ++VI  DH + GVD PE  +++ + +
Sbjct  220  IRVILTDHVSVGVDTPEQAEQVEQIL  245



>ref|WP_012419228.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Akkermansia 
muciniphila]
 gb|ACD04013.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Akkermansia 
muciniphila ATCC BAA-835]
Length=249

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +  +V P    L HLGI +Y   FL+ Y    PTPL+  E LEQL+ LENG R
Sbjct  163  RSVIPYARHPRVAPP---LRHLGIYAYRRDFLENYVRWAPTPLEQTESLEQLRALENGAR  219

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFM  436
            ++VI  DH + GVD PE  +++ + +
Sbjct  220  IRVILTDHVSVGVDTPEQAEQVEQIL  245



>ref|WP_004376083.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella oris]
 gb|EFI49375.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Prevotella 
oris C735]
Length=247

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 58/92 (63%), Gaps = 3/92 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVN---PDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLEN  523
            R +IP+ +S +       +P+L HLGI +Y T+ LK    L  + L+L E LEQL+ LEN
Sbjct  155  RSVIPFVRSVERQEWLKKYPFLKHLGIYAYRTEVLKAITRLPQSSLELAESLEQLRWLEN  214

Query  522  GYRMKVIKVDHEAHGVDAPEDVQKIVEFMRER  427
            GYR+KV   + E  G+D PED+Q+  +F+R R
Sbjct  215  GYRIKVGITNVETVGIDTPEDLQRAEDFIRNR  246



>ref|WP_027890144.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Megamonas hypermegale]
Length=243

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 53/91 (58%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIPY +    N       H+GI  Y   FL  Y ++QPTPL+  E LEQL+ LENGY+
Sbjct  156  RSLIPYPRE---NTGVTVYKHIGIYGYRRDFLLQYAKMQPTPLEQTESLEQLRALENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KVI  D    GVD PED+ ++ E  +  NL
Sbjct  213  IKVITTDKHFVGVDTPEDLAEVNEIYQNLNL  243



>ref|WP_022397535.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Akkermansia 
sp. CAG:344]
 emb|CDD93952.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Akkermansia 
sp. CAG:344]
Length=249

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +  +V    P L HLGI +Y   FL+ Y   +PTPL+  E LEQL+ LENG R
Sbjct  163  RSVIPYARHPRV---IPPLRHLGIYAYRRDFLENYVRWEPTPLEQTESLEQLRALENGAR  219

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFM  436
            ++VI  DH + GVD PE   ++ + +
Sbjct  220  IRVILTDHVSVGVDTPEQAAQVEQIL  245



>ref|WP_031930055.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Akkermansia 
muciniphila]
Length=249

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +  +V P    L HLGI +Y   FL+ Y    PTPL+  E LEQL+ LENG R
Sbjct  163  RSVIPYARHPRVAPP---LRHLGIYAYRHDFLENYVRWAPTPLEQTESLEQLRALENGAR  219

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFM  436
            ++VI  DH + GVD PE  +++ + +
Sbjct  220  IRVILTDHVSVGVDTPEQAEQVEQIL  245



>ref|WP_018499034.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Leptotrichia 
wadei]
Length=248

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY ++   N DF Y  H+GI  Y T FL     L+   L+  E LEQL+ +ENGY+
Sbjct  157  RSVIPYERNK--NADFKYFRHIGIYGYTTSFLNKLKNLKEGVLEKIESLEQLRFIENGYK  214

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++      GVD  ED++++V+F++E  +
Sbjct  215  IKVLETKSNVIGVDTEEDLREVVKFIKENGI  245



>ref|WP_023041210.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum]
 gb|ERT42757.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum CTI-2]
Length=245

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NGNISYFKHIGIYGYKRDFVIEYSKMLATPLEEIESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ +++E N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVINYIKENNI  243



>ref|WP_011016663.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum]
 ref|NP_603704.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum subsp. nucleatum ATCC 25586]
 sp|Q8RFA8.1|KDSB_FUSNN RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-2-keto-3-deoxyoctulosonic acid synthase; 
Short=CKS; Short=CMP-KDO synthase [Fusobacterium nucleatum 
subsp. nucleatum ATCC 25586]
 gb|AAL95003.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum subsp. nucleatum ATCC 25586]
Length=245

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NGNISYFKHIGIYGYKRDFVIEYSKMLATPLEEIESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ +++E N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVINYIKENNI  243



>ref|WP_005903438.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum]
 gb|EFG95053.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum subsp. nucleatum ATCC 23726]
Length=245

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NGNISYFKHIGIYGYKRDFVIEYSKMLATPLEEIESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ +++E N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVINYIKENNI  243



>gb|EEV87699.1| hypothetical protein HMPREF0198_2231, partial [Cardiobacterium 
hominis ATCC 15826]
Length=115

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = -2

Query  693  RGLIPYNKSG-KVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGY  517
            R  IPY +    V+  FPYL H+GI +Y    LK YP+L  TPL+  E LEQL+ LE+G 
Sbjct  22   RAAIPYVRDADGVSGAFPYLRHIGIYAYRVAALKRYPQLAATPLEQAEKLEQLRFLEHGL  81

Query  516  RMKVIKVDHE-AHGVDAPEDVQKIVEFMR  433
            R+ V  V+     GVD  ED+Q++  F+R
Sbjct  82   RIAVGVVNEAPPPGVDCEEDLQRVEAFLR  110



>emb|CDZ81480.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Chlamydia sp. 
'Rubis']
Length=251

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 55/90 (61%), Gaps = 3/90 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP +KS        Y  H+GI ++   F+  Y  L  TPLQ  EDLEQLKVLE+GY+
Sbjct  164  RSLIPGSKS---ELSGQYFKHIGIYAFKRDFIYKYASLPATPLQTTEDLEQLKVLEHGYK  220

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERN  424
            +K + V+  + GVD PED+QK+   +  +N
Sbjct  221  IKTVLVNSVSVGVDIPEDIQKVERMLCNQN  250



>ref|WP_032846284.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
sp. CM22]
 gb|EUB27139.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Fusobacterium 
sp. CM22]
Length=245

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NENIFYFKHIGIYGYKRDFVIDYSKMLATPLEETESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ +++E N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVINYIKENNI  243



>ref|WP_038673945.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Pelosinus sp. 
UFO1]
 gb|AIF53760.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Pelosinus sp. 
UFO1]
Length=240

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP+ +   V    P   H+GI +Y   FL  Y +L PTPL+  E LEQL+ LE+GYR
Sbjct  156  RSLIPFPR---VETGLPVYKHIGIYAYRRDFLLKYAKLAPTPLEKAESLEQLRALEHGYR  212

Query  513  MKVIKVDHEAHGVDAPEDVQKI  448
            +KVIK D ++ GVD  ED++K+
Sbjct  213  IKVIKTDFQSIGVDTMEDLEKV  234



>ref|WP_008566021.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella maculosa]
 gb|EHO68022.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Prevotella 
maculosa OT 289]
Length=247

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 57/92 (62%), Gaps = 3/92 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVN---PDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLEN  523
            R +IP+ +  +       +P+L HLGI +Y T  LK   +L  + L+L E LEQL+ L+N
Sbjct  155  RSIIPFVRGTERQDWLSKYPFLKHLGIYAYRTNVLKEITKLPQSSLELAESLEQLRWLQN  214

Query  522  GYRMKVIKVDHEAHGVDAPEDVQKIVEFMRER  427
            GYR+KV   D E  G+D P+D+Q+  EF+R R
Sbjct  215  GYRIKVGLTDVETVGIDTPDDLQRAEEFIRNR  246



>ref|WP_040355896.1| 3-deoxy-manno-octulosonate cytidylyltransferase, partial [Cardiobacterium 
hominis]
Length=109

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = -2

Query  693  RGLIPYNKSG-KVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGY  517
            R  IPY +    V+  FPYL H+GI +Y    LK YP+L  TPL+  E LEQL+ LE+G 
Sbjct  16   RAAIPYVRDADGVSGAFPYLRHIGIYAYRVAALKRYPQLAATPLEQAEKLEQLRFLEHGL  75

Query  516  RMKVIKVDHE-AHGVDAPEDVQKIVEFMR  433
            R+ V  V+     GVD  ED+Q++  F+R
Sbjct  76   RIAVGVVNEAPPPGVDCEEDLQRVEAFLR  104



>ref|WP_009646350.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Selenomonas 
sp. CM52]
 gb|EJU27659.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Selenomonas 
sp. CM52]
Length=244

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 4/92 (4%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R L+PY ++       P   H+GI +Y   FL  Y  L+PTPL+  E LEQL+ LENGY 
Sbjct  157  RSLVPYPRAAA----GPVYKHIGIYAYRRDFLLRYARLEPTPLERAESLEQLRALENGYG  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            ++V++ D    GVD PED+  + +  RE+ L+
Sbjct  213  IRVLETDCRFVGVDTPEDLALVNKIYREQGLA  244



>ref|WP_021589283.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Prevotella 
baroniae]
 gb|ERK39718.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Prevotella 
baroniae F0067]
Length=243

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = -2

Query  693  RGLIPYNKSGKVN---PDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLEN  523
            R +IP+ +  + +     FP+L HLGI +Y T+ L+   EL  +PL+L E LEQL+ L+N
Sbjct  155  RSIIPFIRGKEKSQWLTTFPFLKHLGIYAYKTEVLREITELPQSPLELAESLEQLRWLQN  214

Query  522  GYRMKVIKVDHEAHGVDAPEDVQK  451
            GYR+KV   D E  G+D PED+Q+
Sbjct  215  GYRVKVGITDIETVGIDTPEDLQR  238



>ref|WP_027444530.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella baroniae]
Length=243

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = -2

Query  693  RGLIPYNKSGKVN---PDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLEN  523
            R +IP+ +  + +     FP+L HLGI +Y T+ L+   EL  +PL+L E LEQL+ L+N
Sbjct  155  RSIIPFIRGKEKSQWLTTFPFLKHLGIYAYKTEVLREITELPQSPLELAESLEQLRWLQN  214

Query  522  GYRMKVIKVDHEAHGVDAPEDVQK  451
            GYR+KV   D E  G+D PED+Q+
Sbjct  215  GYRVKVGITDIETVGIDTPEDLQR  238



>gb|EGQ75432.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum subsp. animalis ATCC 51191]
Length=243

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  160  RSVIPYPRK---NENIAYFKHIGIYGYKRDFVIEYSKMSITPLEETESLEQLRVLENGYK  216

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMR  433
            +KV++  H   GVD  E++++++ F+R
Sbjct  217  IKVLETTHSLIGVDTQENLEQVITFIR  243



>ref|WP_006190698.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Selenomonas 
sputigena]
 gb|EEX78504.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Selenomonas 
sputigena ATCC 35185]
 gb|AEC00853.1| 3-deoxy-D-manno-octulosonatecytidylyltransferase [Selenomonas 
sputigena ATCC 35185]
Length=244

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 4/92 (4%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R L+PY ++       P   H+GI +Y   FL  Y  L+PTPL+  E LEQL+ LENGY 
Sbjct  157  RSLVPYPRAAA----GPVYKHIGIYAYRRDFLLRYARLEPTPLERAESLEQLRALENGYG  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            ++V++ D    GVD PED+  + +  RE+ L+
Sbjct  213  IRVLETDCRFVGVDTPEDLALVNKIYREQGLA  244



>ref|WP_005886566.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
mortiferum]
 gb|EEO35630.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Fusobacterium 
mortiferum ATCC 9817]
Length=246

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 59/91 (65%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +   +     Y  H+GI  Y   F+  Y +++PTPL+L E LEQL+ LENGYR
Sbjct  156  RSVIPYPRKLDIQN---YYKHVGIYGYKRDFVVEYAKMEPTPLELSESLEQLRALENGYR  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  ++  GVD  E+++K+ E+++E  L
Sbjct  213  IKVMETPYKIIGVDTQEELEKVREYIKENGL  243



>ref|WP_006556419.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Veillonella 
ratti]
 gb|EKU77974.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Veillonella 
ratti ACS-216-V-Col6b]
Length=243

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 55/89 (62%), Gaps = 3/89 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIPY ++  VN     L H+GI +Y  +FL  + ++ PTP +L E LEQL+ LENG  
Sbjct  156  RSLIPYPRNAFVNAP---LKHIGIYAYTREFLLEFAKMAPTPAELTESLEQLRALENGVT  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRER  427
            ++VIK D    GVD PED+  + E  +++
Sbjct  213  IQVIKTDARFIGVDTPEDLAAVNEIFKKQ  241



>ref|WP_004370973.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella oris]
 gb|EFB33381.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Prevotella 
oris F0302]
Length=247

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = -2

Query  648  FPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYRMKVIKVDHEAHGVDA  469
            +P+L HLGI +Y T+ LK    L  + L+L E LEQL+ LENGYR+KV   + E  G+D 
Sbjct  173  YPFLKHLGIYAYRTEVLKAITRLPQSSLELAESLEQLRWLENGYRIKVGITNVETVGIDT  232

Query  468  PEDVQKIVEFMRER  427
            PED+Q+  +F+R R
Sbjct  233  PEDLQRAEDFIRNR  246



>ref|WP_026738165.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Leptotrichia 
goodfellowii]
Length=247

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY ++     DF Y  H+GI  Y +KFLK    L+   L+  E LEQL+ +ENGY+
Sbjct  157  RSVIPYERNEI--KDFKYYKHIGIYGYTSKFLKELKNLKSGILEKIESLEQLRFIENGYK  214

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            +KV++   E  GVD  ED+++++E++ + N++
Sbjct  215  IKVLETTSEVIGVDTEEDLKEVIEYINKNNIT  246



>ref|WP_029598986.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum]
Length=245

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NENIAYFKHIGIYGYKRDFVIEYSKMSITPLEETESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ F+ + N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVITFIIKNNI  243



>ref|WP_004336679.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella bivia]
 gb|EFB93503.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Prevotella 
bivia JCVIHMP010]
 gb|EIM33671.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Prevotella 
bivia DSM 20514]
 gb|KGF45010.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella bivia 
DNF00320]
Length=247

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 57/93 (61%), Gaps = 3/93 (3%)
 Frame = -2

Query  693  RGLIPY---NKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLEN  523
            R +IP+    +  K    +P+L H+G+ +Y T+ LK    L  + L+L E LEQL+ L+N
Sbjct  155  RSVIPFIRGKEQTKWLDSYPFLKHIGLYAYRTEVLKEISRLPQSSLELAESLEQLRWLQN  214

Query  522  GYRMKVIKVDHEAHGVDAPEDVQKIVEFMRERN  424
            GY++KV     E  G+D PED+QK  EF++ RN
Sbjct  215  GYKIKVGLTASETIGIDTPEDLQKAEEFLKSRN  247



>ref|WP_026747761.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Leptotrichia 
trevisanii]
Length=251

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    + +F Y  H+GI  Y  KFL     L+   L+  E LEQL+ +ENGY+
Sbjct  157  RSVIPYERDKNNSENFKYFKHVGIYGYTAKFLNELKNLREGVLEKMESLEQLRFIENGYK  216

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            +KV++ +    GVD  ED+ ++V+F+ E  ++
Sbjct  217  IKVLETNSNVIGVDTQEDLSEVVKFITENGIT  248



>ref|WP_018920860.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella oris]
Length=247

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVN---PDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLEN  523
            R +IP+ +S +       +P+L HLGI +Y T+ LK    L  + L+L E LEQL+ LEN
Sbjct  155  RSIIPFVRSVERQEWLKKYPFLKHLGIYAYRTEVLKAITRLPQSSLELAESLEQLRWLEN  214

Query  522  GYRMKVIKVDHEAHGVDAPEDVQKIVEFMR  433
            GYR+KV   + E  G+D PED+Q+  +F+R
Sbjct  215  GYRIKVGITNVETVGIDTPEDLQRAEDFIR  244



>ref|WP_044504519.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Megasphaera 
sp. NP3]
Length=249

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 55/92 (60%), Gaps = 8/92 (9%)
 Frame = -2

Query  693  RGLIPYNK----SGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLE  526
            R LIPY +     G V P      H+GI +Y   FL  Y  ++PTP +  E LEQL+VLE
Sbjct  156  RSLIPYPRHAFEEGGVVP----YKHIGIYAYRRDFLLAYAAMEPTPAEKVESLEQLRVLE  211

Query  525  NGYRMKVIKVDHEAHGVDAPEDVQKIVEFMRE  430
            NGY++KVIK  H+  G+D P+D+ +I  +  E
Sbjct  212  NGYKIKVIKTHHQFIGIDTPDDLARIRRYFAE  243



>ref|WP_008821758.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
periodonticum]
 gb|EFG27470.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Fusobacterium 
periodonticum 1_1_41FAA]
Length=245

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 56/91 (62%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +      D  Y  H+GI  Y   F+  Y ++  T L++ E LEQL+VLENGY+
Sbjct  156  RSVIPYPRKA---DDISYFKHIGIYGYKRDFVIEYSKMPATALEIAESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++ +++ F+++ N+
Sbjct  213  IKVLETTHSLIGVDTQENLDQVINFVKKNNI  243



>ref|WP_018451254.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Leptotrichia 
shahii]
Length=248

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 58/91 (64%), Gaps = 2/91 (2%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY ++   N DF Y  H+GI  Y TKFL     L+   L+  E LEQL+ +ENGY+
Sbjct  157  RSVIPYERNQ--NEDFKYFRHIGIYGYTTKFLNKLKNLKEGVLEKIESLEQLRFIENGYK  214

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++      GVD  +D++++V+F++++ +
Sbjct  215  IKVLETRSNVIGVDTEDDLREVVKFIKDKGI  245



>ref|WP_023039082.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum]
 gb|ERT34959.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum CTI-5]
Length=245

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y ++  T L+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NENIAYFKHIGIYGYKRDFVIEYSKMSITSLEETESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E+++++++F+++ N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVIKFIKKNNI  243



>ref|WP_021720674.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Phascolarctobacterium 
succinatutens]
 emb|CDD09768.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Phascolarctobacterium 
succinatutens CAG:287]
Length=244

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 56/91 (62%), Gaps = 4/91 (4%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPD-FPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGY  517
            R L+PY ++    P+ +    H+GI +Y   FL  Y  LQPTPL+  E LEQL+ LENGY
Sbjct  156  RSLMPYPRN---KPEGYKVYKHVGIYAYRRSFLLKYAALQPTPLERAESLEQLRALENGY  212

Query  516  RMKVIKVDHEAHGVDAPEDVQKIVEFMRERN  424
            ++KV++ D +  GVD PED+  + E   + N
Sbjct  213  KIKVLESDFQGIGVDTPEDLAAVNELFAKMN  243



>ref|WP_027339486.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Halonatronum 
saccharophilum]
Length=240

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 55/82 (67%), Gaps = 3/82 (4%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIPY +  K   +  Y  H+G+  Y  +FL  Y +L+ T L+  E LEQL+VLENGY+
Sbjct  156  RSLIPYPREDK---EINYYKHIGLYVYRREFLLDYSKLKRTSLEQTESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKI  448
            +KV++ DH++ GVD  ED++K+
Sbjct  213  IKVVETDHQSIGVDTKEDLEKV  234



>ref|WP_022121184.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella copri 
CAG:164]
 emb|CDA65745.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella copri 
CAG:164]
Length=247

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 59/93 (63%), Gaps = 5/93 (5%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPD----FPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLE  526
            R +IPY + GK   +    FPYL HLGI +Y  + LK   +L  + L++ E LEQL+ L+
Sbjct  155  RSIIPYVR-GKEEEEWLKSFPYLKHLGIYAYRKEVLKEVTKLPQSSLEIAESLEQLRWLQ  213

Query  525  NGYRMKVIKVDHEAHGVDAPEDVQKIVEFMRER  427
            NGY++KV   D E  G+D PED+Q+  +F++ R
Sbjct  214  NGYKIKVGTTDVETVGIDTPEDLQRAEDFLKNR  246



>ref|WP_009144992.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Phascolarctobacterium 
succinatutens]
 gb|EFY05471.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Phascolarctobacterium 
succinatutens YIT 12067]
Length=244

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 56/91 (62%), Gaps = 4/91 (4%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPD-FPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGY  517
            R L+PY ++    P+ +    H+GI +Y   FL  Y  LQPTPL+  E LEQL+ LENGY
Sbjct  156  RSLMPYPRN---KPEGYKVYKHVGIYAYRRSFLLKYAALQPTPLERAESLEQLRALENGY  212

Query  516  RMKVIKVDHEAHGVDAPEDVQKIVEFMRERN  424
            ++KV++ D +  GVD PED+  + E   + N
Sbjct  213  KIKVLESDFQGIGVDTPEDLAAVNELFAKMN  243



>ref|WP_009422816.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
sp. oral taxon 370]
 gb|EHI79600.1| hypothetical protein HMPREF9093_00124 [Fusobacterium sp. oral 
taxon 370 str. F0437]
Length=245

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +      +  Y  H+GI  Y   F+  Y ++  T L++ E LEQL+VLENGY+
Sbjct  156  RSVIPYPRKAN---NISYFKHIGIYGYKRDFVIDYSKMPATALEVAESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E+++++++F+++ N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVIDFVKKNNI  243



>ref|WP_021840892.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Veillonella 
sp. CAG:933]
 emb|CCX53329.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Veillonella 
sp. CAG:933]
Length=243

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 56/91 (62%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIPY ++  VN     L H+GI +Y   FL  + +++PTP +L E LEQL+ LENG  
Sbjct  156  RSLIPYPRNAFVNAP---LKHIGIYAYTRDFLLEFAKMEPTPAELTESLEQLRALENGIA  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            ++VIK +    GVD PED+  + E  +++ L
Sbjct  213  IQVIKTEARFIGVDTPEDLAAVNEIFKKQGL  243



>ref|WP_022437378.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella sp. 
CAG:279]
 emb|CDE40439.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella sp. 
CAG:279]
Length=257

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 58/94 (62%), Gaps = 3/94 (3%)
 Frame = -2

Query  693  RGLIPY---NKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLEN  523
            R +IPY    ++G+    FP+L+H+G+ +Y    L+    L  + L++ E LEQL+ L+N
Sbjct  162  RSVIPYIRNKETGEWAESFPFLMHVGMYAYRASVLEEITRLPQSSLEIAESLEQLRWLQN  221

Query  522  GYRMKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            GY++KV   +HE  G+D P D+++  +F+   NL
Sbjct  222  GYKIKVGLTEHETIGIDTPADLERANKFLESSNL  255



>ref|WP_005970484.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
periodonticum]
 gb|EFE87972.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Fusobacterium 
periodonticum ATCC 33693]
Length=245

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +      +  Y  H+GI  Y   F+  Y ++  T L++ E LEQL+VLENGY+
Sbjct  156  RSVIPYPRKA---DNISYFKHIGIYGYKRDFVIDYSKMPATELEIAESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++++++E N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVIDYIKENNI  243



>ref|WP_036862020.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella bivia]
 gb|KGF23110.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella bivia 
DNF00188]
 gb|KGF38469.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella bivia 
DNF00650]
Length=247

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 59/94 (63%), Gaps = 5/94 (5%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPD----FPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLE  526
            R +IP+ + GK   +    +P+L H+G+ +Y T+ LK    L  + L+L E LEQL+ L+
Sbjct  155  RSVIPFIR-GKEQTNWLDSYPFLKHIGLYAYRTEVLKEISRLPQSSLELAESLEQLRWLQ  213

Query  525  NGYRMKVIKVDHEAHGVDAPEDVQKIVEFMRERN  424
            NGY++KV     E  G+D PED+QK  EF++ RN
Sbjct  214  NGYKIKVGLTASETIGIDTPEDLQKAEEFLKSRN  247



>ref|WP_005908738.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum]
 gb|EHO79622.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
nucleatum subsp. animalis F0419]
Length=245

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y ++  TPL+  E LEQL+VLENGY+
Sbjct  156  RSVIPYPRK---NENIEYFKHIGIYGYKRDFVIEYSKMSITPLEETESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ F+ + N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVITFIIKNNI  243



>ref|WP_010522394.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Flavobacteriaceae 
bacterium HQM9]
Length=239

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R  IP+N+ G       Y  HLGI  Y  KFL  Y +++PT L++ E LEQL+V+ENG+ 
Sbjct  153  RAAIPFNRDGVDVEKIDYFKHLGIYGYSKKFLIKYAQMKPTRLEITEKLEQLRVIENGFS  212

Query  513  MKVIKVDHEAHGVDAPED  460
            + +++  H A G+D  ED
Sbjct  213  IHMVQTTHNAIGIDTLED  230



>ref|WP_015837883.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Geobacter sp. 
M21]
 sp|C6E0M8.1|KDSB_GEOSM RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-2-keto-3-deoxyoctulosonic acid synthase; 
Short=CKS; Short=CMP-KDO synthase [Geobacter sp. M21]
 gb|ACT18652.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Geobacter 
sp. M21]
Length=252

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -2

Query  633  HLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYRMKVIKVDHEAHGVDAPEDVQ  454
            H+G+  Y  +FL ++  L+PT L+L E LEQL+VLENGYR+K+++ + E+ GVD P D+ 
Sbjct  184  HVGLYVYRREFLPVFAGLKPTYLELAEKLEQLRVLENGYRIKIVETEFESIGVDTPADLD  243

Query  453  KIVEFMRER  427
            K++E +++R
Sbjct  244  KVLERLKDR  252



>ref|WP_035904850.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
necrophorum]
 gb|KDE60645.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
necrophorum BL]
 gb|KDE62673.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
necrophorum DJ-1]
 gb|KDE70242.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
necrophorum DJ-2]
 gb|KDE70414.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
necrophorum DAB]
 gb|KDE74216.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
necrophorum BFTR-2]
Length=247

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 59/92 (64%), Gaps = 3/92 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R ++PY +   +     Y  H+GI  Y  +F+  Y  + PT L+  E LEQL+VLENGY+
Sbjct  155  RSVLPYPRKENLTL---YYKHIGIYGYTREFVLEYAAMAPTALETSESLEQLRVLENGYK  211

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            +KV++  +++ GVD  ED++K+ +++ ER ++
Sbjct  212  IKVLETPYQSVGVDTQEDLEKVCQWIEERGIT  243



>ref|WP_005963337.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
necrophorum]
 gb|EFS23111.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Fusobacterium 
necrophorum D12]
 gb|EJU16414.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Fusobacterium 
necrophorum subsp. funduliforme Fnf 1007]
Length=247

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 61/92 (66%), Gaps = 3/92 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R ++PY +  K N    Y  H+GI  Y  +F+  Y  + PT L+  E LEQL+VLENGY+
Sbjct  155  RSVLPYPR--KENSAL-YYKHIGIYGYTREFVLEYAAMAPTALETSESLEQLRVLENGYK  211

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            +KV++  +++ GVD  ED++++ ++++ER ++
Sbjct  212  IKVLETPYQSVGVDTQEDLERVCQWIQERGIT  243



>ref|WP_021746106.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Leptotrichia 
wadei]
 gb|ERK49259.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Leptotrichia 
wadei F0279]
Length=248

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY ++   N DF Y  H+GI  Y T FL     L+   L+  E LEQL+ +ENGY+
Sbjct  157  RSVIPYERNK--NADFKYFRHIGIYGYTTSFLNKLKNLKEGVLEKIELLEQLRFIENGYK  214

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++      GVD  ED++++V+F++E  +
Sbjct  215  IKVLETKSNVIGVDTEEDLREVVKFIKENGI  245



>ref|WP_029545960.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Selenomonas 
ruminantium]
Length=241

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 53/88 (60%), Gaps = 6/88 (7%)
 Frame = -2

Query  693  RGLIPY-NKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGY  517
            R L+PY  KSG      P   H+GI +Y   FL  Y  ++PTPL+  E LEQL+ LENGY
Sbjct  157  RSLMPYPRKSG-----CPVYKHIGIYAYRRDFLLNYARMEPTPLEQAESLEQLRALENGY  211

Query  516  RMKVIKVDHEAHGVDAPEDVQKIVEFMR  433
            R+KV++      GVD  ED++++ E  R
Sbjct  212  RIKVVETHASFVGVDTAEDLERVNEIYR  239



>ref|WP_040637138.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Mitsuokella 
sp. oral taxon 131]
Length=246

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = -2

Query  693  RGLIPY-NKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGY  517
            R LIPY  K+G          H+GI +Y   FL  Y +++PTPL+  E LEQL+ LENG 
Sbjct  161  RSLIPYPRKAGG-----HVFKHIGIYAYRRGFLLAYAKMEPTPLEQAESLEQLRALENGC  215

Query  516  RMKVIKVDHEAHGVDAPEDVQKI  448
            ++KVI+ DHE  GVD  ED+ K+
Sbjct  216  KIKVIETDHEFVGVDTAEDLAKV  238



>ref|WP_012030648.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Dichelobacter 
nodosus]
 sp|A5EW69.1|KDSB_DICNV RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-2-keto-3-deoxyoctulosonic acid synthase; 
Short=CKS; Short=CMP-KDO synthase [Dichelobacter nodosus VCS1703A]
 gb|ABQ13530.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Dichelobacter 
nodosus VCS1703A]
Length=244

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 54/83 (65%), Gaps = 2/83 (2%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R ++PY +     P   YL H+GI +Y  + LK YP+L PTPL+  E LEQL+ LE+G++
Sbjct  156  RSVMPYVRDAAA-PPVSYLRHIGIYAYRVQLLKRYPQLAPTPLEQAEKLEQLRFLEHGFK  214

Query  513  MKVIKVDHE-AHGVDAPEDVQKI  448
            + V ++D     GVD+PED+ ++
Sbjct  215  IAVAQIDEAPPAGVDSPEDLARV  237



>gb|ERL04986.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Mitsuokella 
sp. oral taxon 131 str. W9106]
Length=254

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = -2

Query  693  RGLIPY-NKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGY  517
            R LIPY  K+G          H+GI +Y   FL  Y +++PTPL+  E LEQL+ LENG 
Sbjct  169  RSLIPYPRKAGG-----HVFKHIGIYAYRRGFLLAYAKMEPTPLEQAESLEQLRALENGC  223

Query  516  RMKVIKVDHEAHGVDAPEDVQKI  448
            ++KVI+ DHE  GVD  ED+ K+
Sbjct  224  KIKVIETDHEFVGVDTAEDLAKV  246



>ref|WP_005954817.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
necrophorum]
 gb|EHO18763.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Fusobacterium 
necrophorum subsp. funduliforme 1_1_36S]
 gb|EYD69328.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
necrophorum subsp. funduliforme B35]
 gb|KID49608.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
necrophorum subsp. funduliforme B35]
Length=247

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 61/92 (66%), Gaps = 3/92 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R ++PY +  K N    Y  H+GI  Y  +F+  Y  + PT L+  E LEQL+VLENGY+
Sbjct  155  RSVLPYPR--KENSAL-YYKHIGIYGYTREFVLEYAAMAPTALETSESLEQLRVLENGYK  211

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            +KV++  +++ GVD  ED++K+ ++++ER ++
Sbjct  212  IKVLETPYQSVGVDTQEDLEKVRQWIQERGIT  243



>ref|WP_005967304.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
periodonticum]
 gb|EKA93597.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
periodonticum D10]
 gb|KGE62125.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
periodonticum 2_1_31]
Length=245

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +      +  Y  H+GI  Y   F+  Y ++  T L++ E LEQL+VLENGY+
Sbjct  156  RSVIPYPRKA---DNISYFKHIGIYGYKRDFVIDYSKMPATALEVAESLEQLRVLENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++  H   GVD  E++++++ F+++ N+
Sbjct  213  IKVLETTHSLIGVDTQENLEQVINFVKKNNI  243



>gb|ETI35980.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Phytophthora 
parasitica P1569]
 gb|ETK76215.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Phytophthora 
parasitica]
 gb|ETL29653.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Phytophthora 
parasitica]
 gb|ETL82875.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Phytophthora 
parasitica]
 gb|ETM36108.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Phytophthora 
parasitica]
 gb|ETO64699.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Phytophthora 
parasitica P1976]
 gb|ETP05798.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Phytophthora 
parasitica CJ01A1]
 gb|ETP33908.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Phytophthora 
parasitica P10297]
Length=255

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDF-PYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGY  517
            R +IP++KSGK +P+   YL H+G+ ++   FL  +P L P+ L+  EDLEQL+VL  GY
Sbjct  162  RAMIPHSKSGKFSPETTSYLRHVGMYAFRKDFLLEFPTLPPSDLEESEDLEQLRVLSAGY  221

Query  516  RMKVIKVDHEAHGVDAPEDVQKI  448
            R+++++VD    GVD   D++ +
Sbjct  222  RIQLVQVDSTLPGVDTRADLEDL  244



>ref|WP_021766458.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Leptotrichia 
sp. oral taxon 215]
 gb|ERK68673.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Leptotrichia 
sp. oral taxon 215 str. W9775]
Length=247

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 59/94 (63%), Gaps = 6/94 (6%)
 Frame = -2

Query  693  RGLIPYNKSGKVNP--DFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENG  520
            R +IPY +    NP  D+ Y  H+GI  Y + FL     L+   L+  E LEQL+ +ENG
Sbjct  157  RSVIPYER----NPIGDYKYYKHIGIYGYTSNFLNELKNLKEGVLEKIESLEQLRFIENG  212

Query  519  YRMKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            Y++KV++ D E  GVD  ED+ +++E+++E+ ++
Sbjct  213  YKIKVLETDSEVIGVDTEEDLAEVIEYVKEKGIT  246



>ref|XP_008896315.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Phytophthora 
parasitica INRA-310]
 gb|ETN18678.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Phytophthora 
parasitica INRA-310]
Length=252

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDF-PYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGY  517
            R +IP++KSGK +P+   YL H+G+ ++   FL  +P L P+ L+  EDLEQL+VL  GY
Sbjct  162  RAMIPHSKSGKFSPETTSYLRHVGMYAFRKDFLLEFPTLPPSDLEESEDLEQLRVLSAGY  221

Query  516  RMKVIKVDHEAHGVDAPEDVQKI  448
            R+++++VD    GVD   D++ +
Sbjct  222  RIQLVQVDSTLPGVDTRADLEDL  244



>ref|WP_035937413.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
necrophorum]
 gb|KDE61100.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
necrophorum BFTR-1]
Length=247

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 58/92 (63%), Gaps = 3/92 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R ++PY +   +     Y  H+GI  Y  +F+  Y  + PT L+  E LEQL+VLENGY+
Sbjct  155  RSVLPYPRKENLTL---YYKHIGIYGYTREFVLEYAAMAPTALETSESLEQLRVLENGYK  211

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            +KV++  +++ GVD  ED+ K+ +++ ER ++
Sbjct  212  IKVLETPYQSVGVDTQEDLDKVCQWIEERGIT  243



>ref|WP_012647355.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Geobacter daltonii]
 sp|B9M9Q4.1|KDSB_GEODF RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-2-keto-3-deoxyoctulosonic acid synthase; 
Short=CKS; Short=CMP-KDO synthase [Geobacter daltonii FRC-32]
 gb|ACM20626.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Geobacter 
daltonii FRC-32]
Length=253

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -2

Query  633  HLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYRMKVIKVDHEAHGVDAPEDVQ  454
            H+G+  Y  +FL  + ++ PT L++ E LEQL+VLENGYR+KV++ D E+ GVD P D+ 
Sbjct  184  HVGLYVYRREFLLQFAQMSPTYLEMAEKLEQLRVLENGYRIKVVETDFESIGVDTPGDLD  243

Query  453  KIVEFMRERN  424
            K++E +++R 
Sbjct  244  KVLERLKDRG  253



>ref|WP_004512092.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Geobacter metallireducens]
 sp|Q39W63.1|KDSB_GEOMG RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-2-keto-3-deoxyoctulosonic acid synthase; 
Short=CKS; Short=CMP-KDO synthase [Geobacter metallireducens 
GS-15]
 gb|ABB31511.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Geobacter 
metallireducens GS-15]
 gb|EHP88399.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Geobacter 
metallireducens RCH3]
Length=254

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  633  HLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYRMKVIKVDHEAHGVDAPEDVQ  454
            H+G+  Y   FL  +  + PTPL+L E LEQL+VLENG+R++V++   E+ GVD P D+ 
Sbjct  184  HVGLYVYRRDFLLAFARMAPTPLELAEKLEQLRVLENGFRIRVVETSFESIGVDTPSDLD  243

Query  453  KIVE  442
            K+VE
Sbjct  244  KVVE  247



>ref|WP_041262700.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Geobacter bemidjiensis]
Length=251

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  633  HLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYRMKVIKVDHEAHGVDAPEDVQ  454
            H+G+  Y  +FL ++  LQPT L+L E LEQL+VLENGYR+K+++ + E+ GVD P D+ 
Sbjct  184  HVGLYVYRREFLPVFAGLQPTYLELAEKLEQLRVLENGYRIKIVETEFESIGVDTPADLD  243

Query  453  KIVEFMR  433
            K++E ++
Sbjct  244  KVLERLK  250



>ref|WP_013446517.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Paludibacter 
propionicigenes]
 gb|ADQ81148.1| 3-deoxy-D-manno-octulosonatecytidylyltransferase [Paludibacter 
propionicigenes WB4]
Length=260

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 59/92 (64%), Gaps = 5/92 (5%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDF----PYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLE  526
            R +IPY +  ++  D+    PYL H+GI +Y    L+    L+ +PL++ E LEQL+ LE
Sbjct  169  RSVIPYRRGAELE-DWISLHPYLKHVGIYAYRADVLRELTLLEQSPLEIAESLEQLRWLE  227

Query  525  NGYRMKVIKVDHEAHGVDAPEDVQKIVEFMRE  430
            NGYR+KV   D E  G+D PED++K+ + +++
Sbjct  228  NGYRIKVGFTDVETVGIDTPEDLEKVKDLLKD  259



>sp|B5E8N2.2|KDSB_GEOBB RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-2-keto-3-deoxyoctulosonic acid synthase; 
Short=CKS; Short=CMP-KDO synthase [Geobacter bemidjiensis Bem]
 gb|ACH38617.2| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Geobacter 
bemidjiensis Bem]
Length=255

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  633  HLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYRMKVIKVDHEAHGVDAPEDVQ  454
            H+G+  Y  +FL ++  LQPT L+L E LEQL+VLENGYR+K+++ + E+ GVD P D+ 
Sbjct  188  HVGLYVYRREFLPVFAGLQPTYLELAEKLEQLRVLENGYRIKIVETEFESIGVDTPADLD  247

Query  453  KIVEFMR  433
            K++E ++
Sbjct  248  KVLERLK  254



>ref|WP_008451097.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella amnii]
 gb|EFN90348.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Prevotella 
amnii CRIS 21A-A]
 gb|KGF52070.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella amnii 
DNF00058]
Length=245

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -2

Query  651  DFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYRMKVIKVDHEAHGVD  472
            +FP+L H+G+ +Y T+ LK   +LQ +PL++ E LEQL+ L+NGY++KV   D E  G+D
Sbjct  172  NFPFLKHIGLYAYKTEVLKEISKLQQSPLEIAESLEQLRWLQNGYKIKVGITDIETIGID  231

Query  471  APEDVQKIVEFM  436
             PED+QK   F+
Sbjct  232  TPEDLQKAEIFL  243



>ref|WP_019035633.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella amnii]
Length=245

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -2

Query  651  DFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYRMKVIKVDHEAHGVD  472
            +FP+L H+G+ +Y T+ LK   +LQ +PL++ E LEQL+ L+NGY++KV   D E  G+D
Sbjct  172  NFPFLKHIGLYAYKTEVLKEISKLQQSPLEIAESLEQLRWLQNGYKIKVGITDIETIGID  231

Query  471  APEDVQKIVEFM  436
             PED+QK   F+
Sbjct  232  TPEDLQKAEIFL  243



>ref|WP_007939017.1| MULTISPECIES: 3-deoxy-manno-octulosonate cytidylyltransferase 
[Pelosinus]
 gb|EIW15990.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Pelosinus 
fermentans B4]
 gb|EIW27304.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Pelosinus fermentans 
A11]
Length=240

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP+ +   V    P   H+GI +Y  +FL  Y +L PTPL+  E LEQL+ LE+GYR
Sbjct  156  RSLIPFPR---VEVGLPVFKHIGIYAYRREFLLKYAKLSPTPLEKTESLEQLRALEHGYR  212

Query  513  MKVIKVDHEAHGVDAPEDVQKI  448
            +KVI+ + ++ GVD  ED++K+
Sbjct  213  IKVIETNFKSIGVDTLEDLEKV  234



>ref|WP_022818764.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
russii]
Length=246

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 56/90 (62%), Gaps = 4/90 (4%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    N +  Y  H+GI  Y   F+  Y  +  TPL+  E LEQL+VLENGYR
Sbjct  156  RSVIPYPRK---NENINYFKHIGIYGYKRDFVIEYSNMSSTPLEEAESLEQLRVLENGYR  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERN  424
            +KV++  H   GVD  E+++ +++++ E+N
Sbjct  213  IKVLETSHSLIGVDTEENLKDVIQYI-EKN  241



>ref|WP_024992681.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella amnii]
Length=251

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -2

Query  654  PDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYRMKVIKVDHEAHGV  475
             +FP+L H+G+ +Y T+ LK   +LQ +PL++ E LEQL+ L+NGY++KV   D E  G+
Sbjct  171  ANFPFLKHIGLYAYKTEVLKEISKLQQSPLEIAESLEQLRWLQNGYKIKVGITDIETIGI  230

Query  474  DAPEDVQK  451
            D PED+QK
Sbjct  231  DTPEDLQK  238



>ref|WP_013279112.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Acetohalobium 
arabaticum]
 gb|ADL13671.1| 3-deoxy-D-manno-octulosonatecytidylyltransferase [Acetohalobium 
arabaticum DSM 5501]
Length=248

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 56/88 (64%), Gaps = 2/88 (2%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R  IPY ++ + +  F    H+G+ +Y   FL  + +L+ TPL+  E LEQL+ LENGYR
Sbjct  159  RSPIPYLRNQETDSKF--YKHIGLYAYQKSFLLKFAKLEATPLEQAESLEQLRALENGYR  216

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRE  430
            +KV++ +H + GVD  ED++++   M E
Sbjct  217  IKVVETEHASIGVDTEEDLKRVRNVMEE  244



>ref|WP_007952084.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Pelosinus fermentans]
 gb|EIW28209.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Pelosinus fermentans 
DSM 17108]
Length=240

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP+ +   V    P   H+GI +Y  +FL  Y +L PTPL+  E LEQL+ LE+GYR
Sbjct  156  RSLIPFPR---VEVGLPVFKHIGIYAYRREFLLKYAKLAPTPLEKTESLEQLRALEHGYR  212

Query  513  MKVIKVDHEAHGVDAPEDVQKI  448
            +KVI+ + ++ GVD  ED++K+
Sbjct  213  IKVIETNFKSIGVDTLEDLEKV  234



>ref|WP_026560968.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Bacillus sp. 
J37]
Length=240

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 3/82 (4%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R  IPYN+S   N  F Y  HLGI  Y  + L  + +L  + L+  E LEQL++LENGY 
Sbjct  155  RSAIPYNRS---NVSFSYYKHLGIYGYPKEVLNKFVQLPQSSLEEAEMLEQLRLLENGYT  211

Query  513  MKVIKVDHEAHGVDAPEDVQKI  448
            +KV++  + A GVD PED++K+
Sbjct  212  VKVVETSYNAVGVDTPEDIEKV  233



>ref|WP_007290534.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Thermosinus 
carboxydivorans]
 gb|EAX46460.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Thermosinus 
carboxydivorans Nor1]
Length=245

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP+ +    +  +    H+GI +Y   FL  +  L PTPL+  E LEQL+ LE+GYR
Sbjct  156  RSLIPFPRVK--HEAYNVYKHIGIYAYRRDFLLTFAALPPTPLERAESLEQLRALEHGYR  213

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRER  427
            +KV+K D ++ GVD PED++++   + +R
Sbjct  214  IKVLKTDFKSIGVDTPEDLERVRAIVEQR  242



>ref|WP_005957718.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
necrophorum]
 gb|EIJ71263.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Fusobacterium 
necrophorum subsp. funduliforme ATCC 51357]
Length=247

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 61/92 (66%), Gaps = 3/92 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R ++PY +  K N    Y  H+GI  Y  +F+  Y  + PT L+  E LEQL+VLENGY+
Sbjct  155  RSVLPYPR--KENSAL-YYKHIGIYGYTREFVLEYAAMAPTALETSESLEQLRVLENGYK  211

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            +KV++  +++ GVD  ED++++ ++++ER ++
Sbjct  212  IKVLETPYQSVGVDTQEDLERVRQWIQERGIT  243



>ref|WP_020700515.1| hypothetical protein [Selenomonas bovis]
Length=248

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 52/87 (60%), Gaps = 3/87 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R L+PY +    +   P   H+GI +Y   FL  + +L PTPL+  E LEQL+ LENGYR
Sbjct  159  RSLLPYPRH---HLGIPVYKHIGIYAYRRDFLLKFAKLAPTPLERAESLEQLRALENGYR  215

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMR  433
            +KVI+ D    GVD  ED+ ++ E  R
Sbjct  216  IKVIETDRTFVGVDTEEDLARVNEIYR  242



>ref|WP_011687872.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Candidatus Solibacter 
usitatus]
 sp|Q01T78.1|KDSB_SOLUE RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-2-keto-3-deoxyoctulosonic acid synthase; 
Short=CKS; Short=CMP-KDO synthase [Candidatus Solibacter usitatus 
Ellin6076]
 gb|ABJ87142.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Candidatus 
Solibacter usitatus Ellin6076]
Length=252

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 54/87 (62%), Gaps = 2/87 (2%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R  IP+++    + D PY  H+G+  Y   FL  Y  L   PL+  E LEQL+ LENGYR
Sbjct  158  RCPIPFDRDR--SADTPYFKHVGLYVYQRDFLLSYSTLPVGPLERSERLEQLRALENGYR  215

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMR  433
            ++V++ ++E+ GVD PED++++    +
Sbjct  216  IRVVETEYESLGVDTPEDLERVSRLFK  242



>ref|WP_031585671.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Selenomonas 
bovis]
Length=248

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 51/87 (59%), Gaps = 3/87 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R L+PY +    +   P   H+GI +Y   FL  +  L PTPL+  E LEQL+ LENGYR
Sbjct  159  RSLLPYPRH---HLGIPVYKHIGIYAYRRDFLLKFANLAPTPLERAESLEQLRALENGYR  215

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMR  433
            +KVI+ D    GVD  ED+ ++ E  R
Sbjct  216  IKVIETDRTFVGVDTEEDLARVNEIYR  242



>ref|WP_007390720.1| MULTISPECIES: 3-deoxy-manno-octulosonate cytidylyltransferase 
[Megasphaera]
 gb|EFD93498.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Megasphaera 
genomosp. type_1 str. 28L]
 gb|EGL41930.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Megasphaera 
sp. UPII 199-6]
Length=245

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIPY +        PY  H+GI +Y   FL  Y  L  TP +  E LEQL+VLENGY 
Sbjct  156  RSLIPYPRHAFAAGRGPYK-HIGIYAYKKDFLLQYATLPQTPAEQAESLEQLRVLENGYT  214

Query  513  MKVIKVDHEAHGVDAPEDVQKI  448
            +KVI+ D    G+D PED+Q++
Sbjct  215  IKVIRTDKRFIGIDTPEDLQRV  236



>ref|WP_013265234.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella melaninogenica]
 gb|ADK96754.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Prevotella 
melaninogenica ATCC 25845]
Length=246

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 56/91 (62%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPY---NKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLEN  523
            R +IP+    +S +    FP+L H+G+ +Y TK L+    L  +PL+L E LEQL+ L+N
Sbjct  155  RSVIPFVRGKESAEWLTHFPFLKHIGLYAYRTKVLREVSRLPQSPLELAESLEQLRWLQN  214

Query  522  GYRMKVIKVDHEAHGVDAPEDVQKIVEFMRE  430
            GY++KV   D E  G+D PED+Q   E +R 
Sbjct  215  GYKIKVGLTDVETIGIDTPEDLQHAEEKLRS  245



>ref|WP_007958966.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Pelosinus fermentans]
 gb|AJQ25967.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Pelosinus fermentans 
JBW45]
Length=240

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIP+ +   +    P   H+GI +Y  +FL  Y +L PTPL+  E LEQL+ LE+GYR
Sbjct  156  RSLIPFPR---IEIGLPVFKHIGIYAYRREFLLKYAKLAPTPLEKTESLEQLRALEHGYR  212

Query  513  MKVIKVDHEAHGVDAPEDVQKI  448
            +KVI+ + ++ GVD  ED++K+
Sbjct  213  IKVIETNFKSIGVDTIEDLEKV  234



>ref|WP_028571361.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Desulfonatronum 
lacustre]
Length=252

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 56/92 (61%), Gaps = 4/92 (4%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIPY + G       +L H+G+ ++  + L+ + +L P  L+  E LEQL++LE G  
Sbjct  165  RALIPYPREGTGE----FLGHIGLYAFRMRTLRAFVDLGPGKLEQIEKLEQLRLLEAGIP  220

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNLS  418
            ++V++ +H  HGVD PEDV  +   +RE+ L+
Sbjct  221  IRVLRTEHRTHGVDRPEDVPSVCTLLREQGLA  252



>ref|XP_007511142.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Bathycoccus 
prasinos]
 emb|CCO66702.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Bathycoccus 
prasinos]
Length=326

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IP+NKSG  +PD  YL  LGI SY   FL  Y  +  + LQ+ EDLEQ KV+E GY+
Sbjct  218  RAIIPHNKSGTYDPDTKYLRKLGIYSYRADFLPEYVRMPESMLQISEDLEQNKVIEAGYK  277

Query  513  MKVIKVDHEAHGVDA  469
            +K+  V+   HGVD 
Sbjct  278  IKLGWVEDAVHGVDT  292



>ref|WP_025839275.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella scopos]
Length=248

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = -2

Query  693  RGLIPY---NKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLEN  523
            R +IPY    +S + +  FP+L H+G+ +Y T+ L+    L  +PL+L E LEQL+ L+N
Sbjct  155  RSVIPYVRGKESNEWHTHFPFLKHIGLYAYRTEVLREVSHLPQSPLELAESLEQLRWLQN  214

Query  522  GYRMKVIKVDHEAHGVDAPEDVQK  451
            GY++KV   D E  G+D PED+Q+
Sbjct  215  GYKIKVGLTDVETIGIDTPEDLQR  238



>ref|WP_026687436.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Azovibrio restrictus]
Length=257

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 60/110 (55%), Gaps = 17/110 (15%)
 Frame = -2

Query  693  RGLIPYNKSG------KVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKV  532
            R  IPY +         + P  P   H+G+ +Y T FLK Y +L P+PL+  E LEQL+ 
Sbjct  158  RAPIPYARDAFAVSREALPPGLPLFRHVGLYAYRTAFLKAYADLAPSPLEQFESLEQLRA  217

Query  531  LENGYRMKVIKVDHE-AHGVDAPEDVQKIVEFMRERNLS**NYTKPAICG  385
            L +GYR++V++VD     GVD PED +++      R L    + +P  CG
Sbjct  218  LWHGYRIRVLEVDGAPPPGVDTPEDAERM------RKL----FDRPGDCG  257



>gb|ERK55527.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Leptotrichia 
sp. oral taxon 879 str. F0557]
Length=253

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    + +  Y  H+GI  Y  KFL     L+   L+  E LEQL+ +ENGY+
Sbjct  159  RSVIPYERDKNNSENIRYFRHIGIYGYTAKFLNELKNLRDGVLEKIESLEQLRFIENGYK  218

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++ D    GVD  ED++++V+F+ ++ +
Sbjct  219  IKVLETDSNVIGVDTEEDLKEVVKFIEKKGI  249



>ref|WP_005641144.1| MULTISPECIES: 3-deoxy-manno-octulosonate cytidylyltransferase 
[Parabacteroides]
 gb|EDN84550.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Parabacteroides 
merdae ATCC 43184]
 gb|EKN07423.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
merdae CL03T12C32]
 emb|CDD13511.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
merdae CAG:48]
Length=261

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 54/92 (59%), Gaps = 3/92 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVN---PDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLEN  523
            R +IPY +  K     P+  Y  H+G+ +Y    LK    L  +PL+L E LEQL+ LEN
Sbjct  159  RSIIPYMRGRKYTEWLPNHTYYKHIGLYAYRADTLKEITHLPQSPLELAESLEQLRWLEN  218

Query  522  GYRMKVIKVDHEAHGVDAPEDVQKIVEFMRER  427
            GY++KV     E  G+D PED++K + F++ R
Sbjct  219  GYKIKVGITQQETIGIDTPEDMEKALAFLKNR  250



>ref|WP_039901259.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Leptotrichia 
sp. oral taxon 879]
Length=251

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R +IPY +    + +  Y  H+GI  Y  KFL     L+   L+  E LEQL+ +ENGY+
Sbjct  157  RSVIPYERDKNNSENIRYFRHIGIYGYTAKFLNELKNLRDGVLEKIESLEQLRFIENGYK  216

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++ D    GVD  ED++++V+F+ ++ +
Sbjct  217  IKVLETDSNVIGVDTEEDLKEVVKFIEKKGI  247



>ref|WP_011939821.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Geobacter uraniireducens]
 sp|A5G5T4.1|KDSB_GEOUR RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-2-keto-3-deoxyoctulosonic acid synthase; 
Short=CKS; Short=CMP-KDO synthase [Geobacter uraniireducens 
Rf4]
 gb|ABQ27152.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Geobacter 
uraniireducens Rf4]
Length=251

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -2

Query  633  HLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYRMKVIKVDHEAHGVDAPEDVQ  454
            H+G+  Y   FL  + ++ PT L++ E LEQL+VLENGYR+KV++ D+E+ GVD P D++
Sbjct  184  HVGLYVYRRDFLLQFAQMSPTYLEMAEKLEQLRVLENGYRIKVVETDYESIGVDTPGDLE  243

Query  453  KIVEFMRE  430
            K++E +++
Sbjct  244  KVLERLKK  251



>ref|WP_033171540.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Selenomonas 
sp. ND2010]
Length=243

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 4/91 (4%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R L+PY +    +   P   H+GI +Y  +FL  Y +++ TPL+  E LEQL+ LENGYR
Sbjct  157  RSLMPYPR----HEGCPVYKHIGIYAYKREFLLQYAKMESTPLESAESLEQLRALENGYR  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            +KV++   +  GVD  ED++K+ E  R+  L
Sbjct  213  IKVVETKAKFVGVDTAEDLEKVNEIYRKMAL  243



>ref|WP_005976139.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
ulcerans]
 gb|EFS25975.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
ulcerans ATCC 49185]
 gb|EHO80180.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Fusobacterium 
ulcerans 12-1B]
Length=246

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 58/92 (63%), Gaps = 5/92 (5%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFP-YLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGY  517
            R +IPY +    N D   Y  H+GI  Y   F+  Y ++  TPL+L E LEQL+VLENGY
Sbjct  156  RSVIPYPR----NLDLKNYYKHIGIYGYKRDFVMEYSKMNSTPLELSESLEQLRVLENGY  211

Query  516  RMKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            ++KVI+  ++  GVD  E++ K+ +++ E N+
Sbjct  212  KIKVIETPYKIIGVDTQEELDKVRKYITEHNI  243



>ref|WP_006846719.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella copri]
 gb|EFB36610.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Prevotella 
copri DSM 18205]
Length=247

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPD----FPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLE  526
            R +IPY + GK   +    FPYL HLGI +Y  + LK   +   + L++ E LEQL+ L+
Sbjct  155  RSIIPYVR-GKEEEEWLKSFPYLKHLGIYAYRKEVLKEVTKQPQSSLEIAESLEQLRWLQ  213

Query  525  NGYRMKVIKVDHEAHGVDAPEDVQKIVEFMRER  427
            NGY++KV   D E  G+D PED+Q+  +F++ R
Sbjct  214  NGYKIKVGTTDVETVGIDTPEDLQRAEDFLKNR  246



>ref|WP_005651239.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
merdae]
 gb|EKN27635.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
merdae CL09T00C40]
Length=261

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 54/92 (59%), Gaps = 3/92 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVN---PDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLEN  523
            R +IPY +  K     P+  Y  H+G+ +Y    LK    L  +PL+L E LEQL+ LEN
Sbjct  159  RSIIPYMRGRKYTEWLPNHTYYKHIGLYAYRADTLKEITHLPQSPLELAESLEQLRWLEN  218

Query  522  GYRMKVIKVDHEAHGVDAPEDVQKIVEFMRER  427
            GY++KV     E  G+D PED++K + F++ R
Sbjct  219  GYKIKVGITQQETIGIDTPEDMEKALAFLKNR  250



>ref|WP_005998140.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Desulfuromonas 
acetoxidans]
 gb|EAT16729.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Desulfuromonas 
acetoxidans DSM 684]
Length=255

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = -2

Query  693  RGLIPYNK--SGKVNPDFPYLL---HLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVL  529
            R  IP+++  S      F  +    H+G+  Y   FL  YP L  TPL+  E LEQL+ L
Sbjct  156  RAPIPWSRDYSATAAETFDQIRAFKHVGLYVYRRDFLLAYPTLTATPLEQMEKLEQLRAL  215

Query  528  ENGYRMKVIKVDHEAHGVDAPEDVQKIVEFM  436
            ENGYR++V++ D ++ GVD P+D+ ++ E +
Sbjct  216  ENGYRIRVVETDLQSQGVDTPQDLLRVCEIL  246



>ref|WP_007554984.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Dialister micraerophilus]
 gb|EFR42408.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Dialister 
microaerophilus UPII 345-E]
Length=242

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 3/91 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R LIPY +        P L H+GI +Y  +FL  Y  ++ T L+  E LEQL++LENGY+
Sbjct  155  RSLIPYPRH---EFSVPPLKHIGIYAYRKEFLLKYANMKQTSLEKTESLEQLRLLENGYK  211

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRERNL  421
            + V+ V     GVD  ED++K++E+++ R L
Sbjct  212  IGVVTVKSYGIGVDTQEDLEKVIEYIKRREL  242



>ref|WP_024821769.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Aminobacterium 
mobile]
Length=245

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 49/88 (56%), Gaps = 5/88 (6%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R  IPY +   V    P   H+GI  Y   FL  Y EL+ TPL   E LEQLK+LENGY 
Sbjct  156  RSPIPYFR---VQASLPVYEHIGIYGYRKDFLMKYVELENTPLSTVESLEQLKILENGYS  212

Query  513  MKVI--KVDHEAHGVDAPEDVQKIVEFM  436
            MKV+  KV H    VD PED++ +   M
Sbjct  213  MKVLETKVTHRGPSVDTPEDLEAVRRIM  240



>ref|WP_026839838.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Geobacter bremensis]
Length=251

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  633  HLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYRMKVIKVDHEAHGVDAPEDVQ  454
            H+G+  Y  +FL ++  L+PT L+L E LEQL+VLENGYR+K+++ + E+ GVD P D+ 
Sbjct  184  HVGLYVYRREFLPVFAGLKPTYLELAEKLEQLRVLENGYRIKIVETEFESIGVDTPADLD  243

Query  453  KIVEFMR  433
            K++E ++
Sbjct  244  KVLERLK  250



>ref|WP_040635630.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Mitsuokella 
multacida]
Length=244

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 4/88 (5%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R L+PY +    +P  P   H+GI +Y   FL  Y ++  TPL+  E LEQL+ LENGYR
Sbjct  157  RSLMPYPR----HPGTPVYKHIGIYAYKRDFLLAYAKMAETPLEHAESLEQLRALENGYR  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRE  430
            ++VIK  +   GVD  ED+ K+    R+
Sbjct  213  IRVIKTPYRFVGVDTAEDLAKVNAIYRQ  240



>gb|EEX68850.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Mitsuokella 
multacida DSM 20544]
Length=250

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 4/88 (5%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R L+PY +    +P  P   H+GI +Y   FL  Y ++  TPL+  E LEQL+ LENGYR
Sbjct  163  RSLMPYPR----HPGTPVYKHIGIYAYKRDFLLAYAKMAETPLEHAESLEQLRALENGYR  218

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRE  430
            ++VIK  +   GVD  ED+ K+    R+
Sbjct  219  IRVIKTPYRFVGVDTAEDLAKVNAIYRQ  246



>ref|WP_021826121.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Prevotella 
salivae]
 gb|ERJ99391.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Prevotella 
salivae F0493]
Length=247

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 59/92 (64%), Gaps = 3/92 (3%)
 Frame = -2

Query  693  RGLIPYNKS-GKVN--PDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLEN  523
            R +IP+ +S  K N   ++P+L HLGI +Y    L+   +L  + L+L E LEQL+ L+N
Sbjct  155  RSIIPFVRSVDKQNWLENYPFLKHLGIYAYRKDVLREITKLPQSSLELAESLEQLRWLQN  214

Query  522  GYRMKVIKVDHEAHGVDAPEDVQKIVEFMRER  427
            GYR+KV   + E  G+D PED+Q+  +F+R R
Sbjct  215  GYRVKVGITNVETVGIDTPEDLQRAKDFIRNR  246



>ref|WP_026766858.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Selenomonas 
ruminantium]
Length=242

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 52/87 (60%), Gaps = 4/87 (5%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R ++PY +    N   P   H+GI +Y   FL  Y +++ TPL+  E LEQL+ LENGYR
Sbjct  157  RSVMPYPR----NAGCPVYKHIGIYAYRRDFLLAYAKMESTPLEQSESLEQLRALENGYR  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMR  433
            +KV++   +  GVD  ED+ K+ E  +
Sbjct  213  IKVVETKAKFVGVDTAEDLAKVNEIYK  239



>ref|WP_003322448.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Bacillus alcalophilus]
 gb|KGA96906.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Bacillus alcalophilus 
ATCC 27647]
Length=243

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 57/86 (66%), Gaps = 3/86 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R  +PYN+SG VN    Y  HLG+  Y    LK + +L  + L+  E LEQL+++ENGY 
Sbjct  155  RSAVPYNRSG-VNQ--IYYKHLGLYGYPRNVLKRFVQLPASELEKAEVLEQLRLIENGYV  211

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFM  436
            +KVI+ ++EA GVD PED++K+ + +
Sbjct  212  IKVIETEYEAIGVDTPEDIKKVEQLL  237



>ref|WP_015328007.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Halobacteroides 
halobius]
 gb|AGB42293.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Halobacteroides 
halobius DSM 5150]
Length=241

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 55/88 (63%), Gaps = 3/88 (3%)
 Frame = -2

Query  693  RGLIPYNKSGKVNPDFPYLLHLGIQSYDTKFLKIYPELQPTPLQLQEDLEQLKVLENGYR  514
            R  IPY        D  Y  H+G+  Y  +FL  Y +L  TPL+ QE LEQL+ LENGY+
Sbjct  156  RAPIPYPHQEN---DITYYKHIGLYVYRREFLLNYADLPATPLEQQESLEQLRALENGYK  212

Query  513  MKVIKVDHEAHGVDAPEDVQKIVEFMRE  430
            +KV+K +H++ GVD  +D++K+ + + +
Sbjct  213  IKVVKTEHQSIGVDTKDDLEKVRKIVNQ  240



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1197759904156