BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6807

Length=800
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009774529.1|  PREDICTED: probable folate-biopterin transpo...    110   5e-24   Nicotiana sylvestris
ref|XP_009609918.1|  PREDICTED: probable folate-biopterin transpo...    110   5e-24   Nicotiana tomentosiformis
ref|XP_009609917.1|  PREDICTED: probable folate-biopterin transpo...    110   6e-24   Nicotiana tomentosiformis
ref|XP_004241672.1|  PREDICTED: probable folate-biopterin transpo...    107   5e-23   Solanum lycopersicum
ref|XP_006366264.1|  PREDICTED: probable folate-biopterin transpo...    106   1e-22   Solanum tuberosum [potatoes]
ref|XP_009774795.1|  PREDICTED: probable folate-biopterin transpo...    100   5e-21   Nicotiana sylvestris
ref|XP_009615688.1|  PREDICTED: probable folate-biopterin transpo...  99.8    2e-20   Nicotiana tomentosiformis
emb|CBI25262.3|  unnamed protein product                              97.4    8e-20   Vitis vinifera
emb|CAN74675.1|  hypothetical protein VITISV_038367                   97.8    1e-19   Vitis vinifera
ref|XP_007023526.1|  Major facilitator superfamily protein            98.2    1e-19   
ref|XP_002272239.1|  PREDICTED: probable folate-biopterin transpo...  97.8    1e-19   
gb|KJB56496.1|  hypothetical protein B456_009G122100                  94.7    4e-19   Gossypium raimondii
ref|XP_011082613.1|  PREDICTED: probable folate-biopterin transpo...  96.3    5e-19   Sesamum indicum [beniseed]
gb|KJB56497.1|  hypothetical protein B456_009G122100                  94.7    7e-19   Gossypium raimondii
gb|KDP41941.1|  hypothetical protein JCGZ_26959                       94.7    1e-18   Jatropha curcas
ref|XP_012067460.1|  PREDICTED: probable folate-biopterin transpo...  94.7    1e-18   Jatropha curcas
ref|XP_004305470.2|  PREDICTED: probable folate-biopterin transpo...  94.0    3e-18   Fragaria vesca subsp. vesca
ref|XP_007215269.1|  hypothetical protein PRUPE_ppa004652mg           92.8    6e-18   
ref|XP_002512755.1|  transporter, putative                            90.9    2e-17   
ref|XP_010532070.1|  PREDICTED: probable folate-biopterin transpo...  90.9    3e-17   Tarenaya hassleriana [spider flower]
ref|XP_009354223.1|  PREDICTED: probable folate-biopterin transpo...  90.5    4e-17   Pyrus x bretschneideri [bai li]
emb|CDX88561.1|  BnaC06g40050D                                        89.7    7e-17   
emb|CDX87359.1|  BnaA07g35140D                                        89.7    7e-17   
ref|XP_008342828.1|  PREDICTED: probable folate-biopterin transpo...  89.7    8e-17   
ref|XP_009106695.1|  PREDICTED: probable folate-biopterin transpo...  89.4    9e-17   
ref|XP_009375475.1|  PREDICTED: probable folate-biopterin transpo...  89.4    1e-16   Pyrus x bretschneideri [bai li]
ref|XP_006389855.1|  hypothetical protein EUTSA_v10018741mg           87.8    1e-16   
ref|XP_011034592.1|  PREDICTED: probable folate-biopterin transpo...  89.0    1e-16   Populus euphratica
ref|XP_008365736.1|  PREDICTED: LOW QUALITY PROTEIN: probable fol...  88.2    2e-16   
ref|XP_002299158.2|  integral membrane transporter family protein     87.8    3e-16   
gb|EYU24569.1|  hypothetical protein MIMGU_mgv1a005024mg              87.0    5e-16   Erythranthe guttata [common monkey flower]
ref|XP_010104513.1|  hypothetical protein L484_025485                 87.0    6e-16   
ref|XP_008228849.1|  PREDICTED: probable folate-biopterin transpo...  84.7    4e-15   Prunus mume [ume]
ref|XP_007222125.1|  hypothetical protein PRUPE_ppa004658mg           84.0    7e-15   Prunus persica
ref|XP_002887801.1|  integral membrane transporter family protein     84.0    7e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_008220649.1|  PREDICTED: LOW QUALITY PROTEIN: probable fol...  84.0    7e-15   Prunus mume [ume]
ref|NP_178089.1|  probable folate-biopterin transporter 3             82.8    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301270.1|  hypothetical protein CARUB_v10021670mg           82.0    3e-14   Capsella rubella
ref|XP_010417642.1|  PREDICTED: probable folate-biopterin transpo...  81.6    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_007011686.1|  Major facilitator superfamily protein            81.3    6e-14   
ref|XP_007011688.1|  Major facilitator superfamily protein isoform 2  80.1    7e-14   
ref|XP_007011689.1|  Major facilitator superfamily protein isoform 3  79.7    8e-14   
ref|XP_007011687.1|  Major facilitator superfamily protein isoform 1  80.1    1e-13   
ref|XP_010429876.1|  PREDICTED: probable folate-biopterin transpo...  79.7    2e-13   Camelina sativa [gold-of-pleasure]
gb|KHG17661.1|  Shikimate kinase                                      78.6    3e-13   Gossypium arboreum [tree cotton]
gb|KJB55119.1|  hypothetical protein B456_009G063800                  78.2    8e-13   Gossypium raimondii
gb|KJB55120.1|  hypothetical protein B456_009G063800                  77.8    1e-12   Gossypium raimondii
ref|XP_011036709.1|  PREDICTED: probable folate-biopterin transpo...  77.0    1e-12   Populus euphratica
ref|XP_011031425.1|  PREDICTED: probable folate-biopterin transpo...  77.0    1e-12   Populus euphratica
emb|CDP07891.1|  unnamed protein product                              77.0    1e-12   Coffea canephora [robusta coffee]
ref|XP_010687327.1|  PREDICTED: probable folate-biopterin transpo...  77.0    1e-12   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK35303.1|  unknown                                               76.6    2e-12   Lotus japonicus
ref|XP_009359095.1|  PREDICTED: probable folate-biopterin transpo...  76.3    2e-12   Pyrus x bretschneideri [bai li]
ref|XP_002324921.1|  hypothetical protein POPTR_0018s02750g           75.9    3e-12   Populus trichocarpa [western balsam poplar]
ref|XP_011081988.1|  PREDICTED: probable folate-biopterin transpo...  75.9    3e-12   Sesamum indicum [beniseed]
ref|XP_002515410.1|  transporter, putative                            75.9    3e-12   Ricinus communis
ref|XP_004291974.1|  PREDICTED: probable folate-biopterin transpo...  75.5    4e-12   Fragaria vesca subsp. vesca
ref|XP_002309684.1|  hypothetical protein POPTR_0006s28180g           75.5    4e-12   
gb|KCW80541.1|  hypothetical protein EUGRSUZ_C01893                   74.7    6e-12   Eucalyptus grandis [rose gum]
ref|XP_010265508.1|  PREDICTED: probable folate-biopterin transpo...  74.7    7e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010265507.1|  PREDICTED: probable folate-biopterin transpo...  74.7    7e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010048291.1|  PREDICTED: probable folate-biopterin transpo...  74.7    7e-12   Eucalyptus grandis [rose gum]
ref|XP_007161137.1|  hypothetical protein PHAVU_001G045500g           73.9    1e-11   Phaseolus vulgaris [French bean]
ref|XP_009790825.1|  PREDICTED: probable folate-biopterin transpo...  72.4    4e-11   Nicotiana sylvestris
ref|XP_008445272.1|  PREDICTED: probable folate-biopterin transpo...  72.4    5e-11   Cucumis melo [Oriental melon]
ref|XP_006357077.1|  PREDICTED: probable folate-biopterin transpo...  72.0    5e-11   Solanum tuberosum [potatoes]
ref|XP_004244510.1|  PREDICTED: probable folate-biopterin transpo...  71.6    7e-11   Solanum lycopersicum
gb|KCW80542.1|  hypothetical protein EUGRSUZ_C01894                   70.9    1e-10   Eucalyptus grandis [rose gum]
ref|XP_004138696.1|  PREDICTED: probable folate-biopterin transpo...  70.1    2e-10   Cucumis sativus [cucumbers]
ref|XP_004498793.1|  PREDICTED: probable folate-biopterin transpo...  70.1    3e-10   Cicer arietinum [garbanzo]
ref|XP_004498792.1|  PREDICTED: probable folate-biopterin transpo...  70.1    3e-10   
ref|XP_003550212.2|  PREDICTED: probable folate-biopterin transpo...  69.7    3e-10   Glycine max [soybeans]
ref|XP_009615878.1|  PREDICTED: probable folate-biopterin transpo...  68.6    9e-10   Nicotiana tomentosiformis
ref|XP_003544591.2|  PREDICTED: probable folate-biopterin transpo...  68.2    1e-09   Glycine max [soybeans]
ref|XP_002283372.1|  PREDICTED: probable folate-biopterin transpo...  67.8    1e-09   Vitis vinifera
gb|KJB55121.1|  hypothetical protein B456_009G063900                  67.4    2e-09   Gossypium raimondii
ref|XP_008377493.1|  PREDICTED: probable folate-biopterin transpo...  66.2    5e-09   
ref|XP_012076403.1|  PREDICTED: probable folate-biopterin transpo...  66.2    6e-09   Jatropha curcas
ref|XP_010670827.1|  PREDICTED: probable folate-biopterin transpo...  65.5    1e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006450260.1|  hypothetical protein CICLE_v10008084mg           65.1    1e-08   Citrus clementina [clementine]
sp|F4KIL8.2|FBT5_ARATH  RecName: Full=Probable folate-biopterin t...  65.1    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190390.1|  probable folate-biopterin transporter 5          65.1    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010048290.1|  PREDICTED: probable folate-biopterin transpo...  64.3    2e-08   Eucalyptus grandis [rose gum]
ref|XP_008790123.1|  PREDICTED: probable folate-biopterin transpo...  64.3    2e-08   Phoenix dactylifera
ref|XP_004976116.1|  PREDICTED: probable folate-biopterin transpo...  63.9    3e-08   Setaria italica
ref|XP_003588878.1|  hypothetical protein MTR_1g014250                62.8    7e-08   Medicago truncatula
gb|KEH39874.1|  folate/biopterin transporter                          62.0    1e-07   Medicago truncatula
ref|XP_009151029.1|  PREDICTED: probable folate-biopterin transpo...  61.6    2e-07   Brassica rapa
emb|CDX88152.1|  BnaA06g27430D                                        61.2    2e-07   
gb|EMT28403.1|  hypothetical protein F775_17337                       61.2    2e-07   
emb|CDX80483.1|  BnaC07g29610D                                        61.2    3e-07   
ref|XP_009390541.1|  PREDICTED: probable folate-biopterin transpo...  60.8    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_197887.1|  probable folate-biopterin transporter 2             60.5    4e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AAO64142.1|  putative membrane protein                             60.5    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009394927.1|  PREDICTED: probable folate-biopterin transpo...  60.5    4e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008794379.1|  PREDICTED: probable folate-biopterin transpo...  60.5    5e-07   Phoenix dactylifera
ref|XP_006394753.1|  hypothetical protein EUTSA_v10004061mg           60.1    6e-07   Eutrema salsugineum [saltwater cress]
ref|XP_002872136.1|  integral membrane transporter family protein     60.1    6e-07   
ref|XP_010914026.1|  PREDICTED: probable folate-biopterin transpo...  59.7    9e-07   Elaeis guineensis
ref|XP_008377495.1|  PREDICTED: probable folate-biopterin transpo...  58.9    1e-06   
gb|EMS49312.1|  hypothetical protein TRIUR3_08956                     58.2    2e-06   Triticum urartu
ref|XP_002446742.1|  hypothetical protein SORBIDRAFT_06g021580        58.2    3e-06   Sorghum bicolor [broomcorn]
ref|XP_009359096.1|  PREDICTED: probable folate-biopterin transpo...  57.8    3e-06   Pyrus x bretschneideri [bai li]
dbj|BAK01020.1|  predicted protein                                    57.8    4e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009359139.1|  PREDICTED: probable folate-biopterin transpo...  57.8    4e-06   Pyrus x bretschneideri [bai li]
ref|XP_008669213.1|  PREDICTED: probable folate-biopterin transpo...  57.4    5e-06   
tpg|DAA37101.1|  TPA: hypothetical protein ZEAMMB73_089511            57.4    6e-06   
ref|XP_010929183.1|  PREDICTED: probable folate-biopterin transpo...  57.0    7e-06   Elaeis guineensis
ref|XP_006845395.2|  PREDICTED: probable folate-biopterin transpo...  56.6    7e-06   Amborella trichopoda
ref|XP_011623772.1|  PREDICTED: probable folate-biopterin transpo...  56.6    8e-06   
gb|ERN07070.1|  hypothetical protein AMTR_s00019p00060350             56.6    8e-06   Amborella trichopoda
gb|EYU22001.1|  hypothetical protein MIMGU_mgv1a005007mg              56.6    8e-06   Erythranthe guttata [common monkey flower]
ref|XP_010541554.1|  PREDICTED: probable folate-biopterin transpo...  55.8    1e-05   Tarenaya hassleriana [spider flower]
ref|XP_011081396.1|  PREDICTED: probable folate-biopterin transpo...  55.8    2e-05   Sesamum indicum [beniseed]
ref|XP_006289494.1|  hypothetical protein CARUB_v10003028mg           55.5    2e-05   Capsella rubella
gb|KJB55110.1|  hypothetical protein B456_009G063700                  54.7    4e-05   Gossypium raimondii
ref|XP_008789895.1|  PREDICTED: probable folate-biopterin transpo...  54.3    5e-05   
ref|XP_008789896.1|  PREDICTED: probable folate-biopterin transpo...  54.3    5e-05   Phoenix dactylifera
ref|XP_006483723.1|  PREDICTED: probable folate-biopterin transpo...  53.9    7e-05   Citrus sinensis [apfelsine]
gb|KDO67414.1|  hypothetical protein CISIN_1g037870mg                 53.5    1e-04   Citrus sinensis [apfelsine]
ref|XP_006450268.1|  hypothetical protein CICLE_v10010366mg           53.5    1e-04   Citrus clementina [clementine]
ref|XP_002308712.2|  hypothetical protein POPTR_0006s28130g           53.1    1e-04   
gb|AFW85534.1|  hypothetical protein ZEAMMB73_468561                  52.4    1e-04   
ref|XP_011031432.1|  PREDICTED: probable folate-biopterin transpo...  52.8    2e-04   Populus euphratica
ref|XP_011031431.1|  PREDICTED: probable folate-biopterin transpo...  52.8    2e-04   Populus euphratica
ref|NP_001169377.1|  uncharacterized protein LOC100383245             52.0    2e-04   
ref|XP_002437984.1|  hypothetical protein SORBIDRAFT_10g005900        52.4    2e-04   Sorghum bicolor [broomcorn]
ref|XP_010927961.1|  PREDICTED: probable folate-biopterin transpo...  52.0    3e-04   
ref|XP_010421353.1|  PREDICTED: probable folate-biopterin transpo...  51.6    4e-04   
ref|XP_002324339.2|  hypothetical protein POPTR_0018s02720g           51.6    4e-04   
ref|XP_004964643.1|  PREDICTED: probable folate-biopterin transpo...  51.6    4e-04   Setaria italica
gb|EPS69234.1|  hypothetical protein M569_05531                       51.2    5e-04   Genlisea aurea
ref|XP_010454828.1|  PREDICTED: probable folate-biopterin transpo...  51.2    5e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010495476.1|  PREDICTED: probable folate-biopterin transpo...  51.2    5e-04   
ref|XP_008348559.1|  PREDICTED: LOW QUALITY PROTEIN: probable fol...  50.8    7e-04   
gb|KFK27767.1|  hypothetical protein AALP_AA8G426300                  50.8    7e-04   Arabis alpina [alpine rockcress]
gb|EEC80148.1|  hypothetical protein OsI_21953                        50.8    7e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_006289087.1|  hypothetical protein CARUB_v10002493mg           50.4    9e-04   
ref|XP_009125269.1|  PREDICTED: probable folate-biopterin transpo...  50.4    9e-04   Brassica rapa
ref|XP_002873479.1|  integral membrane transporter family protein     50.4    0.001   Arabidopsis lyrata subsp. lyrata



>ref|XP_009774529.1| PREDICTED: probable folate-biopterin transporter 3 [Nicotiana 
sylvestris]
Length=500

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRTQFDNL  VIVIRS LR+LP+ +LFL+PSSDPNASILPTEML +KKG+D  +  NM
Sbjct  425  NVTRTQFDNLWIVIVIRSCLRILPVCILFLIPSSDPNASILPTEMLKSKKGDDIVENQNM  484

Query  615  EMAALINPVDQTL  577
            EMA+L++ VDQ L
Sbjct  485  EMASLVSNVDQHL  497



>ref|XP_009609918.1| PREDICTED: probable folate-biopterin transporter 3 isoform X2 
[Nicotiana tomentosiformis]
Length=500

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRTQFDNL  VIVIRS LR+LP+ +LFLVPSSDPNASILPTEML +KKG+D  +  NM
Sbjct  425  NVTRTQFDNLWIVIVIRSCLRILPVCILFLVPSSDPNASILPTEMLKSKKGDDIVENQNM  484

Query  615  EMAALINPVDQTL  577
            EMA+L++ +DQ L
Sbjct  485  EMASLVSSLDQHL  497



>ref|XP_009609917.1| PREDICTED: probable folate-biopterin transporter 3 isoform X1 
[Nicotiana tomentosiformis]
Length=548

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRTQFDNL  VIVIRS LR+LP+ +LFLVPSSDPNASILPTEML +KKG+D  +  NM
Sbjct  473  NVTRTQFDNLWIVIVIRSCLRILPVCILFLVPSSDPNASILPTEMLKSKKGDDIVENQNM  532

Query  615  EMAALINPVDQTL  577
            EMA+L++ +DQ L
Sbjct  533  EMASLVSSLDQHL  545



>ref|XP_004241672.1| PREDICTED: probable folate-biopterin transporter 3 [Solanum lycopersicum]
Length=500

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            +VTRTQFDNL  VIVIRS+LRVLP+ +LFL+PSSDPNASILP+EML +KKG+D  +  NM
Sbjct  425  DVTRTQFDNLWIVIVIRSILRVLPVFILFLIPSSDPNASILPSEMLKSKKGDDMLENQNM  484

Query  615  EMAALINPVDQTL  577
            EMA L++ VDQ L
Sbjct  485  EMAPLVSSVDQHL  497



>ref|XP_006366264.1| PREDICTED: probable folate-biopterin transporter 3-like [Solanum 
tuberosum]
Length=500

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRTQFDNL  VIVIRS+LRVLP+ +LFL+PSSDPNASILPTEML +KK +D  +  +M
Sbjct  425  NVTRTQFDNLWIVIVIRSILRVLPVFILFLIPSSDPNASILPTEMLKSKKADDMLENQSM  484

Query  615  EMAALINPVDQTL  577
            EMA L++ VDQ L
Sbjct  485  EMAPLVSSVDQHL  497



>ref|XP_009774795.1| PREDICTED: probable folate-biopterin transporter 3 [Nicotiana 
sylvestris]
Length=372

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRTQFDNL   +VIRS+ RVLPIGLLFLVPSSDP ASILPTEML  KKG+D+     +
Sbjct  297  NVTRTQFDNLWIAVVIRSISRVLPIGLLFLVPSSDPTASILPTEMLNRKKGDDNLGAQKL  356

Query  615  EMAALINPVDQTL  577
            EM  L+  VDQ L
Sbjct  357  EMTPLVTNVDQHL  369



>ref|XP_009615688.1| PREDICTED: probable folate-biopterin transporter 3 [Nicotiana 
tomentosiformis]
Length=500

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRTQFDNL   +VIRS  RVLPIGLLFLVPSSDP ASILPTEML  KKG+D+     +
Sbjct  425  NVTRTQFDNLWIAVVIRSFSRVLPIGLLFLVPSSDPTASILPTEMLNRKKGDDNLGAQKL  484

Query  615  EMAALINPVDQTL  577
            EM  L+  +DQ L
Sbjct  485  EMTPLVTNIDQHL  497



>emb|CBI25262.3| unnamed protein product [Vitis vinifera]
Length=405

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -3

Query  792  VTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNME  613
            VTRTQFDNL   I+IRS+ R++P+GLLFLVP SDPN SILPTEML TKKG+D  ++DN+E
Sbjct  338  VTRTQFDNLWLSILIRSMFRIIPLGLLFLVPRSDPNLSILPTEMLRTKKGDDIPESDNIE  397

Query  612  MAALIN  595
            MA L+N
Sbjct  398  MAPLVN  403



>emb|CAN74675.1| hypothetical protein VITISV_038367 [Vitis vinifera]
Length=468

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -3

Query  792  VTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNME  613
            VTRTQFDNL   I+IRS+ R++P+GLLFLVP SDPN SILPTEML TKKG+D  ++DN+E
Sbjct  401  VTRTQFDNLWLSILIRSMFRIIPLGLLFLVPRSDPNLSILPTEMLRTKKGDDIPESDNIE  460

Query  612  MAALIN  595
            MA L+N
Sbjct  461  MAPLVN  466



>ref|XP_007023526.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY26148.1| Major facilitator superfamily protein [Theobroma cacao]
Length=502

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRTQFDNL   I+IRSLLR++PIG LFL+P SDP  SILP+EML TKK  D  + +N+
Sbjct  433  NVTRTQFDNLWIAILIRSLLRLIPIGFLFLIPRSDPKLSILPSEMLRTKKSNDILEQENI  492

Query  615  EMAALINPVD  586
            EMA+L+N +D
Sbjct  493  EMASLVNSID  502



>ref|XP_002272239.1| PREDICTED: probable folate-biopterin transporter 3 [Vitis vinifera]
 ref|XP_010655138.1| PREDICTED: probable folate-biopterin transporter 3 [Vitis vinifera]
Length=496

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -3

Query  792  VTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNME  613
            VTRTQFDNL   I+IRS+ R++P+GLLFLVP SDPN SILPTEML TKKG+D  ++DN+E
Sbjct  429  VTRTQFDNLWLSILIRSMFRIIPLGLLFLVPRSDPNLSILPTEMLRTKKGDDIPESDNIE  488

Query  612  MAALIN  595
            MA L+N
Sbjct  489  MAPLVN  494



>gb|KJB56496.1| hypothetical protein B456_009G122100 [Gossypium raimondii]
Length=365

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRTQFDNL   IVIRS LR++PIG LFL+P SDPN SILP+EML TK+G D  + +N+
Sbjct  297  NVTRTQFDNLWIAIVIRSPLRLIPIGFLFLMPRSDPNLSILPSEMLRTKRGNDVLEPENI  356

Query  615  EMAALINPV  589
            EMA L+N +
Sbjct  357  EMATLVNSI  365



>ref|XP_011082613.1| PREDICTED: probable folate-biopterin transporter 3 [Sesamum indicum]
Length=498

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRT FDNL   I IRSL RVLPIG+LFL+PSSDPN  ILPTEML TKK  ++    NM
Sbjct  423  NVTRTTFDNLWLAISIRSLFRVLPIGILFLIPSSDPNVLILPTEMLRTKKDNNTTDPINM  482

Query  615  EMAALINPVDQT  580
            EMA L+N +D T
Sbjct  483  EMAPLVNRIDHT  494



>gb|KJB56497.1| hypothetical protein B456_009G122100 [Gossypium raimondii]
Length=428

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRTQFDNL   IVIRS LR++PIG LFL+P SDPN SILP+EML TK+G D  + +N+
Sbjct  360  NVTRTQFDNLWIAIVIRSPLRLIPIGFLFLMPRSDPNLSILPSEMLRTKRGNDVLEPENI  419

Query  615  EMAALINPV  589
            EMA L+N +
Sbjct  420  EMATLVNSI  428



>gb|KDP41941.1| hypothetical protein JCGZ_26959 [Jatropha curcas]
Length=458

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRTQFDNL   I+IRS+LR++PI LLFL+P SDPN+SILP EML TKKG D  +T N+
Sbjct  390  QVTRTQFDNLWMAILIRSMLRLVPIALLFLIPRSDPNSSILPEEMLNTKKGNDMLETGNL  449

Query  615  EMAALIN  595
            EMA+L++
Sbjct  450  EMASLVD  456



>ref|XP_012067460.1| PREDICTED: probable folate-biopterin transporter 3 [Jatropha 
curcas]
Length=485

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRTQFDNL   I+IRS+LR++PI LLFL+P SDPN+SILP EML TKKG D  +T N+
Sbjct  417  QVTRTQFDNLWMAILIRSMLRLVPIALLFLIPRSDPNSSILPEEMLNTKKGNDMLETGNL  476

Query  615  EMAALIN  595
            EMA+L++
Sbjct  477  EMASLVD  483



>ref|XP_004305470.2| PREDICTED: probable folate-biopterin transporter 3 [Fragaria 
vesca subsp. vesca]
 ref|XP_011467002.1| PREDICTED: probable folate-biopterin transporter 3 [Fragaria 
vesca subsp. vesca]
Length=498

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 60/69 (87%), Gaps = 1/69 (1%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            N+TRTQF+NL   I+IRS+LR+LPI LLFL+P +DP++SILP+EML TKKG+D  +++N+
Sbjct  431  NITRTQFENLWMAILIRSILRILPIALLFLIPRADPSSSILPSEMLRTKKGDD-LESENV  489

Query  615  EMAALINPV  589
            EMA+L+N V
Sbjct  490  EMASLVNGV  498



>ref|XP_007215269.1| hypothetical protein PRUPE_ppa004652mg [Prunus persica]
 gb|EMJ16468.1| hypothetical protein PRUPE_ppa004652mg [Prunus persica]
Length=497

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             +TRTQF+NL   I+IRSLLR++PI LLFL+P +DPN SILP EML TKKG D+ + +N+
Sbjct  429  KITRTQFENLWMAILIRSLLRIVPIALLFLIPRTDPNLSILPPEMLRTKKGHDTHEYENI  488

Query  615  EMAALIN  595
            EMA+L+N
Sbjct  489  EMASLVN  495



>ref|XP_002512755.1| transporter, putative [Ricinus communis]
 gb|EEF49258.1| transporter, putative [Ricinus communis]
Length=467

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTR QFDNL   I+IRS+LR++PI LLFL+P +DP +SILP EML TKKG+D  K +N+
Sbjct  399  KVTRIQFDNLWMAILIRSILRMVPISLLFLIPKADPTSSILPAEMLNTKKGDDMLKNENL  458

Query  615  EMAALIN  595
            EM +L+N
Sbjct  459  EMVSLVN  465



>ref|XP_010532070.1| PREDICTED: probable folate-biopterin transporter 3 [Tarenaya 
hassleriana]
Length=495

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRT+FDNL   IVIRSLLR++PIGL+FL+P+SDPN+ +LPTEML  + GE   ++DN+
Sbjct  426  KVTRTEFDNLWLAIVIRSLLRLIPIGLVFLIPNSDPNSFVLPTEMLKNRTGEAVLESDNV  485

Query  615  EMAALIN  595
            EM+AL+ 
Sbjct  486  EMSALLG  492



>ref|XP_009354223.1| PREDICTED: probable folate-biopterin transporter 3 [Pyrus x bretschneideri]
Length=501

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            N+TRTQF+NL   I+IRSLLR++PI LLFL+P SDPN SILP+EML TKK +D  + + +
Sbjct  433  NITRTQFENLWMAILIRSLLRIVPIALLFLIPRSDPNLSILPSEMLRTKKADDVHEYETL  492

Query  615  EMAALIN  595
            EMA+L+ 
Sbjct  493  EMASLVT  499



>emb|CDX88561.1| BnaC06g40050D [Brassica napus]
Length=484

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRTQFDNL  VIVIRSLLRV+PIGL+FL+P+ DP+++ILP +ML  ++ ED  +TD +
Sbjct  415  KVTRTQFDNLWLVIVIRSLLRVIPIGLVFLIPNVDPSSTILPADMLMNRRSEDVVETDKI  474

Query  615  EMAALIN  595
            EM AL+ 
Sbjct  475  EMTALLT  481



>emb|CDX87359.1| BnaA07g35140D [Brassica napus]
Length=495

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRTQFDNL  VIVIRSLLRV+PIGL+FL+P+ DP+++ILP +ML  ++ ED  +TD +
Sbjct  426  KVTRTQFDNLWLVIVIRSLLRVVPIGLVFLIPNVDPSSTILPADMLMNRRSEDVVETDKI  485

Query  615  EMAALIN  595
            EM AL++
Sbjct  486  EMTALLS  492



>ref|XP_008342828.1| PREDICTED: probable folate-biopterin transporter 3 [Malus domestica]
Length=499

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            N+TRTQF+NL   I+IRSLLR+ PI LLFL+P SDPN SILP+EML TKK +D  + + +
Sbjct  431  NITRTQFENLWMAILIRSLLRIXPIALLFLIPRSDPNLSILPSEMLRTKKADDVHEYETL  490

Query  615  EMAALIN  595
            EMA+L+ 
Sbjct  491  EMASLVT  497



>ref|XP_009106695.1| PREDICTED: probable folate-biopterin transporter 3 [Brassica 
rapa]
 ref|XP_009106696.1| PREDICTED: probable folate-biopterin transporter 3 [Brassica 
rapa]
 ref|XP_009106697.1| PREDICTED: probable folate-biopterin transporter 3 [Brassica 
rapa]
 ref|XP_009106698.1| PREDICTED: probable folate-biopterin transporter 3 [Brassica 
rapa]
 ref|XP_009106699.1| PREDICTED: probable folate-biopterin transporter 3 [Brassica 
rapa]
Length=495

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRTQFDNL  VIVIRSLLRV+PIGL+FL+P+ DP+++ILP +ML  ++ ED  +TD +
Sbjct  426  KVTRTQFDNLWLVIVIRSLLRVVPIGLVFLIPNVDPSSTILPADMLMHRRSEDVVETDKI  485

Query  615  EMAALIN  595
            EM AL++
Sbjct  486  EMTALLS  492



>ref|XP_009375475.1| PREDICTED: probable folate-biopterin transporter 3 [Pyrus x bretschneideri]
Length=499

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            N+TRTQF+NL   I+IRSLLR++PI LLFL+P SDPN +ILP+EML TKK  D  + + +
Sbjct  431  NITRTQFENLWMAILIRSLLRIVPIALLFLIPRSDPNLTILPSEMLRTKKANDVHEYETL  490

Query  615  EMAALIN  595
            EM++L+N
Sbjct  491  EMSSLVN  497



>ref|XP_006389855.1| hypothetical protein EUTSA_v10018741mg [Eutrema salsugineum]
 gb|ESQ27141.1| hypothetical protein EUTSA_v10018741mg [Eutrema salsugineum]
Length=369

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRT+FDNL  VIVIRSLLRV+PIG++FL+P+ DPNA+ILP EML  ++ E   +T+ +
Sbjct  300  KVTRTRFDNLWLVIVIRSLLRVVPIGMVFLIPNVDPNATILPAEMLMNRRSEAVIETEKI  359

Query  615  EMAALIN  595
            EM ALI+
Sbjct  360  EMTALIS  366



>ref|XP_011034592.1| PREDICTED: probable folate-biopterin transporter 3 [Populus euphratica]
Length=487

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRTQFDNL   I+IRSL+R++P+ LLFL+P SDPN SILP EML  KKGE+  +++N 
Sbjct  419  KVTRTQFDNLWVAILIRSLMRIIPVFLLFLIPRSDPNLSILPEEMLKMKKGENRLESENT  478

Query  615  EMAALIN  595
            EM +L++
Sbjct  479  EMVSLVD  485



>ref|XP_008365736.1| PREDICTED: LOW QUALITY PROTEIN: probable folate-biopterin transporter 
3 [Malus domestica]
Length=499

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            N+TRTQF+N+   I+IRSLLR++PI LLFL+P SDPN +ILP+EML TKK  D  + + +
Sbjct  431  NITRTQFENIWMAILIRSLLRIVPIALLFLIPRSDPNLTILPSEMLRTKKANDVHEYETL  490

Query  615  EMAALIN  595
            EM++L+N
Sbjct  491  EMSSLLN  497



>ref|XP_002299158.2| integral membrane transporter family protein [Populus trichocarpa]
 gb|EEE83963.2| integral membrane transporter family protein [Populus trichocarpa]
Length=484

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRTQFDNL   I+IRSL+R++P+ LLFL+P SDPN SILP EML TKKG++  +++N 
Sbjct  416  KVTRTQFDNLWVAILIRSLMRIIPVFLLFLIPRSDPNLSILPEEMLKTKKGDNRLESENT  475

Query  615  EMAAL  601
            EM +L
Sbjct  476  EMVSL  480



>gb|EYU24569.1| hypothetical protein MIMGU_mgv1a005024mg [Erythranthe guttata]
Length=500

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRT FDNL   +++RS  RVLPI +LFLVPS DPN +ILP EML  KKGED A    M
Sbjct  428  NVTRTSFDNLWLAVLVRSFFRVLPIVILFLVPSGDPNLNILPIEMLGAKKGEDLADDSEM  487

Query  615  EMAA-LINPVDQ  583
            EM A L+N  +Q
Sbjct  488  EMEALLVNRANQ  499



>ref|XP_010104513.1| hypothetical protein L484_025485 [Morus notabilis]
 gb|EXC01114.1| hypothetical protein L484_025485 [Morus notabilis]
Length=510

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -3

Query  792  VTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNME  613
            VTRTQFDNL   I+IR++LR+ P+GLLFLVP +DPN+SILPTE+L T++  D+ +  N+E
Sbjct  439  VTRTQFDNLWLAILIRNILRISPLGLLFLVPRADPNSSILPTEILSTEEETDTQEAKNVE  498

Query  612  MAALINPVD  586
            + +L+N VD
Sbjct  499  LVSLVNNVD  507



>ref|XP_008228849.1| PREDICTED: probable folate-biopterin transporter 3 [Prunus mume]
Length=500

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             +TRT+F+NL   I+IRS LR++PI LLFL+P +DPN  ILP EML TKKG D+ + + +
Sbjct  432  KITRTEFENLWMAILIRSSLRIVPIALLFLIPRTDPNLCILPPEMLRTKKGHDTHEYETL  491

Query  615  EMAALIN  595
            EMA+L+N
Sbjct  492  EMASLVN  498



>ref|XP_007222125.1| hypothetical protein PRUPE_ppa004658mg [Prunus persica]
 gb|EMJ23324.1| hypothetical protein PRUPE_ppa004658mg [Prunus persica]
Length=497

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRTQFDNL   I+IR+ LR+ P+ LLFLVP  DPN+SILPTE+L TK+  ++ +T+N+
Sbjct  426  KVTRTQFDNLWLAILIRNFLRLAPLCLLFLVPRVDPNSSILPTEILNTKEDIETQETENI  485

Query  615  EMAALINPVD  586
            E+ +L+N VD
Sbjct  486  ELVSLVNRVD  495



>ref|XP_002887801.1| integral membrane transporter family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH64060.1| integral membrane transporter family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=497

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRTQFDNL  VIVIRSLLRV+PIGL+FL+P+ D N++ILP EML  ++ E    T+ +
Sbjct  429  KVTRTQFDNLWLVIVIRSLLRVIPIGLVFLIPNVDSNSTILPAEMLTNRRSE-GVDTEKI  487

Query  615  EMAALIN  595
            EM ALI+
Sbjct  488  EMTALIS  494



>ref|XP_008220649.1| PREDICTED: LOW QUALITY PROTEIN: probable folate-biopterin transporter 
2 [Prunus mume]
Length=504

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRTQFDNL   I+IR+ LR+ P+ LLFLVP  DPN+SILPTE+L TK+  ++ +T+N+
Sbjct  433  KVTRTQFDNLWLAILIRNFLRLAPLCLLFLVPRVDPNSSILPTEILNTKEDIETQETENI  492

Query  615  EMAALINPVD  586
            E+ +L+N VD
Sbjct  493  ELVSLVNRVD  502



>ref|NP_178089.1| probable folate-biopterin transporter 3 [Arabidopsis thaliana]
 sp|Q9SQN2.1|FBT3_ARATH RecName: Full=Probable folate-biopterin transporter 3 [Arabidopsis 
thaliana]
 gb|AAF68109.1|AC010793_4 F20B17.13 [Arabidopsis thaliana]
 gb|AAG52252.1|AC011717_20 hypothetical protein; 109043-107192 [Arabidopsis thaliana]
 gb|AEE36290.1| probable folate-biopterin transporter 3 [Arabidopsis thaliana]
Length=497

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRTQFDNL  VIVIRSLLRV+PIGL+FL+P+ D N++ILP EML ++  E    T+ +
Sbjct  429  KVTRTQFDNLWLVIVIRSLLRVIPIGLVFLIPNVDSNSTILPAEMLTSRISE-GVDTEKI  487

Query  615  EMAALIN  595
            EM ALI+
Sbjct  488  EMTALIS  494



>ref|XP_006301270.1| hypothetical protein CARUB_v10021670mg [Capsella rubella]
 gb|EOA34168.1| hypothetical protein CARUB_v10021670mg [Capsella rubella]
Length=497

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRTQFDNL   IVIRSLLRV+PIGL+FL+P+ D N++ILP EML  ++ E    T+ +
Sbjct  429  KVTRTQFDNLWLAIVIRSLLRVIPIGLVFLIPNVDSNSTILPAEMLTNRRSE-GVDTEKI  487

Query  615  EMAALIN  595
            EM ALI 
Sbjct  488  EMTALIG  494



>ref|XP_010417642.1| PREDICTED: probable folate-biopterin transporter 3 [Camelina 
sativa]
Length=497

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRTQFDNL   IVIRSLLRV+PIGL+FL+P+ D N++ILP EML  ++ E    T+ +
Sbjct  429  KVTRTQFDNLWLAIVIRSLLRVIPIGLVFLIPNVDSNSTILPAEMLTNRRSE-GVDTEKI  487

Query  615  EMAALI  598
            EM ALI
Sbjct  488  EMTALI  493



>ref|XP_007011686.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY29305.1| Major facilitator superfamily protein [Theobroma cacao]
Length=497

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRT+FD L   ++IR++LRV P+ LLFLVP  DPN+ +LPTE+L +K+  ++ + DNM
Sbjct  426  NVTRTKFDYLWLAVLIRNVLRVSPLCLLFLVPRGDPNSFVLPTELLSSKEETETQEPDNM  485

Query  615  EMAALINPVD  586
            E+ +L+N VD
Sbjct  486  ELVSLVNSVD  495



>ref|XP_007011688.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY29307.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=368

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRT+FDNL   I+IR++LR+ P+ +LFLVP  DPN+SILPTEML +K   ++ +  ++
Sbjct  297  NVTRTKFDNLWLAILIRNILRLSPLSILFLVPRGDPNSSILPTEMLSSKDETEADEPKDI  356

Query  615  EMAALINPVD  586
            E+ +L+N VD
Sbjct  357  ELVSLVNSVD  366



>ref|XP_007011689.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY29308.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
Length=365

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRT+FDNL   I+IR++LR+ P+ +LFLVP  DPN+SILPTEML +K   ++ +  ++
Sbjct  294  NVTRTKFDNLWLAILIRNILRLSPLSILFLVPRGDPNSSILPTEMLSSKDETEADEPKDI  353

Query  615  EMAALINPVD  586
            E+ +L+N VD
Sbjct  354  ELVSLVNSVD  363



>ref|XP_007011687.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY29306.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=496

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRT+FDNL   I+IR++LR+ P+ +LFLVP  DPN+SILPTEML +K   ++ +  ++
Sbjct  425  NVTRTKFDNLWLAILIRNILRLSPLSILFLVPRGDPNSSILPTEMLSSKDETEADEPKDI  484

Query  615  EMAALINPVD  586
            E+ +L+N VD
Sbjct  485  ELVSLVNSVD  494



>ref|XP_010429876.1| PREDICTED: probable folate-biopterin transporter 3 [Camelina 
sativa]
Length=497

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTR QFDNL   IVIRSLLRV+PIGL+FL+P+ D N++ILP EML  ++ E    T+ +
Sbjct  429  KVTRKQFDNLWLAIVIRSLLRVIPIGLVFLIPNVDSNSTILPAEMLTNRRSE-GVGTEKI  487

Query  615  EMAALI  598
            EM ALI
Sbjct  488  EMTALI  493



>gb|KHG17661.1| Shikimate kinase [Gossypium arboreum]
Length=438

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRT+F NL   I+IR++ R+ P+G+LFL+P  DPN+SILPTEML ++    + ++ N+
Sbjct  367  NVTRTKFGNLWLAILIRNIFRLSPLGVLFLIPRGDPNSSILPTEMLGSEDETVAEESSNV  426

Query  615  EMAALINPVD  586
            E+ +L+N VD
Sbjct  427  ELVSLVNSVD  436



>gb|KJB55119.1| hypothetical protein B456_009G063800 [Gossypium raimondii]
Length=975

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 60/91 (66%), Gaps = 10/91 (11%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRT+F +L   I+IR++ R+ P+G+LFL+P  DPN+SILPTEML ++    + +++N+
Sbjct  425  NVTRTKFGSLWLAILIRNIFRLSPLGVLFLIPRGDPNSSILPTEMLGSEDETVAEESNNI  484

Query  615  EMAALINPVDQTLake*akkkACYYHPQEEK  523
            E+ +L+N VD             ++HP  ++
Sbjct  485  ELVSLVNSVD----------GLTFHHPHYQR  505



>gb|KJB55120.1| hypothetical protein B456_009G063800 [Gossypium raimondii]
Length=1295

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 62/97 (64%), Gaps = 12/97 (12%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRT+F +L   I+IR++ R+ P+G+LFL+P  DPN+SILPTEML ++    + +++N+
Sbjct  425  NVTRTKFGSLWLAILIRNIFRLSPLGVLFLIPRGDPNSSILPTEMLGSEDETVAEESNNI  484

Query  615  EMAALINPVDQTLake*akkkACYYHPQEEKRFPGFI  505
            E+ +L+N VD             ++HP  ++   GF 
Sbjct  485  ELVSLVNSVD----------GLTFHHPHYQR--SGFF  509



>ref|XP_011036709.1| PREDICTED: probable folate-biopterin transporter 2 [Populus euphratica]
Length=497

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRT+FDNL   I+ R++LRV P+ LLFL+P  DPNASILPTE+L  ++  ++ + +N+
Sbjct  426  KVTRTRFDNLWLAILTRNILRVTPLCLLFLIPRGDPNASILPTEILGAREEAETPENENI  485

Query  615  EMAALINPVD  586
            E+ +L++ VD
Sbjct  486  ELVSLVSSVD  495



>ref|XP_011031425.1| PREDICTED: probable folate-biopterin transporter 2 [Populus euphratica]
Length=497

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRT+FDNL   I+ R++LR+ P+ LLFL+PS DPNAS+L T++L  K+  ++ + +N+
Sbjct  426  NVTRTRFDNLWLAILTRNILRITPLCLLFLIPSGDPNASVLSTDILGAKEEAETPENENI  485

Query  615  EMAALINPVD  586
            E+ +L++ VD
Sbjct  486  ELVSLVSSVD  495



>emb|CDP07891.1| unnamed protein product [Coffea canephora]
Length=496

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRT+FDNL   I+IR+ LR+ P+ LLFLVP +DPNASILP E+  +K+  +   T+N+
Sbjct  426  NVTRTRFDNLWLAILIRNFLRIAPLTLLFLVPRADPNASILPDEVTSSKERSEPTVTENV  485

Query  615  EMAALINPVD  586
            E+ +L+   D
Sbjct  486  ELVSLVKEAD  495



>ref|XP_010687327.1| PREDICTED: probable folate-biopterin transporter 3 [Beta vulgaris 
subsp. vulgaris]
Length=492

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            +VTR++FDNL   ++IR+LLR+ PI LLFLVP +DPN  +LP+E+  TK+  ++  TDN+
Sbjct  426  HVTRSEFDNLWLAVLIRNLLRLAPIFLLFLVPRTDPNLPVLPSEISKTKRDTETLATDNL  485

Query  615  EMAALIN  595
            EMA+L++
Sbjct  486  EMASLLS  492



>gb|AFK35303.1| unknown [Lotus japonicus]
Length=499

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             +TRT+FDNL   I+IR++LR+ P+ LLFLVP +DPN+SILP+E+  +K   D+++T ++
Sbjct  428  KITRTRFDNLWLAILIRNVLRITPLCLLFLVPRADPNSSILPSEIANSKVAVDTSETIDV  487

Query  615  EMAALINPVD  586
            E+ +L++ VD
Sbjct  488  ELVSLVHSVD  497



>ref|XP_009359095.1| PREDICTED: probable folate-biopterin transporter 2 [Pyrus x bretschneideri]
 ref|XP_009359140.1| PREDICTED: probable folate-biopterin transporter 2 [Pyrus x bretschneideri]
Length=498

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTR QFDNL   I+IR+ LR+ P+ LLFLVP +DP +SILPTE+  TK+  ++ +T N+
Sbjct  427  KVTRMQFDNLWLAILIRNFLRLAPLCLLFLVPRADPKSSILPTEIANTKEDIETLETKNV  486

Query  615  EMAALINPVDQ  583
            E+ +L+N  D 
Sbjct  487  ELVSLVNRADH  497



>ref|XP_002324921.1| hypothetical protein POPTR_0018s02750g [Populus trichocarpa]
 gb|EEF03486.1| hypothetical protein POPTR_0018s02750g [Populus trichocarpa]
Length=494

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRT+FDNL   I+ R++LRV P+ LLFL+P  DPNASILPTE+L  K   + A+ +N+
Sbjct  426  KVTRTRFDNLWIAILTRNILRVTPLCLLFLIPRGDPNASILPTEILGAK---EEAENENI  482

Query  615  EMAALINPVD  586
            E+ +L++ VD
Sbjct  483  ELVSLVSSVD  492



>ref|XP_011081988.1| PREDICTED: probable folate-biopterin transporter 2 [Sesamum indicum]
Length=499

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRT+F N    I+IR++LR+ P+ LLFLVP +DPNASILP E+L +K+  ++   DN+
Sbjct  428  NVTRTEFGNFWLAILIRNVLRISPLFLLFLVPRTDPNASILPDEVLNSKEVAETRAPDNV  487

Query  615  EMAALINPVD  586
            E+ AL+  +D
Sbjct  488  ELVALVESMD  497



>ref|XP_002515410.1| transporter, putative [Ricinus communis]
 gb|EEF46859.1| transporter, putative [Ricinus communis]
Length=498

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            +VTRT+FDNL   I++RS+LR+ P+ L+FLVP  DPNAS+LP+E+L T    ++ + +N+
Sbjct  427  DVTRTKFDNLWLAIILRSILRMSPLCLIFLVPRGDPNASLLPSEILGTDDRNEAPEDENI  486

Query  615  EMAALINPVDQ  583
            E+ +L+  VD 
Sbjct  487  ELVSLVRSVDS  497



>ref|XP_004291974.1| PREDICTED: probable folate-biopterin transporter 2 [Fragaria 
vesca subsp. vesca]
Length=491

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGE--DSAKTD  622
             VTRTQFDNL   I+IR++LR+ P+ LLFL+P  DPN+SILPTE+L TK+    ++ + +
Sbjct  418  KVTRTQFDNLWLAILIRNVLRLTPLCLLFLIPRVDPNSSILPTEILSTKEDTEIETPEAE  477

Query  621  NMEMAALINPVD  586
            N+E+ +L++ VD
Sbjct  478  NIELVSLVSRVD  489



>ref|XP_002309684.1| hypothetical protein POPTR_0006s28180g [Populus trichocarpa]
 gb|EEE93207.1| hypothetical protein POPTR_0006s28180g [Populus trichocarpa]
Length=494

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRT+FDNL   I+IR++LR+ P+ LLFL+P  DPNAS+L  ++L  K+  ++ + +N+
Sbjct  423  NVTRTRFDNLWLAILIRNILRITPLCLLFLIPRGDPNASVLSNDILGAKEEAETPENENI  482

Query  615  EMAALINPVD  586
            E+ +L++ VD
Sbjct  483  ELVSLVSSVD  492



>gb|KCW80541.1| hypothetical protein EUGRSUZ_C01893 [Eucalyptus grandis]
Length=465

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -3

Query  792  VTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNME  613
            VTRTQF NL   I+IR++LR+ P+ LLFLVP  DPNAS+LP E+L +++G ++ +  ++E
Sbjct  395  VTRTQFSNLWLAILIRNILRISPLCLLFLVPGGDPNASLLPDEVLASREGTETVEPQHVE  454

Query  612  MAALINPVD  586
            + +L+N  +
Sbjct  455  LLSLVNSAE  463



>ref|XP_010265508.1| PREDICTED: probable folate-biopterin transporter 2 isoform X2 
[Nelumbo nucifera]
Length=490

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTR  FDNL   I+IR+++R+LP+  LFLVP SDP +SILP EML T + ++S   +N+
Sbjct  425  KVTRVHFDNLWLAILIRNIMRILPLSFLFLVPRSDPTSSILPAEMLTTIESQES---ENI  481

Query  615  EMAALIN  595
            E+A+L+N
Sbjct  482  ELASLVN  488



>ref|XP_010265507.1| PREDICTED: probable folate-biopterin transporter 2 isoform X1 
[Nelumbo nucifera]
Length=492

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTR  FDNL   I+IR+++R+LP+  LFLVP SDP +SILP EML T + ++S   +N+
Sbjct  427  KVTRVHFDNLWLAILIRNIMRILPLSFLFLVPRSDPTSSILPAEMLTTIESQES---ENI  483

Query  615  EMAALIN  595
            E+A+L+N
Sbjct  484  ELASLVN  490



>ref|XP_010048291.1| PREDICTED: probable folate-biopterin transporter 2 [Eucalyptus 
grandis]
 gb|KCW80540.1| hypothetical protein EUGRSUZ_C01893 [Eucalyptus grandis]
Length=500

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -3

Query  792  VTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNME  613
            VTRTQF NL   I+IR++LR+ P+ LLFLVP  DPNAS+LP E+L +++G ++ +  ++E
Sbjct  430  VTRTQFSNLWLAILIRNILRISPLCLLFLVPGGDPNASLLPDEVLASREGTETVEPQHVE  489

Query  612  MAALINPVD  586
            + +L+N  +
Sbjct  490  LLSLVNSAE  498



>ref|XP_007161137.1| hypothetical protein PHAVU_001G045500g [Phaseolus vulgaris]
 gb|ESW33131.1| hypothetical protein PHAVU_001G045500g [Phaseolus vulgaris]
Length=498

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILP-TEMLPTKKGEDSAKTDN  619
             +TRT+FDN+   I IR++LR+ P+ LLFLVP +DPN+SILP +E + +K   D++ T N
Sbjct  426  KITRTRFDNIWLAIFIRNILRITPLWLLFLVPRADPNSSILPASETMDSKVAIDTSDTKN  485

Query  618  MEMAALINPVD  586
            +E+ +L++ VD
Sbjct  486  VELMSLVHSVD  496



>ref|XP_009790825.1| PREDICTED: probable folate-biopterin transporter 2 [Nicotiana 
sylvestris]
Length=501

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 54/72 (75%), Gaps = 2/72 (3%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKT--D  622
             VTRTQFDNL   I+IR++LR+ P+ +LFLVP SDPN+SILP E+  +K+  ++  T  +
Sbjct  428  KVTRTQFDNLWLAILIRNILRITPLFVLFLVPRSDPNSSILPDEVSDSKENIETPATENE  487

Query  621  NMEMAALINPVD  586
            N+E+ ALI+ +D
Sbjct  488  NIELVALIHNMD  499



>ref|XP_008445272.1| PREDICTED: probable folate-biopterin transporter 2 [Cucumis melo]
Length=503

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGED-SAKTDN  619
             VTRT+F NL   I+IR+LLR+ P+ +LFLVP  DPN+SILPTE+  ++   D S + DN
Sbjct  425  QVTRTKFSNLWLAILIRNLLRLSPLCMLFLVPRGDPNSSILPTELPSSEVDNDTSEEADN  484

Query  618  MEMAALINPVD  586
            +E+ +L+N +D
Sbjct  485  IELVSLVNGMD  495



>ref|XP_006357077.1| PREDICTED: probable folate-biopterin transporter 2-like [Solanum 
tuberosum]
Length=513

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 53/71 (75%), Gaps = 2/71 (3%)
 Frame = -3

Query  792  VTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKK--GEDSAKTDN  619
            +TRT+F NL   I+IR++LR+ P+ +LFL+P SDPN+SILP EM  +K+  G  + + +N
Sbjct  441  ITRTKFHNLWLAILIRNILRITPLFILFLIPRSDPNSSILPDEMSDSKETTGASATQNEN  500

Query  618  MEMAALINPVD  586
            +E+ AL++ +D
Sbjct  501  IELVALVHNMD  511



>ref|XP_004244510.1| PREDICTED: probable folate-biopterin transporter 2 [Solanum lycopersicum]
Length=513

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 53/72 (74%), Gaps = 2/72 (3%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKK--GEDSAKTD  622
             +TRT+F NL   I+IR++LR+ P+ +LFL+P SDPN+SILP EM  +K+  G  + + +
Sbjct  440  KITRTKFHNLWLAILIRNILRITPLFILFLIPRSDPNSSILPDEMSDSKETTGTSTTQNE  499

Query  621  NMEMAALINPVD  586
            N+E+ AL++ +D
Sbjct  500  NIELVALVHNMD  511



>gb|KCW80542.1| hypothetical protein EUGRSUZ_C01894 [Eucalyptus grandis]
Length=404

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = -3

Query  783  TQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNMEMAA  604
            TQF NL   I+IR++LR+ P+ LLFLVPS DPN S+LP ++L +K+G ++ +  ++E+ +
Sbjct  337  TQFGNLWLAILIRNILRISPLCLLFLVPSGDPNVSLLPEDLLASKEGTETVEAQHIELVS  396

Query  603  LINPVDQ  583
            L+N  + 
Sbjct  397  LVNSAES  403



>ref|XP_004138696.1| PREDICTED: probable folate-biopterin transporter 2 [Cucumis sativus]
 gb|KGN63001.1| hypothetical protein Csa_2G382740 [Cucumis sativus]
Length=503

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGED-SAKTDN  619
             VTRT+F NL   I+IR+LLR+ P+ +LFLVP  DPN+SILPTE+  ++   D S + DN
Sbjct  425  QVTRTKFGNLWLAILIRNLLRLSPLCMLFLVPRGDPNSSILPTELPSSEVDNDTSEEADN  484

Query  618  MEMAALINPVD  586
            +E+ +L+N ++
Sbjct  485  IELVSLVNGMN  495



>ref|XP_004498793.1| PREDICTED: probable folate-biopterin transporter 2-like isoform 
X2 [Cicer arietinum]
Length=503

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASI-LPTEMLPTKKGEDSAKTDN  619
             +TRTQFDN+   I+IR++LR+ PI +LFLVP  DPN+ I LP E + +K   D+++T N
Sbjct  431  KITRTQFDNIWLAILIRNILRITPICMLFLVPRVDPNSFILLPRESVDSKVDIDASETKN  490

Query  618  MEMAALINPVD  586
            +E+ +L++ VD
Sbjct  491  VELMSLVHTVD  501



>ref|XP_004498792.1| PREDICTED: probable folate-biopterin transporter 2-like isoform 
X1 [Cicer arietinum]
Length=524

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASI-LPTEMLPTKKGEDSAKTDN  619
             +TRTQFDN+   I+IR++LR+ PI +LFLVP  DPN+ I LP E + +K   D+++T N
Sbjct  452  KITRTQFDNIWLAILIRNILRITPICMLFLVPRVDPNSFILLPRESVDSKVDIDASETKN  511

Query  618  MEMAALINPVD  586
            +E+ +L++ VD
Sbjct  512  VELMSLVHTVD  522



>ref|XP_003550212.2| PREDICTED: probable folate-biopterin transporter 2-like [Glycine 
max]
 gb|KHN46357.1| hypothetical protein glysoja_036435 [Glycine soja]
Length=498

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -3

Query  792  VTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNME  613
            +TRT+FDN+   I+IR++LR+ P+ LLFLVP +DP++SILP++ + +K   D++   N+E
Sbjct  427  ITRTKFDNIWLAILIRNILRIAPLWLLFLVPRADPSSSILPSKNMNSKVAIDTSDIKNVE  486

Query  612  MAALINPVD  586
            + +L++ ++
Sbjct  487  LVSLVHSLE  495



>ref|XP_009615878.1| PREDICTED: probable folate-biopterin transporter 2 [Nicotiana 
tomentosiformis]
Length=501

 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 52/72 (72%), Gaps = 2/72 (3%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKT--D  622
             VTRTQFDNL   I+IR++LR+ P+ +LFLVP SDPN+S LP E+  +K+  ++  T  +
Sbjct  428  KVTRTQFDNLWLAILIRNILRITPLFVLFLVPRSDPNSSSLPDEVSDSKENIETPATENE  487

Query  621  NMEMAALINPVD  586
            N+E+ AL+  +D
Sbjct  488  NIELVALVRNMD  499



>ref|XP_003544591.2| PREDICTED: probable folate-biopterin transporter 2-like [Glycine 
max]
 gb|KHN12483.1| hypothetical protein glysoja_045225 [Glycine soja]
Length=496

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -3

Query  792  VTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNME  613
            +TRT+FDN+   I+IR++LR+ P+ LLFLVP +D ++SILP + + ++   D + T N+E
Sbjct  426  ITRTKFDNIWLAILIRNILRIAPLWLLFLVPRADRSSSILPCKSMNSEVAIDPSDTKNVE  485

Query  612  MAALINPVD  586
            + +L++ VD
Sbjct  486  LVSLVHSVD  494



>ref|XP_002283372.1| PREDICTED: probable folate-biopterin transporter 2 [Vitis vinifera]
 ref|XP_010648766.1| PREDICTED: probable folate-biopterin transporter 2 [Vitis vinifera]
 ref|XP_010648767.1| PREDICTED: probable folate-biopterin transporter 2 [Vitis vinifera]
 ref|XP_010648768.1| PREDICTED: probable folate-biopterin transporter 2 [Vitis vinifera]
 emb|CBI21157.3| unnamed protein product [Vitis vinifera]
Length=506

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 9/79 (11%)
 Frame = -3

Query  792  VTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKK---------GE  640
            VTR QFDNL   I+IR++LR+ P+ LLFLVP +DPN+SI+P+++L   K          E
Sbjct  427  VTRVQFDNLWMAILIRNILRLSPLALLFLVPRTDPNSSIIPSQILQNTKQAAHASHPENE  486

Query  639  DSAKTDNMEMAALINPVDQ  583
            +  +  N+E+  L+N VD 
Sbjct  487  NKNEDGNIELLPLVNNVDS  505



>gb|KJB55121.1| hypothetical protein B456_009G063900 [Gossypium raimondii]
Length=493

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 5/70 (7%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTR +F++L   I+IR++LRV P+ LLFLVP  DPNA      ML TK   ++++ DN+
Sbjct  426  NVTRIKFEDLWLAILIRNILRVSPLCLLFLVPKGDPNAF-----MLSTKDEAETSEPDNI  480

Query  615  EMAALINPVD  586
            E+A+LI+ VD
Sbjct  481  ELASLIHSVD  490



>ref|XP_008377493.1| PREDICTED: probable folate-biopterin transporter 2 [Malus domestica]
Length=498

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRTQFDNL   I+IR+LLR+ P+ LLFLVP +DPN+SILPTE+  TK+  ++ +T N+
Sbjct  427  KVTRTQFDNLWLAILIRNLLRLAPLCLLFLVPRADPNSSILPTEIANTKEDIETLETKNV  486

Query  615  EMAALINPVD  586
            E+ +L+N  D
Sbjct  487  ELVSLVNRAD  496



>ref|XP_012076403.1| PREDICTED: probable folate-biopterin transporter 2 [Jatropha 
curcas]
 ref|XP_012076404.1| PREDICTED: probable folate-biopterin transporter 2 [Jatropha 
curcas]
 gb|KDP33498.1| hypothetical protein JCGZ_07069 [Jatropha curcas]
Length=499

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLP--TKKGEDSAKTD  622
            +VTRT+FDNL   I+IRS+LRV P+ L+F++P  DPNAS+LP+E+L    ++  ++ + +
Sbjct  426  DVTRTKFDNLWLAIIIRSILRVSPLCLIFMIPKGDPNASLLPSEILGREDEERTETTENE  485

Query  621  NMEMAALINPVD  586
            N+E+ +LI+ VD
Sbjct  486  NIELVSLISSVD  497



>ref|XP_010670827.1| PREDICTED: probable folate-biopterin transporter 2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670828.1| PREDICTED: probable folate-biopterin transporter 2 [Beta vulgaris 
subsp. vulgaris]
Length=496

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            N+TRT+FDNL   I+IR++ R+ P+ ++FLVP +DPN+ ILP+++  ++  E +   D +
Sbjct  426  NITRTRFDNLWVAILIRNIARISPLLVIFLVPRTDPNSCILPSQVSSSETAE-TLDDDEI  484

Query  615  EMAALINPVDQ  583
            E+A+L+  VD+
Sbjct  485  ELASLMTNVDR  495



>ref|XP_006450260.1| hypothetical protein CICLE_v10008084mg [Citrus clementina]
 ref|XP_006483527.1| PREDICTED: probable folate-biopterin transporter 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483528.1| PREDICTED: probable folate-biopterin transporter 2-like isoform 
X2 [Citrus sinensis]
 gb|ESR63500.1| hypothetical protein CICLE_v10008084mg [Citrus clementina]
 gb|KDO67403.1| hypothetical protein CISIN_1g041017mg [Citrus sinensis]
Length=499

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRTQF NL   I+IR++LR+ P+ ++FLVP  DP+ S LP E+   ++  ++++ +N+
Sbjct  428  KVTRTQFHNLWLAILIRNILRITPLCVIFLVPRGDPDTSFLPAELESKEETAEASEAENI  487

Query  615  EMAALINPVD  586
            E+ AL+N +D
Sbjct  488  ELVALVNSID  497



>sp|F4KIL8.2|FBT5_ARATH RecName: Full=Probable folate-biopterin transporter 5 [Arabidopsis 
thaliana]
Length=492

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 51/74 (69%), Gaps = 6/74 (8%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAK--TD  622
             VTRT+F NL   +++R+++R+LPI  LFLVP  D N   LP E++    GEDS +  T 
Sbjct  423  KVTRTEFGNLWLAVLVRNVMRLLPICFLFLVPQGDQNTFKLPAEIM----GEDSEEEGTR  478

Query  621  NMEMAALINPVDQT  580
            N+E+A+L++ VD++
Sbjct  479  NLELASLVDYVDRS  492



>ref|NP_001190390.1| probable folate-biopterin transporter 5 [Arabidopsis thaliana]
 gb|AED93392.1| probable folate-biopterin transporter 5 [Arabidopsis thaliana]
Length=517

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 51/74 (69%), Gaps = 6/74 (8%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAK--TD  622
             VTRT+F NL   +++R+++R+LPI  LFLVP  D N   LP E++    GEDS +  T 
Sbjct  448  KVTRTEFGNLWLAVLVRNVMRLLPICFLFLVPQGDQNTFKLPAEIM----GEDSEEEGTR  503

Query  621  NMEMAALINPVDQT  580
            N+E+A+L++ VD++
Sbjct  504  NLELASLVDYVDRS  517



>ref|XP_010048290.1| PREDICTED: probable folate-biopterin transporter 2 [Eucalyptus 
grandis]
 gb|KCW80539.1| hypothetical protein EUGRSUZ_C01892 [Eucalyptus grandis]
Length=506

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRTQF NL   I+IR++LR+ P+ LLFLVP  DP +SILP++ + +++  ++ + + +
Sbjct  432  GVTRTQFKNLWLAILIRNILRISPLCLLFLVPRGDPKSSILPSKEVASEEDTEALEPEKI  491

Query  615  EMAALINPVD  586
            E+ +L+   D
Sbjct  492  ELVSLVKHTD  501



>ref|XP_008790123.1| PREDICTED: probable folate-biopterin transporter 2 [Phoenix dactylifera]
Length=508

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 49/70 (70%), Gaps = 4/70 (6%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLP---TKKGEDSAKT  625
             VTR +F NL   I+IR+++R LP+ LLFLVP++DPN++ILP ++L      +  D+A  
Sbjct  438  KVTRVEFGNLWAAILIRNIMRALPLALLFLVPNADPNSTILPADILTGNDNTEANDAAAI  497

Query  624  DNMEMAALIN  595
            D +E+ +L+N
Sbjct  498  D-IELVSLVN  506



>ref|XP_004976116.1| PREDICTED: probable folate-biopterin transporter 2-like [Setaria 
italica]
Length=534

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTR +F NL   ++IR++ R++P+ LLFLVP SD N+++LP EML   +  ++ K  ++
Sbjct  426  NVTRMEFSNLWIAVLIRNISRLVPLTLLFLVPQSDQNSTLLPAEMLQDGESTEAVKAGSV  485

Query  615  EMAALIN  595
            E + L+ 
Sbjct  486  EFSVLVQ  492



>ref|XP_003588878.1| hypothetical protein MTR_1g014250 [Medicago truncatula]
 gb|AES59129.1| folate/biopterin transporter [Medicago truncatula]
Length=505

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 53/73 (73%), Gaps = 3/73 (4%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASI-LPTEMLPTK--KGEDSAKT  625
             +TRT+FDNL   I+IR++LR+ P+ +LFLVP  DPN+ I LP E + +K    +D+++T
Sbjct  430  KITRTKFDNLWLAILIRNILRLTPLCMLFLVPRVDPNSFILLPKENVDSKVIAIDDASET  489

Query  624  DNMEMAALINPVD  586
             ++E+ +L++ VD
Sbjct  490  KDVELVSLVHSVD  502



>gb|KEH39874.1| folate/biopterin transporter [Medicago truncatula]
Length=382

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 53/72 (74%), Gaps = 3/72 (4%)
 Frame = -3

Query  792  VTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASI-LPTEMLPTK--KGEDSAKTD  622
            +TRT+FDNL   I+IR++LR+ P+ +LFLVP  DPN+ I LP E + +K    +D+++T 
Sbjct  308  ITRTKFDNLWLAILIRNILRLTPLCMLFLVPRVDPNSFILLPKENVDSKVIAIDDASETK  367

Query  621  NMEMAALINPVD  586
            ++E+ +L++ VD
Sbjct  368  DVELVSLVHSVD  379



>ref|XP_009151029.1| PREDICTED: probable folate-biopterin transporter 2 [Brassica 
rapa]
Length=499

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTD--  622
            NVTRT+F NL   ++IR++LRV P+ +LFLVP  D N   LP E++      D  K +  
Sbjct  426  NVTRTEFGNLWLAVLIRNVLRVSPLFVLFLVPKGDQNTFKLPGEIIGEDSDSDEEKEEAR  485

Query  621  NMEMAALINPVDQ  583
            N+E+A+L++  D+
Sbjct  486  NLELASLVHSADR  498



>emb|CDX88152.1| BnaA06g27430D [Brassica napus]
Length=499

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTD--  622
            NVTRT+F NL   ++IR++LRV P+ +LFLVP  D N   LP E++      D  K +  
Sbjct  426  NVTRTEFGNLWLAVLIRNVLRVSPLFVLFLVPKGDQNTFKLPGEIIGEDSDSDEEKEEAR  485

Query  621  NMEMAALINPVDQ  583
            N+E+A+L++  D+
Sbjct  486  NLELASLVHSADR  498



>gb|EMT28403.1| hypothetical protein F775_17337 [Aegilops tauschii]
Length=527

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGE  640
             VTRT+F NL   ++ R+ +R+LP+  LFLVP SD N++ILP EMLP   G 
Sbjct  434  GVTRTEFGNLWVAVLARNAMRLLPLAFLFLVPRSDQNSTILPAEMLPGDGGS  485



>emb|CDX80483.1| BnaC07g29610D [Brassica napus]
Length=499

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTD--  622
             VTRT+F NL   ++IR+++RVLP+ +LFLVP  D N   LP E++      D  K +  
Sbjct  426  KVTRTEFGNLWLAVLIRNVMRVLPLFVLFLVPKGDQNTFKLPGEIMGEDSDSDEEKEEAR  485

Query  621  NMEMAALINPVDQ  583
            N+E+A+L++  D+
Sbjct  486  NLELASLVHSADR  498



>ref|XP_009390541.1| PREDICTED: probable folate-biopterin transporter 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009390542.1| PREDICTED: probable folate-biopterin transporter 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009390543.1| PREDICTED: probable folate-biopterin transporter 2 [Musa acuminata 
subsp. malaccensis]
Length=521

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 50/74 (68%), Gaps = 5/74 (7%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTD--  622
             VTRT+F NL   I+IR+++RV+P+ LLFLVP SD N+++LP ++L      ++ + D  
Sbjct  446  KVTRTEFSNLWAAILIRNIMRVIPLVLLFLVPISDQNSTLLPADLLNGNDNMEAHERDID  505

Query  621  ---NMEMAALINPV  589
               N+E+ +L++ +
Sbjct  506  DIKNIELVSLVDQI  519



>ref|NP_197887.1| probable folate-biopterin transporter 2 [Arabidopsis thaliana]
 sp|Q5FV41.1|FBT2_ARATH RecName: Full=Probable folate-biopterin transporter 2 [Arabidopsis 
thaliana]
 gb|AAW70379.1| At5g25050 [Arabidopsis thaliana]
 gb|AED93394.1| probable folate-biopterin transporter 2 [Arabidopsis thaliana]
Length=499

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 11/78 (14%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAK----  628
             VTRT+F NL   +++R+++R+LP+  LFLVP  D N   LP E++    GEDS +    
Sbjct  425  KVTRTEFGNLWLAVLVRNVMRLLPLCFLFLVPKGDQNTFKLPDEIM----GEDSDEEKDE  480

Query  627  ---TDNMEMAALINPVDQ  583
               T N+E+A+L++ VD+
Sbjct  481  KEGTRNLELASLVHSVDR  498



>gb|AAO64142.1| putative membrane protein [Arabidopsis thaliana]
 dbj|BAF00588.1| putative membrane protein [Arabidopsis thaliana]
Length=499

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 11/78 (14%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAK----  628
             VTRT+F NL   +++R+++R+LP+  LFLVP  D N   LP E++    GEDS +    
Sbjct  425  KVTRTEFGNLWLAVLVRNVMRLLPLCFLFLVPEGDQNTFKLPDEIM----GEDSDEEKDE  480

Query  627  ---TDNMEMAALINPVDQ  583
               T N+E+A+L++ VD+
Sbjct  481  KEGTRNLELASLVHSVDR  498



>ref|XP_009394927.1| PREDICTED: probable folate-biopterin transporter 2 [Musa acuminata 
subsp. malaccensis]
Length=519

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 48/72 (67%), Gaps = 5/72 (7%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKG-----EDSA  631
             VTRT+F NL   I+IR+++R++P+ LLFLVP SD N+++LP +ML          ED  
Sbjct  446  KVTRTEFSNLWAAILIRNIMRIVPLVLLFLVPKSDQNSTLLPADMLDADDNTEVLEEDVD  505

Query  630  KTDNMEMAALIN  595
              +++E+ +L++
Sbjct  506  DIEDIELVSLVS  517



>ref|XP_008794379.1| PREDICTED: probable folate-biopterin transporter 2 [Phoenix dactylifera]
Length=511

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPT--KKGEDSAKTD  622
             VTR +F NL   I+IRS++R LP+ +L LVP SDP+++ LP +ML    K     A+ D
Sbjct  441  KVTRAEFSNLWAAILIRSIMRALPLAILCLVPKSDPSSTSLPADMLTGNDKMEAHEAEVD  500

Query  621  NMEMAALIN  595
            ++E+ +L++
Sbjct  501  DVELVSLVD  509



>ref|XP_006394753.1| hypothetical protein EUTSA_v10004061mg [Eutrema salsugineum]
 gb|ESQ32039.1| hypothetical protein EUTSA_v10004061mg [Eutrema salsugineum]
Length=499

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEML---PTKKGEDSAKT  625
             VTRT+F NL   +++R+++RV P+ +LFLVP  D N   LP E++      +G++  +T
Sbjct  425  KVTRTEFGNLWLAVLLRNVMRVSPLFVLFLVPKGDQNTFKLPDEIMGEDSDGEGDEKEET  484

Query  624  DNMEMAALINPVDQ  583
             N+E+A+L+  VD+
Sbjct  485  RNLELASLVQSVDR  498



>ref|XP_002872136.1| integral membrane transporter family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH48395.1| integral membrane transporter family protein, partial [Arabidopsis 
lyrata subsp. lyrata]
Length=498

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 5/75 (7%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAK----  628
             VTRT+F NL   +++R+++R+LP+  LFLVP  D N   LP E++  ++ EDS      
Sbjct  424  KVTRTEFHNLWLAVLVRNVMRLLPLCFLFLVPKGDQNTFKLPDEIMG-EESEDSENEKEG  482

Query  627  TDNMEMAALINPVDQ  583
            T N+E+A+L+  VD+
Sbjct  483  TRNLELASLVQAVDR  497



>ref|XP_010914026.1| PREDICTED: probable folate-biopterin transporter 2 [Elaeis guineensis]
Length=508

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDS--AKTD  622
             VTR +F NL   I+IR+++R LP+ LLFL+P  DPN++ILP ++L      ++  A   
Sbjct  438  KVTRVEFGNLWAAILIRNIMRALPLALLFLIPKGDPNSTILPADILTGNDNIEAHEAAVI  497

Query  621  NMEMAALIN  595
            ++E+ +L++
Sbjct  498  DIELVSLVD  506



>ref|XP_008377495.1| PREDICTED: probable folate-biopterin transporter 2 [Malus domestica]
Length=461

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRT+FDNL   I+IR+LLR+ P+ LLFLVP SD  ++ILPTE+L TK   D+ +T+N+
Sbjct  390  KVTRTKFDNLWLAILIRNLLRLTPLFLLFLVPKSDARSAILPTEILNTKGDIDTTETENI  449

Query  615  EMAALINPVD  586
            E+ +L+  VD
Sbjct  450  ELVSLVKRVD  459



>gb|EMS49312.1| hypothetical protein TRIUR3_08956 [Triticum urartu]
Length=457

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGE  640
             VTRT+F NL   ++ R+ +R+LP+  LFLVP SD N++ILP EML    G 
Sbjct  364  GVTRTEFGNLWVAVLARNAMRLLPLAFLFLVPRSDQNSTILPAEMLLADGGS  415



>ref|XP_002446742.1| hypothetical protein SORBIDRAFT_06g021580 [Sorghum bicolor]
 gb|EES11070.1| hypothetical protein SORBIDRAFT_06g021580 [Sorghum bicolor]
Length=529

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTR +F NL  +++IR+  R++P+ LLFLVP  D N+++LP EML   +  ++ K  + 
Sbjct  422  NVTRMEFSNLWIIVLIRNTSRLVPLMLLFLVPDCDQNSTLLPAEMLHGNESTETTKNGSN  481

Query  615  EMAALIN  595
            + + L+ 
Sbjct  482  QFSILVG  488



>ref|XP_009359096.1| PREDICTED: probable folate-biopterin transporter 2 [Pyrus x bretschneideri]
Length=498

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRT+FDNL   I+IR+LLR+ P+ LLFLVP SD  ++ILPTE+L TK+  ++ +T+N+
Sbjct  427  KVTRTKFDNLWLAILIRNLLRLTPLFLLFLVPKSDARSAILPTEILNTKEDIETTETENI  486

Query  615  EMAALINPVD  586
            E+ +L+  VD
Sbjct  487  ELVSLVKRVD  496



>dbj|BAK01020.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=528

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGE  640
            +VTRT+F NL   ++ R+ +R+LP+  LFLVP SD N++ILP EML    G 
Sbjct  434  SVTRTEFGNLWMAVLARNAMRLLPLAFLFLVPRSDQNSTILPAEMLLADGGS  485



>ref|XP_009359139.1| PREDICTED: probable folate-biopterin transporter 2 [Pyrus x bretschneideri]
Length=498

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
             VTRT+FDNL   I+IR+LLR+ P+ LLFLVP SD  ++ILPTE+L TK+  ++ +T+N+
Sbjct  427  KVTRTKFDNLWLAILIRNLLRLTPLFLLFLVPKSDARSAILPTEILNTKEDIETTETENI  486

Query  615  EMAALINPVD  586
            E+ +L+  VD
Sbjct  487  ELVSLVKRVD  496



>ref|XP_008669213.1| PREDICTED: probable folate-biopterin transporter 2 [Zea mays]
Length=404

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTR +F NL   ++IR++ R +P+ LLFLVP  D N+++LP EML   +  ++ +  + 
Sbjct  297  NVTRLEFSNLWIAVLIRNISRFVPLMLLFLVPDCDQNSALLPAEMLHGSESTETMEKGSN  356

Query  615  EMAALIN  595
            E + L+ 
Sbjct  357  EFSVLVG  363



>tpg|DAA37101.1| TPA: hypothetical protein ZEAMMB73_089511 [Zea mays]
Length=633

 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTR +F NL   ++IR++ R +P+ LLFLVP  D N+++LP EML   +  ++ +  + 
Sbjct  526  NVTRLEFSNLWIAVLIRNISRFVPLMLLFLVPDCDQNSALLPAEMLHGSESTETMEKGSN  585

Query  615  EMAALIN  595
            E + L+ 
Sbjct  586  EFSVLVG  592



>ref|XP_010929183.1| PREDICTED: probable folate-biopterin transporter 2 [Elaeis guineensis]
Length=512

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 47/69 (68%), Gaps = 2/69 (3%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDS--AKTD  622
             VTR +F NL   +++R+++R LP+ LL LVP SD +++ILP +ML      ++  A+ D
Sbjct  442  KVTRAEFSNLWVAVLVRNIMRALPLALLCLVPKSDLSSTILPADMLTGNHELEAHEAEVD  501

Query  621  NMEMAALIN  595
            ++E+ +L++
Sbjct  502  DIELVSLVD  510



>ref|XP_006845395.2| PREDICTED: probable folate-biopterin transporter 2 isoform X1 
[Amborella trichopoda]
Length=477

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEML  658
             VTRT+F NL   I+IR+L+R LP+ LLFL+P++D N+++LP ++L
Sbjct  408  KVTRTEFGNLWAAILIRNLMRFLPLALLFLIPNADQNSTLLPMDLL  453



>ref|XP_011623772.1| PREDICTED: probable folate-biopterin transporter 2 isoform X2 
[Amborella trichopoda]
Length=474

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEML  658
             VTRT+F NL   I+IR+L+R LP+ LLFL+P++D N+++LP ++L
Sbjct  405  KVTRTEFGNLWAAILIRNLMRFLPLALLFLIPNADQNSTLLPMDLL  450



>gb|ERN07070.1| hypothetical protein AMTR_s00019p00060350 [Amborella trichopoda]
Length=471

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEML  658
             VTRT+F NL   I+IR+L+R LP+ LLFL+P++D N+++LP ++L
Sbjct  402  KVTRTEFGNLWAAILIRNLMRFLPLALLFLIPNADQNSTLLPMDLL  447



>gb|EYU22001.1| hypothetical protein MIMGU_mgv1a005007mg [Erythranthe guttata]
Length=501

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTK  649
             VTRT+F NL   +++R+LLR+ P+ LLFLVP  DPN++IL  E+L  K
Sbjct  427  KVTRTEFGNLWVAVLVRNLLRISPLFLLFLVPKGDPNSAILSDEVLNLK  475



>ref|XP_010541554.1| PREDICTED: probable folate-biopterin transporter 2 [Tarenaya 
hassleriana]
Length=499

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 5/76 (7%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEM-----LPTKKGEDSA  631
            NV+RT+F NL   +++R++ RVLP+  LFLVP  D N+  LP E+        ++G +  
Sbjct  423  NVSRTEFGNLWLAVLVRNVSRVLPLCFLFLVPKGDQNSFRLPPEVSLLGQEEDEEGGEKG  482

Query  630  KTDNMEMAALINPVDQ  583
             T +ME+A+LI+P+D 
Sbjct  483  GTKSMELASLIHPLDS  498



>ref|XP_011081396.1| PREDICTED: probable folate-biopterin transporter 6 [Sesamum indicum]
Length=522

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            NVTRT F NL   ++IR++LR+  +GL+FLVP++DP+  ++P ++L    G++  + +++
Sbjct  452  NVTRTDFKNLWLSVLIRNILRLSTLGLVFLVPNADPSEVLIPPDVLTKNNGKNMDEEESI  511

Query  615  EMAAL  601
            +M  L
Sbjct  512  QMVPL  516



>ref|XP_006289494.1| hypothetical protein CARUB_v10003028mg [Capsella rubella]
 gb|EOA22392.1| hypothetical protein CARUB_v10003028mg [Capsella rubella]
Length=499

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 48/74 (65%), Gaps = 3/74 (4%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLP---TKKGEDSAKT  625
             VTRT+F NL   +++R+++R+LP+  LFLVP  D N   LP E++     ++ ++   T
Sbjct  425  KVTRTEFSNLWLSVLVRNVMRLLPLCFLFLVPKGDQNTFKLPDEIMGEDSEEEEDEKEGT  484

Query  624  DNMEMAALINPVDQ  583
             N+E+A+L+  VD+
Sbjct  485  RNLELASLVQSVDR  498



>gb|KJB55110.1| hypothetical protein B456_009G063700 [Gossypium raimondii]
Length=519

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKK  646
            +VTRT F NL  VI+IR++LR+  +GL+FLVP +DP+ +++P ++L T  
Sbjct  445  HVTRTDFTNLWLVILIRNILRIATLGLIFLVPKADPSDALIPQDILMTHS  494



>ref|XP_008789895.1| PREDICTED: probable folate-biopterin transporter 2 isoform X1 
[Phoenix dactylifera]
Length=499

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDS--AKTD  622
             V+R++F NL   I+IRSLLRV+P+ LL+LVP S+ ++ ILP  +       ++  A  D
Sbjct  429  KVSRSEFSNLWVAILIRSLLRVVPLALLYLVPKSNQHSVILPAYVFMKNGVSEAVEAGGD  488

Query  621  NMEMAAL  601
            ++E A+L
Sbjct  489  DVERASL  495



>ref|XP_008789896.1| PREDICTED: probable folate-biopterin transporter 2 isoform X2 
[Phoenix dactylifera]
Length=499

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDS--AKTD  622
             V+R++F NL   I+IRSLLRV+P+ LL+LVP S+ ++ ILP  +       ++  A  D
Sbjct  429  KVSRSEFSNLWVAILIRSLLRVVPLALLYLVPKSNQHSVILPAYVFMKNGVSEAVEAGGD  488

Query  621  NMEMAAL  601
            ++E A+L
Sbjct  489  DVERASL  495



>ref|XP_006483723.1| PREDICTED: probable folate-biopterin transporter 6-like [Citrus 
sinensis]
Length=511

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            +VTRT F NL  VI+IR++LR+  +GL+FLVP +D +  ++P ++L  +K  D++  D  
Sbjct  440  HVTRTDFTNLWLVILIRNILRLATLGLIFLVPKADQSDELIPVDLL--RKNSDTSTDDEG  497

Query  615  EMAALINPVDQ  583
                 IN  +Q
Sbjct  498  LQLVTINEKNQ  508



>gb|KDO67414.1| hypothetical protein CISIN_1g037870mg [Citrus sinensis]
Length=511

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            +VTRT F NL  VI+IR++LR+  +GL+FLVP +D +  ++P ++L  +K  D++  D  
Sbjct  440  HVTRTDFTNLWLVILIRNVLRLATLGLIFLVPKADQSDELIPVDLL--RKNSDTSTDDEG  497

Query  615  EMAALINPVDQ  583
                 IN  +Q
Sbjct  498  LQLVTINEKNQ  508



>ref|XP_006450268.1| hypothetical protein CICLE_v10010366mg [Citrus clementina]
 gb|ESR63508.1| hypothetical protein CICLE_v10010366mg [Citrus clementina]
Length=511

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            +VTRT F NL  VI+IR++LR+  +GL+FLVP +D +  ++P ++L  +K  D++  D  
Sbjct  440  HVTRTDFTNLWLVILIRNVLRLATLGLIFLVPKADQSDELIPVDLL--RKNSDTSTDDEG  497

Query  615  EMAALINPVDQ  583
                 IN  +Q
Sbjct  498  LQLVTINEKNQ  508



>ref|XP_002308712.2| hypothetical protein POPTR_0006s28130g [Populus trichocarpa]
 gb|EEE92235.2| hypothetical protein POPTR_0006s28130g [Populus trichocarpa]
Length=479

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 5/72 (7%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            +VTRT F NL  VI+IR+ LR   +GL+FLVP  D   S++P+++L T     S   D +
Sbjct  402  HVTRTDFTNLWLVILIRNFLRFATLGLIFLVPRGDQTDSLIPSDVL-TANSAASLDDDGL  460

Query  615  EMAALINPVDQT  580
            E+     PV +T
Sbjct  461  ELV----PVKET  468



>gb|AFW85534.1| hypothetical protein ZEAMMB73_468561 [Zea mays]
Length=267

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -3

Query  792  VTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNME  613
            +TRT+F NL   I+IR+++R+LP+ LLFLVP SDPN+++LP+++L     +++ + +N+E
Sbjct  175  ITRTEFKNLWAAILIRNMMRLLPLALLFLVPRSDPNSTLLPSDLLNEGDDDEAQRVENVE  234

Query  612  MAAL  601
            + +L
Sbjct  235  LTSL  238



>ref|XP_011031432.1| PREDICTED: probable folate-biopterin transporter 6 isoform X2 
[Populus euphratica]
Length=515

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 5/72 (7%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            +VTRT F NL  VI+IR+ LR   +GL+FLVP  D   S++P+++L T     S   D +
Sbjct  438  HVTRTDFTNLWLVILIRNFLRFATLGLIFLVPRGDQADSLIPSDIL-TANSAASLDDDGL  496

Query  615  EMAALINPVDQT  580
            E+     PV +T
Sbjct  497  ELV----PVKET  504



>ref|XP_011031431.1| PREDICTED: probable folate-biopterin transporter 6 isoform X1 
[Populus euphratica]
Length=515

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 5/72 (7%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            +VTRT F NL  VI+IR+ LR   +GL+FLVP  D   S++P+++L T     S   D +
Sbjct  438  HVTRTDFTNLWLVILIRNFLRFATLGLIFLVPRGDQADSLIPSDIL-TANSAASLDDDGL  496

Query  615  EMAALINPVDQT  580
            E+     PV +T
Sbjct  497  ELV----PVKET  504



>ref|NP_001169377.1| uncharacterized protein LOC100383245 [Zea mays]
 gb|ACN33572.1| unknown [Zea mays]
Length=371

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -3

Query  792  VTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNME  613
            +TRT+F NL   I+IR+++R+LP+ LLFLVP SDPN+++LP+++L     +++ + +N+E
Sbjct  279  ITRTEFKNLWAAILIRNMMRLLPLALLFLVPRSDPNSTLLPSDLLNEGDDDEAQRVENVE  338

Query  612  MAAL  601
            + +L
Sbjct  339  LTSL  342



>ref|XP_002437984.1| hypothetical protein SORBIDRAFT_10g005900 [Sorghum bicolor]
 gb|EER89351.1| hypothetical protein SORBIDRAFT_10g005900 [Sorghum bicolor]
Length=543

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -3

Query  792  VTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNME  613
            +TRT+F NL   I+IR+++R+LP+ LLFLVP SDPN+++LP+++L     +++ + +N+E
Sbjct  443  ITRTEFKNLWAAILIRNIMRLLPLALLFLVPRSDPNSTLLPSDLLNEADDDEAQRVENVE  502

Query  612  MAAL  601
            + +L
Sbjct  503  LTSL  506



>ref|XP_010927961.1| PREDICTED: probable folate-biopterin transporter 2 [Elaeis guineensis]
Length=499

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEML  658
             V+R++F NL   I+IRSLLRV+P+ LL+LVP S+ ++ ILP ++ 
Sbjct  429  KVSRSEFSNLWVAILIRSLLRVVPLALLYLVPKSNQHSIILPVDVF  474



>ref|XP_010421353.1| PREDICTED: probable folate-biopterin transporter 2 [Camelina 
sativa]
Length=500

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 47/74 (64%), Gaps = 3/74 (4%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLP---TKKGEDSAKT  625
             VTR +F NL   +++R+++R+ P+  LFLVP  D N   LP E++     ++ ++   T
Sbjct  426  KVTRNEFGNLWLAVLVRNVMRLSPLCFLFLVPKGDQNTFKLPDEIMGEDSEEEEDEKEGT  485

Query  624  DNMEMAALINPVDQ  583
             N+E+A+L++ VD+
Sbjct  486  RNLELASLVHSVDR  499



>ref|XP_002324339.2| hypothetical protein POPTR_0018s02720g [Populus trichocarpa]
 gb|EEF02904.2| hypothetical protein POPTR_0018s02720g [Populus trichocarpa]
Length=519

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 42/72 (58%), Gaps = 5/72 (7%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            +VTRT F NL   I+IR+ LR   IGL+FLVP  D    ++P ++L T   + S   D +
Sbjct  436  HVTRTDFTNLWLAILIRNFLRFATIGLIFLVPKGDQEDDLIPPDIL-TANSDASLDDDGL  494

Query  615  EMAALINPVDQT  580
            E+A    PV +T
Sbjct  495  ELA----PVKET  502



>ref|XP_004964643.1| PREDICTED: probable folate-biopterin transporter 2-like [Setaria 
italica]
Length=539

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -3

Query  792  VTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNME  613
            +TRT+F NL   I+IR+++R+LP+ LLFLVPSSDPN+++LP+++L      +  + +N+E
Sbjct  439  ITRTEFKNLWAAIMIRNVMRLLPLALLFLVPSSDPNSALLPSDLLNEDDDGEGHQMENIE  498

Query  612  MAAL  601
            + +L
Sbjct  499  LTSL  502



>gb|EPS69234.1| hypothetical protein M569_05531, partial [Genlisea aurea]
Length=484

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEML  658
            +VTRT+F  L   ++IR+++R+ P+ LLFLVP +DPNA++LP  ++
Sbjct  406  SVTRTRFGRLWVGVLIRNVMRIAPLFLLFLVPRTDPNAALLPDSVM  451



>ref|XP_010454828.1| PREDICTED: probable folate-biopterin transporter 2 [Camelina 
sativa]
Length=501

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 4/75 (5%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSA----K  628
             VTR +F NL   +++R+++R+ P+  LFLVP  D N   LP E++     E+       
Sbjct  426  KVTRNEFGNLWLAVLVRNVMRLSPLCFLFLVPKGDQNTFKLPDEIMGEDSSEEEEDEKDG  485

Query  627  TDNMEMAALINPVDQ  583
            T N+E+A+L++ VD+
Sbjct  486  TRNLELASLVHSVDR  500



>ref|XP_010495476.1| PREDICTED: probable folate-biopterin transporter 2 [Camelina 
sativa]
Length=725

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 4/75 (5%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAK----  628
             VTR +F NL   +++R+++R+ P+  LFLVP  D N   LP E++     E+       
Sbjct  650  KVTRNEFGNLWLAVLVRNVMRLSPLCFLFLVPKGDQNTFKLPDEIMGEDSSEEEEDEKDG  709

Query  627  TDNMEMAALINPVDQ  583
            T N+E+A+L++ VD+
Sbjct  710  TRNLELASLVHSVDR  724



>ref|XP_008348559.1| PREDICTED: LOW QUALITY PROTEIN: probable folate-biopterin transporter 
3 [Malus domestica]
Length=514

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVP  700
            N+TRTQF+N+   I+IRSLLR++PI LLFL+P
Sbjct  367  NITRTQFENIWMAILIRSLLRIVPIALLFLIP  398



>gb|KFK27767.1| hypothetical protein AALP_AA8G426300 [Arabis alpina]
Length=499

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTD--  622
             VTRT F NL   ++IR+++RV P+ +LFL+P  D N   LP E++     E+  + +  
Sbjct  425  KVTRTDFGNLWLAVLIRNVMRVSPLCVLFLLPKGDQNTFKLPDEIMGEDSDEEEDEKEDN  484

Query  621  -NMEMAALINPVDQ  583
             N+E+A+L+  VD+
Sbjct  485  RNLELASLVQSVDR  498



>gb|EEC80148.1| hypothetical protein OsI_21953 [Oryza sativa Indica Group]
Length=601

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDSAKTDNM  616
            N+TRT+F NL   I+IR+ +R+LP+ LLFLVP SD N+++LP ++LP   G    + DN+
Sbjct  503  NITRTEFKNLWAAILIRNAMRLLPLALLFLVPRSDQNSNLLPADLLPEDDGAQY-QVDNV  561

Query  615  EMAAL  601
            E+ +L
Sbjct  562  ELTSL  566



>ref|XP_006289087.1| hypothetical protein CARUB_v10002493mg [Capsella rubella]
 gb|EOA21985.1| hypothetical protein CARUB_v10002493mg [Capsella rubella]
Length=482

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGED  637
             VTR +F NL  VI+IR++LR++ +  +FLVP SD    ++P+++LP  + ED
Sbjct  422  GVTRHEFGNLWLVILIRNILRLVTVCFVFLVPDSDHLDDLVPSDVLPKNESED  474



>ref|XP_009125269.1| PREDICTED: probable folate-biopterin transporter 6 [Brassica 
rapa]
 ref|XP_009125270.1| PREDICTED: probable folate-biopterin transporter 6 [Brassica 
rapa]
Length=497

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGEDS  634
             VTR +F NL  VI++R+++R   +  +FLVP SD    ++P+EMLP  + ED+
Sbjct  435  GVTRHEFGNLWLVILLRNVMRFATLCFVFLVPDSDHLDDLVPSEMLPKNQSEDA  488



>ref|XP_002873479.1| integral membrane transporter family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH49738.1| integral membrane transporter family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=502

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  795  NVTRTQFDNLGTVIVIRSLLRVLPIGLLFLVPSSDPNASILPTEMLPTKKGE  640
             VTR  F NL  VI+IR+LLR++ +  +FLVP SD    ++P+++LP K+ E
Sbjct  440  GVTRHDFGNLWLVILIRNLLRLVTVCFVFLVPDSDHLDDLVPSDVLPKKQSE  491



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1641823912876