BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6623

Length=651
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006354348.1|  PREDICTED: probable receptor-like protein ki...    218   5e-65   Solanum tuberosum [potatoes]
ref|XP_006354344.1|  PREDICTED: probable receptor-like protein ki...    218   8e-65   Solanum tuberosum [potatoes]
ref|XP_006354346.1|  PREDICTED: probable receptor-like protein ki...    216   4e-64   Solanum tuberosum [potatoes]
ref|XP_004246645.1|  PREDICTED: probable receptor-like protein ki...    212   2e-62   Solanum lycopersicum
ref|XP_010325981.1|  PREDICTED: probable receptor-like protein ki...    210   8e-62   Solanum lycopersicum
ref|XP_009605410.1|  PREDICTED: probable receptor-like protein ki...    200   7e-58   Nicotiana tomentosiformis
ref|XP_009605411.1|  PREDICTED: probable receptor-like protein ki...    198   4e-57   
ref|XP_009764510.1|  PREDICTED: probable receptor-like protein ki...    196   2e-56   Nicotiana sylvestris
ref|XP_011094636.1|  PREDICTED: probable receptor-like protein ki...    196   2e-56   
ref|XP_009764511.1|  PREDICTED: probable receptor-like protein ki...    194   8e-56   Nicotiana sylvestris
gb|EYU34469.1|  hypothetical protein MIMGU_mgv1a006457mg                195   8e-56   Erythranthe guttata [common monkey flower]
gb|EYU34470.1|  hypothetical protein MIMGU_mgv1a006457mg                195   9e-56   Erythranthe guttata [common monkey flower]
ref|XP_011094637.1|  PREDICTED: probable receptor-like protein ki...    194   1e-55   Sesamum indicum [beniseed]
emb|CBI31433.3|  unnamed protein product                                184   5e-53   Vitis vinifera
ref|XP_010658387.1|  PREDICTED: probable receptor-like protein ki...    183   2e-51   Vitis vinifera
ref|XP_007205192.1|  hypothetical protein PRUPE_ppa005670mg             176   2e-48   Prunus persica
ref|XP_008243964.1|  PREDICTED: probable receptor-like protein ki...    176   2e-48   Prunus mume [ume]
ref|XP_006428740.1|  hypothetical protein CICLE_v10011770mg             173   9e-48   
ref|XP_007009900.1|  Receptor-like protein kinase                       173   1e-47   
ref|XP_006481482.1|  PREDICTED: probable receptor-like protein ki...    173   1e-47   Citrus sinensis [apfelsine]
ref|XP_008359647.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    167   2e-47   
gb|KDO48065.1|  hypothetical protein CISIN_1g014245mg                   172   3e-47   Citrus sinensis [apfelsine]
ref|XP_004304448.1|  PREDICTED: probable receptor-like protein ki...    172   3e-47   Fragaria vesca subsp. vesca
ref|XP_010653601.1|  PREDICTED: probable receptor-like protein ki...    171   4e-47   Vitis vinifera
ref|XP_012082392.1|  PREDICTED: probable receptor-like protein ki...    171   4e-47   Jatropha curcas
emb|CBI32759.3|  unnamed protein product                                172   7e-47   Vitis vinifera
ref|XP_009350770.1|  PREDICTED: probable receptor-like protein ki...    171   1e-46   Pyrus x bretschneideri [bai li]
ref|XP_009376804.1|  PREDICTED: probable receptor-like protein ki...    168   1e-45   Pyrus x bretschneideri [bai li]
ref|XP_011018721.1|  PREDICTED: probable receptor-like protein ki...    168   1e-45   Populus euphratica
gb|KJB36568.1|  hypothetical protein B456_006G165500                    166   3e-45   Gossypium raimondii
gb|KJB73529.1|  hypothetical protein B456_011G238100                    167   3e-45   Gossypium raimondii
ref|XP_011018722.1|  PREDICTED: probable receptor-like protein ki...    166   4e-45   Populus euphratica
ref|XP_010253943.1|  PREDICTED: probable receptor-like protein ki...    166   6e-45   Nelumbo nucifera [Indian lotus]
gb|KHG18706.1|  hypothetical protein F383_01912                         166   6e-45   Gossypium arboreum [tree cotton]
ref|XP_006381430.1|  kinase family protein                              165   1e-44   
gb|KDO48066.1|  hypothetical protein CISIN_1g014245mg                   164   2e-44   Citrus sinensis [apfelsine]
ref|XP_007027372.1|  Kinase superfamily protein                         164   3e-44   Theobroma cacao [chocolate]
ref|XP_010107509.1|  putative receptor-like protein kinase              163   5e-44   Morus notabilis
ref|XP_010241858.1|  PREDICTED: probable receptor-like protein ki...    163   6e-44   Nelumbo nucifera [Indian lotus]
ref|XP_010543404.1|  PREDICTED: probable receptor-like protein ki...    162   2e-43   Tarenaya hassleriana [spider flower]
ref|XP_006593326.1|  PREDICTED: protein kinase isoform X1               162   3e-43   Glycine max [soybeans]
ref|XP_010035962.1|  PREDICTED: probable receptor-like protein ki...    159   1e-42   Eucalyptus grandis [rose gum]
ref|XP_010935734.1|  PREDICTED: probable receptor-like protein ki...    159   2e-42   
ref|XP_006407633.1|  hypothetical protein EUTSA_v10020792mg             159   2e-42   Eutrema salsugineum [saltwater cress]
gb|KJB62395.1|  hypothetical protein B456_009G415600                    159   3e-42   Gossypium raimondii
gb|KJB62396.1|  hypothetical protein B456_009G415600                    159   4e-42   Gossypium raimondii
ref|XP_010935733.1|  PREDICTED: probable receptor-like protein ki...    159   4e-42   Elaeis guineensis
ref|XP_006827432.1|  PREDICTED: probable receptor-like protein ki...    158   4e-42   Amborella trichopoda
gb|KJB62397.1|  hypothetical protein B456_009G415600                    159   4e-42   Gossypium raimondii
ref|XP_002530935.1|  Protein kinase APK1B, chloroplast precursor,...    157   1e-41   
ref|XP_011041041.1|  PREDICTED: probable receptor-like protein ki...    156   3e-41   Populus euphratica
gb|KJB60555.1|  hypothetical protein B456_009G312200                    155   4e-41   Gossypium raimondii
gb|KJB60556.1|  hypothetical protein B456_009G312200                    155   4e-41   Gossypium raimondii
ref|XP_007144362.1|  hypothetical protein PHAVU_007G149900g             155   7e-41   Phaseolus vulgaris [French bean]
ref|NP_001235402.1|  protein kinase                                     155   8e-41   Glycine max [soybeans]
gb|KDO46223.1|  hypothetical protein CISIN_1g013504mg                   155   9e-41   Citrus sinensis [apfelsine]
ref|XP_003625670.1|  Protein kinase                                     154   1e-40   Medicago truncatula
ref|XP_006648129.1|  PREDICTED: probable receptor-like protein ki...    154   1e-40   Oryza brachyantha
gb|KEH24024.1|  kinase 1B                                               154   1e-40   Medicago truncatula
ref|XP_003521400.1|  PREDICTED: probable receptor-like protein ki...    154   1e-40   Glycine max [soybeans]
ref|XP_009386349.1|  PREDICTED: probable receptor-like protein ki...    154   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH24025.1|  kinase 1B                                               154   1e-40   Medicago truncatula
gb|KHG26991.1|  hypothetical protein F383_05198                         153   2e-40   Gossypium arboreum [tree cotton]
ref|XP_009146895.1|  PREDICTED: probable receptor-like protein ki...    153   3e-40   
gb|EYU39624.1|  hypothetical protein MIMGU_mgv1a007133mg                153   3e-40   Erythranthe guttata [common monkey flower]
ref|XP_002519512.1|  Protein kinase APK1A, chloroplast precursor,...    153   4e-40   
ref|XP_004497523.1|  PREDICTED: probable receptor-like protein ki...    153   5e-40   
ref|NP_001048536.1|  Os02g0819600                                       152   5e-40   
ref|XP_006436456.1|  hypothetical protein CICLE_v10031608mg             152   5e-40   Citrus clementina [clementine]
ref|XP_002454791.1|  hypothetical protein SORBIDRAFT_04g037460          152   5e-40   Sorghum bicolor [broomcorn]
ref|XP_006485632.1|  PREDICTED: probable receptor-like protein ki...    152   6e-40   Citrus sinensis [apfelsine]
ref|XP_002882639.1|  hypothetical protein ARALYDRAFT_478307             152   6e-40   
ref|XP_008776800.1|  PREDICTED: probable receptor-like protein ki...    152   6e-40   Phoenix dactylifera
gb|EEC74260.1|  hypothetical protein OsI_09473                          152   6e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_004493982.1|  PREDICTED: probable receptor-like protein ki...    152   6e-40   Cicer arietinum [garbanzo]
ref|XP_004493981.1|  PREDICTED: probable receptor-like protein ki...    152   6e-40   Cicer arietinum [garbanzo]
ref|XP_004497524.1|  PREDICTED: probable receptor-like protein ki...    152   7e-40   Cicer arietinum [garbanzo]
gb|ACG27469.1|  protein kinase APK1A                                    152   1e-39   Zea mays [maize]
ref|XP_003554386.1|  PREDICTED: probable receptor-like protein ki...    151   1e-39   Glycine max [soybeans]
ref|XP_006604577.1|  PREDICTED: probable receptor-like protein ki...    151   2e-39   Glycine max [soybeans]
ref|XP_008643528.1|  PREDICTED: uncharacterized LOC100280259 isof...    150   2e-39   Zea mays [maize]
ref|XP_010464638.1|  PREDICTED: probable receptor-like protein ki...    150   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010477459.1|  PREDICTED: probable receptor-like protein ki...    150   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_011031713.1|  PREDICTED: probable receptor-like protein ki...    150   3e-39   Populus euphratica
ref|NP_001146659.1|  uncharacterized LOC100280259                       150   3e-39   Zea mays [maize]
ref|XP_004954409.1|  PREDICTED: probable receptor-like protein ki...    150   3e-39   Setaria italica
ref|XP_007162763.1|  hypothetical protein PHAVU_001G178400g             150   4e-39   Phaseolus vulgaris [French bean]
emb|CDO99768.1|  unnamed protein product                                150   5e-39   Coffea canephora [robusta coffee]
ref|XP_002315317.2|  hypothetical protein POPTR_0010s23220g             150   5e-39   
ref|XP_011031711.1|  PREDICTED: probable receptor-like protein ki...    150   6e-39   Populus euphratica
gb|ACJ85098.1|  unknown                                                 149   6e-39   Medicago truncatula
gb|KEH42211.1|  kinase 1B                                               149   1e-38   Medicago truncatula
ref|XP_006297732.1|  hypothetical protein CARUB_v10013766mg             148   2e-38   Capsella rubella
ref|XP_009123163.1|  PREDICTED: probable receptor-like protein ki...    148   2e-38   Brassica rapa
ref|XP_003590458.1|  Protein kinase 2A                                  148   2e-38   Medicago truncatula
ref|XP_010684093.1|  PREDICTED: probable receptor-like protein ki...    148   2e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008778999.1|  PREDICTED: probable receptor-like protein ki...    148   2e-38   Phoenix dactylifera
ref|XP_008233294.1|  PREDICTED: probable receptor-like protein ki...    148   3e-38   Prunus mume [ume]
ref|XP_007218041.1|  hypothetical protein PRUPE_ppa006060mg             148   3e-38   Prunus persica
ref|XP_011077249.1|  PREDICTED: probable receptor-like protein ki...    147   4e-38   
ref|XP_004149901.1|  PREDICTED: probable receptor-like protein ki...    146   9e-38   Cucumis sativus [cucumbers]
emb|CDY54619.1|  BnaA05g28720D                                          146   9e-38   Brassica napus [oilseed rape]
ref|NP_187594.1|  protein kinase family protein                         145   3e-37   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19927.1|  AT3G09830                                              145   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008343482.1|  PREDICTED: probable receptor-like protein ki...    144   7e-37   
ref|XP_010918690.1|  PREDICTED: probable receptor-like protein ki...    143   9e-37   
ref|XP_010235978.1|  PREDICTED: probable receptor-like protein ki...    144   9e-37   
ref|XP_010918688.1|  PREDICTED: probable receptor-like protein ki...    143   1e-36   Elaeis guineensis
ref|XP_010032169.1|  PREDICTED: probable receptor-like protein ki...    143   1e-36   Eucalyptus grandis [rose gum]
ref|XP_004307370.1|  PREDICTED: probable receptor-like protein ki...    143   2e-36   Fragaria vesca subsp. vesca
ref|XP_008365181.1|  PREDICTED: probable receptor-like protein ki...    142   3e-36   
ref|XP_008456511.1|  PREDICTED: probable receptor-like protein ki...    142   3e-36   Cucumis melo [Oriental melon]
ref|XP_009386350.1|  PREDICTED: probable receptor-like protein ki...    142   3e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384041.1|  PREDICTED: probable receptor-like protein ki...    142   5e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN48255.1|  Putative receptor-like protein kinase                   141   9e-36   Glycine soja [wild soybean]
ref|XP_008646892.1|  PREDICTED: probable receptor-like protein ki...    134   4e-35   
ref|XP_006436457.1|  hypothetical protein CICLE_v10031608mg             139   4e-35   
gb|KHN09513.1|  Putative receptor-like protein kinase                   138   5e-35   Glycine soja [wild soybean]
ref|XP_002871026.1|  hypothetical protein ARALYDRAFT_908199             139   6e-35   Arabidopsis lyrata subsp. lyrata
emb|CDY41315.1|  BnaA01g32040D                                          138   9e-35   Brassica napus [oilseed rape]
dbj|BAJ91599.1|  predicted protein                                      138   1e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001145785.1|  uncharacterized LOC100279292                       134   3e-34   Zea mays [maize]
ref|NP_195952.1|  protein kinase family protein                         137   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009397532.1|  PREDICTED: probable receptor-like protein ki...    136   4e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006398776.1|  hypothetical protein EUTSA_v10013665mg             136   5e-34   Eutrema salsugineum [saltwater cress]
ref|XP_009368900.1|  PREDICTED: probable receptor-like protein ki...    134   5e-33   Pyrus x bretschneideri [bai li]
ref|XP_008677078.1|  PREDICTED: uncharacterized LOC100279292 isof...    133   6e-33   
ref|XP_006287832.1|  hypothetical protein CARUB_v10001049mg             132   1e-32   Capsella rubella
ref|XP_009386591.1|  PREDICTED: probable receptor-like protein ki...    132   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010490808.1|  PREDICTED: probable receptor-like protein ki...    132   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010423734.1|  PREDICTED: probable receptor-like protein ki...    132   2e-32   Camelina sativa [gold-of-pleasure]
gb|EPS66606.1|  hypothetical protein M569_08171                         131   2e-32   Genlisea aurea
ref|XP_010452206.1|  PREDICTED: probable receptor-like protein ki...    131   2e-32   Camelina sativa [gold-of-pleasure]
gb|KHG19471.1|  hypothetical protein F383_26407                         131   3e-32   Gossypium arboreum [tree cotton]
dbj|BAK01480.1|  predicted protein                                      130   6e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY10387.1|  BnaCnng02880D                                          129   1e-31   Brassica napus [oilseed rape]
emb|CDY22206.1|  BnaC01g38950D                                          129   2e-31   Brassica napus [oilseed rape]
ref|XP_010112214.1|  putative receptor-like protein kinase              129   2e-31   
ref|XP_009788489.1|  PREDICTED: probable receptor-like protein ki...    129   3e-31   Nicotiana sylvestris
ref|XP_008457617.1|  PREDICTED: probable receptor-like protein ki...    128   3e-31   Cucumis melo [Oriental melon]
ref|XP_008784814.1|  PREDICTED: probable receptor-like protein ki...    128   4e-31   Phoenix dactylifera
gb|AAF43496.1|AF131222_1  protein serine/threonine kinase               128   5e-31   Thinopyrum elongatum [tall wheatgrass]
gb|KHG23255.1|  hypothetical protein F383_07036                         127   6e-31   Gossypium arboreum [tree cotton]
ref|XP_009594135.1|  PREDICTED: probable receptor-like protein ki...    127   7e-31   Nicotiana tomentosiformis
ref|XP_003560283.1|  PREDICTED: probable receptor-like protein ki...    125   3e-30   Brachypodium distachyon [annual false brome]
ref|XP_004143264.1|  PREDICTED: probable receptor-like protein ki...    125   4e-30   Cucumis sativus [cucumbers]
ref|XP_002312001.1|  kinase family protein                              125   4e-30   
emb|CDX70313.1|  BnaA10g26620D                                          125   4e-30   
gb|KGN48176.1|  hypothetical protein Csa_6G446370                       125   6e-30   Cucumis sativus [cucumbers]
ref|XP_009122715.1|  PREDICTED: probable receptor-like protein ki...    124   1e-29   Brassica rapa
ref|XP_010557951.1|  PREDICTED: probable receptor-like protein ki...    124   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_010441480.1|  PREDICTED: LOW QUALITY PROTEIN: probable dis...    126   4e-29   
gb|ABG66097.1|  Protein kinase domain containing protein, expressed     122   5e-29   Oryza sativa Japonica Group [Japonica rice]
gb|AAP53976.2|  Protein kinase domain containing protein, expressed     122   7e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008664921.1|  PREDICTED: probable serine/threonine-protein...    120   3e-28   Zea mays [maize]
ref|XP_008664920.1|  PREDICTED: probable serine/threonine-protein...    120   3e-28   Zea mays [maize]
ref|XP_006340033.1|  PREDICTED: probable receptor-like protein ki...    120   3e-28   Solanum tuberosum [potatoes]
ref|XP_008664922.1|  PREDICTED: probable serine/threonine-protein...    120   4e-28   Zea mays [maize]
ref|XP_004247375.1|  PREDICTED: probable receptor-like protein ki...    119   5e-28   Solanum lycopersicum
gb|EEC67045.1|  hypothetical protein OsI_33788                          117   5e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_010494959.1|  PREDICTED: probable disease resistance prote...    119   7e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010494957.1|  PREDICTED: probable disease resistance prote...    119   7e-27   
emb|CDY44356.1|  BnaC02g03210D                                          115   9e-27   Brassica napus [oilseed rape]
ref|XP_002464564.1|  hypothetical protein SORBIDRAFT_01g020900          116   9e-27   Sorghum bicolor [broomcorn]
ref|XP_009125492.1|  PREDICTED: probable receptor-like protein ki...    115   1e-26   Brassica rapa
emb|CDY69874.1|  BnaAnng31840D                                          115   1e-26   Brassica napus [oilseed rape]
gb|KHN39036.1|  Putative receptor-like protein kinase                   114   3e-26   Glycine soja [wild soybean]
dbj|BAK00090.1|  predicted protein                                      114   3e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90857.1|  predicted protein                                      114   3e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003573979.2|  PREDICTED: probable receptor-like protein ki...    113   6e-26   Brachypodium distachyon [annual false brome]
ref|XP_007208565.1|  hypothetical protein PRUPE_ppa023937mg             113   1e-25   Prunus persica
ref|XP_006662393.1|  PREDICTED: probable receptor-like protein ki...    112   1e-25   
ref|XP_008223696.1|  PREDICTED: probable receptor-like protein ki...    112   2e-25   Prunus mume [ume]
ref|XP_008223689.1|  PREDICTED: probable receptor-like protein ki...    112   2e-25   Prunus mume [ume]
ref|XP_004983005.1|  PREDICTED: probable receptor-like protein ki...    112   2e-25   
ref|XP_010264440.1|  PREDICTED: probable receptor-like protein ki...    111   3e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010256920.1|  PREDICTED: probable receptor-like protein ki...    110   6e-25   Nelumbo nucifera [Indian lotus]
gb|ERN07884.1|  hypothetical protein AMTR_s00012p00223410               110   7e-25   Amborella trichopoda
gb|KGN47838.1|  hypothetical protein Csa_6G406010                       109   1e-24   Cucumis sativus [cucumbers]
gb|EYU38549.1|  hypothetical protein MIMGU_mgv1a022350mg                108   2e-24   Erythranthe guttata [common monkey flower]
ref|XP_002283598.1|  PREDICTED: probable receptor-like protein ki...    109   2e-24   Vitis vinifera
ref|XP_009141782.1|  PREDICTED: probable serine/threonine-protein...    109   2e-24   
ref|XP_009143340.1|  PREDICTED: probable receptor-like protein ki...    107   8e-24   
emb|CDY18353.1|  BnaA04g22340D                                          107   1e-23   Brassica napus [oilseed rape]
emb|CDX93286.1|  BnaC04g46100D                                          107   1e-23   
ref|XP_002313435.2|  hypothetical protein POPTR_0009s03680g             105   3e-23   
ref|XP_010264439.1|  PREDICTED: probable receptor-like protein ki...    105   4e-23   Nelumbo nucifera [Indian lotus]
ref|XP_011042708.1|  PREDICTED: probable receptor-like protein ki...    105   7e-23   Populus euphratica
ref|XP_009364394.1|  PREDICTED: probable receptor-like protein ki...    105   7e-23   Pyrus x bretschneideri [bai li]
ref|XP_004294512.2|  PREDICTED: probable receptor-like protein ki...    104   1e-22   Fragaria vesca subsp. vesca
ref|XP_008357170.1|  PREDICTED: probable receptor-like protein ki...    103   2e-22   Malus domestica [apple tree]
ref|XP_002969082.1|  hypothetical protein SELMODRAFT_170305             103   3e-22   Selaginella moellendorffii
ref|XP_008779202.1|  PREDICTED: probable receptor-like protein ki...    103   4e-22   Phoenix dactylifera
emb|CDP09392.1|  unnamed protein product                                102   5e-22   Coffea canephora [robusta coffee]
ref|XP_011093490.1|  PREDICTED: probable receptor-like protein ki...    102   7e-22   Sesamum indicum [beniseed]
ref|XP_002973981.1|  hypothetical protein SELMODRAFT_173964             101   1e-21   
ref|XP_002298354.2|  hypothetical protein POPTR_0001s24730g             101   1e-21   Populus trichocarpa [western balsam poplar]
gb|EPS66576.1|  hypothetical protein M569_08202                       99.8    3e-21   Genlisea aurea
ref|XP_010931273.1|  PREDICTED: probable receptor-like protein ki...    100   3e-21   Elaeis guineensis
ref|XP_009388614.1|  PREDICTED: probable receptor-like protein ki...    100   4e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004505859.1|  PREDICTED: probable receptor-like protein ki...  99.4    7e-21   Cicer arietinum [garbanzo]
ref|XP_009759488.1|  PREDICTED: probable receptor-like protein ki...  99.4    7e-21   Nicotiana sylvestris
ref|XP_009594763.1|  PREDICTED: probable receptor-like protein ki...  99.4    8e-21   Nicotiana tomentosiformis
ref|XP_011035308.1|  PREDICTED: probable receptor-like protein ki...  99.4    8e-21   Populus euphratica
gb|KHG03664.1|  hypothetical protein F383_05225                       96.7    9e-21   Gossypium arboreum [tree cotton]
ref|XP_008464123.1|  PREDICTED: probable receptor-like protein ki...  99.0    1e-20   Cucumis melo [Oriental melon]
ref|XP_004240362.1|  PREDICTED: probable receptor-like protein ki...  99.0    1e-20   Solanum lycopersicum
gb|KJB83775.1|  hypothetical protein B456_013G263500                  99.0    2e-20   Gossypium raimondii
ref|XP_004229716.1|  PREDICTED: probable receptor-like protein ki...  97.4    3e-20   Solanum lycopersicum
ref|XP_012083746.1|  PREDICTED: probable receptor-like protein ki...  97.4    3e-20   Jatropha curcas
ref|XP_011085500.1|  PREDICTED: probable receptor-like protein ki...  97.4    4e-20   Sesamum indicum [beniseed]
ref|XP_004143119.1|  PREDICTED: probable receptor-like protein ki...  97.4    4e-20   Cucumis sativus [cucumbers]
ref|XP_006424839.1|  hypothetical protein CICLE_v10028420mg           97.4    5e-20   Citrus clementina [clementine]
gb|KDO72842.1|  hypothetical protein CISIN_1g043568mg                 97.1    5e-20   Citrus sinensis [apfelsine]
ref|XP_010274546.1|  PREDICTED: probable receptor-like protein ki...  96.7    5e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010941253.1|  PREDICTED: probable receptor-like protein ki...  95.9    8e-20   Elaeis guineensis
ref|XP_004245841.1|  PREDICTED: probable receptor-like protein ki...  95.9    9e-20   Solanum lycopersicum
gb|KHN01616.1|  Putative receptor-like protein kinase                 95.9    1e-19   Glycine soja [wild soybean]
emb|CDX74866.1|  BnaA05g06120D                                        95.9    1e-19   
ref|XP_001757199.1|  predicted protein                                94.7    2e-19   
ref|XP_006354647.1|  PREDICTED: probable receptor-like protein ki...  95.1    2e-19   
ref|XP_004133967.1|  PREDICTED: probable receptor-like protein ki...  95.1    2e-19   Cucumis sativus [cucumbers]
ref|XP_003530124.1|  PREDICTED: probable receptor-like protein ki...  95.1    2e-19   Glycine max [soybeans]
ref|XP_006354645.1|  PREDICTED: probable receptor-like protein ki...  95.1    3e-19   Solanum tuberosum [potatoes]
gb|KCW85563.1|  hypothetical protein EUGRSUZ_B02362                   94.7    3e-19   Eucalyptus grandis [rose gum]
ref|XP_004307263.1|  PREDICTED: probable receptor-like protein ki...  94.4    4e-19   Fragaria vesca subsp. vesca
ref|XP_010269868.1|  PREDICTED: probable receptor-like protein ki...  94.0    4e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010089771.1|  putative receptor-like protein kinase            94.4    4e-19   Morus notabilis
ref|XP_008799403.1|  PREDICTED: probable receptor-like protein ki...  94.0    4e-19   Phoenix dactylifera
ref|XP_009590399.1|  PREDICTED: probable receptor-like protein ki...  94.7    5e-19   Nicotiana tomentosiformis
ref|XP_010269867.1|  PREDICTED: probable receptor-like protein ki...  94.0    5e-19   Nelumbo nucifera [Indian lotus]
gb|EPS63005.1|  hypothetical protein M569_11782                       93.6    5e-19   Genlisea aurea
ref|XP_010269866.1|  PREDICTED: probable receptor-like protein ki...  94.0    5e-19   Nelumbo nucifera [Indian lotus]
ref|XP_006358625.1|  PREDICTED: probable receptor-like protein ki...  94.0    5e-19   
ref|XP_011018668.1|  PREDICTED: probable receptor-like protein ki...  93.6    5e-19   Populus euphratica
ref|XP_011089472.1|  PREDICTED: probable receptor-like protein ki...  94.4    5e-19   Sesamum indicum [beniseed]
ref|NP_973556.1|  protein kinase family protein                       94.4    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_012092541.1|  PREDICTED: probable receptor-like protein ki...  94.4    6e-19   Jatropha curcas
ref|XP_009386442.1|  PREDICTED: probable receptor-like protein ki...  93.6    6e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009590397.1|  PREDICTED: probable receptor-like protein ki...  94.4    7e-19   Nicotiana tomentosiformis
ref|XP_010269864.1|  PREDICTED: probable receptor-like protein ki...  94.0    7e-19   Nelumbo nucifera [Indian lotus]
gb|ABE01834.1|  NAK-type protein kinase                               93.6    7e-19   Nicotiana tabacum [American tobacco]
ref|XP_009619124.1|  PREDICTED: probable receptor-like protein ki...  93.6    7e-19   Nicotiana tomentosiformis
ref|XP_009795376.1|  PREDICTED: probable receptor-like protein ki...  93.2    8e-19   Nicotiana sylvestris
gb|EYU18978.1|  hypothetical protein MIMGU_mgv1a006424mg              93.6    8e-19   Erythranthe guttata [common monkey flower]
gb|KJB25423.1|  hypothetical protein B456_004G190600                  92.8    1e-18   Gossypium raimondii
gb|KJB40949.1|  hypothetical protein B456_007G084600                  93.2    1e-18   Gossypium raimondii
gb|KJB40950.1|  hypothetical protein B456_007G084600                  93.2    1e-18   Gossypium raimondii
ref|XP_006409927.1|  hypothetical protein EUTSA_v10017635mg           93.2    2e-18   Eutrema salsugineum [saltwater cress]
ref|XP_007052402.1|  Kinase superfamily protein isoform 1             92.8    2e-18   
ref|XP_010052762.1|  PREDICTED: probable receptor-like protein ki...  92.8    2e-18   Eucalyptus grandis [rose gum]
ref|XP_007132064.1|  hypothetical protein PHAVU_011G063900g           92.8    2e-18   Phaseolus vulgaris [French bean]
gb|EYU17859.1|  hypothetical protein MIMGU_mgv1a008283mg              91.7    2e-18   Erythranthe guttata [common monkey flower]
ref|XP_010521845.1|  PREDICTED: probable receptor-like protein ki...  92.8    2e-18   Tarenaya hassleriana [spider flower]
ref|XP_010043546.1|  PREDICTED: probable receptor-like protein ki...  92.4    3e-18   Eucalyptus grandis [rose gum]
ref|XP_007016401.1|  Kinase APK1B, chloroplast, putative              92.4    3e-18   
gb|KHG22470.1|  hypothetical protein F383_00842                       91.7    3e-18   Gossypium arboreum [tree cotton]
ref|XP_006398401.1|  hypothetical protein EUTSA_v10000898mg           91.7    4e-18   Eutrema salsugineum [saltwater cress]
ref|XP_010919813.1|  PREDICTED: probable receptor-like protein ki...  91.3    4e-18   
ref|XP_011045606.1|  PREDICTED: probable receptor-like protein ki...  91.7    4e-18   Populus euphratica
ref|XP_002526490.1|  ATP binding protein, putative                    91.7    5e-18   
ref|XP_003539672.1|  PREDICTED: probable receptor-like protein ki...  91.7    5e-18   Glycine max [soybeans]
ref|XP_009418710.1|  PREDICTED: probable receptor-like protein ki...  90.5    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011032714.1|  PREDICTED: probable receptor-like protein ki...  91.3    5e-18   Populus euphratica
ref|XP_007039635.1|  Receptor protein kinase isoform 1                90.9    5e-18   
ref|XP_001767988.1|  predicted protein                                89.7    6e-18   
ref|XP_006385387.1|  kinase family protein                            90.5    6e-18   Populus trichocarpa [western balsam poplar]
ref|XP_011070252.1|  PREDICTED: probable receptor-like protein ki...  90.9    6e-18   Sesamum indicum [beniseed]
ref|XP_007209229.1|  hypothetical protein PRUPE_ppa006942mg           90.5    7e-18   Prunus persica
ref|XP_002517511.1|  Protein kinase APK1B, chloroplast precursor,...  90.1    7e-18   
ref|XP_008343868.1|  PREDICTED: probable receptor-like protein ki...  90.9    7e-18   
emb|CDX77738.1|  BnaC07g19920D                                        90.5    7e-18   
ref|XP_010919810.1|  PREDICTED: probable receptor-like protein ki...  91.3    7e-18   
ref|XP_009101450.1|  PREDICTED: probable receptor-like protein ki...  90.9    7e-18   Brassica rapa
ref|XP_011014611.1|  PREDICTED: probable receptor-like protein ki...  90.9    7e-18   Populus euphratica
ref|XP_009353658.1|  PREDICTED: probable receptor-like protein ki...  91.3    7e-18   
ref|XP_010935034.1|  PREDICTED: probable receptor-like protein ki...  90.1    9e-18   
ref|XP_011070251.1|  PREDICTED: probable receptor-like protein ki...  90.9    9e-18   Sesamum indicum [beniseed]
gb|ABU49132.1|  ser/thr protein kinase                                90.5    1e-17   Malus domestica [apple tree]
ref|XP_002268330.1|  PREDICTED: probable receptor-like protein ki...  90.5    1e-17   
ref|XP_009398481.1|  PREDICTED: probable receptor-like protein ki...  90.1    1e-17   
gb|EEC67043.1|  hypothetical protein OsI_33785                        88.6    1e-17   
gb|KFK32248.1|  hypothetical protein AALP_AA6G217300                  90.5    1e-17   
ref|XP_008229495.1|  PREDICTED: probable receptor-like protein ki...  89.7    1e-17   
gb|EYU28252.1|  hypothetical protein MIMGU_mgv1a018333mg              89.4    2e-17   
gb|KJB39784.1|  hypothetical protein B456_007G030500                  89.4    2e-17   
ref|XP_001776671.1|  predicted protein                                89.0    2e-17   
ref|XP_008794867.1|  PREDICTED: probable receptor-like protein ki...  89.7    2e-17   
ref|XP_006375193.1|  hypothetical protein POPTR_0014s05160g           89.7    2e-17   
ref|XP_009376148.1|  PREDICTED: probable receptor-like protein ki...  89.7    2e-17   
gb|KJB22259.1|  hypothetical protein B456_004G038000                  89.4    2e-17   
ref|XP_009376146.1|  PREDICTED: probable receptor-like protein ki...  89.4    2e-17   
gb|KDO85426.1|  hypothetical protein CISIN_1g013790mg                 89.4    3e-17   
ref|XP_002282904.1|  PREDICTED: probable receptor-like protein ki...  89.0    3e-17   
ref|XP_008788652.1|  PREDICTED: probable receptor-like protein ki...  88.6    3e-17   
emb|CDY33513.1|  BnaA06g35600D                                        89.0    3e-17   
emb|CDY49086.1|  BnaA06g09200D                                        89.0    4e-17   
ref|XP_012075363.1|  PREDICTED: probable receptor-like protein ki...  88.2    4e-17   
ref|XP_002531439.1|  Protein kinase APK1B, chloroplast precursor,...  89.4    4e-17   
ref|XP_008232338.1|  PREDICTED: probable receptor-like protein ki...  89.0    4e-17   
ref|XP_010414462.1|  PREDICTED: probable receptor-like protein ki...  89.0    4e-17   
ref|XP_008438279.1|  PREDICTED: probable receptor-like protein ki...  88.6    4e-17   
ref|XP_009114306.1|  PREDICTED: probable receptor-like protein ki...  88.6    5e-17   
ref|XP_011031999.1|  PREDICTED: probable receptor-like protein ki...  88.2    5e-17   
gb|KEH30166.1|  receptor-like kinase                                  88.6    5e-17   
ref|XP_010510559.1|  PREDICTED: probable receptor-like protein ki...  89.0    5e-17   
ref|XP_009148734.1|  PREDICTED: protein kinase 2A, chloroplastic-...  88.6    5e-17   
gb|EMS52364.1|  Protein kinase APK1A, chloroplastic                   87.4    5e-17   
ref|XP_010470024.1|  PREDICTED: probable receptor-like protein ki...  88.6    6e-17   
ref|XP_006464387.1|  PREDICTED: probable receptor-like protein ki...  88.6    6e-17   
ref|XP_009389571.1|  PREDICTED: protein kinase 2A, chloroplastic-...  88.2    6e-17   
ref|XP_009624443.1|  PREDICTED: probable receptor-like protein ki...  88.6    6e-17   
gb|KEH31591.1|  receptor-like kinase plant                            87.8    6e-17   
ref|XP_009389572.1|  PREDICTED: protein kinase 2A, chloroplastic-...  88.2    6e-17   
ref|XP_009370938.1|  PREDICTED: probable receptor-like protein ki...  88.2    7e-17   
ref|XP_009370940.1|  PREDICTED: probable receptor-like protein ki...  88.2    7e-17   
ref|XP_008382233.1|  PREDICTED: probable receptor-like protein ki...  88.2    7e-17   
ref|XP_007134382.1|  hypothetical protein PHAVU_010G043100g           88.2    8e-17   
ref|NP_001235210.1|  protein kinase                                   88.2    9e-17   
ref|XP_007155730.1|  hypothetical protein PHAVU_003G226700g           87.0    1e-16   
ref|NP_001147668.1|  serine/threonine-protein kinase NAK              87.8    1e-16   
ref|XP_006294171.1|  hypothetical protein CARUB_v10023166mg           87.8    1e-16   
ref|XP_007218043.1|  hypothetical protein PRUPE_ppa006098mg           87.8    1e-16   
ref|XP_006445469.1|  hypothetical protein CICLE_v10020196mg           87.8    1e-16   
gb|KJB55869.1|  hypothetical protein B456_009G098900                  87.8    1e-16   
ref|XP_009391972.1|  PREDICTED: probable receptor-like protein ki...  87.0    1e-16   
gb|KHN42646.1|  Putative receptor-like protein kinase                 86.7    1e-16   
ref|NP_001238477.1|  NAK-type protein kinase                          86.7    1e-16   
ref|XP_009371856.1|  PREDICTED: probable receptor-like protein ki...  87.0    1e-16   
ref|XP_002863373.1|  hypothetical protein ARALYDRAFT_494273           87.0    1e-16   
gb|KHN19718.1|  Putative receptor-like protein kinase                 87.4    2e-16   
ref|XP_010558329.1|  PREDICTED: probable serine/threonine-protein...  86.3    2e-16   
ref|XP_003521049.1|  PREDICTED: probable receptor-like protein ki...  87.0    2e-16   
ref|XP_003578499.1|  PREDICTED: probable receptor-like protein ki...  86.7    2e-16   
emb|CAB10546.1|  NAK like protein kinase                              86.3    2e-16   
ref|XP_010558327.1|  PREDICTED: probable serine/threonine-protein...  86.3    2e-16   
ref|XP_010106486.1|  putative receptor-like protein kinase            87.0    2e-16   
ref|XP_004981243.1|  PREDICTED: protein kinase APK1B, chloroplast...  86.7    2e-16   
ref|XP_006661476.1|  PREDICTED: probable receptor-like protein ki...  87.0    2e-16   
ref|XP_003539123.1|  PREDICTED: probable receptor-like protein ki...  85.9    2e-16   
ref|XP_006411135.1|  hypothetical protein EUTSA_v10016674mg           86.7    2e-16   
emb|CDY66626.1|  BnaCnng51670D                                        86.7    2e-16   
ref|XP_010531641.1|  PREDICTED: serine/threonine-protein kinase B...  85.9    2e-16   
ref|NP_193501.2|  protein kinase family protein                       86.3    2e-16   
ref|XP_010452061.1|  PREDICTED: probable serine/threonine-protein...  86.3    3e-16   
ref|XP_002881023.1|  kinase family protein                            87.0    3e-16   
ref|XP_010558326.1|  PREDICTED: probable serine/threonine-protein...  86.3    3e-16   
ref|XP_008651383.1|  PREDICTED: LOC100280671 isoform X1               86.3    3e-16   
ref|XP_010490647.1|  PREDICTED: probable serine/threonine-protein...  86.3    3e-16   
ref|NP_001147062.1|  LOC100280671                                     86.3    3e-16   
ref|XP_010476493.1|  PREDICTED: protein kinase 2A, chloroplastic-...  84.7    3e-16   
ref|XP_004957463.1|  PREDICTED: probable receptor-like protein ki...  86.3    3e-16   
ref|XP_008343582.1|  PREDICTED: protein kinase APK1A, chloroplast...  85.9    3e-16   
gb|KJB51744.1|  hypothetical protein B456_008G230200                  85.9    3e-16   
gb|KHG28699.1|  hypothetical protein F383_14963                       85.5    4e-16   
ref|XP_008354131.1|  PREDICTED: protein kinase APK1A, chloroplast...  85.9    4e-16   
ref|XP_010423878.1|  PREDICTED: probable serine/threonine-protein...  85.9    4e-16   
ref|XP_010452063.1|  PREDICTED: probable serine/threonine-protein...  85.1    4e-16   
ref|XP_003626764.1|  Protein kinase 2B                                86.3    4e-16   
ref|XP_001764576.1|  predicted protein                                84.7    5e-16   
ref|XP_007013526.1|  Receptor serine/threonine-protein kinase         85.9    5e-16   
ref|XP_009414410.1|  PREDICTED: probable serine/threonine-protein...  85.5    5e-16   
ref|XP_004516992.1|  PREDICTED: probable receptor-like protein ki...  85.9    5e-16   
ref|XP_010481378.1|  PREDICTED: probable receptor-like protein ki...  85.5    5e-16   
ref|XP_010692004.1|  PREDICTED: probable receptor-like protein ki...  85.5    6e-16   
ref|XP_002862908.1|  hypothetical protein ARALYDRAFT_921086           85.5    6e-16   
ref|XP_009588344.1|  PREDICTED: probable serine/threonine-protein...  85.5    6e-16   
ref|NP_172889.1|  protein kinase 2A                                   85.5    6e-16   
ref|XP_002890052.1|  hypothetical protein ARALYDRAFT_471608           85.5    6e-16   
ref|XP_010695453.1|  PREDICTED: probable receptor-like protein ki...  85.1    6e-16   
gb|KCW88942.1|  hypothetical protein EUGRSUZ_A01268                   84.0    6e-16   
ref|XP_009125442.1|  PREDICTED: probable serine/threonine-protein...  85.1    6e-16   
emb|CDY48100.1|  BnaC02g03570D                                        85.1    6e-16   
gb|KCW88940.1|  hypothetical protein EUGRSUZ_A01268                   85.1    6e-16   
emb|CDY04848.1|  BnaAnng00300D                                        85.1    6e-16   
gb|AAC79621.1|  putative protein kinase                               85.5    7e-16   
ref|XP_006287879.1|  hypothetical protein CARUB_v10001106mg           85.1    7e-16   
gb|AAO42877.1|  At2g39110                                             85.5    7e-16   
ref|NP_850311.1|  protein kinase superfamily protein                  85.5    7e-16   
ref|XP_006417017.1|  hypothetical protein EUTSA_v10007701mg           85.5    7e-16   
ref|XP_010538484.1|  PREDICTED: probable receptor-like protein ki...  84.7    7e-16   
gb|KFK31404.1|  hypothetical protein AALP_AA6G107700                  85.1    8e-16   
ref|XP_010110539.1|  hypothetical protein L484_023373                 84.7    8e-16   
gb|KCW44281.1|  hypothetical protein EUGRSUZ_L02283                   83.6    8e-16   
ref|XP_006385587.1|  hypothetical protein POPTR_0003s08340g           84.7    9e-16   
ref|NP_001063770.1|  Os09g0533600                                     84.7    9e-16   
emb|CDY39318.1|  BnaC05g10610D                                        85.1    9e-16   
ref|XP_002534306.1|  Protein kinase APK1B, chloroplast precursor,...  84.3    1e-15   
ref|XP_009766459.1|  PREDICTED: probable serine/threonine-protein...  84.7    1e-15   
ref|XP_001776496.1|  predicted protein                                84.7    1e-15   
ref|NP_001145874.1|  uncharacterized protein LOC100279389             84.7    1e-15   
ref|XP_009343547.1|  PREDICTED: protein kinase APK1A, chloroplast...  84.7    1e-15   
gb|ACF87678.1|  unknown                                               84.7    1e-15   
ref|NP_195849.1|  putative serine/threonine-protein kinase NAK        84.3    1e-15   
ref|XP_010494917.1|  PREDICTED: probable receptor-like protein ki...  84.7    1e-15   
ref|XP_006339025.1|  PREDICTED: protein kinase APK1A, chloroplast...  84.7    1e-15   
gb|AAA18853.1|  protein kinase                                        84.3    1e-15   
gb|KCW44282.1|  hypothetical protein EUGRSUZ_L02283                   84.0    1e-15   
ref|XP_010476492.1|  PREDICTED: protein kinase 2A, chloroplastic-...  84.7    1e-15   
ref|XP_011078389.1|  PREDICTED: receptor-like serine/threonine-pr...  84.7    1e-15   
ref|XP_006658573.1|  PREDICTED: probable receptor-like protein ki...  82.8    1e-15   
ref|XP_006649471.1|  PREDICTED: protein kinase 2B, chloroplastic-...  84.3    1e-15   
emb|CDY41675.1|  BnaC02g34790D                                        84.7    1e-15   
emb|CDY67404.1|  BnaA02g36850D                                        84.7    1e-15   
ref|XP_010111458.1|  putative serine/threonine-protein kinase NAK     84.0    1e-15   
ref|XP_010256925.1|  PREDICTED: protein kinase APK1A, chloroplastic   84.3    1e-15   
gb|KJB36716.1|  hypothetical protein B456_006G172600                  82.8    2e-15   
ref|XP_010047712.1|  PREDICTED: protein kinase APK1B, chloroplast...  84.0    2e-15   
ref|XP_006283936.1|  hypothetical protein CARUB_v10005055mg           84.0    2e-15   
ref|XP_007156604.1|  hypothetical protein PHAVU_002G002600g           83.6    2e-15   
ref|XP_009124370.1|  PREDICTED: probable receptor-like protein ki...  84.7    2e-15   
ref|XP_004142761.1|  PREDICTED: probable serine/threonine-protein...  84.0    2e-15   
ref|XP_001758139.1|  predicted protein                                84.7    2e-15   
ref|XP_010434633.1|  PREDICTED: probable receptor-like protein ki...  84.0    2e-15   
ref|XP_009792201.1|  PREDICTED: probable receptor-like protein ki...  84.7    2e-15   
ref|XP_010047703.1|  PREDICTED: probable serine/threonine-protein...  84.0    2e-15   
ref|XP_004508979.1|  PREDICTED: probable receptor-like protein ki...  83.6    2e-15   
ref|XP_010509071.1|  PREDICTED: probable receptor-like protein ki...  84.3    2e-15   
ref|XP_009129123.1|  PREDICTED: protein kinase 2B, chloroplastic ...  84.7    2e-15   
ref|XP_008233629.1|  PREDICTED: protein kinase APK1A, chloroplast...  84.0    2e-15   
ref|XP_006295687.1|  hypothetical protein CARUB_v10024803mg           84.3    2e-15   
ref|XP_010505573.1|  PREDICTED: probable receptor-like protein ki...  84.3    2e-15   
ref|XP_009774717.1|  PREDICTED: protein kinase APK1A, chloroplast...  84.0    2e-15   
ref|XP_004239839.1|  PREDICTED: probable serine/threonine-protein...  84.0    2e-15   
ref|NP_001238681.1|  NAK-type protein kinase                          83.6    2e-15   
ref|XP_009129122.1|  PREDICTED: protein kinase 2B, chloroplastic ...  84.3    2e-15   
ref|XP_007218038.1|  hypothetical protein PRUPE_ppa006035mg           84.0    2e-15   
ref|XP_009129121.1|  PREDICTED: protein kinase 2B, chloroplastic ...  84.3    2e-15   
ref|XP_010268227.1|  PREDICTED: protein kinase 2B, chloroplastic-...  84.0    2e-15   
ref|XP_002873046.1|  hypothetical protein ARALYDRAFT_487008           83.6    2e-15   
ref|XP_003558236.1|  PREDICTED: protein kinase APK1B, chloroplast...  83.2    2e-15   
ref|XP_009378388.1|  PREDICTED: probable receptor-like protein ki...  83.6    2e-15   
ref|XP_010458935.1|  PREDICTED: protein kinase 2A, chloroplastic-...  84.0    2e-15   
ref|XP_009590400.1|  PREDICTED: protein kinase APK1A, chloroplastic   83.6    2e-15   
ref|XP_010496035.1|  PREDICTED: protein kinase 2A, chloroplastic      84.0    2e-15   
emb|CDY20465.1|  BnaC04g05790D                                        83.6    2e-15   
ref|XP_010690630.1|  PREDICTED: probable serine/threonine-protein...  83.6    2e-15   
gb|AAL84315.1|AC073556_32  putative protein tyrosine-serine-threo...  84.0    2e-15   
gb|ABF94203.1|  serine/threonine-protein kinase NAK, putative, ex...  84.0    2e-15   
ref|XP_009130691.1|  PREDICTED: probable serine/threonine-protein...  83.6    2e-15   
emb|CDY55560.1|  BnaA03g54910D                                        83.2    3e-15   
ref|XP_008653698.1|  PREDICTED: protein kinase 2B, chloroplastic-...  81.3    3e-15   
ref|XP_009360375.1|  PREDICTED: protein kinase 2B, chloroplastic-...  83.6    3e-15   
gb|EEC74601.1|  hypothetical protein OsI_10191                        83.6    3e-15   
ref|XP_008464125.1|  PREDICTED: protein kinase APK1A, chloroplast...  82.8    3e-15   
ref|XP_006307552.1|  hypothetical protein CARUB_v10009175mg           84.0    3e-15   
emb|CDP09061.1|  unnamed protein product                              84.0    3e-15   
ref|XP_010685749.1|  PREDICTED: probable receptor-like protein ki...  84.0    3e-15   
gb|EEE67208.1|  hypothetical protein OsJ_24323                        82.8    3e-15   
ref|XP_002462727.1|  hypothetical protein SORBIDRAFT_02g030970        83.6    3e-15   
ref|XP_003616403.1|  Serine/threonine protein kinase                  83.6    3e-15   
ref|XP_008780759.1|  PREDICTED: protein kinase 2B, chloroplastic-...  83.6    3e-15   
ref|XP_008458866.1|  PREDICTED: protein kinase APK1A, chloroplastic   83.2    3e-15   
ref|XP_006440140.1|  hypothetical protein CICLE_v10020507mg           83.2    3e-15   
ref|XP_010316258.1|  PREDICTED: probable receptor-like protein ki...  82.8    3e-15   
ref|XP_006477061.1|  PREDICTED: probable receptor-like protein ki...  83.2    3e-15   
ref|XP_009143298.1|  PREDICTED: serine/threonine-protein kinase B...  83.2    3e-15   
gb|KHN33381.1|  Protein kinase APK1A, chloroplastic                   83.6    3e-15   
emb|CDY09904.1|  BnaC08g45470D                                        83.2    3e-15   
ref|XP_006398693.1|  hypothetical protein EUTSA_v10013737mg           83.2    3e-15   
ref|XP_007157675.1|  hypothetical protein PHAVU_002G089100g           83.2    3e-15   
ref|XP_007009313.1|  Kinase superfamily protein isoform 2             82.4    3e-15   
ref|XP_011657150.1|  PREDICTED: protein kinase APK1A, chloroplastic   83.2    3e-15   
ref|XP_002870091.1|  predicted protein                                83.2    3e-15   
gb|KDO82855.1|  hypothetical protein CISIN_1g014623mg                 83.2    3e-15   
ref|XP_008663158.1|  PREDICTED: protein kinase 2B, chloroplastic-...  79.7    3e-15   
ref|XP_004249535.1|  PREDICTED: probable serine/threonine-protein...  83.2    3e-15   
ref|XP_006650809.1|  PREDICTED: protein kinase APK1B, chloroplast...  83.2    3e-15   
ref|NP_001234409.1|  protein kinase 1b                                83.2    3e-15   
ref|XP_006438644.1|  hypothetical protein CICLE_v10031645mg           83.2    4e-15   
emb|CDP00097.1|  unnamed protein product                              83.2    4e-15   
ref|XP_008464124.1|  PREDICTED: protein kinase APK1A, chloroplast...  83.2    4e-15   
ref|XP_009412843.1|  PREDICTED: probable receptor-like protein ki...  83.2    4e-15   
ref|XP_003580831.1|  PREDICTED: putative serine/threonine-protein...  82.8    4e-15   
ref|XP_002311595.1|  KINASE 2B family protein                         83.2    4e-15   
ref|XP_009380641.1|  PREDICTED: probable serine/threonine-protein...  83.2    4e-15   
ref|XP_010543301.1|  PREDICTED: probable serine/threonine-protein...  82.8    4e-15   
gb|ACJ84335.1|  unknown                                               83.2    4e-15   
ref|XP_008362489.1|  PREDICTED: protein kinase 2B, chloroplastic-...  82.4    4e-15   
ref|XP_003613630.1|  Protein kinase 2B                                82.8    4e-15   
gb|KFK43683.1|  hypothetical protein AALP_AA1G159500                  83.2    4e-15   
ref|XP_002466186.1|  hypothetical protein SORBIDRAFT_01g003130        83.2    4e-15   
ref|XP_002963908.1|  hypothetical protein SELMODRAFT_79963            82.4    4e-15   
ref|XP_010937617.1|  PREDICTED: protein kinase APK1A, chloroplast...  82.8    4e-15   
ref|XP_011094865.1|  PREDICTED: protein kinase APK1A, chloroplastic   82.8    4e-15   
ref|XP_009347017.1|  PREDICTED: protein kinase 2B, chloroplastic-...  82.4    5e-15   
gb|EEC82083.1|  hypothetical protein OsI_26079                        82.8    5e-15   
ref|XP_010439967.1|  PREDICTED: probable receptor-like protein ki...  82.8    5e-15   
ref|XP_003519043.2|  PREDICTED: protein kinase 2B, chloroplastic-...  82.8    5e-15   
ref|XP_003517946.2|  PREDICTED: protein kinase 2B, chloroplastic-...  82.8    5e-15   
ref|XP_010937616.1|  PREDICTED: protein kinase APK1A, chloroplast...  82.8    5e-15   
ref|XP_009117905.1|  PREDICTED: protein kinase 2A, chloroplastic      83.2    5e-15   
emb|CDX81634.1|  BnaC08g39670D                                        82.8    5e-15   
gb|KJB83756.1|  hypothetical protein B456_013G263600                  82.8    5e-15   
gb|ACG32116.1|  protein kinase APK1B                                  82.8    5e-15   
emb|CDY53554.1|  BnaA09g57130D                                        82.8    5e-15   
ref|XP_010229119.1|  PREDICTED: protein kinase 2B, chloroplastic      82.8    5e-15   
ref|XP_004490898.1|  PREDICTED: protein kinase APK1A, chloroplast...  82.8    5e-15   
ref|XP_002988311.1|  hypothetical protein SELMODRAFT_127709           82.4    5e-15   
ref|XP_012092540.1|  PREDICTED: protein kinase APK1B, chloroplast...  82.8    5e-15   



>ref|XP_006354348.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X5 [Solanum tuberosum]
Length=412

 Score =   218 bits (555),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = +1

Query  211  YPDLLMTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTE  390
            +  +L  M+CF F+N EK EEPK  KS PVLSS  G  D + +HS+ ESSSQN SDTSTE
Sbjct  5    FSSILKDMKCFQFYNSEKKEEPKTAKSNPVLSSSFGLFDSEFRHSHRESSSQNVSDTSTE  64

Query  391  SRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASR  570
            SRGR+Q PS+SERPS+LR F+FSELK+ATKNFNR+TKIGEGGFG VYKAT+K  ED A +
Sbjct  65   SRGRSQIPSLSERPSDLRAFTFSELKAATKNFNRTTKIGEGGFGCVYKATVKTGEDSAKK  124

Query  571  VDVAVKQLSRRGLQGHREWVTEVNVLG  651
            +DVAVKQL RRGLQGH+EWVTEVNVLG
Sbjct  125  IDVAVKQLGRRGLQGHKEWVTEVNVLG  151



>ref|XP_006354344.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006354345.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X2 [Solanum tuberosum]
Length=434

 Score =   218 bits (555),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = +1

Query  211  YPDLLMTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTE  390
            +  +L  M+CF F+N EK EEPK  KS PVLSS  G  D + +HS+ ESSSQN SDTSTE
Sbjct  5    FSSILKDMKCFQFYNSEKKEEPKTAKSNPVLSSSFGLFDSEFRHSHRESSSQNVSDTSTE  64

Query  391  SRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASR  570
            SRGR+Q PS+SERPS+LR F+FSELK+ATKNFNR+TKIGEGGFG VYKAT+K  ED A +
Sbjct  65   SRGRSQIPSLSERPSDLRAFTFSELKAATKNFNRTTKIGEGGFGCVYKATVKTGEDSAKK  124

Query  571  VDVAVKQLSRRGLQGHREWVTEVNVLG  651
            +DVAVKQL RRGLQGH+EWVTEVNVLG
Sbjct  125  IDVAVKQLGRRGLQGHKEWVTEVNVLG  151



>ref|XP_006354346.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X3 [Solanum tuberosum]
 ref|XP_006354347.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X4 [Solanum tuberosum]
Length=423

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F+N EK EEPK  KS PVLSS  G  D + +HS+ ESSSQN SDTSTESRGR+Q 
Sbjct  1    MKCFQFYNSEKKEEPKTAKSNPVLSSSFGLFDSEFRHSHRESSSQNVSDTSTESRGRSQI  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS+SERPS+LR F+FSELK+ATKNFNR+TKIGEGGFG VYKAT+K  ED A ++DVAVKQ
Sbjct  61   PSLSERPSDLRAFTFSELKAATKNFNRTTKIGEGGFGCVYKATVKTGEDSAKKIDVAVKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L RRGLQGH+EWVTEVNVLG
Sbjct  121  LGRRGLQGHKEWVTEVNVLG  140



>ref|XP_004246645.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010325980.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Solanum lycopersicum]
Length=433

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = +1

Query  211  YPDLLMTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTE  390
            +  +L  M+CF F+N EK EEPK  KS PVLSS  G  D + +HS+ ESSSQN SDTS+E
Sbjct  5    FSSILKDMKCFPFYNAEKKEEPKTTKSNPVLSSSFGLFDSEFRHSHRESSSQNVSDTSSE  64

Query  391  SRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASR  570
            SRGR+Q PS+S+RPS+LR F+FSELK+ATKNFNR+TKIGEGGFG VYKAT+K  ED + +
Sbjct  65   SRGRSQIPSLSDRPSDLRAFTFSELKAATKNFNRTTKIGEGGFGCVYKATVKTGEDSSKK  124

Query  571  VDVAVKQLSRRGLQGHREWVTEVNVLG  651
            +DVA+KQL RRGLQGH+EWVTEVNVLG
Sbjct  125  IDVAIKQLGRRGLQGHKEWVTEVNVLG  151



>ref|XP_010325981.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Solanum lycopersicum]
Length=422

 Score =   210 bits (534),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F+N EK EEPK  KS PVLSS  G  D + +HS+ ESSSQN SDTS+ESRGR+Q 
Sbjct  1    MKCFPFYNAEKKEEPKTTKSNPVLSSSFGLFDSEFRHSHRESSSQNVSDTSSESRGRSQI  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS+S+RPS+LR F+FSELK+ATKNFNR+TKIGEGGFG VYKAT+K  ED + ++DVA+KQ
Sbjct  61   PSLSDRPSDLRAFTFSELKAATKNFNRTTKIGEGGFGCVYKATVKTGEDSSKKIDVAIKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L RRGLQGH+EWVTEVNVLG
Sbjct  121  LGRRGLQGHKEWVTEVNVLG  140



>ref|XP_009605410.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Nicotiana tomentosiformis]
Length=434

 Score =   200 bits (508),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = +1

Query  220  LLMTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRG  399
            +L  M+CF F+  +K EEPK V S  VLS+ S  SD + ++S LES SQNASDTSTESRG
Sbjct  8    ILKDMKCFQFYVGDKKEEPKTVNSNSVLSTSSVLSDREFRNSRLESCSQNASDTSTESRG  67

Query  400  RTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
            R+QFPS+S+RPSNLR F+FSELKSATKNFNR+TKIGEGGFG VYKAT+K+ ED   ++DV
Sbjct  68   RSQFPSLSDRPSNLRVFTFSELKSATKNFNRTTKIGEGGFGCVYKATVKSGEDSVRKIDV  127

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            AVKQL RRGLQGH+EWVTEVNVLG
Sbjct  128  AVKQLGRRGLQGHKEWVTEVNVLG  151



>ref|XP_009605411.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Nicotiana tomentosiformis]
Length=423

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F+  +K EEPK V S  VLS+ S  SD + ++S LES SQNASDTSTESRGR+QF
Sbjct  1    MKCFQFYVGDKKEEPKTVNSNSVLSTSSVLSDREFRNSRLESCSQNASDTSTESRGRSQF  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS+S+RPSNLR F+FSELKSATKNFNR+TKIGEGGFG VYKAT+K+ ED   ++DVAVKQ
Sbjct  61   PSLSDRPSNLRVFTFSELKSATKNFNRTTKIGEGGFGCVYKATVKSGEDSVRKIDVAVKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L RRGLQGH+EWVTEVNVLG
Sbjct  121  LGRRGLQGHKEWVTEVNVLG  140



>ref|XP_009764510.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Nicotiana sylvestris]
Length=434

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = +1

Query  220  LLMTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRG  399
            +L  M+CF F+  +K EEPK V S  VLSS S  SD + ++S LE SSQNASDTSTESRG
Sbjct  8    ILKDMKCFQFYVGDKKEEPKTVNSNSVLSSSSVLSDREFRNSRLECSSQNASDTSTESRG  67

Query  400  RTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
            R+QFPS+S+RPSNLR F+FSELKSATKNFNR+TKIGEGGFG VYKAT+K+ ED   ++DV
Sbjct  68   RSQFPSLSDRPSNLRVFTFSELKSATKNFNRTTKIGEGGFGCVYKATVKSGEDSVKKIDV  127

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            AVKQL RRGLQGH+EWVTEVNVLG
Sbjct  128  AVKQLGRRGLQGHKEWVTEVNVLG  151



>ref|XP_011094636.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Sesamum indicum]
Length=436

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 115/143 (80%), Gaps = 3/143 (2%)
 Frame = +1

Query  223  LMTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGR  402
            LM M+CF FH  EK EE K  + T V SS   F+DH+++ S  E +SQNAS+ STESRGR
Sbjct  11   LMVMKCFQFHIGEKREEAKTPRPTSVQSS---FTDHEIRQSGSEFNSQNASEESTESRGR  67

Query  403  TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
            +QFPS+SERPSNL+ F+F ELK ATKNF+R+TK+GEGGFG V+K  +K SEDPA ++DVA
Sbjct  68   SQFPSLSERPSNLKVFTFPELKQATKNFSRTTKLGEGGFGCVFKGIVKISEDPAQKIDVA  127

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            VKQL RRGLQGH+EWVTEVNVLG
Sbjct  128  VKQLGRRGLQGHKEWVTEVNVLG  150



>ref|XP_009764511.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Nicotiana sylvestris]
Length=423

 Score =   194 bits (494),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F+  +K EEPK V S  VLSS S  SD + ++S LE SSQNASDTSTESRGR+QF
Sbjct  1    MKCFQFYVGDKKEEPKTVNSNSVLSSSSVLSDREFRNSRLECSSQNASDTSTESRGRSQF  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS+S+RPSNLR F+FSELKSATKNFNR+TKIGEGGFG VYKAT+K+ ED   ++DVAVKQ
Sbjct  61   PSLSDRPSNLRVFTFSELKSATKNFNRTTKIGEGGFGCVYKATVKSGEDSVKKIDVAVKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L RRGLQGH+EWVTEVNVLG
Sbjct  121  LGRRGLQGHKEWVTEVNVLG  140



>gb|EYU34469.1| hypothetical protein MIMGU_mgv1a006457mg [Erythranthe guttata]
Length=440

 Score =   195 bits (495),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 115/144 (80%), Gaps = 5/144 (3%)
 Frame = +1

Query  223  LMTMRCFLFHNDEKDEEPKIVKSTPV-LSSCSGFSDHDVKHSNLESSSQNASDTSTESRG  399
            +  M CF FHN +K+EEPK    TPV +S  + F+D +V+ S  E +SQN SDTSTESRG
Sbjct  27   IKAMNCFQFHNGDKNEEPK----TPVQISPQTSFTDREVRQSGSEFNSQNVSDTSTESRG  82

Query  400  RTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
            R QFPS+SERPSNL+ F+FS+LK ATKNF+R+ K+GEGGFG VYK  IKNSEDP  ++DV
Sbjct  83   RGQFPSLSERPSNLKVFTFSDLKQATKNFSRTAKLGEGGFGCVYKGIIKNSEDPPKKIDV  142

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            AVKQL +RGLQGH+EWVTEVNVLG
Sbjct  143  AVKQLGKRGLQGHKEWVTEVNVLG  166



>gb|EYU34470.1| hypothetical protein MIMGU_mgv1a006457mg [Erythranthe guttata]
Length=443

 Score =   195 bits (495),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 115/144 (80%), Gaps = 5/144 (3%)
 Frame = +1

Query  223  LMTMRCFLFHNDEKDEEPKIVKSTPV-LSSCSGFSDHDVKHSNLESSSQNASDTSTESRG  399
            +  M CF FHN +K+EEPK    TPV +S  + F+D +V+ S  E +SQN SDTSTESRG
Sbjct  30   IKAMNCFQFHNGDKNEEPK----TPVQISPQTSFTDREVRQSGSEFNSQNVSDTSTESRG  85

Query  400  RTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
            R QFPS+SERPSNL+ F+FS+LK ATKNF+R+ K+GEGGFG VYK  IKNSEDP  ++DV
Sbjct  86   RGQFPSLSERPSNLKVFTFSDLKQATKNFSRTAKLGEGGFGCVYKGIIKNSEDPPKKIDV  145

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            AVKQL +RGLQGH+EWVTEVNVLG
Sbjct  146  AVKQLGKRGLQGHKEWVTEVNVLG  169



>ref|XP_011094637.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Sesamum indicum]
 ref|XP_011094638.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Sesamum indicum]
 ref|XP_011094639.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Sesamum indicum]
Length=425

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 114/142 (80%), Gaps = 3/142 (2%)
 Frame = +1

Query  226  MTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRT  405
            M M+CF FH  EK EE K  + T V SS   F+DH+++ S  E +SQNAS+ STESRGR+
Sbjct  1    MVMKCFQFHIGEKREEAKTPRPTSVQSS---FTDHEIRQSGSEFNSQNASEESTESRGRS  57

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
            QFPS+SERPSNL+ F+F ELK ATKNF+R+TK+GEGGFG V+K  +K SEDPA ++DVAV
Sbjct  58   QFPSLSERPSNLKVFTFPELKQATKNFSRTTKLGEGGFGCVFKGIVKISEDPAQKIDVAV  117

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQL RRGLQGH+EWVTEVNVLG
Sbjct  118  KQLGRRGLQGHKEWVTEVNVLG  139



>emb|CBI31433.3| unnamed protein product [Vitis vinifera]
Length=300

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 111/142 (78%), Gaps = 2/142 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSS--CSGFSDHDVKHSNLESSSQNASDTSTESRGRT  405
            M CF FH  EK++EPK  KST V SS   S  +DH+V+ S  E +SQNASD STES  +T
Sbjct  1    MTCFPFHKGEKNDEPKATKSTSVRSSTSISMSTDHEVRRSGSEFNSQNASDISTESSAKT  60

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             F S+ +RPSNL+ F+FSELKSATKNF+RS  IGEGGFG VY+  I+++EDP  ++D+AV
Sbjct  61   SFTSLQQRPSNLKVFTFSELKSATKNFSRSLMIGEGGFGGVYRGVIRSTEDPHKKIDIAV  120

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQLSRRGLQGH+EWVTEVNVLG
Sbjct  121  KQLSRRGLQGHKEWVTEVNVLG  142



>ref|XP_010658387.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Vitis 
vinifera]
 ref|XP_010658388.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Vitis 
vinifera]
Length=429

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 111/142 (78%), Gaps = 2/142 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSS--CSGFSDHDVKHSNLESSSQNASDTSTESRGRT  405
            M CF FH  EK++EPK  KST V SS   S  +DH+V+ S  E +SQNASD STES  +T
Sbjct  1    MTCFPFHKGEKNDEPKATKSTSVRSSTSISMSTDHEVRRSGSEFNSQNASDISTESSAKT  60

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             F S+ +RPSNL+ F+FSELKSATKNF+RS  IGEGGFG VY+  I+++EDP  ++D+AV
Sbjct  61   SFTSLQQRPSNLKVFTFSELKSATKNFSRSLMIGEGGFGGVYRGVIRSTEDPHKKIDIAV  120

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQLSRRGLQGH+EWVTEVNVLG
Sbjct  121  KQLSRRGLQGHKEWVTEVNVLG  142



>ref|XP_007205192.1| hypothetical protein PRUPE_ppa005670mg [Prunus persica]
 gb|EMJ06391.1| hypothetical protein PRUPE_ppa005670mg [Prunus persica]
Length=448

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 107/140 (76%), Gaps = 8/140 (6%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CFLF+  EK +EPK        S+ + F+D ++K S  E  SQN SD STES  R Q+
Sbjct  1    MKCFLFYIGEKKDEPK--------STITTFTDGEMKRSGSELDSQNISDASTESMRRNQY  52

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS S+RPSNLR F+ SELKSATKNF+RS  +GEGGFG VYK  IK++EDP+ +++VAVKQ
Sbjct  53   PSFSQRPSNLRVFTVSELKSATKNFSRSVMVGEGGFGCVYKGVIKSAEDPSQKLEVAVKQ  112

Query  592  LSRRGLQGHREWVTEVNVLG  651
            LS+RGLQGH+EWVTEVNVLG
Sbjct  113  LSKRGLQGHKEWVTEVNVLG  132



>ref|XP_008243964.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Prunus mume]
 ref|XP_008243965.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Prunus mume]
 ref|XP_008243967.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Prunus mume]
 ref|XP_008243968.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Prunus mume]
Length=458

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 107/140 (76%), Gaps = 8/140 (6%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CFLF+  EK +EPK        S+ + F+D ++K S  E  SQN SD STES  R Q+
Sbjct  1    MKCFLFYVGEKKDEPK--------STITTFTDGEMKRSGSELDSQNISDASTESMRRNQY  52

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS S+RPSNLR F+ SELKSATKNF+RS  +GEGGFG VYK  IK++EDP+ +++VAVKQ
Sbjct  53   PSFSQRPSNLRVFTVSELKSATKNFSRSVMVGEGGFGCVYKGVIKSAEDPSQKLEVAVKQ  112

Query  592  LSRRGLQGHREWVTEVNVLG  651
            LS+RGLQGH+EWVTEVNVLG
Sbjct  113  LSKRGLQGHKEWVTEVNVLG  132



>ref|XP_006428740.1| hypothetical protein CICLE_v10011770mg [Citrus clementina]
 ref|XP_006428741.1| hypothetical protein CICLE_v10011770mg [Citrus clementina]
 gb|ESR41980.1| hypothetical protein CICLE_v10011770mg [Citrus clementina]
 gb|ESR41981.1| hypothetical protein CICLE_v10011770mg [Citrus clementina]
Length=432

 Score =   173 bits (439),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query  232  MRCFLFHN-DEKDEEPKIVKST-PVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRT  405
            M+CF F N D+KDE P   KS   + SSC+ F+D++V     E +SQN S  S ES  R 
Sbjct  1    MKCFPFTNWDKKDEPPTTPKSLFSIRSSCATFNDNEVGRIGSELTSQNVSAISVESEARP  60

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             +PSMS+RPSNL++F+ +ELKSATKNF+RS  IGEGGFG VYK  IKNSEDP+ +V+VAV
Sbjct  61   SYPSMSQRPSNLKEFTIAELKSATKNFSRSVVIGEGGFGCVYKGLIKNSEDPSQKVEVAV  120

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQL RRG+QGH+EWVTEVN LG
Sbjct  121  KQLGRRGVQGHKEWVTEVNFLG  142



>ref|XP_007009900.1| Receptor-like protein kinase [Theobroma cacao]
 gb|EOY18710.1| Receptor-like protein kinase [Theobroma cacao]
Length=430

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 108/142 (76%), Gaps = 2/142 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSS--CSGFSDHDVKHSNLESSSQNASDTSTESRGRT  405
            M+CF F   EK+ EPK  KS  V SS   S  +DHD++ S  E +SQN SD STES  + 
Sbjct  1    MKCFCFSGKEKNAEPKATKSISVRSSTSISMSADHDMRRSGSEFNSQNVSDFSTESSTKN  60

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             F ++S+R SNLR+F+FSELK+ATKNF+RS  IGEGGFG VY+  I++++DP  ++D+AV
Sbjct  61   SFAALSQRQSNLREFTFSELKTATKNFSRSLMIGEGGFGGVYRGVIRSTDDPHKKIDIAV  120

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQLSRRGLQGH+EWVTEVNVLG
Sbjct  121  KQLSRRGLQGHKEWVTEVNVLG  142



>ref|XP_006481482.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
[Citrus sinensis]
Length=432

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query  232  MRCFLFHN-DEKDEEPKIVKST-PVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRT  405
            M+CF F N D+KDE P   KS   + SSC+ F+D++V     E +SQN S  S ES  R 
Sbjct  1    MKCFPFTNWDKKDEPPTTPKSLFSIRSSCATFNDNEVGRIGSELTSQNVSAISVESEARP  60

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             +PSMS+RPSNL++F+ +ELKSATKNF+RS  IGEGGFG VYK  IKNSEDP+ +V+VAV
Sbjct  61   SYPSMSQRPSNLKEFTIAELKSATKNFSRSVVIGEGGFGCVYKGLIKNSEDPSQKVEVAV  120

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQL RRG+QGH+EWVTEVN LG
Sbjct  121  KQLGRRGVQGHKEWVTEVNFLG  142



>ref|XP_008359647.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor-like protein 
kinase At5g47070 [Malus domestica]
Length=247

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 103/140 (74%), Gaps = 8/140 (6%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F+  EK +EPK   +T        F+D ++K S  E  SQN SD STES  R Q+
Sbjct  1    MKCFPFYIGEKKDEPKSTNTT--------FTDGEMKRSGSELDSQNISDASTESLRRNQY  52

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS S+RPSNL+ FS SELKSATKNF+RS  +GEGGFG VYK  IK+ EDP  +++VAVKQ
Sbjct  53   PSFSQRPSNLKVFSVSELKSATKNFSRSVMVGEGGFGCVYKGLIKSEEDPNKKLEVAVKQ  112

Query  592  LSRRGLQGHREWVTEVNVLG  651
            LS+RGLQGH+EWVTEVNVLG
Sbjct  113  LSKRGLQGHKEWVTEVNVLG  132



>gb|KDO48065.1| hypothetical protein CISIN_1g014245mg [Citrus sinensis]
Length=428

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query  232  MRCFLFHN-DEKDEEPKIVKST-PVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRT  405
            M+CF F N D+KDE P   KS   + SSC+ F+D++V     E +SQN S  S ES  R 
Sbjct  1    MKCFPFTNWDKKDEPPTTPKSLFSIRSSCATFNDNEVGRIGSELTSQNVSAISVESEARP  60

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             +PSMS+RPSNL++F+ +ELKSATKNF+RS  IGEGGFG VYK  IKNSEDP+ +V+VAV
Sbjct  61   SYPSMSQRPSNLKEFTIAELKSATKNFSRSVVIGEGGFGCVYKGLIKNSEDPSQKVEVAV  120

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQL RRG+QGH+EW+TEVN LG
Sbjct  121  KQLGRRGVQGHKEWMTEVNFLG  142



>ref|XP_004304448.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Fragaria 
vesca subsp. vesca]
 ref|XP_011468117.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Fragaria 
vesca subsp. vesca]
 ref|XP_011468118.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Fragaria 
vesca subsp. vesca]
 ref|XP_011468119.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Fragaria 
vesca subsp. vesca]
Length=466

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 106/144 (74%), Gaps = 8/144 (6%)
 Frame = +1

Query  220  LLMTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRG  399
            LL  M+CF FH  +K +EPK        S  + F+D D+K S  E  SQN SD S+ES  
Sbjct  5    LLEAMKCFSFHVGDKKDEPK--------SPNTMFTDGDMKRSGSELDSQNISDASSESLR  56

Query  400  RTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
            R Q+PS S+RPSNLR F+ SELKSATKNF RS  +GEGGFG VYK  I++SEDP+ +++V
Sbjct  57   RNQYPSFSQRPSNLRIFTVSELKSATKNFGRSGMVGEGGFGCVYKGQIRSSEDPSQKIEV  116

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            AVKQLS+RGLQGH+EWVTEVNVLG
Sbjct  117  AVKQLSKRGLQGHKEWVTEVNVLG  140



>ref|XP_010653601.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Vitis 
vinifera]
Length=426

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F+  +K EEPK  K T V S+ S  ++ ++K    E SSQN S+ STES  R  F
Sbjct  1    MKCFTFYYGDKKEEPKTSKWTSVQSNNSTLTEQEMKRFASELSSQNVSNVSTESLARPTF  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS+S+R SNLR F+FSELKS TKNF+RS  IGEGGFG VYK  IK+S+DP S++DVAVKQ
Sbjct  61   PSLSQRVSNLRVFTFSELKSVTKNFSRSAMIGEGGFGCVYKGMIKSSDDPPSKLDVAVKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L +RG+QGH+EWVTEV VLG
Sbjct  121  LGKRGMQGHKEWVTEVKVLG  140



>ref|XP_012082392.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Jatropha 
curcas]
 gb|KDP29140.1| hypothetical protein JCGZ_16529 [Jatropha curcas]
Length=427

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 110/140 (79%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F+  +K +E + VK+T V S+ S F+DH+V  S  E +SQN S TSTES  R  F
Sbjct  1    MKCFPFYIADKKDESRTVKTTSVQSTNSTFTDHEVGRSGSELNSQNVSGTSTESIVRPLF  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS+S+RPSNLR F+ +ELKSAT+NF+RS  +GEGGFG VY+ +I++++DP  R++VAVKQ
Sbjct  61   PSVSQRPSNLRVFTVAELKSATRNFSRSVMLGEGGFGCVYRGSIRSADDPTRRLEVAVKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L +RG+QGH+EWVTEVNVLG
Sbjct  121  LGKRGMQGHKEWVTEVNVLG  140



>emb|CBI32759.3| unnamed protein product [Vitis vinifera]
Length=460

 Score =   172 bits (435),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F+  +K EEPK  K T V S+ S  ++ ++K    E SSQN S+ STES  R  F
Sbjct  1    MKCFTFYYGDKKEEPKTSKWTSVQSNNSTLTEQEMKRFASELSSQNVSNVSTESLARPTF  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS+S+R SNLR F+FSELKS TKNF+RS  IGEGGFG VYK  IK+S+DP S++DVAVKQ
Sbjct  61   PSLSQRVSNLRVFTFSELKSVTKNFSRSAMIGEGGFGCVYKGMIKSSDDPPSKLDVAVKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L +RG+QGH+EWVTEV VLG
Sbjct  121  LGKRGMQGHKEWVTEVKVLG  140



>ref|XP_009350770.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Pyrus 
x bretschneideri]
 ref|XP_009350771.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Pyrus 
x bretschneideri]
Length=447

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 104/140 (74%), Gaps = 8/140 (6%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F+  EK +EPK        S+ + F+D D+K S  E  SQN SD STES  R Q+
Sbjct  1    MKCFSFYIGEKKDEPK--------STNTTFTDADMKRSGSELDSQNISDASTESLRRNQY  52

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS S+RPSNLR FS SELKSATKNF+RS  +GEGGFG VYK  IK+ EDP+ +++VAVKQ
Sbjct  53   PSFSQRPSNLRVFSVSELKSATKNFSRSVMVGEGGFGCVYKGLIKSEEDPSKKLEVAVKQ  112

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L +RGLQGH+EWVTEVNVLG
Sbjct  113  LGKRGLQGHKEWVTEVNVLG  132



>ref|XP_009376804.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Pyrus 
x bretschneideri]
Length=456

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 104/140 (74%), Gaps = 8/140 (6%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F+  EK +EPK        S+ + F+D ++K S  E  SQN SD STES  R Q+
Sbjct  1    MKCFPFYIGEKKDEPK--------STNTTFTDGEMKRSGSELDSQNISDASTESLRRNQY  52

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS S+RPSNL+ FS SELKSATKNF+RS  +GEGGFG VYK  IK+ EDP  +++VAVKQ
Sbjct  53   PSFSQRPSNLKVFSVSELKSATKNFSRSVMVGEGGFGCVYKGLIKSEEDPNKKLEVAVKQ  112

Query  592  LSRRGLQGHREWVTEVNVLG  651
            LS+RGLQGH+EWVTEVNVLG
Sbjct  113  LSKRGLQGHKEWVTEVNVLG  132



>ref|XP_011018721.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Populus euphratica]
Length=457

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +1

Query  223  LMTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGR  402
            L  M+CF F++ +K +EPK  KS  V S     +D ++  S  E +SQN   TSTES  R
Sbjct  29   LWAMKCFSFYSGDKTDEPKTPKSVSVQSVNFPGADREIGRSGSELNSQNVPGTSTESMVR  88

Query  403  TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
               PSMS+RPSNLR F+ SELKSATKNF+RS  IGEGGFG VYK +IK++EDP +++++A
Sbjct  89   PSLPSMSQRPSNLRVFTVSELKSATKNFSRSVMIGEGGFGCVYKGSIKSTEDPTTKLEIA  148

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            VKQL +RG+QGH+EW+TEVNVLG
Sbjct  149  VKQLGKRGMQGHKEWITEVNVLG  171



>gb|KJB36568.1| hypothetical protein B456_006G165500 [Gossypium raimondii]
 gb|KJB36569.1| hypothetical protein B456_006G165500 [Gossypium raimondii]
Length=419

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F N  K +EPK  +S    S  S  +D ++  S  E +SQN S  S+ES GR+ F
Sbjct  1    MKCFTFPNWYKKDEPKTPRSLSNRSLNSLCTDREIARSGSELNSQNVSGVSSESMGRSYF  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PSMS+RPSNLR F+ SELKSATKNF+RS  +GEGGFG VYK ++K+ EDP+ +++VAVKQ
Sbjct  61   PSMSQRPSNLRVFTVSELKSATKNFSRSFMLGEGGFGCVYKGSLKSPEDPSEKIEVAVKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L +RGLQGH+EWVTEVNVLG
Sbjct  121  LGKRGLQGHKEWVTEVNVLG  140



>gb|KJB73529.1| hypothetical protein B456_011G238100 [Gossypium raimondii]
Length=429

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSS--CSGFSDHDVKHSNLESSSQNASDTSTESRGRT  405
            M+CF F  +EK++EPK  KS  V SS   S  +DHD++ S  E +SQN SD STES  + 
Sbjct  1    MKCFHFSGNEKNDEPKTTKSISVRSSESVSISTDHDMRRSGSEFNSQNVSDFSTESSTKN  60

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             F ++S+R SNLR+F+F ELK+ATKNF+RS  IGEGGFG VY+  I+ S+D   ++D+AV
Sbjct  61   SFAALSQRQSNLREFTFLELKAATKNFSRSLMIGEGGFGGVYRGVIRISDDYHKKLDIAV  120

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQLSRRGLQGH+EWVTEVNVLG
Sbjct  121  KQLSRRGLQGHKEWVTEVNVLG  142



>ref|XP_011018722.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Populus euphratica]
 ref|XP_011018723.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Populus euphratica]
 ref|XP_011018724.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Populus euphratica]
Length=426

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F++ +K +EPK  KS  V S     +D ++  S  E +SQN   TSTES  R   
Sbjct  1    MKCFSFYSGDKTDEPKTPKSVSVQSVNFPGADREIGRSGSELNSQNVPGTSTESMVRPSL  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PSMS+RPSNLR F+ SELKSATKNF+RS  IGEGGFG VYK +IK++EDP +++++AVKQ
Sbjct  61   PSMSQRPSNLRVFTVSELKSATKNFSRSVMIGEGGFGCVYKGSIKSTEDPTTKLEIAVKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L +RG+QGH+EW+TEVNVLG
Sbjct  121  LGKRGMQGHKEWITEVNVLG  140



>ref|XP_010253943.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nelumbo 
nucifera]
Length=426

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 107/140 (76%), Gaps = 2/140 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F + E+ +EP+  KS  V SS S  +D + + S  E +S+N S+ S+ES GR  F
Sbjct  1    MKCFYFISGERKDEPRTTKSISVRSSTS--TDREARRSGSEFNSENISEMSSESMGRPTF  58

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS+S+R +NL+ F+FSELK+ATKNF+ S  +GEGGFG VY+  IKNSE+P  R+DVAVKQ
Sbjct  59   PSLSQRSNNLKVFTFSELKTATKNFSLSLMVGEGGFGCVYRGVIKNSEEPNVRLDVAVKQ  118

Query  592  LSRRGLQGHREWVTEVNVLG  651
            LSRRGLQGH++WVTEVNVLG
Sbjct  119  LSRRGLQGHKQWVTEVNVLG  138



>gb|KHG18706.1| hypothetical protein F383_01912 [Gossypium arboreum]
Length=429

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 106/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSS--CSGFSDHDVKHSNLESSSQNASDTSTESRGRT  405
            M+CF F   EK++EPK  KS  V SS   S  +DHD++ S  E +SQN SD STES  + 
Sbjct  1    MKCFHFSGHEKNDEPKTTKSISVRSSESVSISTDHDMRRSGSEFNSQNVSDFSTESSTKN  60

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             F ++S+R SNLR+F+F ELK+ATKNF+RS  IGEGGFG VY+  I+ S+D   ++D+AV
Sbjct  61   SFAALSQRQSNLREFTFLELKAATKNFSRSLMIGEGGFGGVYRGVIRISDDYHKKLDIAV  120

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQLSRRGLQGH+EWVTEVNVLG
Sbjct  121  KQLSRRGLQGHKEWVTEVNVLG  142



>ref|XP_006381430.1| kinase family protein [Populus trichocarpa]
 gb|ERP59227.1| kinase family protein [Populus trichocarpa]
Length=424

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 105/140 (75%), Gaps = 2/140 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF FH+ +K +EPK  KS  V S  S  +D ++  S  E +SQN S TSTES  R   
Sbjct  1    MKCFSFHSGDKTDEPKTPKSVSVQSVNSPGADREIGRSGSELNSQNVSGTSTESMVRPSL  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PSMS+RPSNLR F+ SELKSATKNF+RS  IGEGGFG VYK +IK++EDP +++++AVKQ
Sbjct  61   PSMSQRPSNLRVFTVSELKSATKNFSRSVMIGEGGFGCVYKGSIKSTEDPTTKLEIAVKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L +RG  GH+EWVTEVNVLG
Sbjct  121  LGKRG--GHKEWVTEVNVLG  138



>gb|KDO48066.1| hypothetical protein CISIN_1g014245mg [Citrus sinensis]
Length=426

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 105/142 (74%), Gaps = 4/142 (3%)
 Frame = +1

Query  232  MRCFLFHN-DEKDEEPKIVKST-PVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRT  405
            M+CF F N D+KDE P   KS   + SSC+ F+D++V     E +SQN S  S ES  R 
Sbjct  1    MKCFPFTNWDKKDEPPTTPKSLFSIRSSCATFNDNEVGRIGSELTSQNVSAISVESEARP  60

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             +PSMS+RPSNL++F+ +ELKSATKNF+RS  IGEGGFG VYK  IKNSEDP+ +V+VAV
Sbjct  61   SYPSMSQRPSNLKEFTIAELKSATKNFSRSVVIGEGGFGCVYKGLIKNSEDPSQKVEVAV  120

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQL RRG  GH+EW+TEVN LG
Sbjct  121  KQLGRRG--GHKEWMTEVNFLG  140



>ref|XP_007027372.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY07874.1| Kinase superfamily protein [Theobroma cacao]
Length=424

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF+F + +K +E K  KS    S  S F+D ++  S  E +SQN S  S ES GR+ F
Sbjct  1    MKCFIFPSWDKKDESKTPKSVSTRSMNSIFTDREIGRSGSELNSQNVSGVSNESMGRSSF  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PSMS+RPSNLR F+ SELKSATKNF+RS  +GEGGFG VYK  +K+ +D + +++VAVKQ
Sbjct  61   PSMSQRPSNLRVFTVSELKSATKNFSRSVMVGEGGFGCVYKGFLKSPDDSSQKIEVAVKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L +RGLQGH+EWVTEVNVLG
Sbjct  121  LGKRGLQGHKEWVTEVNVLG  140



>ref|XP_010107509.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXC16191.1| putative receptor-like protein kinase [Morus notabilis]
Length=426

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F   +K +E K  KS  + S  S F+D + K S  + +SQ  SD STES  R  F
Sbjct  1    MKCFPFSLGDKKDEAKNTKSASLRSINSTFTDGETKRSGSDLNSQIVSDASTESLRRMSF  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS  +RPSNLR F+ SELKSATKNF+RS  +GEGGFG VYK  IK++EDP+ +++VAVKQ
Sbjct  61   PSYPQRPSNLRVFTVSELKSATKNFSRSVMVGEGGFGCVYKGLIKSTEDPSKKLEVAVKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            LS+RGLQGHREWVTEVN+LG
Sbjct  121  LSKRGLQGHREWVTEVNLLG  140



>ref|XP_010241858.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nelumbo 
nucifera]
Length=427

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 104/140 (74%), Gaps = 2/140 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F + EK +E K  KS    S  S  +D +V  S  E +S+N S+ S ES GR  F
Sbjct  1    MKCFYFISGEKKDEAKTSKSISTRSFAS--TDREVIRSGSELNSENISEMSVESMGRVPF  58

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
             S+S+RP+NLR F+FSE+K+ATK+F+RS  +GEGGFG VY+  IK+SEDP  R+DVAVKQ
Sbjct  59   SSLSQRPTNLRVFTFSEMKAATKSFSRSLMVGEGGFGCVYRGMIKDSEDPNVRLDVAVKQ  118

Query  592  LSRRGLQGHREWVTEVNVLG  651
            LSRRGLQGH+EWVTEVNVLG
Sbjct  119  LSRRGLQGHKEWVTEVNVLG  138



>ref|XP_010543404.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Tarenaya 
hassleriana]
Length=426

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 105/143 (73%), Gaps = 7/143 (5%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSC-SGFSDHDVKHSNLESSSQNASDTSTESRG--R  402
            M+CFLF + +K +E K    TP L S  S FSD +V  S  E +SQN S TSTES    R
Sbjct  1    MKCFLFPSGDKRDEQK----TPNLVSLNSNFSDREVARSGSELNSQNVSGTSTESSMGRR  56

Query  403  TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
              +PSM+ R SNL++F+ SELKSATKNF+RS  IGEGGFG VY+ TIKN+EDP+ R +VA
Sbjct  57   NSYPSMNTRASNLKEFTISELKSATKNFSRSVMIGEGGFGCVYRGTIKNTEDPSKRTEVA  116

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            VKQL +RGLQGH+EWVTEVN LG
Sbjct  117  VKQLGKRGLQGHKEWVTEVNFLG  139



>ref|XP_006593326.1| PREDICTED: protein kinase isoform X1 [Glycine max]
Length=483

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  MTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRT  405
            + M+CF F+  EK + PK ++S    S+ S + + +++ S  E +S +ASD ST+S  R+
Sbjct  52   VAMKCFPFYFGEKKDGPKSLQSISGQSNSSTYVEAEMRRSGSELNSMDASDNSTDSLRRS  111

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             FPS+S+RPSNLR+F+ SELK+ATK+F+RS  +GEGGFG VYK  IK+ +DP+++++VAV
Sbjct  112  AFPSLSQRPSNLREFTVSELKTATKSFSRSVMLGEGGFGCVYKGLIKSVDDPSTKIEVAV  171

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQL RRG+QGH+EWVTEVNVLG
Sbjct  172  KQLGRRGIQGHKEWVTEVNVLG  193



>ref|XP_010035962.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Eucalyptus 
grandis]
 gb|KCW47479.1| hypothetical protein EUGRSUZ_K01253 [Eucalyptus grandis]
Length=422

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M CF F N +K ++ +  K     S+ S F+D DV+    E +S+N S+ STES GRT F
Sbjct  1    MNCFSFLNGDKKDDERTPKWVSAQSTASIFTDSDVRRVGSELTSRNLSEISTESLGRTAF  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            P++ ++ SNL+ F+ SELKS TKNF+RS  IGEGGFG VYK TIK +EDP+ +++VAVKQ
Sbjct  61   PNVLQKSSNLKAFTVSELKSVTKNFSRSVMIGEGGFGSVYKGTIKITEDPSKKLEVAVKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L+R+G QGH+EWVTEVNVLG
Sbjct  121  LNRKGTQGHKEWVTEVNVLG  140



>ref|XP_010935734.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Elaeis guineensis]
 ref|XP_010935735.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Elaeis guineensis]
Length=430

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F N  K  E     S    S+ +  +D DV+ S  E +S N SD S +S GR Q+
Sbjct  1    MKCFPFPNGLKKSEILSTFSASARSNSTTSTDRDVRRSGSEFNSWNVSDMSADSLGRCQY  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS S+RPS+LR F+FSEL++AT+NF+RS  +GEGGFG VY+ TIK+SEDP  R+++AVKQ
Sbjct  61   PSFSQRPSDLRVFTFSELRTATRNFSRSLMVGEGGFGCVYRGTIKSSEDPNMRLEIAVKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L+R+GLQGH+EW+TEVNVLG
Sbjct  121  LNRKGLQGHKEWLTEVNVLG  140



>ref|XP_006407633.1| hypothetical protein EUTSA_v10020792mg [Eutrema salsugineum]
 gb|ESQ49086.1| hypothetical protein EUTSA_v10020792mg [Eutrema salsugineum]
Length=426

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 107/142 (75%), Gaps = 5/142 (4%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTES-RGR-T  405
            M+CFLF   +K ++ K  KS   +S  S FSDHD+  S  E +S++AS TSTES  GR  
Sbjct  1    MKCFLFSGGDKKDDQKTPKS---VSLTSNFSDHDINRSGSEFNSRDASATSTESSMGRKN  57

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             +P+MS R SNLR+FS ++LKSATKNF+RS  IGEGGFG VY+ T+++ EDP+ +++VAV
Sbjct  58   SYPTMSTRASNLREFSITDLKSATKNFSRSVMIGEGGFGCVYRGTVRDLEDPSIKIEVAV  117

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQL +RGLQGH+EWVTEVN LG
Sbjct  118  KQLGKRGLQGHKEWVTEVNFLG  139



>gb|KJB62395.1| hypothetical protein B456_009G415600 [Gossypium raimondii]
Length=455

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 103/141 (73%), Gaps = 0/141 (0%)
 Frame = +1

Query  229  TMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQ  408
             M+CF+F +  + +EPK        S  S F+D ++  S  E +SQN S TS+ES  R+ 
Sbjct  36   AMKCFIFLSWRRKDEPKTPTPISTRSKNSTFTDREIGRSGSELNSQNVSATSSESIRRSS  95

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
            FPSMS+RPSNL+ F+ SELKSATKNF+RS  +GEGGFG VYK  IK+ +D + +++VAVK
Sbjct  96   FPSMSQRPSNLKVFTVSELKSATKNFSRSAMLGEGGFGCVYKGFIKSPDDSSQKIEVAVK  155

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QL +RGLQGH+EWVTEVN+LG
Sbjct  156  QLGKRGLQGHKEWVTEVNLLG  176



>gb|KJB62396.1| hypothetical protein B456_009G415600 [Gossypium raimondii]
Length=450

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 103/141 (73%), Gaps = 0/141 (0%)
 Frame = +1

Query  229  TMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQ  408
             M+CF+F +  + +EPK        S  S F+D ++  S  E +SQN S TS+ES  R+ 
Sbjct  31   AMKCFIFLSWRRKDEPKTPTPISTRSKNSTFTDREIGRSGSELNSQNVSATSSESIRRSS  90

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
            FPSMS+RPSNL+ F+ SELKSATKNF+RS  +GEGGFG VYK  IK+ +D + +++VAVK
Sbjct  91   FPSMSQRPSNLKVFTVSELKSATKNFSRSAMLGEGGFGCVYKGFIKSPDDSSQKIEVAVK  150

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QL +RGLQGH+EWVTEVN+LG
Sbjct  151  QLGKRGLQGHKEWVTEVNLLG  171



>ref|XP_010935733.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Elaeis guineensis]
Length=475

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 103/141 (73%), Gaps = 0/141 (0%)
 Frame = +1

Query  229  TMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQ  408
             M+CF F N  K  E     S    S+ +  +D DV+ S  E +S N SD S +S GR Q
Sbjct  45   AMKCFPFPNGLKKSEILSTFSASARSNSTTSTDRDVRRSGSEFNSWNVSDMSADSLGRCQ  104

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
            +PS S+RPS+LR F+FSEL++AT+NF+RS  +GEGGFG VY+ TIK+SEDP  R+++AVK
Sbjct  105  YPSFSQRPSDLRVFTFSELRTATRNFSRSLMVGEGGFGCVYRGTIKSSEDPNMRLEIAVK  164

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QL+R+GLQGH+EW+TEVNVLG
Sbjct  165  QLNRKGLQGHKEWLTEVNVLG  185



>ref|XP_006827432.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Amborella 
trichopoda]
 gb|ERM94848.1| hypothetical protein AMTR_s00009p00089890 [Amborella trichopoda]
Length=428

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            MRCF F N EK EEPK  KS    S  +  +D +V+ S  E +SQN  DTS +S GR  F
Sbjct  1    MRCFYFSNGEKKEEPKTAKSLRARSFSASSNDREVRRSGSEFNSQNVFDTSVDSLGRRTF  60

Query  412  PSMS-ERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
             S S  R +NLR F+FSEL++AT+NF+RS  IGEGGFG VY+ +I+N ++P+S++++AVK
Sbjct  61   SSSSSHRSNNLRVFTFSELRTATRNFSRSAMIGEGGFGCVYRGSIRNPQEPSSKIEIAVK  120

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QLS++GLQGH+EWVTEVNVLG
Sbjct  121  QLSKKGLQGHKEWVTEVNVLG  141



>gb|KJB62397.1| hypothetical protein B456_009G415600, partial [Gossypium raimondii]
Length=458

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 103/141 (73%), Gaps = 0/141 (0%)
 Frame = +1

Query  229  TMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQ  408
             M+CF+F +  + +EPK        S  S F+D ++  S  E +SQN S TS+ES  R+ 
Sbjct  39   AMKCFIFLSWRRKDEPKTPTPISTRSKNSTFTDREIGRSGSELNSQNVSATSSESIRRSS  98

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
            FPSMS+RPSNL+ F+ SELKSATKNF+RS  +GEGGFG VYK  IK+ +D + +++VAVK
Sbjct  99   FPSMSQRPSNLKVFTVSELKSATKNFSRSAMLGEGGFGCVYKGFIKSPDDSSQKIEVAVK  158

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QL +RGLQGH+EWVTEVN+LG
Sbjct  159  QLGKRGLQGHKEWVTEVNLLG  179



>ref|XP_002530935.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF31450.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=457

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 106/156 (68%), Gaps = 13/156 (8%)
 Frame = +1

Query  223  LMTMRCFLFHNDEKDEEPKIVKSTP----VLSSCSGFSDHDVKHSNLESSSQNASDTSTE  390
            L  M+CF F N EK+EEPK  KS        +S S  +D D+K S  E +SQN SD STE
Sbjct  15   LGAMKCFYFSNREKNEEPKTTKSASGRSTASTSMSMSTDRDLKRSGSEFNSQNVSDFSTE  74

Query  391  SRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASR  570
            S  +  F ++S R SNLR F+FSELKSATKNF+RS  +GEGGFG VY+  I+++EDP  +
Sbjct  75   SSTKNSFAALSLRQSNLRVFTFSELKSATKNFSRSLMVGEGGFGSVYRGVIRSTEDPNKK  134

Query  571  VDVAVKQLSRRGLQ---------GHREWVTEVNVLG  651
            +DVAVKQLSRRGLQ         GH+EWVTEV VLG
Sbjct  135  IDVAVKQLSRRGLQAGILLLHHHGHKEWVTEVKVLG  170



>ref|XP_011041041.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Populus 
euphratica]
 ref|XP_011041042.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Populus 
euphratica]
 ref|XP_011041043.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Populus 
euphratica]
Length=434

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 105/145 (72%), Gaps = 5/145 (3%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIV-----KSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESR  396
            M+CF F + EK+EEPK V       +   +S S  +D D++ S  E +SQN SD STES 
Sbjct  1    MKCFHFSSREKNEEPKTVTKSVSVQSTSSTSMSMSTDRDLRKSGSELNSQNVSDFSTESS  60

Query  397  GRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVD  576
             +  F S+ +R SNL+ F+FSELK+ATKNF+RS  IGEGGFG VY+  I++ ED + ++D
Sbjct  61   TKNSFASLCQRQSNLKAFTFSELKTATKNFSRSVMIGEGGFGGVYRGVIRSMEDSSKKID  120

Query  577  VAVKQLSRRGLQGHREWVTEVNVLG  651
            +AVKQLSRRGLQGH+EWVTEVNVLG
Sbjct  121  IAVKQLSRRGLQGHKEWVTEVNVLG  145



>gb|KJB60555.1| hypothetical protein B456_009G312200 [Gossypium raimondii]
Length=427

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 105/144 (73%), Gaps = 4/144 (3%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFS---DHDVKHSNLESSSQNASD-TSTESRG  399
            M+CF F++  K++EP+  KS  + SS S  S   D+DV+ S  ES+SQN SD +S  S  
Sbjct  1    MKCFHFNSKVKNDEPRTTKSISIQSSTSPVSMSTDNDVRRSGSESNSQNVSDFSSGSSTT  60

Query  400  RTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
            +  F  MS+R SNLR+F+F ELK+ATKNF+RS  IGEGGFG VY+  I++SED   ++D+
Sbjct  61   KNSFAVMSQRRSNLREFTFLELKTATKNFSRSLMIGEGGFGAVYRGLIRSSEDSHKKIDI  120

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            AVKQLSR G QGH+EWVTEVNVLG
Sbjct  121  AVKQLSRSGFQGHKEWVTEVNVLG  144



>gb|KJB60556.1| hypothetical protein B456_009G312200 [Gossypium raimondii]
Length=426

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 105/144 (73%), Gaps = 4/144 (3%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFS---DHDVKHSNLESSSQNASD-TSTESRG  399
            M+CF F++  K++EP+  KS  + SS S  S   D+DV+ S  ES+SQN SD +S  S  
Sbjct  1    MKCFHFNSKVKNDEPRTTKSISIQSSTSPVSMSTDNDVRRSGSESNSQNVSDFSSGSSTT  60

Query  400  RTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
            +  F  MS+R SNLR+F+F ELK+ATKNF+RS  IGEGGFG VY+  I++SED   ++D+
Sbjct  61   KNSFAVMSQRRSNLREFTFLELKTATKNFSRSLMIGEGGFGAVYRGLIRSSEDSHKKIDI  120

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            AVKQLSR G QGH+EWVTEVNVLG
Sbjct  121  AVKQLSRSGFQGHKEWVTEVNVLG  144



>ref|XP_007144362.1| hypothetical protein PHAVU_007G149900g [Phaseolus vulgaris]
 gb|ESW16356.1| hypothetical protein PHAVU_007G149900g [Phaseolus vulgaris]
Length=425

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F+  EK +  K ++S    S+ S F + +++ S  E +S +ASDTST+S  R+ F
Sbjct  1    MKCFPFYFGEKKDGAKRLQSISGRSNSSTFVEAEMRRSGSELNSMDASDTSTDSFRRSAF  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS+S+RPSNLR F+  EL++ATK+F+R   +GEGGFG VYK  IK+ +DP+++++VAVKQ
Sbjct  61   PSLSQRPSNLRVFTVPELRTATKSFSRGVMLGEGGFGCVYKGLIKSVDDPSTKIEVAVKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L RRG+QGH+EWVTEVNVLG
Sbjct  121  LGRRGIQGHKEWVTEVNVLG  140



>ref|NP_001235402.1| protein kinase [Glycine max]
 gb|ACM89571.1| protein kinase [Glycine max]
Length=491

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 110/150 (73%), Gaps = 8/150 (5%)
 Frame = +1

Query  226  MTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRT  405
            + M+CF F+  EK + PK ++S    S+ S + + +++ S  E +S +ASD ST+S  R+
Sbjct  52   VAMKCFPFYFGEKKDGPKSLQSISGQSNSSTYVEAEMRRSGSELNSMDASDNSTDSLRRS  111

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             FPS+S+RPSNLR+F+ SELK+ATK+F+RS  +GEGGFG VYK  IK+ +DP+++++VAV
Sbjct  112  AFPSLSQRPSNLREFTVSELKTATKSFSRSVMLGEGGFGCVYKGLIKSVDDPSTKIEVAV  171

Query  586  KQLSRRG--------LQGHREWVTEVNVLG  651
            KQL RRG        LQGH+EWVTEVNVLG
Sbjct  172  KQLGRRGIQARFCLLLQGHKEWVTEVNVLG  201



>gb|KDO46223.1| hypothetical protein CISIN_1g013504mg [Citrus sinensis]
Length=441

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 104/143 (73%), Gaps = 3/143 (2%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFS---DHDVKHSNLESSSQNASDTSTESRGR  402
            M+C    N +K+EE K  KS  V SS S  S   D DV+ S  E +SQNASD S+ES  R
Sbjct  12   MKCLYASNKDKNEEQKTAKSISVRSSASNTSMSTDRDVRKSGSEFNSQNASDFSSESSSR  71

Query  403  TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
              F  +S+R SNLR F+FSELK+ATKNF+RS  IGEGGFG VY+  I+++ED   ++D+A
Sbjct  72   NTFAVLSQRQSNLRVFTFSELKTATKNFSRSLMIGEGGFGGVYRGVIRSTEDSHKKIDIA  131

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            VKQLSRRGLQGH+EWVTEVNVLG
Sbjct  132  VKQLSRRGLQGHKEWVTEVNVLG  154



>ref|XP_003625670.1| Protein kinase [Medicago truncatula]
 gb|AES81888.1| kinase 1B [Medicago truncatula]
Length=434

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +1

Query  229  TMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDT-STESRGRT  405
             M+CF FH+ +K +EPK ++S    S  S + D + +    E +SQ+ SD+ S ES  R 
Sbjct  8    IMKCFPFHSSDKKDEPKGLQSASGRSDSSTYVDVEGRRCGSELNSQDISDSGSVESLRRN  67

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
              P++S+RPSNLR F+ SELKSATKNF+RS  +GEGGFG VY+  I++ +DP+ R++VAV
Sbjct  68   APPNLSQRPSNLRVFTVSELKSATKNFSRSVMLGEGGFGCVYQGVIRSVDDPSRRIEVAV  127

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQLS+RG+QGHREWVTEVNVLG
Sbjct  128  KQLSKRGVQGHREWVTEVNVLG  149



>ref|XP_006648129.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
[Oryza brachyantha]
Length=427

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 105/141 (74%), Gaps = 3/141 (2%)
 Frame = +1

Query  232  MRCF-LFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQ  408
            MRC   FH D K+E+P + KS  V S  +  ++ DV+ S  + +S N SD S ES  RTQ
Sbjct  1    MRCLPFFHGDSKEEDP-VNKSASVRSLSTTSTERDVR-SGSDFNSMNVSDMSAESIRRTQ  58

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
            +PS ++RPSNLR FSFSELK+AT+NF+RS  +GEGGFG VY+  IKNS++P  R ++AVK
Sbjct  59   YPSFTDRPSNLRAFSFSELKNATRNFSRSLMVGEGGFGCVYRGVIKNSDEPNERTEIAVK  118

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QL+R+GLQG +EW+TE+NVLG
Sbjct  119  QLNRKGLQGQKEWLTELNVLG  139



>gb|KEH24024.1| kinase 1B [Medicago truncatula]
Length=426

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDT-STESRGRTQ  408
            M+CF FH+ +K +EPK ++S    S  S + D + +    E +SQ+ SD+ S ES  R  
Sbjct  1    MKCFPFHSSDKKDEPKGLQSASGRSDSSTYVDVEGRRCGSELNSQDISDSGSVESLRRNA  60

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
             P++S+RPSNLR F+ SELKSATKNF+RS  +GEGGFG VY+  I++ +DP+ R++VAVK
Sbjct  61   PPNLSQRPSNLRVFTVSELKSATKNFSRSVMLGEGGFGCVYQGVIRSVDDPSRRIEVAVK  120

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QLS+RG+QGHREWVTEVNVLG
Sbjct  121  QLSKRGVQGHREWVTEVNVLG  141



>ref|XP_003521400.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X1 [Glycine max]
 ref|XP_006577026.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X2 [Glycine max]
Length=428

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 107/147 (73%), Gaps = 11/147 (7%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDH------DVKHSNLESSSQNASDT-STE  390
            M+CF F   EK +EPK ++    L S SG SD+      +V+ S  E +SQ+ SD  S+E
Sbjct  1    MKCFPFSYGEKKDEPKGLQ----LQSTSGRSDNSMCVEAEVRRSGSELNSQDVSDNGSSE  56

Query  391  SRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASR  570
            S+ R   PS+S+RPSNLR F+ SELKSATKNF+RS  IGEGGFG VY   I+++ED + R
Sbjct  57   SQRRNAIPSLSQRPSNLRVFTVSELKSATKNFSRSVMIGEGGFGCVYLGLIRSAEDSSRR  116

Query  571  VDVAVKQLSRRGLQGHREWVTEVNVLG  651
            ++VAVKQLS+RG+QGHREWVTEVNVLG
Sbjct  117  IEVAVKQLSKRGMQGHREWVTEVNVLG  143



>ref|XP_009386349.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=427

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F N     E +   S  V S+ +  ++ D++ S  E +S + +D+ T+S GR Q+
Sbjct  1    MKCFAFRNGATKAELQARLSASVRSNSTTSTERDMRRSGSEFNSGDVTDSGTDSVGRPQY  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS S+RP NLR F+FSEL++ATKNF+RS  +GEGGFG VY+ TIK+ +DP +++++AVKQ
Sbjct  61   PSFSQRPINLRVFTFSELRNATKNFSRSLMVGEGGFGCVYRGTIKSLDDPDAKIEIAVKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L+R+GLQGH+EW+TEVNVLG
Sbjct  121  LNRKGLQGHKEWLTEVNVLG  140



>gb|KEH24025.1| kinase 1B [Medicago truncatula]
Length=446

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +1

Query  229  TMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDT-STESRGRT  405
             M+CF FH+ +K +EPK ++S    S  S + D + +    E +SQ+ SD+ S ES  R 
Sbjct  20   IMKCFPFHSSDKKDEPKGLQSASGRSDSSTYVDVEGRRCGSELNSQDISDSGSVESLRRN  79

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
              P++S+RPSNLR F+ SELKSATKNF+RS  +GEGGFG VY+  I++ +DP+ R++VAV
Sbjct  80   APPNLSQRPSNLRVFTVSELKSATKNFSRSVMLGEGGFGCVYQGVIRSVDDPSRRIEVAV  139

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQLS+RG+QGHREWVTEVNVLG
Sbjct  140  KQLSKRGVQGHREWVTEVNVLG  161



>gb|KHG26991.1| hypothetical protein F383_05198 [Gossypium arboreum]
Length=426

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 105/143 (73%), Gaps = 3/143 (2%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSS--CSGFSDHDVKHSNLESSSQNASD-TSTESRGR  402
            M+CF F++  K++EP+  KS  + S+   S  +D+DV+ S  ES+SQN SD +S  S  +
Sbjct  1    MKCFHFNSKVKNDEPRTTKSISIQSTSPVSMSTDNDVRRSGSESNSQNVSDFSSGSSTTK  60

Query  403  TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
              F  MS+R SNLR+F+F ELK+ATKNF+RS  IGEGGFG VY+  I++SED   ++D+A
Sbjct  61   NSFAVMSQRRSNLREFTFLELKTATKNFSRSLMIGEGGFGAVYRGLIRSSEDSHKKIDIA  120

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            VKQLSR G QGH+EWVTEVNVLG
Sbjct  121  VKQLSRSGFQGHKEWVTEVNVLG  143



>ref|XP_009146895.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Brassica 
rapa]
Length=424

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 103/143 (72%), Gaps = 7/143 (5%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTES---RGR  402
            M+CF F   +K EE K    TP +S  S FSD D+  S  E +S++ S TSTES   R  
Sbjct  1    MKCFFFSGGDKKEEHK----TPNVSQTSNFSDRDINRSGSEFNSRDVSGTSTESSMGRRN  56

Query  403  TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
            +  P+MS R SNLR+FS ++LK+ATKNF+RS  IGEGGFG VY+ T+++ EDP+ +++VA
Sbjct  57   SYPPTMSTRASNLREFSITDLKAATKNFSRSVMIGEGGFGCVYRGTVRSLEDPSIKIEVA  116

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            VKQL +RGLQGH+EWVTEVN LG
Sbjct  117  VKQLGKRGLQGHKEWVTEVNFLG  139



>gb|EYU39624.1| hypothetical protein MIMGU_mgv1a007133mg [Erythranthe guttata]
Length=418

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            MRCF F N  K +EPK VKST + SS S  SD DV+ S  E +SQN SD S  S      
Sbjct  1    MRCFQFSNANKTDEPKTVKSTSIFSSTSASSDQDVRRSGSECNSQNISDISNASSANITL  60

Query  412  PSMSERPSNL-RDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
             S+S+RP+NL R F+F ELK+ATKNF+RS  +GEGGFGPVY+  ++ +E+   R+D+AVK
Sbjct  61   SSLSQRPTNLLRCFTFDELKTATKNFSRSLMLGEGGFGPVYRGVLRETENSNKRIDIAVK  120

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QLS RGLQGH+EW+ EVNVLG
Sbjct  121  QLSTRGLQGHKEWINEVNVLG  141



>ref|XP_002519512.1| Protein kinase APK1A, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF42926.1| Protein kinase APK1A, chloroplast precursor, putative [Ricinus 
communis]
Length=422

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 101/136 (74%), Gaps = 2/136 (1%)
 Frame = +1

Query  244  LFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQFPSMS  423
            L H D+KDE PK  K   V S+ S F+D +V  S+ E +  + S TS ES  R  FPSMS
Sbjct  3    LSHGDKKDE-PKTTKLVSVQSTNSAFTDREVGRSS-EFNYPDVSGTSIESIDRPSFPSMS  60

Query  424  ERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQLSRR  603
            +RPSNLR F+ +ELKSAT+NF+RS  +GEGGFG VY+ +IK+ EDP  +++VAVKQL +R
Sbjct  61   QRPSNLRVFTVAELKSATRNFSRSVMLGEGGFGCVYRGSIKSLEDPTKKLEVAVKQLGKR  120

Query  604  GLQGHREWVTEVNVLG  651
            G+QGH+EWVTEVNVLG
Sbjct  121  GMQGHKEWVTEVNVLG  136



>ref|XP_004497523.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X1 [Cicer arietinum]
Length=436

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 104/144 (72%), Gaps = 2/144 (1%)
 Frame = +1

Query  226  MTMRCF--LFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRG  399
            + M+CF  L +  EK  + K ++S   LS+ S +   DV+ +  E +S +ASD ST+S  
Sbjct  8    VAMKCFPFLIYYGEKKGDAKSLRSLSGLSNNSTYGGSDVRRTGSELNSLDASDNSTDSLR  67

Query  400  RTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
            R  FP++S+RPS+LR F+ SELKSATKNF RS  +GEGGFG VYK  IK+ +DP  +++V
Sbjct  68   RNAFPNLSQRPSSLRVFTVSELKSATKNFGRSVMLGEGGFGCVYKGLIKSVDDPPRKIEV  127

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            AVKQL +RG+QGH+EWVTEVNVLG
Sbjct  128  AVKQLGKRGIQGHKEWVTEVNVLG  151



>ref|NP_001048536.1| Os02g0819600 [Oryza sativa Japonica Group]
 dbj|BAD22970.1| putative protein serine/threonine kinase [Oryza sativa Japonica 
Group]
 dbj|BAD23099.1| putative protein serine/threonine kinase [Oryza sativa Japonica 
Group]
 dbj|BAF10450.1| Os02g0819600 [Oryza sativa Japonica Group]
 gb|EEE58058.1| hypothetical protein OsJ_08896 [Oryza sativa Japonica Group]
Length=427

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 105/141 (74%), Gaps = 3/141 (2%)
 Frame = +1

Query  232  MRCFLF-HNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQ  408
            MRC  F H D K+E+P + KS  V S  +  ++ DV+ S  + +S N SD S ES  RTQ
Sbjct  1    MRCLPFLHGDSKEEDP-VNKSASVRSLSTTSTERDVR-SGSDFNSLNVSDMSAESIRRTQ  58

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
            +PS ++RPSNLR FSFSELK+AT+NF+RS  +GEGGFG VY+  IKNS++P  R ++AVK
Sbjct  59   YPSFTDRPSNLRVFSFSELKNATRNFSRSLMVGEGGFGCVYRGVIKNSDEPTERTEIAVK  118

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QL+R+GLQG +EW+TE+NVLG
Sbjct  119  QLNRKGLQGQKEWLTELNVLG  139



>ref|XP_006436456.1| hypothetical protein CICLE_v10031608mg [Citrus clementina]
 ref|XP_006485633.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X2 [Citrus sinensis]
 ref|XP_006485634.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X3 [Citrus sinensis]
 ref|XP_006485635.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X4 [Citrus sinensis]
 ref|XP_006485636.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X5 [Citrus sinensis]
 gb|ESR49696.1| hypothetical protein CICLE_v10031608mg [Citrus clementina]
Length=430

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 103/143 (72%), Gaps = 3/143 (2%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFS---DHDVKHSNLESSSQNASDTSTESRGR  402
            M+C      +K+EE K  KS  V SS S  S   D DV+ S  E +SQNASD S+ES  R
Sbjct  1    MKCLYASKKDKNEEQKTAKSISVRSSASNTSMSTDRDVRKSGSEFNSQNASDFSSESSSR  60

Query  403  TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
              F  +S+R SNLR F+FSELK+ATKNF+RS  IGEGGFG VY+  I+++ED   ++D+A
Sbjct  61   NTFAVLSQRQSNLRVFTFSELKTATKNFSRSLMIGEGGFGGVYRGVIRSTEDSHKKIDIA  120

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            VKQLSRRGLQGH+EWVTEVNVLG
Sbjct  121  VKQLSRRGLQGHKEWVTEVNVLG  143



>ref|XP_002454791.1| hypothetical protein SORBIDRAFT_04g037460 [Sorghum bicolor]
 gb|EES07767.1| hypothetical protein SORBIDRAFT_04g037460 [Sorghum bicolor]
Length=422

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 106/141 (75%), Gaps = 3/141 (2%)
 Frame = +1

Query  232  MRCFLF-HNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQ  408
            M+C  F H D K+++P + KS  V S  +  ++ DV+ S  + +S N SD S ES  RTQ
Sbjct  1    MKCLPFLHGDAKEKDP-VTKSASVRSMSTTSTERDVR-SGSDFTSLNVSDMSAESIRRTQ  58

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
            +PS ++RP NLR FSF+ELKSAT+NF+RS  +GEGGFG VY+  IKNS++P+ R+++AVK
Sbjct  59   YPSFTDRPPNLRVFSFAELKSATRNFSRSLMVGEGGFGCVYRGVIKNSDEPSERIEIAVK  118

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QL+R+GLQG +EW+TE+NVLG
Sbjct  119  QLNRKGLQGQKEWLTEMNVLG  139



>ref|XP_006485632.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X1 [Citrus sinensis]
Length=441

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 103/143 (72%), Gaps = 3/143 (2%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFS---DHDVKHSNLESSSQNASDTSTESRGR  402
            M+C      +K+EE K  KS  V SS S  S   D DV+ S  E +SQNASD S+ES  R
Sbjct  12   MKCLYASKKDKNEEQKTAKSISVRSSASNTSMSTDRDVRKSGSEFNSQNASDFSSESSSR  71

Query  403  TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
              F  +S+R SNLR F+FSELK+ATKNF+RS  IGEGGFG VY+  I+++ED   ++D+A
Sbjct  72   NTFAVLSQRQSNLRVFTFSELKTATKNFSRSLMIGEGGFGGVYRGVIRSTEDSHKKIDIA  131

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            VKQLSRRGLQGH+EWVTEVNVLG
Sbjct  132  VKQLSRRGLQGHKEWVTEVNVLG  154



>ref|XP_002882639.1| hypothetical protein ARALYDRAFT_478307 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58898.1| hypothetical protein ARALYDRAFT_478307 [Arabidopsis lyrata subsp. 
lyrata]
Length=418

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 106/143 (74%), Gaps = 7/143 (5%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPV-LSSCSGFSDHDVKHSNLESSSQNASDTSTES-RGR-  402
            M+CFLF   +K  E K    TP+ +S  S FSD ++  S  E +S++ S TSTES  GR 
Sbjct  1    MKCFLFSGGDKKGEQK----TPISVSLTSNFSDREINRSGSEFNSRDVSGTSTESSMGRK  56

Query  403  TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
              +P+MS R SN+R+FS ++LKSATKNF+RS  IGEGGFG V++ T++N EDP+++++VA
Sbjct  57   NSYPTMSTRASNIREFSITDLKSATKNFSRSVMIGEGGFGCVFRGTVRNLEDPSNKIEVA  116

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            VKQL +RGLQGH+EWVTEVN LG
Sbjct  117  VKQLGKRGLQGHKEWVTEVNFLG  139



>ref|XP_008776800.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Phoenix 
dactylifera]
Length=428

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 107/140 (76%), Gaps = 1/140 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F N +K  EP+  +S   +SS +  +D D++ S  E +S + SD S +S GR+QF
Sbjct  1    MKCFPFSNGKK-REPQARRSPSSMSSSTMSTDCDMRKSGSELNSLSVSDMSADSIGRSQF  59

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS S+RPSNLR F+F EL++AT+NF+RS  IGEGGFG VY+  I++S++P +R DVA+KQ
Sbjct  60   PSFSQRPSNLRTFTFEELRNATRNFSRSLMIGEGGFGCVYRGAIRSSDEPNTRKDVAIKQ  119

Query  592  LSRRGLQGHREWVTEVNVLG  651
            LSRRGLQGH+EW+TEV+VLG
Sbjct  120  LSRRGLQGHKEWLTEVHVLG  139



>gb|EEC74260.1| hypothetical protein OsI_09473 [Oryza sativa Indica Group]
Length=427

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 105/141 (74%), Gaps = 3/141 (2%)
 Frame = +1

Query  232  MRCFLF-HNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQ  408
            MRC  F H D K+E+P + KS  V S  +  ++ DV+ S  + +S N SD S ES  RTQ
Sbjct  1    MRCLPFLHGDSKEEDP-VNKSASVRSLSTTSTERDVR-SGSDFNSLNVSDMSAESIRRTQ  58

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
            +PS ++RPSNLR FSFSELK+AT+NF+RS  +GEGGFG VY+  IKNS++P  R ++AVK
Sbjct  59   YPSFTDRPSNLRVFSFSELKNATRNFSRSLMVGEGGFGCVYRGVIKNSDEPTERTEIAVK  118

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QL+R+GLQG +EW+TE+NVLG
Sbjct  119  QLNRKGLQGQKEWLTELNVLG  139



>ref|XP_004493982.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X2 [Cicer arietinum]
Length=427

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDT-STESRGRTQ  408
            M+CF FH  +K +EPK ++S    S  S + + + +    E +SQ+ SD+ S ES  +  
Sbjct  1    MKCFTFHYGDKKDEPKGLQSGSGRSDSSTYVEVEGRRCGSELNSQDVSDSGSVESLRKNV  60

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
             PS+S+RPSNLR F+ SELKSATKNF+RS  +GEGGFG VY+  I++ +DP+ R++VAVK
Sbjct  61   SPSLSQRPSNLRVFTVSELKSATKNFSRSVMLGEGGFGCVYQGVIRSVDDPSGRIEVAVK  120

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QLS+RG+QGHREWVTEVNVLG
Sbjct  121  QLSKRGVQGHREWVTEVNVLG  141



>ref|XP_004493981.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X1 [Cicer arietinum]
Length=439

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 104/142 (73%), Gaps = 1/142 (1%)
 Frame = +1

Query  229  TMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDT-STESRGRT  405
             M+CF FH  +K +EPK ++S    S  S + + + +    E +SQ+ SD+ S ES  + 
Sbjct  12   IMKCFTFHYGDKKDEPKGLQSGSGRSDSSTYVEVEGRRCGSELNSQDVSDSGSVESLRKN  71

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
              PS+S+RPSNLR F+ SELKSATKNF+RS  +GEGGFG VY+  I++ +DP+ R++VAV
Sbjct  72   VSPSLSQRPSNLRVFTVSELKSATKNFSRSVMLGEGGFGCVYQGVIRSVDDPSGRIEVAV  131

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQLS+RG+QGHREWVTEVNVLG
Sbjct  132  KQLSKRGVQGHREWVTEVNVLG  153



>ref|XP_004497524.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X2 [Cicer arietinum]
Length=427

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 103/142 (73%), Gaps = 2/142 (1%)
 Frame = +1

Query  232  MRCF--LFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRT  405
            M+CF  L +  EK  + K ++S   LS+ S +   DV+ +  E +S +ASD ST+S  R 
Sbjct  1    MKCFPFLIYYGEKKGDAKSLRSLSGLSNNSTYGGSDVRRTGSELNSLDASDNSTDSLRRN  60

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             FP++S+RPS+LR F+ SELKSATKNF RS  +GEGGFG VYK  IK+ +DP  +++VAV
Sbjct  61   AFPNLSQRPSSLRVFTVSELKSATKNFGRSVMLGEGGFGCVYKGLIKSVDDPPRKIEVAV  120

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQL +RG+QGH+EWVTEVNVLG
Sbjct  121  KQLGKRGIQGHKEWVTEVNVLG  142



>gb|ACG27469.1| protein kinase APK1A [Zea mays]
Length=431

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 105/141 (74%), Gaps = 3/141 (2%)
 Frame = +1

Query  232  MRCFLF-HNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQ  408
            MRC  F H D K+++P + KS  V S  +  ++ DV+ S  + +S N SD S ES  RTQ
Sbjct  1    MRCLPFLHGDAKEKDP-VTKSASVRSMSTTSTERDVR-SGSDFTSLNVSDMSAESIRRTQ  58

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
            +PS ++RPSNLR FSF+ELKSAT+NF+RS  +GEGGFG VY+  IK S++P  R+++AVK
Sbjct  59   YPSFTDRPSNLRVFSFAELKSATRNFSRSLMVGEGGFGCVYRGVIKTSDEPNERIEIAVK  118

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QL+R+GLQG +EW+TE+NVLG
Sbjct  119  QLNRKGLQGQKEWLTEMNVLG  139



>ref|XP_003554386.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X1 [Glycine max]
 gb|KHN02327.1| Putative receptor-like protein kinase [Glycine soja]
Length=428

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 104/147 (71%), Gaps = 11/147 (7%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDH------DVKHSNLESSSQNASDT-STE  390
            M+CF F   EK +EPK ++    L S SG SD+      +V+ S    +SQ+ SD  S+E
Sbjct  1    MKCFPFSYGEKKDEPKGLQ----LQSTSGRSDNSTCVEAEVRRSGSALNSQDVSDNGSSE  56

Query  391  SRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASR  570
            S  R   PS+S+RP NLR F+ SELKSATKNF+RS  IGEGGFG VY   I+++EDP+ R
Sbjct  57   SLRRNAIPSLSQRPCNLRVFTVSELKSATKNFSRSVMIGEGGFGCVYLGLIRSAEDPSRR  116

Query  571  VDVAVKQLSRRGLQGHREWVTEVNVLG  651
             +VAVKQLS+RG+QGHREWVTEVNVLG
Sbjct  117  TEVAVKQLSKRGMQGHREWVTEVNVLG  143



>ref|XP_006604577.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X2 [Glycine max]
Length=440

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 104/147 (71%), Gaps = 11/147 (7%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDH------DVKHSNLESSSQNASDT-STE  390
            M+CF F   EK +EPK ++    L S SG SD+      +V+ S    +SQ+ SD  S+E
Sbjct  13   MKCFPFSYGEKKDEPKGLQ----LQSTSGRSDNSTCVEAEVRRSGSALNSQDVSDNGSSE  68

Query  391  SRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASR  570
            S  R   PS+S+RP NLR F+ SELKSATKNF+RS  IGEGGFG VY   I+++EDP+ R
Sbjct  69   SLRRNAIPSLSQRPCNLRVFTVSELKSATKNFSRSVMIGEGGFGCVYLGLIRSAEDPSRR  128

Query  571  VDVAVKQLSRRGLQGHREWVTEVNVLG  651
             +VAVKQLS+RG+QGHREWVTEVNVLG
Sbjct  129  TEVAVKQLSKRGMQGHREWVTEVNVLG  155



>ref|XP_008643528.1| PREDICTED: uncharacterized LOC100280259 isoform X2 [Zea mays]
Length=390

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 105/141 (74%), Gaps = 3/141 (2%)
 Frame = +1

Query  232  MRCFLF-HNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQ  408
            MRC  F H D K+++P + KS  + S  +  ++ DV+ S  + +S N SD S ES  RTQ
Sbjct  1    MRCLPFLHGDTKEKDP-VTKSASLRSMSTTSTERDVR-SGSDFTSLNVSDMSAESIRRTQ  58

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
            +PS ++RPSNLR FSF+ELKSAT+NF+RS  +GEGGFG VY+  IK S++P  R+++AVK
Sbjct  59   YPSFTDRPSNLRVFSFAELKSATRNFSRSLMVGEGGFGCVYRGVIKTSDEPNERIEIAVK  118

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QL+R+GLQG +EW+TE+NVLG
Sbjct  119  QLNRKGLQGQKEWLTEMNVLG  139



>ref|XP_010464638.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Camelina 
sativa]
Length=426

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 5/142 (4%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTES-RGR-T  405
            M+CFLF   +K  E K   S   +S  S FSD ++  S  E +S++ S TSTES  GR  
Sbjct  1    MKCFLFSGGDKKGEQKTPNS---VSLTSNFSDREINRSGSEFNSRDVSGTSTESSMGRKN  57

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             +P+MS R SNLR+FS ++LKSATKNF+RS  IGEGGFG V++ T++N EDP+ +++VAV
Sbjct  58   SYPTMSTRASNLREFSITDLKSATKNFSRSVMIGEGGFGCVFRGTVRNLEDPSIKIEVAV  117

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQL +RGLQGH+EWVTEVN LG
Sbjct  118  KQLGKRGLQGHKEWVTEVNFLG  139



>ref|XP_010477459.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Camelina 
sativa]
 ref|XP_010477529.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Camelina 
sativa]
 ref|XP_010486557.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Camelina 
sativa]
Length=426

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 5/142 (4%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTES-RGR-T  405
            M+CFLF   +K  E K   S   +S  S FSD ++  S  E +S++ S TSTES  GR  
Sbjct  1    MKCFLFSGGDKKGEQKTPNS---VSLTSNFSDREINRSGSEFNSRDVSGTSTESSMGRKN  57

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             +P+MS R SNLR+FS ++LKSATKNF+RS  IGEGGFG V++ T++N EDP+ +++VAV
Sbjct  58   SYPTMSTRASNLREFSITDLKSATKNFSRSVMIGEGGFGCVFRGTVRNLEDPSIKIEVAV  117

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQL +RGLQGH+EWVTEVN LG
Sbjct  118  KQLGKRGLQGHKEWVTEVNFLG  139



>ref|XP_011031713.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Populus euphratica]
Length=385

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 100/145 (69%), Gaps = 5/145 (3%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKST-----PVLSSCSGFSDHDVKHSNLESSSQNASDTSTESR  396
            M+CF F N EK+EEPK             +S S  +D D++ S    +SQN SD STES 
Sbjct  1    MKCFHFSNKEKNEEPKTCNQIGSARSTSSTSTSMSTDRDLRKSGSGFNSQNVSDFSTESS  60

Query  397  GRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVD  576
             +  F ++S+R SNLR F+F ELK+ATKNF+RS  IGEGGFG VY+  I++ ED + ++D
Sbjct  61   TKNSFAALSQRQSNLRVFTFLELKTATKNFSRSVMIGEGGFGGVYRGVIRSMEDSSKKID  120

Query  577  VAVKQLSRRGLQGHREWVTEVNVLG  651
            +AVKQL RRGLQGH+EWVTEVN LG
Sbjct  121  IAVKQLGRRGLQGHKEWVTEVNFLG  145



>ref|NP_001146659.1| uncharacterized LOC100280259 [Zea mays]
 ref|XP_008643525.1| PREDICTED: uncharacterized LOC100280259 isoform X1 [Zea mays]
 ref|XP_008643526.1| PREDICTED: uncharacterized LOC100280259 isoform X1 [Zea mays]
 ref|XP_008643527.1| PREDICTED: uncharacterized LOC100280259 isoform X1 [Zea mays]
 gb|ACL54482.1| unknown [Zea mays]
 gb|ACL54571.1| unknown [Zea mays]
 gb|AFW74065.1| putative protein kinase superfamily protein isoform 1 [Zea mays]
 gb|AFW74066.1| putative protein kinase superfamily protein isoform 2 [Zea mays]
Length=431

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 105/141 (74%), Gaps = 3/141 (2%)
 Frame = +1

Query  232  MRCFLF-HNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQ  408
            MRC  F H D K+++P + KS  + S  +  ++ DV+ S  + +S N SD S ES  RTQ
Sbjct  1    MRCLPFLHGDTKEKDP-VTKSASLRSMSTTSTERDVR-SGSDFTSLNVSDMSAESIRRTQ  58

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
            +PS ++RPSNLR FSF+ELKSAT+NF+RS  +GEGGFG VY+  IK S++P  R+++AVK
Sbjct  59   YPSFTDRPSNLRVFSFAELKSATRNFSRSLMVGEGGFGCVYRGVIKTSDEPNERIEIAVK  118

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QL+R+GLQG +EW+TE+NVLG
Sbjct  119  QLNRKGLQGQKEWLTEMNVLG  139



>ref|XP_004954409.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
[Setaria italica]
Length=427

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 101/140 (72%), Gaps = 1/140 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            MRC  F + E  EE  +  S  V S  +  ++ DV+ S  + +S N SD S ES  RTQ+
Sbjct  1    MRCLPFWHGEVKEEDPVTMSASVRSISTTSTERDVR-SGSDFTSLNVSDMSAESIRRTQY  59

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS ++RPSNLR FSF+ELKSAT+NF+RS  +GEGGFG VY+  IK S++P  R+++AVKQ
Sbjct  60   PSFTDRPSNLRVFSFAELKSATRNFSRSLMVGEGGFGCVYRGIIKTSDEPNERIEIAVKQ  119

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L+R+GLQG +EW+TE+NVLG
Sbjct  120  LNRKGLQGQKEWLTEMNVLG  139



>ref|XP_007162763.1| hypothetical protein PHAVU_001G178400g [Phaseolus vulgaris]
 ref|XP_007162764.1| hypothetical protein PHAVU_001G178400g [Phaseolus vulgaris]
 gb|ESW34757.1| hypothetical protein PHAVU_001G178400g [Phaseolus vulgaris]
 gb|ESW34758.1| hypothetical protein PHAVU_001G178400g [Phaseolus vulgaris]
Length=425

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 102/141 (72%), Gaps = 3/141 (2%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDT-STESRGRTQ  408
            M+CF F   EK +EPK  +ST   S  S  +D  ++ S  E +S  ASD+ STES  R  
Sbjct  1    MKCFTFSYGEKKDEPKGFRSTSGPSENSTCAD--IRRSGSELNSLEASDSGSTESLRRNA  58

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
             PS+S+RPSNLR F+ SELKSAT+NF+RS KIGEGGFG VY   IK+ E P+ + +VA+K
Sbjct  59   MPSLSQRPSNLRVFTVSELKSATRNFSRSVKIGEGGFGCVYLGLIKSVEVPSGKSEVAIK  118

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QLS+RG+QGHREWVTEVNVLG
Sbjct  119  QLSKRGMQGHREWVTEVNVLG  139



>emb|CDO99768.1| unnamed protein product [Coffea canephora]
Length=426

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            MRCF F N ++ +EPK  KS  V SS S  +D +V+ S  E +S N SD ST S      
Sbjct  1    MRCFSFSNTDRKDEPKTTKSISVRSSTSTSTDPEVRRSGSEYNSLNVSDISTGSSVGMSL  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
             S S RPSNLR FSF+ELK+AT+NF+RS  IGEGGFG VY+  I++ +D   ++D+AVKQ
Sbjct  61   TSASPRPSNLRVFSFTELKTATRNFSRSLMIGEGGFGGVYRGVIRDVQDLDKKLDIAVKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            LSRRGLQGH+EWVTEVNVLG
Sbjct  121  LSRRGLQGHKEWVTEVNVLG  140



>ref|XP_002315317.2| hypothetical protein POPTR_0010s23220g [Populus trichocarpa]
 gb|EEF01488.2| hypothetical protein POPTR_0010s23220g [Populus trichocarpa]
Length=438

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 105/149 (70%), Gaps = 9/149 (6%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIV-----KSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESR  396
            M+CF F + EK+EEPK V       +   +S S  +D D++ S  E +SQN SD STES 
Sbjct  1    MKCFHFSSREKNEEPKTVTKSVSVQSTSSTSMSMSTDRDLRKSGSELNSQNVSDFSTESS  60

Query  397  GRTQFP----SMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPA  564
             +  F     S+ +R SNL+ F+FSELK+ATKNF+RS  IGEGGFG VY+  I++ ED +
Sbjct  61   TKNSFANSFASLCQRQSNLKAFTFSELKTATKNFSRSVMIGEGGFGGVYRGVIRSMEDSS  120

Query  565  SRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
             ++D+AVKQLSRRGLQGH+EWVTEVNVLG
Sbjct  121  KKIDIAVKQLSRRGLQGHKEWVTEVNVLG  149



>ref|XP_011031711.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Populus euphratica]
 ref|XP_011031712.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Populus euphratica]
Length=426

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 100/145 (69%), Gaps = 5/145 (3%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKST-----PVLSSCSGFSDHDVKHSNLESSSQNASDTSTESR  396
            M+CF F N EK+EEPK             +S S  +D D++ S    +SQN SD STES 
Sbjct  1    MKCFHFSNKEKNEEPKTCNQIGSARSTSSTSTSMSTDRDLRKSGSGFNSQNVSDFSTESS  60

Query  397  GRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVD  576
             +  F ++S+R SNLR F+F ELK+ATKNF+RS  IGEGGFG VY+  I++ ED + ++D
Sbjct  61   TKNSFAALSQRQSNLRVFTFLELKTATKNFSRSVMIGEGGFGGVYRGVIRSMEDSSKKID  120

Query  577  VAVKQLSRRGLQGHREWVTEVNVLG  651
            +AVKQL RRGLQGH+EWVTEVN LG
Sbjct  121  IAVKQLGRRGLQGHKEWVTEVNFLG  145



>gb|ACJ85098.1| unknown [Medicago truncatula]
Length=385

 Score =   149 bits (375),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 105/144 (73%), Gaps = 4/144 (3%)
 Frame = +1

Query  232  MRCF---LFHNDEKDEEPKI-VKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRG  399
            M CF   +++ ++K +   + ++S   LS+ S +   DV+ +  E +S +ASD S++S  
Sbjct  1    MNCFPFNIYYGEKKGDAKGLQMQSLSGLSNNSTYGGSDVRRTGSELNSLDASDNSSDSLR  60

Query  400  RTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
            R  FP++S+RPSNLR F+ SELKSATKNF RS  +GEGGFG VYK  IK+ +DPA ++++
Sbjct  61   RNAFPNLSQRPSNLRVFTVSELKSATKNFGRSVMLGEGGFGCVYKGLIKSVDDPAKKIEI  120

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            AVKQL +RG+QGH+EWVTEVNVLG
Sbjct  121  AVKQLGKRGIQGHKEWVTEVNVLG  144



>gb|KEH42211.1| kinase 1B [Medicago truncatula]
Length=436

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 106/146 (73%), Gaps = 4/146 (3%)
 Frame = +1

Query  226  MTMRCF---LFHNDEKDEEPKI-VKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTES  393
            + M CF   +++ ++K +   + ++S   LS+ S +   DV+ +  E +S +ASD S++S
Sbjct  8    IAMNCFPFNIYYGEKKGDAKGLQMQSLSGLSNNSTYGGSDVRRTGSELNSLDASDNSSDS  67

Query  394  RGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRV  573
              R  FP++S+RPSNLR F+ SELKSATKNF RS  +GEGGFG VYK  IK+ +DPA ++
Sbjct  68   LRRNAFPNLSQRPSNLRVFTVSELKSATKNFGRSVMLGEGGFGCVYKGLIKSVDDPAKKI  127

Query  574  DVAVKQLSRRGLQGHREWVTEVNVLG  651
            ++AVKQL +RG+QGH+EWVTEVNVLG
Sbjct  128  EIAVKQLGKRGIQGHKEWVTEVNVLG  153



>ref|XP_006297732.1| hypothetical protein CARUB_v10013766mg [Capsella rubella]
 gb|EOA30630.1| hypothetical protein CARUB_v10013766mg [Capsella rubella]
Length=426

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 103/142 (73%), Gaps = 5/142 (4%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTES-RGR-T  405
            M+CFLF   +K  E K   S   +S  S FSD ++  S  E +S++ S TSTES  GR  
Sbjct  1    MKCFLFSGGDKKGEQKTPNS---VSLTSNFSDREINRSGSEFNSRDVSGTSTESSMGRKN  57

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             +P+MS R SNLR+FS ++LKSATKNF+RS  IGEGGFG V++ T+++ EDP+ +++VAV
Sbjct  58   SYPTMSTRASNLREFSITDLKSATKNFSRSVMIGEGGFGCVFRGTVRSLEDPSIKIEVAV  117

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQL +RGLQGH+EWVTEVN LG
Sbjct  118  KQLGKRGLQGHKEWVTEVNFLG  139



>ref|XP_009123163.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Brassica 
rapa]
 ref|XP_009123166.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Brassica 
rapa]
Length=428

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 105/142 (74%), Gaps = 4/142 (3%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTES-RGR-T  405
            M+CF F + +K EE    K+   +S  S FSD D+  S  + +S++AS TSTES  GR  
Sbjct  1    MKCFKFSSGDKKEEHN--KTPKSVSLTSNFSDRDINRSGSDFNSRDASGTSTESSMGRKN  58

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             +PSMS R SNLR+FS ++LK+ATKNF+RS  IGEGGFG V++ T+++ EDP+ +++VAV
Sbjct  59   SYPSMSARESNLREFSVTDLKAATKNFSRSVMIGEGGFGCVFRGTVRDLEDPSIKIEVAV  118

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQL +RGLQGH+EWVTEVN LG
Sbjct  119  KQLGKRGLQGHKEWVTEVNFLG  140



>ref|XP_003590458.1| Protein kinase 2A [Medicago truncatula]
 gb|AES60709.1| kinase 1B [Medicago truncatula]
 gb|AFK42573.1| unknown [Medicago truncatula]
Length=427

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 105/144 (73%), Gaps = 4/144 (3%)
 Frame = +1

Query  232  MRCF---LFHNDEKDEEPKI-VKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRG  399
            M CF   +++ ++K +   + ++S   LS+ S +   DV+ +  E +S +ASD S++S  
Sbjct  1    MNCFPFNIYYGEKKGDAKGLQMQSLSGLSNNSTYGGSDVRRTGSELNSLDASDNSSDSLR  60

Query  400  RTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
            R  FP++S+RPSNLR F+ SELKSATKNF RS  +GEGGFG VYK  IK+ +DPA ++++
Sbjct  61   RNAFPNLSQRPSNLRVFTVSELKSATKNFGRSVMLGEGGFGCVYKGLIKSVDDPAKKIEI  120

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            AVKQL +RG+QGH+EWVTEVNVLG
Sbjct  121  AVKQLGKRGIQGHKEWVTEVNVLG  144



>ref|XP_010684093.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Beta 
vulgaris subsp. vulgaris]
Length=423

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 97/141 (69%), Gaps = 1/141 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M CF F +     EPK +K    LSS S   D +      E +SQN SDTST+S  +  F
Sbjct  1    MGCFPFFDGANTGEPKAMKVVSNLSSNSALGDDEENIYGSELNSQNVSDTSTDSIRKNSF  60

Query  412  PSMSER-PSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
             SMS+R  SNLR F+F ELKS TK F+RS +IGEGGFG VYK  IK+ EDP+ +VDVAVK
Sbjct  61   FSMSQRSTSNLRVFTFQELKSCTKGFSRSGRIGEGGFGCVYKGMIKSLEDPSVKVDVAVK  120

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QL +RGLQGH+EWVTEV+VLG
Sbjct  121  QLGKRGLQGHKEWVTEVSVLG  141



>ref|XP_008778999.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Phoenix 
dactylifera]
 ref|XP_008779000.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Phoenix 
dactylifera]
Length=430

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F N  K  E     S    SS +  +D D++ S  E +SQN SD S +S GR Q+
Sbjct  1    MKCFPFPNGLKKSELLSTFSASARSSSTTSTDRDMRRSASEFNSQNVSDMSADSLGRCQY  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS S+RPS+LR F+ S+L++AT+NF+RS  +GEGGFG VY+ TIK+SEDP+ ++++AVKQ
Sbjct  61   PSFSQRPSDLRVFTLSDLRTATRNFSRSMMVGEGGFGCVYRGTIKSSEDPSMKLEIAVKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L+R+GLQGH+EW+TEVNVLG
Sbjct  121  LNRKGLQGHKEWLTEVNVLG  140



>ref|XP_008233294.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Prunus 
mume]
Length=429

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 106/141 (75%), Gaps = 2/141 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFS-DHDVKHSNLESSSQNASDTSTESRGRTQ  408
            M+CF F+N EK++E K  KST   S+   FS D D + S  ES+SQNA++ ST S  ++ 
Sbjct  1    MKCFYFYNKEKNDEAKTTKSTSTRSTSPFFSLDRDPRKSGSESNSQNATEFSTASSAKS-  59

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
            F ++S+R SNLR+F+ SELK+ATKNF+ S  +GEGGFG VY+  I+ +EDP  ++DVAVK
Sbjct  60   FAALSQRQSNLREFTCSELKAATKNFSLSLMLGEGGFGGVYRGVIRTTEDPHKKIDVAVK  119

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QLS+RG QGH+EWVTEVNVLG
Sbjct  120  QLSKRGFQGHKEWVTEVNVLG  140



>ref|XP_007218041.1| hypothetical protein PRUPE_ppa006060mg [Prunus persica]
 gb|EMJ19240.1| hypothetical protein PRUPE_ppa006060mg [Prunus persica]
Length=429

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 106/141 (75%), Gaps = 2/141 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFS-DHDVKHSNLESSSQNASDTSTESRGRTQ  408
            M+CF F+N EK++E K  KST   S+   FS D D + S  ES+SQNA++ ST S  ++ 
Sbjct  1    MKCFYFYNKEKNDEAKTTKSTSTRSTSPFFSLDRDPRKSGSESNSQNATEFSTASSAKS-  59

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
            F ++S+R SNLR+F+ SELK+ATKNF+ S  +GEGGFG VY+  I+ +EDP  ++DVAVK
Sbjct  60   FAALSQRQSNLREFTCSELKAATKNFSLSLMLGEGGFGGVYRGVIRTTEDPHKKIDVAVK  119

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QLS+RG QGH+EWVTEVNVLG
Sbjct  120  QLSKRGFQGHKEWVTEVNVLG  140



>ref|XP_011077249.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
 ref|XP_011077250.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
 ref|XP_011077251.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
 ref|XP_011077253.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
Length=423

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            MRCF F N  K +EPK  KST   S+ S  +D DV+ S  E SSQN SD S+ S  +  F
Sbjct  1    MRCFPFSNSNKTDEPKTTKSTSGRSTTSTSTDQDVRKSGSEYSSQNISDISSASSAKISF  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
             S+S+RPSNLR F+F+ELK+AT+NF+RS  +GEGGFGPVY+  ++ + D + R+D+AVKQ
Sbjct  61   ASLSQRPSNLRVFTFAELKTATRNFSRSLMLGEGGFGPVYRGVLRETHDSSKRIDIAVKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            LS RGLQGH+EWVTEVNVLG
Sbjct  121  LSSRGLQGHKEWVTEVNVLG  140



>ref|XP_004149901.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Cucumis 
sativus]
Length=430

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 99/144 (69%), Gaps = 5/144 (3%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFS---DHDVK-HSNLESSSQNASDTSTESRG  399
            M+CF F N+E+    +    +    SC+  S   + D K   + + +SQN S+ S  S  
Sbjct  1    MKCFYFFNNERTVGTRTTTKSNSFLSCTSNSTSMNQDFKMFDSADLNSQNVSEISVASSA  60

Query  400  RTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
               F ++S+R SNLR+F+FSELK+ATKNF+RS  +GEGGFG VY+  I+NSEDP  R+D+
Sbjct  61   -VSFAALSQRQSNLREFTFSELKAATKNFSRSLMVGEGGFGSVYRGAIRNSEDPHKRIDI  119

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            AVKQLSRRGLQGH+EWVTEVN LG
Sbjct  120  AVKQLSRRGLQGHKEWVTEVNFLG  143



>emb|CDY54619.1| BnaA05g28720D [Brassica napus]
Length=427

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 10/146 (7%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTES---RGR  402
            M+CF F   +K +E K    TP +S  S FSD D+  S  E +S++ S TSTES   R  
Sbjct  1    MKCFFFSGGDKKDEHK----TPNVSQTSNFSDRDINRSGSEFNSRDVSGTSTESSMGRRN  56

Query  403  TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
            +  P+MS R SNLR+FS ++LK+ATKNF+RS  IGEGGFG VY+ T+++ EDP+ +++VA
Sbjct  57   SYPPTMSTRASNLREFSITDLKAATKNFSRSVMIGEGGFGCVYRGTVRSLEDPSIKIEVA  116

Query  583  VKQLSRRGLQ---GHREWVTEVNVLG  651
            VKQL +RGLQ   GH+EWVTEVN LG
Sbjct  117  VKQLGKRGLQASLGHKEWVTEVNFLG  142



>ref|NP_187594.1| protein kinase family protein [Arabidopsis thaliana]
 ref|NP_974270.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AAF23252.1|AC015985_10 putative protein kinase [Arabidopsis thaliana]
 gb|AAM14067.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM67514.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEE74818.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AEE74819.1| protein kinase family protein [Arabidopsis thaliana]
Length=418

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 103/143 (72%), Gaps = 7/143 (5%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPV-LSSCSGFSDHDVKHSNLESSSQNASDTSTES-RGR-  402
            M+CFLF   +K  E K    TP+ +S  S FSD ++  S  E +S++ S TSTES  GR 
Sbjct  1    MKCFLFSGGDKRGEQK----TPISVSLTSIFSDREINRSGSEFNSRDVSGTSTESSMGRK  56

Query  403  TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
              +P +S R SNLR+FS ++LKSATKNF+RS  IGEGGFG V++ T++N ED + +++VA
Sbjct  57   NSYPPVSTRASNLREFSITDLKSATKNFSRSVMIGEGGFGCVFRGTVRNLEDSSVKIEVA  116

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            VKQL +RGLQGH+EWVTEVN LG
Sbjct  117  VKQLGKRGLQGHKEWVTEVNFLG  139



>dbj|BAH19927.1| AT3G09830 [Arabidopsis thaliana]
Length=418

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 103/143 (72%), Gaps = 7/143 (5%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPV-LSSCSGFSDHDVKHSNLESSSQNASDTSTES-RGR-  402
            M+CFLF   +K  E K    TP+ +S  S FSD ++  S  E +S++ S TSTES  GR 
Sbjct  1    MKCFLFSGGDKRGEQK----TPISVSLTSIFSDREINRSGSEFNSRDVSGTSTESSMGRK  56

Query  403  TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
              +P +S R SNLR+FS ++LKSATKNF+RS  IGEGGFG V++ T++N ED + +++VA
Sbjct  57   NSYPPVSTRASNLREFSITDLKSATKNFSRSVMIGEGGFGCVFRGTVRNLEDSSVKIEVA  116

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            VKQL +RGLQGH+EWVTEVN LG
Sbjct  117  VKQLGKRGLQGHKEWVTEVNFLG  139



>ref|XP_008343482.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Malus 
domestica]
Length=432

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 102/143 (71%), Gaps = 3/143 (2%)
 Frame = +1

Query  232  MRCFL-FHNDEKDEEPKIVKSTPVLSSCSGFS-DHDVKHSNLESSSQNASDTSTESRGRT  405
            M+CF  F N +KD+EPK  KS    S+ S FS D D + S+ E +SQNA+   + +    
Sbjct  1    MKCFYKFSNRDKDDEPKTTKSISTRSASSFFSLDRDPRKSSSEFNSQNATAELSTTSSAK  60

Query  406  QFPSMSERPSN-LRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
             F ++S+R SN LR+F+ SELK+ATKNF+ S  +GEGGFG VYK  I+++ED   R+DVA
Sbjct  61   SFAALSQRQSNNLREFTCSELKAATKNFSLSLMLGEGGFGGVYKGNIRSTEDQQKRIDVA  120

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            VKQLS+RG QGH+EWVTEVNVLG
Sbjct  121  VKQLSKRGFQGHKEWVTEVNVLG  143



>ref|XP_010918690.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Elaeis guineensis]
Length=386

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 103/140 (74%), Gaps = 1/140 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF   N EK E P+  +S   +SS +  +D D++ S  E +S + SD S +S  R+QF
Sbjct  1    MKCFPLSNREKGE-PQERRSPSAMSSSTTSTDRDMRMSASEFNSLSVSDMSADSIWRSQF  59

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS  +RPSNLR F+F EL++AT+NF+RS  IGEGGFG VY+ TI++S +  +R DVA+KQ
Sbjct  60   PSFLQRPSNLRTFTFEELRNATRNFSRSLMIGEGGFGCVYRGTIRSSVETNARKDVAIKQ  119

Query  592  LSRRGLQGHREWVTEVNVLG  651
            LSRRGLQGH+EW+TEV+VLG
Sbjct  120  LSRRGLQGHKEWLTEVHVLG  139



>ref|XP_010235978.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Brachypodium 
distachyon]
Length=427

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 100/140 (71%), Gaps = 1/140 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M C  F + E  EE    KS  V S  +  ++ +V  S  + +S N SD S ES  RTQ+
Sbjct  1    MGCLAFLHGESKEERPAPKSASVRSFSTTSTEREVP-SGSDLTSMNISDMSAESIRRTQY  59

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS ++RPSNLR F+FSELK+AT+NF+RS  +GEGGFG VY+  IKNS++P  R+++AVKQ
Sbjct  60   PSFTDRPSNLRVFTFSELKNATRNFSRSLMVGEGGFGCVYRGIIKNSDEPNERIEIAVKQ  119

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L+R+G+QG +EW+TE+NVLG
Sbjct  120  LNRKGVQGQKEWLTEMNVLG  139



>ref|XP_010918688.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Elaeis guineensis]
 ref|XP_010918689.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Elaeis guineensis]
Length=427

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 103/140 (74%), Gaps = 1/140 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF   N EK E P+  +S   +SS +  +D D++ S  E +S + SD S +S  R+QF
Sbjct  1    MKCFPLSNREKGE-PQERRSPSAMSSSTTSTDRDMRMSASEFNSLSVSDMSADSIWRSQF  59

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS  +RPSNLR F+F EL++AT+NF+RS  IGEGGFG VY+ TI++S +  +R DVA+KQ
Sbjct  60   PSFLQRPSNLRTFTFEELRNATRNFSRSLMIGEGGFGCVYRGTIRSSVETNARKDVAIKQ  119

Query  592  LSRRGLQGHREWVTEVNVLG  651
            LSRRGLQGH+EW+TEV+VLG
Sbjct  120  LSRRGLQGHKEWLTEVHVLG  139



>ref|XP_010032169.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Eucalyptus 
grandis]
 ref|XP_010032170.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Eucalyptus 
grandis]
 gb|KCW51572.1| hypothetical protein EUGRSUZ_J01074 [Eucalyptus grandis]
Length=430

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 103/143 (72%), Gaps = 3/143 (2%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFS-DHDVKHSNLESSSQNASDTSTESRGRTQ  408
            M+CF F   +K+ E K +KS  V S+ +  S D D++ S  E +SQNASD ST S     
Sbjct  1    MKCFPFTIWDKNGESKTMKSVSVRSTSTSMSADRDMRTSWSELTSQNASDFSTASSAAAT  60

Query  409  --FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
              F  +S+R SNLR+F+F ELK+ATKNF+RS  IGEGGFG V++  +++ +DP  ++D+A
Sbjct  61   NPFAVLSQRQSNLREFTFEELKAATKNFSRSVMIGEGGFGGVFRGIMRSEDDPHKKIDIA  120

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            VKQLSRRGLQGH+EW+TEVNVLG
Sbjct  121  VKQLSRRGLQGHKEWITEVNVLG  143



>ref|XP_004307370.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Fragaria 
vesca subsp. vesca]
Length=430

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 104/141 (74%), Gaps = 4/141 (3%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFS-DHDVKHSNLESSSQNASDTSTESRGRTQ  408
            M+CF F++ EK++EPK  K     S+ S FS D D + S  E +SQ+ S+ ST S  ++ 
Sbjct  1    MKCFYFNSKEKNDEPKTTKCPSGHSTSSFFSLDRDPRRS--EFNSQDVSEFSTTSSVKS-  57

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
            F  MS+R SNL +F+ +ELK+ATKNF+ S  +GEGGFG VY+  IK+++DP  ++D+AVK
Sbjct  58   FAVMSQRHSNLSEFTCAELKAATKNFSLSLMLGEGGFGGVYRGVIKSAQDPHKKIDIAVK  117

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QLS+RGLQGH+EWVTEVNVLG
Sbjct  118  QLSKRGLQGHKEWVTEVNVLG  138



>ref|XP_008365181.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Malus 
domestica]
Length=432

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 104/143 (73%), Gaps = 3/143 (2%)
 Frame = +1

Query  232  MRCFL-FHNDEKDEEPKIVKSTPVLSSCSGFS-DHDVKHSNLESSSQNASDTSTESRGRT  405
            M+CF  F+N +KD+EPK  KS    S+ S FS D D + S+ E +SQNA+   + +    
Sbjct  1    MKCFYNFYNRDKDDEPKSPKSISTRSASSFFSLDRDPRKSSSEFNSQNATAELSTTSSAK  60

Query  406  QFPSMSERPSN-LRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
             F ++S+R SN LR+F+ SELK+ATKNF+ S  +GEGGFG VY+  I+++ED   R+DVA
Sbjct  61   SFAALSQRQSNNLREFTCSELKAATKNFSLSLMLGEGGFGGVYRGHIQSTEDQHQRIDVA  120

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            VKQLS+RGLQGH+EWVTEVNVLG
Sbjct  121  VKQLSKRGLQGHKEWVTEVNVLG  143



>ref|XP_008456511.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Cucumis 
melo]
Length=430

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 101/144 (70%), Gaps = 5/144 (3%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFS---DHDVK-HSNLESSSQNASDTSTESRG  399
            M+CF F N+E+  E +    +  + SC+  S   + D K   + + +SQN S+ S  S  
Sbjct  1    MKCFYFFNNERTVETRTTTKSNSILSCTSNSTSMNQDFKMFDSADLNSQNVSEMSVASSA  60

Query  400  RTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
               F ++S+R SNLR+F+FS+LK+ATKNF+RS  IGEGGFG VY+  I+NSEDP  R+D+
Sbjct  61   -ISFAALSQRQSNLREFTFSDLKAATKNFSRSLMIGEGGFGSVYRGAIRNSEDPHKRIDI  119

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            AVKQLSRRGLQGH+EWVTEVN LG
Sbjct  120  AVKQLSRRGLQGHKEWVTEVNFLG  143



>ref|XP_009386350.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=424

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 101/140 (72%), Gaps = 3/140 (2%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F N     E +   S  V S+ +  ++ D++ S  E +S + +D+ T+S GR Q+
Sbjct  1    MKCFAFRNGATKAELQARLSASVRSNSTTSTERDMRRSGSEFNSGDVTDSGTDSVGRPQY  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS S+RP NLR F+FSEL++ATKNF+RS  +GEGGFG VY+ TIK+ +DP +++++AVKQ
Sbjct  61   PSFSQRPINLRVFTFSELRNATKNFSRSLMVGEGGFGCVYRGTIKSLDDPDAKIEIAVKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L+R+GLQ   EW+TEVNVLG
Sbjct  121  LNRKGLQ---EWLTEVNVLG  137



>ref|XP_009384041.1| PREDICTED: probable receptor-like protein kinase At3g55450 [Musa 
acuminata subsp. malaccensis]
Length=428

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F N     E +   S  V S+ +  ++ +V+ S  E ++ + S    +S GR+ +
Sbjct  1    MKCFPFLNGASKAELQARFSASVRSNSTTSTECNVRRSGPEFNTGDVSSIGADSLGRSLY  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS S+ PSNLR F+FSEL++AT+NF+RS  +GEGGFG VY+ TIK+ +DP  R+++AVKQ
Sbjct  61   PSFSQIPSNLRVFTFSELRNATRNFSRSLMVGEGGFGCVYRGTIKSFKDPNMRIEIAVKQ  120

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L+R+GLQGHREW+ EVNVLG
Sbjct  121  LNRKGLQGHREWLNEVNVLG  140



>gb|KHN48255.1| Putative receptor-like protein kinase [Glycine soja]
Length=431

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 103/142 (73%), Gaps = 8/142 (6%)
 Frame = +1

Query  226  MTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRT  405
            + M+CF F+  EK + PK ++S    S+ S + + +++ S  E +S +ASD ST+S  R+
Sbjct  8    VAMKCFPFYFGEKKDGPKSLQSISGQSNSSTYVEAEMRRSGSELNSMDASDNSTDSLRRS  67

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             FPS+S+RPSNLR+F+ SELK+ATK+F+RS  +GEGGFG VYK  IK+ +DP+++++VAV
Sbjct  68   AFPSLSQRPSNLREFTVSELKTATKSFSRSVMLGEGGFGCVYKGLIKSVDDPSTKIEVAV  127

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQ        H+EWVTEVNVLG
Sbjct  128  KQ--------HKEWVTEVNVLG  141



>ref|XP_008646892.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Zea 
mays]
Length=178

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 94/140 (67%), Gaps = 4/140 (3%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            MRC  F + +  E+  + KS  V S     S      S  + +S N SD S ES  RTQ+
Sbjct  1    MRCLPFLHGDVSEKDPVTKSASVRSM----STTSRSRSGSDFTSLNVSDMSAESIRRTQY  56

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS ++ PSNLR FSF+ELKSAT+NF+RS  +GEGGFG V+   IK S+ P  R+++AVKQ
Sbjct  57   PSFTDCPSNLRVFSFAELKSATRNFSRSLMLGEGGFGCVFSGIIKTSDKPNERIEIAVKQ  116

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L+R+GLQG +EW+TE+NVLG
Sbjct  117  LNRKGLQGQKEWLTEMNVLG  136



>ref|XP_006436457.1| hypothetical protein CICLE_v10031608mg [Citrus clementina]
 gb|ESR49697.1| hypothetical protein CICLE_v10031608mg [Citrus clementina]
Length=399

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  322  SDHDVKHSNLESSSQNASDTSTESRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTK  501
            +D DV+ S  E +SQNASD S+ES  R  F  +S+R SNLR F+FSELK+ATKNF+RS  
Sbjct  3    TDRDVRKSGSEFNSQNASDFSSESSSRNTFAVLSQRQSNLRVFTFSELKTATKNFSRSLM  62

Query  502  IGEGGFGPVYKATIKNSEDPASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            IGEGGFG VY+  I+++ED   ++D+AVKQLSRRGLQGH+EWVTEVNVLG
Sbjct  63   IGEGGFGGVYRGVIRSTEDSHKKIDIAVKQLSRRGLQGHKEWVTEVNVLG  112



>gb|KHN09513.1| Putative receptor-like protein kinase [Glycine soja]
Length=398

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 87/108 (81%), Gaps = 1/108 (1%)
 Frame = +1

Query  331  DVKHSNLESSSQNASDT-STESRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIG  507
            +V+ S  E +SQ+ SD  S+ES+ R   PS+S+RPSNLR F+ SELKSATKNF+RS  IG
Sbjct  6    EVRRSGSELNSQDVSDNGSSESQRRNAIPSLSQRPSNLRVFTVSELKSATKNFSRSVMIG  65

Query  508  EGGFGPVYKATIKNSEDPASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            EGGFG VY   I+++ED + R++VAVKQLS+RG+QGHREWVTEVNVLG
Sbjct  66   EGGFGCVYLGLIRSAEDSSRRIEVAVKQLSKRGMQGHREWVTEVNVLG  113



>ref|XP_002871026.1| hypothetical protein ARALYDRAFT_908199 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47285.1| hypothetical protein ARALYDRAFT_908199 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 100/142 (70%), Gaps = 8/142 (6%)
 Frame = +1

Query  232  MRCFLFH-NDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTST-ESRGRT  405
            M+CFLF   D+KDE+    +S   +S  S FSD  V  S+ + S ++ S TST  S GR 
Sbjct  1    MKCFLFLLGDKKDEQ----RSPKPVSPTSNFSD--VNKSSSDFSPRDVSGTSTVSSTGRN  54

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
               SMS R +NLR+F+  +LKSAT+NF+RS  IGEGGFG VY  TIKN EDP+ +++VAV
Sbjct  55   SNTSMSARENNLREFTIGDLKSATRNFSRSGMIGEGGFGCVYWGTIKNLEDPSKKIEVAV  114

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQL +RGLQGH+EWVTEVN LG
Sbjct  115  KQLGKRGLQGHKEWVTEVNFLG  136



>emb|CDY41315.1| BnaA01g32040D [Brassica napus]
Length=434

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 105/157 (67%), Gaps = 19/157 (12%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTES-RGR-T  405
            M+CF F + +K EE    K+   +S  S FSD D+  S  + +S++AS TSTES  GR  
Sbjct  1    MKCFKFSSGDKKEEHN--KTPKSVSLTSNFSDRDINRSGSDFNSRDASGTSTESSMGRKN  58

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             +PSMS R SNLR+FS ++LK+ATKNF+RS  IGEGGFG V++ T+++ EDP+ +++VAV
Sbjct  59   SYPSMSARESNLREFSVTDLKAATKNFSRSVMIGEGGFGCVFRGTVRDLEDPSIKIEVAV  118

Query  586  KQLSRRGLQ---------------GHREWVTEVNVLG  651
            KQL +RGLQ               GH+EWVTEVN LG
Sbjct  119  KQLGKRGLQAKVIYIIYIYLKIFRGHKEWVTEVNFLG  155



>dbj|BAJ91599.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96520.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +1

Query  322  SDHDVKHSNLESSSQNASDTSTESRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTK  501
            ++ D   S  + +S N SD S ES  RTQ+PS ++RP+NLR FSFSELK+AT+NF+RS  
Sbjct  41   TERDNPRSGSDLNSINVSDMSAESIRRTQYPSFTDRPANLRVFSFSELKAATRNFSRSLM  100

Query  502  IGEGGFGPVYKATIKNSEDPASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            +GEGGFG VY+  IK S+DP  RV++AVKQL+R+G+QG +EW+TE+NVLG
Sbjct  101  VGEGGFGCVYRGVIKGSDDPTQRVEIAVKQLNRKGVQGQKEWLTEMNVLG  150



>ref|NP_001145785.1| uncharacterized LOC100279292 [Zea mays]
 gb|ACL52583.1| unknown [Zea mays]
 gb|AFW63976.1| putative protein kinase superfamily protein [Zea mays]
Length=277

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 94/140 (67%), Gaps = 4/140 (3%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            MRC  F + +  E+  + KS    +S    S      S  + +S N SD S ES  RTQ+
Sbjct  1    MRCLPFLHGDVSEKDPVTKS----ASVRSMSTTSRSRSGSDFTSLNVSDMSAESIRRTQY  56

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS ++ PSNLR FSF+ELKSAT+NF+RS  +GEGGFG V+   IK S+ P  R+++AVKQ
Sbjct  57   PSFTDCPSNLRVFSFAELKSATRNFSRSLMLGEGGFGCVFSGIIKTSDKPNERIEIAVKQ  116

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L+R+GLQG +EW+TE+NVLG
Sbjct  117  LNRKGLQGQKEWLTEMNVLG  136



>ref|NP_195952.1| protein kinase family protein [Arabidopsis thaliana]
 emb|CAB83288.1| protein kinase-like [Arabidopsis thaliana]
 dbj|BAB08392.1| protein serine/threonine kinase [Arabidopsis thaliana]
 gb|ABI49463.1| At5g03320 [Arabidopsis thaliana]
 gb|AED90584.1| protein kinase family protein [Arabidopsis thaliana]
Length=420

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 99/142 (70%), Gaps = 8/142 (6%)
 Frame = +1

Query  232  MRCFLF-HNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTST-ESRGRT  405
            M+CFLF   D+KDE+    +S   +S  S FSD  V  S  + S ++ S TST  S GR 
Sbjct  1    MKCFLFPLGDKKDEQ----RSPKPVSPTSNFSD--VNKSGSDFSPRDVSGTSTVSSTGRN  54

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
               SMS R +NLR+F+  +LKSAT+NF+RS  IGEGGFG V+  TIKN EDP+ +++VAV
Sbjct  55   SNTSMSARENNLREFTIGDLKSATRNFSRSGMIGEGGFGCVFWGTIKNLEDPSKKIEVAV  114

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQL +RGLQGH+EWVTEVN LG
Sbjct  115  KQLGKRGLQGHKEWVTEVNFLG  136



>ref|XP_009397532.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009397533.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Musa 
acuminata subsp. malaccensis]
Length=408

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 100/142 (70%), Gaps = 3/142 (2%)
 Frame = +1

Query  226  MTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRT  405
            M M CF F N EK   P+  KS    S+ S  +D D + S  ES   ++SD S  S GR+
Sbjct  1    MRMNCFQFLNGEK-MVPQSRKSASTRSNSSRSTDRDRRVS--ESDFNSSSDMSDFSVGRS  57

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
            +FPS+S+R +N R F+F ELK AT+NF+RS  IGEGGFG VYK  I++S DP++ +DVAV
Sbjct  58   RFPSLSQRRNNFRIFTFEELKHATRNFSRSLMIGEGGFGCVYKGIIQSSNDPSTTLDVAV  117

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQLSR GLQGH+EW+TEV+VLG
Sbjct  118  KQLSRGGLQGHKEWLTEVDVLG  139



>ref|XP_006398776.1| hypothetical protein EUTSA_v10013665mg [Eutrema salsugineum]
 gb|ESQ40229.1| hypothetical protein EUTSA_v10013665mg [Eutrema salsugineum]
Length=418

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 96/144 (67%), Gaps = 15/144 (10%)
 Frame = +1

Query  232  MRCFLF-HNDEKDEE--PKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTST-ESRG  399
            M+CFLF H D+KDE+  PK V  T + S   G             S  + S TST  S G
Sbjct  1    MKCFLFPHGDKKDEQRSPKPVSPTSIFSDRGG-----------NKSGSDISGTSTVSSTG  49

Query  400  RTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
            R    SMS R +NLR+F+ S+LKSAT++F+RS  IGEGGFG VY  TIK+ EDP+ +++V
Sbjct  50   RNSNTSMSARENNLREFTISDLKSATRSFSRSVMIGEGGFGCVYWGTIKSLEDPSKKIEV  109

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            AVKQL +RGLQGH+EWVTEVN LG
Sbjct  110  AVKQLGKRGLQGHKEWVTEVNFLG  133



>ref|XP_009368900.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Pyrus 
x bretschneideri]
Length=432

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 104/143 (73%), Gaps = 3/143 (2%)
 Frame = +1

Query  232  MRCFL-FHNDEKDEEPKIVKSTPVLSSCSGFS-DHDVKHSNLESSSQNASDTSTESRGRT  405
            M+CF  F+N EKD+EPK  KS    S+ S FS D D + S+ E +SQNA+   + +    
Sbjct  1    MKCFSNFYNREKDDEPKSPKSISSRSASSFFSLDRDPRKSSSEFNSQNATAELSTTSSAK  60

Query  406  QFPSMSERPSN-LRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
             F ++S+R SN LR+F+ SELK+ATKNF+ S  +GEGGFG VY+  I+++ED   R+DVA
Sbjct  61   SFAALSQRQSNNLREFTCSELKAATKNFSLSLMLGEGGFGGVYRGHIQSTEDQHQRIDVA  120

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            VKQLS+RGLQGH+EWVTEVNVLG
Sbjct  121  VKQLSKRGLQGHKEWVTEVNVLG  143



>ref|XP_008677078.1| PREDICTED: uncharacterized LOC100279292 isoform X1 [Zea mays]
 ref|XP_008677079.1| PREDICTED: uncharacterized LOC100279292 isoform X1 [Zea mays]
 gb|AFW63975.1| putative protein kinase superfamily protein [Zea mays]
Length=426

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 94/140 (67%), Gaps = 4/140 (3%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            MRC  F + +  E+  + KS    +S    S      S  + +S N SD S ES  RTQ+
Sbjct  1    MRCLPFLHGDVSEKDPVTKS----ASVRSMSTTSRSRSGSDFTSLNVSDMSAESIRRTQY  56

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS ++ PSNLR FSF+ELKSAT+NF+RS  +GEGGFG V+   IK S+ P  R+++AVKQ
Sbjct  57   PSFTDCPSNLRVFSFAELKSATRNFSRSLMLGEGGFGCVFSGIIKTSDKPNERIEIAVKQ  116

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L+R+GLQG +EW+TE+NVLG
Sbjct  117  LNRKGLQGQKEWLTEMNVLG  136



>ref|XP_006287832.1| hypothetical protein CARUB_v10001049mg [Capsella rubella]
 gb|EOA20730.1| hypothetical protein CARUB_v10001049mg [Capsella rubella]
Length=420

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 98/142 (69%), Gaps = 8/142 (6%)
 Frame = +1

Query  232  MRCFLFH-NDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTST-ESRGRT  405
            M+CFLF   D KD++    +S   +S  S FSD  V  S  + S ++ S TST  S GR 
Sbjct  1    MKCFLFPLGDRKDDQ----RSPKPVSPTSNFSD--VNKSGSDFSPRDVSGTSTVSSTGRN  54

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
               S+S R +NLR+F+  +LKSAT+NF+RS  IGEGGFG VY  TIK+ EDP+ +++VAV
Sbjct  55   SNISISARENNLREFTIGDLKSATRNFSRSGMIGEGGFGCVYWGTIKSLEDPSKKIEVAV  114

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQL +RGLQGH+EWVTEVN LG
Sbjct  115  KQLGKRGLQGHKEWVTEVNFLG  136



>ref|XP_009386591.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009386592.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009386593.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Musa 
acuminata subsp. malaccensis]
Length=424

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = +1

Query  238  CFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQFPS  417
            CFLF N     E +   S  + S+ +  ++ D++ S  E +S++ S  + +   R  +PS
Sbjct  2    CFLFLNGATKAELQSRFSASIRSNSTTSTERDMRRSGSELNSRDVSSDAADYMERPLYPS  61

Query  418  MSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQLS  597
             S+  SNLR F+FSEL++AT+NF+RS  +GEGGFG VYK TIK+ EDP + +++AVK+L+
Sbjct  62   FSQITSNLRVFTFSELRTATRNFSRSLMVGEGGFGCVYKGTIKSLEDPNANIEIAVKKLN  121

Query  598  RRGLQGHREWVTEVNVLG  651
            R+G QGH+EW+TEVNVLG
Sbjct  122  RKGQQGHKEWLTEVNVLG  139



>ref|XP_010490808.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Camelina 
sativa]
Length=421

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 97/141 (69%), Gaps = 5/141 (4%)
 Frame = +1

Query  232  MRCFLF-HNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQ  408
            M+CFLF   D+KDE+    +S   +S  S FSD +   S+      + + T + S GR  
Sbjct  1    MKCFLFPLGDKKDEQ----RSPKPVSPTSIFSDVNKSGSDFSPRDVSGTSTVSSSTGRNS  56

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
              SMS R +NLR+F+ S+LKSAT+NF+RS  IGEGGFG VY  TIKN EDP+ +++VAVK
Sbjct  57   NTSMSARENNLREFTISDLKSATRNFSRSGMIGEGGFGCVYWGTIKNLEDPSKKIEVAVK  116

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QL +RGLQGH+EWVTEVN LG
Sbjct  117  QLGKRGLQGHKEWVTEVNFLG  137



>ref|XP_010423734.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Camelina 
sativa]
Length=422

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 99/147 (67%), Gaps = 16/147 (11%)
 Frame = +1

Query  232  MRCFLFH-NDEKDEE--PKIVKSTPVLS----SCSGFSDHDVKHSNLESSSQNASDTSTE  390
            M+CFLF   D+KDE+  PK V  T + S    S S FS  DV  ++  SSS   +  +T 
Sbjct  1    MKCFLFLLGDKKDEQRSPKPVSPTSIFSDVNKSGSDFSPRDVSGTSTVSSSTGRNSNTT-  59

Query  391  SRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASR  570
                    SMS R +NLR+FS S+LKSAT+NF+RS  IGEGGFG VY  TIKN EDP+ +
Sbjct  60   --------SMSARENNLREFSISDLKSATRNFSRSGMIGEGGFGCVYWGTIKNLEDPSKK  111

Query  571  VDVAVKQLSRRGLQGHREWVTEVNVLG  651
            ++VAVKQL +RGLQGH+EWVTEVN LG
Sbjct  112  IEVAVKQLGKRGLQGHKEWVTEVNFLG  138



>gb|EPS66606.1| hypothetical protein M569_08171, partial [Genlisea aurea]
Length=377

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 95/140 (68%), Gaps = 12/140 (9%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F+N EK E PK        S+ S ++D + +  +  S   +ASD+S  S    QF
Sbjct  1    MKCFPFYNGEKRESPKPS------STLSSYTDREAR--SCASEIIDASDSSIGSNRPPQF  52

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            P   E+ S+LR F+F ELK AT+NF+ + K+GEGGFG VYK  I+N EDP +R+ VAVKQ
Sbjct  53   P---EKFSDLRVFTFLELKQATRNFSMTAKLGEGGFGSVYKGIIRNPEDPTNRI-VAVKQ  108

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L+ RGLQGH+EWVTEVNVLG
Sbjct  109  LNTRGLQGHKEWVTEVNVLG  128



>ref|XP_010452206.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Camelina 
sativa]
Length=421

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 96/141 (68%), Gaps = 5/141 (4%)
 Frame = +1

Query  232  MRCFLF-HNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQ  408
            M+CFLF   D+KDE+    +S   +S  S FSD +   S+      + + T + S GR  
Sbjct  1    MKCFLFPLGDKKDEQ----RSPKPVSPTSIFSDVNKSGSDFSPRDVSGTSTVSSSTGRNS  56

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
              SMS R  NLR+F+ S+LKSAT+NF+RS  IGEGGFG VY  TIKN EDP+ +++VAVK
Sbjct  57   NTSMSAREDNLREFTISDLKSATRNFSRSGMIGEGGFGCVYWGTIKNLEDPSKKIEVAVK  116

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QL +RGLQGH+EWVTEVN LG
Sbjct  117  QLGKRGLQGHKEWVTEVNFLG  137



>gb|KHG19471.1| hypothetical protein F383_26407 [Gossypium arboreum]
Length=409

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 94/140 (67%), Gaps = 10/140 (7%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF+F +  + +EPK        S  S F+D ++  S  E +SQN S TS+ES  R+ F
Sbjct  1    MKCFIFLSWRRKDEPKTPTPISTRSKNSTFTDREIGRSGSELNSQNVSATSSESIRRSSF  60

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            PS+S+RPSNL+ F+ SEL+SATKNF+RS  +GEGGFG VYK  I++ +D + +++VA   
Sbjct  61   PSLSQRPSNLKVFTVSELRSATKNFSRSAMLGEGGFGCVYKGFIRSPDDSSQKIEVA---  117

Query  592  LSRRGLQGHREWVTEVNVLG  651
                   GH+EWVTEVN+LG
Sbjct  118  -------GHKEWVTEVNLLG  130



>dbj|BAK01480.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 101/146 (69%), Gaps = 6/146 (4%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVK----STPVLSSCSGFSDHDVKHSNLESSSQN-ASDTSTESR  396
            M+CF F + EK+ E + ++    S    S+ S  +DHDV+ S  E  S   +S+ S ES 
Sbjct  1    MQCFRFASWEKEREKEELQGPAQSQSARSNSSISTDHDVRRSGSECCSLTVSSEISVESF  60

Query  397  GRTQFPSMSERPSN-LRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRV  573
            GR +  S+ +RP+N LR F+F ELKSAT++F+R+  IGEGGFG VY+ TI+++ +P   +
Sbjct  61   GRYRQLSLPQRPNNDLRIFTFQELKSATRSFSRALMIGEGGFGCVYRGTIRSALEPRRSL  120

Query  574  DVAVKQLSRRGLQGHREWVTEVNVLG  651
            DVA+KQL R+GLQGH+EWVTEVN LG
Sbjct  121  DVAIKQLGRKGLQGHKEWVTEVNFLG  146



>emb|CDY10387.1| BnaCnng02880D [Brassica napus]
Length=435

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 99/152 (65%), Gaps = 17/152 (11%)
 Frame = +1

Query  211  YPDLLMTMRCFLF---HNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDT  381
            +P L    +CFLF    N+++DE+      +P+    SGF+ +          S N S T
Sbjct  15   FPLLGRMKKCFLFPHGDNNKRDEQRSPKPLSPLSDHRSGFTIN---------GSTNGSGT  65

Query  382  S--TESRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSE  555
            S  + S GRT  P    R +NLR+F+ ++LKSATKNF+RS  IGEGGFG VY  TIK+S+
Sbjct  66   SMVSSSTGRTSLPV---RENNLREFTIADLKSATKNFSRSVMIGEGGFGCVYWGTIKSSQ  122

Query  556  DPASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            DP+ +++VAVKQL +RGLQGH+EWVTEVN LG
Sbjct  123  DPSKKIEVAVKQLGKRGLQGHKEWVTEVNFLG  154



>emb|CDY22206.1| BnaC01g38950D [Brassica napus]
Length=452

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 103/166 (62%), Gaps = 28/166 (17%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTES-RGR-T  405
            M+CF F + +K EE    K+   +S  S FSD D+  S  + +S++AS TSTES  GR  
Sbjct  1    MKCFKFSSGDKKEEHN--KTPKSVSLTSNFSDRDINRSGSDFNSRDASGTSTESSMGRKN  58

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             +PS S R SNLR+FS ++LK+ATKNF+RS  IGEGGFG V++ T+++ EDP+ +++VAV
Sbjct  59   SYPSTSARESNLREFSVTDLKAATKNFSRSVMIGEGGFGCVFRGTVRDLEDPSIKIEVAV  118

Query  586  KQLSRRGLQG------------------------HREWVTEVNVLG  651
            KQL +RGLQ                         H+EWVTEVN LG
Sbjct  119  KQLGKRGLQAKCAFGPSQPEPTLRFWREGGGGGGHKEWVTEVNFLG  164



>ref|XP_010112214.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXC32923.1| putative receptor-like protein kinase [Morus notabilis]
Length=470

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 98/141 (70%), Gaps = 13/141 (9%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFS-DHDVKHSNLESSSQNASDTSTESRGRTQ  408
            M+CF F+N EK+EEPK  KS+ + S+ +  S D D++ S+ ES SQN S+ ST S     
Sbjct  1    MKCFYFYNKEKNEEPKTTKSSSMASTSTSMSTDRDMRRSSSESHSQNVSEFSTSSA--KS  58

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
            F  +S+R SNLR+F+FSELKSATKNF+RS  +GEGGFG VYK  I+++ED   ++DVA  
Sbjct  59   FAVLSQRQSNLREFTFSELKSATKNFSRSLMVGEGGFGGVYKGVIRSTEDQHKKIDVA--  116

Query  589  QLSRRGLQGHREWVTEVNVLG  651
                    GH+EWVTEVNVLG
Sbjct  117  --------GHKEWVTEVNVLG  129



>ref|XP_009788489.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nicotiana 
sylvestris]
 ref|XP_009788490.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nicotiana 
sylvestris]
Length=432

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 95/144 (66%), Gaps = 7/144 (5%)
 Frame = +1

Query  232  MRCFLFHNDEK--DEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRT  405
            M+CF F N +K  D   K  KST   S  S  +D + K     S   +ASD STES  R 
Sbjct  1    MKCFQFSNSDKNDDHNNKTTKSTSGQSCASVSTDPEFKGFT-TSGQSSASDISTESCPRL  59

Query  406  QFPSMS--ERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
             F  +S  +RP NLR F+  ELK+AT+NF+RS  IGEGGFG VY+  +++++D   R D+
Sbjct  60   SFSCLSSHKRPCNLRVFTVDELKTATRNFSRSLMIGEGGFGGVYRGVLRDTKD--KRTDI  117

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            AVKQLS+RGLQGH+EWVTEVNVLG
Sbjct  118  AVKQLSQRGLQGHKEWVTEVNVLG  141



>ref|XP_008457617.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Cucumis 
melo]
Length=398

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 105/142 (74%), Gaps = 3/142 (2%)
 Frame = +1

Query  226  MTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRT  405
            M+  C L + D+++   K + STPV+S  S  +D +V  S  E +SQN S++S+ES  R 
Sbjct  1    MSWFCSLCNGDKRE---KPMNSTPVMSINSTNADIEVGRSGSELNSQNVSNSSSESSRRN  57

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
               SMSER SNLR F+ S+LKSATKNF+R+  +GEGGFG VY+ +I++++DP+ +++VAV
Sbjct  58   YILSMSERASNLRVFTVSDLKSATKNFSRTFMVGEGGFGCVYRGSIRSADDPSQKIEVAV  117

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQL +RGLQGH+EWVTEVN LG
Sbjct  118  KQLGKRGLQGHKEWVTEVNFLG  139



>ref|XP_008784814.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Phoenix 
dactylifera]
Length=427

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F N EK + P+  KS   +SS +  +D D++ S  E +S N +  S +S G + F
Sbjct  1    MKCFPFSNGEKGK-PQARKSPSAMSSSTTSTDRDMRKSGSEINSLNVTHGSADSIGGSPF  59

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
              +S+R  NLR F+F EL++AT+NF+RS  IGEGGFG VY+ TI++ +D  +  DVAVKQ
Sbjct  60   LRLSQRACNLRAFTFQELRNATRNFSRSLMIGEGGFGCVYRGTIRSFDDSNTWQDVAVKQ  119

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L R GLQGH+EW+ EVNVLG
Sbjct  120  LHRSGLQGHKEWLNEVNVLG  139



>gb|AAF43496.1|AF131222_1 protein serine/threonine kinase [Lophopyrum elongatum]
 gb|AAK11674.1|AF339747_1 protein kinase [Lophopyrum elongatum]
Length=433

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 99/145 (68%), Gaps = 5/145 (3%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKI---VKSTPVLSSCSGFSDHDVKHSNLESSSQN-ASDTSTESRG  399
            M+CF F + EK+ E ++    +S   LS+ S  +D D + S  E  S   +S+ S +S G
Sbjct  1    MQCFRFASWEKEREEELQGPARSQSALSNSSMSTDRDARRSGSECCSLTVSSEISVDSFG  60

Query  400  RTQFPSMSERPSN-LRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVD  576
            R +  S+  RP+N LR F+F ELKSAT++F+R+  IGEGGFG VY+ TI+++ +P   +D
Sbjct  61   RYRQLSLPHRPNNDLRIFTFQELKSATRSFSRALMIGEGGFGCVYRGTIQSTLEPRRSLD  120

Query  577  VAVKQLSRRGLQGHREWVTEVNVLG  651
            VA+KQL R+GLQGH+EWVTEVN LG
Sbjct  121  VAIKQLGRKGLQGHKEWVTEVNFLG  145



>gb|KHG23255.1| hypothetical protein F383_07036 [Gossypium arboreum]
Length=381

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 81/110 (74%), Gaps = 10/110 (9%)
 Frame = +1

Query  322  SDHDVKHSNLESSSQNASDTSTESRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTK  501
            +D ++  S  E +SQN S  S+ES GR+ FPSMS+RPSNLR F+ SELKSATKNF+RS  
Sbjct  3    ADREIARSGSELNSQNVSGVSSESMGRSYFPSMSQRPSNLRVFTVSELKSATKNFSRSFM  62

Query  502  IGEGGFGPVYKATIKNSEDPASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            +GEGGFG VYK ++K+ EDP+ +++VA          GH+EWVTEVNVLG
Sbjct  63   LGEGGFGCVYKGSLKSPEDPSEKIEVA----------GHKEWVTEVNVLG  102



>ref|XP_009594135.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nicotiana 
tomentosiformis]
 ref|XP_009594136.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nicotiana 
tomentosiformis]
 ref|XP_009594137.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nicotiana 
tomentosiformis]
Length=430

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 92/144 (64%), Gaps = 8/144 (6%)
 Frame = +1

Query  232  MRCFLFHNDEK--DEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRT  405
            M+CF F N +K  D   K  KST   S  S  +D + K     S   +ASD STES  R 
Sbjct  1    MKCFQFSNSDKNDDHNNKTTKSTSGQSCASVSTDPEFKGFT-NSGQSSASDISTESSSRL  59

Query  406  QFPSMS--ERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
             F  +S  +RP NLR F+  ELK+AT+NF+RS  IGEGGFG VY+  ++   D   R D+
Sbjct  60   SFSCLSSHKRPCNLRVFTVDELKTATRNFSRSLMIGEGGFGGVYRGVLR---DTNKRTDI  116

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            AVKQLS+RGLQGH+EWVTEVNVLG
Sbjct  117  AVKQLSQRGLQGHKEWVTEVNVLG  140



>ref|XP_003560283.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Brachypodium 
distachyon]
Length=422

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +1

Query  355  SSSQNASDTSTESRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYK  534
            S S NASD S ES  + Q+PS  +RP+NLR FSFSEL++AT+N +RS  +GEGGFG VY+
Sbjct  42   SGSINASDMSVESMQQRQYPSFVDRPANLRVFSFSELRAATRNLSRSLMLGEGGFGCVYR  101

Query  535  ATIKNSEDPASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
             TI N    A   +VAVK L+R GLQGH+EW+TEVNVLG
Sbjct  102  GTILNGSGSAQEEEVAVKHLNRNGLQGHKEWLTEVNVLG  140



>ref|XP_004143264.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Cucumis 
sativus]
Length=398

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 104/142 (73%), Gaps = 3/142 (2%)
 Frame = +1

Query  226  MTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRT  405
            M+  C L + D+++   K + STPV+S  S  +D +   S  E +SQN S++S+ES  R 
Sbjct  1    MSWFCSLCNGDKRE---KPMNSTPVMSITSTNADIEAGRSGSELNSQNVSNSSSESSRRN  57

Query  406  QFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
               SMSER SNLR F+ S+LKSATKNF+R+  +GEGGFG VY+ +I+++++P+ +++VAV
Sbjct  58   YILSMSERASNLRVFTVSDLKSATKNFSRTFMVGEGGFGCVYRGSIRSADNPSQKIEVAV  117

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQL +RGLQGH+EWVTEVN LG
Sbjct  118  KQLGKRGLQGHKEWVTEVNFLG  139



>ref|XP_002312001.1| kinase family protein [Populus trichocarpa]
 gb|EEE89368.1| kinase family protein [Populus trichocarpa]
Length=403

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 88/140 (63%), Gaps = 18/140 (13%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F N EK+EEPK          CS  S      S  E +SQN SD ST+S  +  F
Sbjct  1    MKCFHFSNKEKNEEPKTCNQI-----CSARS---TSKSGSEFNSQNVSDFSTDSSTKNSF  52

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
             ++S+R SNLR F+FSELK+ATKNF+RS  IGEGGFG VY+  I++ ED + ++D+A   
Sbjct  53   AALSQRQSNLRVFTFSELKTATKNFSRSVMIGEGGFGGVYRGVIRSMEDSSKKIDIA---  109

Query  592  LSRRGLQGHREWVTEVNVLG  651
                   GH+EWVTEVN LG
Sbjct  110  -------GHKEWVTEVNFLG  122



>emb|CDX70313.1| BnaA10g26620D [Brassica napus]
Length=429

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 97/144 (67%), Gaps = 13/144 (9%)
 Frame = +1

Query  220  LLMTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRG  399
            LL  M+CFLF  DE+   PK           S  SDH    +N  S+S + + T + S G
Sbjct  18   LLGRMKCFLFQRDEQ-RSPK---------PLSPLSDHRSGFTNNGSTSGSGTSTVSSSTG  67

Query  400  RTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
            RT  P+   R +NLR+F+ ++LKSATKNF+RS  IGEGGFG VY  TIK+S+DP+ +++V
Sbjct  68   RTSLPA---RENNLREFTIADLKSATKNFSRSVMIGEGGFGCVYWGTIKSSQDPSKKIEV  124

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            AVKQL +RGLQGH+EWVTEVN LG
Sbjct  125  AVKQLGKRGLQGHKEWVTEVNFLG  148



>gb|KGN48176.1| hypothetical protein Csa_6G446370 [Cucumis sativus]
Length=475

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 105/143 (73%), Gaps = 3/143 (2%)
 Frame = +1

Query  223  LMTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGR  402
            +M+  C L + D+++   K + STPV+S  S  +D +   S  E +SQN S++S+ES  R
Sbjct  77   VMSWFCSLCNGDKRE---KPMNSTPVMSITSTNADIEAGRSGSELNSQNVSNSSSESSRR  133

Query  403  TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
                SMSER SNLR F+ S+LKSATKNF+R+  +GEGGFG VY+ +I+++++P+ +++VA
Sbjct  134  NYILSMSERASNLRVFTVSDLKSATKNFSRTFMVGEGGFGCVYRGSIRSADNPSQKIEVA  193

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            VKQL +RGLQGH+EWVTEVN LG
Sbjct  194  VKQLGKRGLQGHKEWVTEVNFLG  216



>ref|XP_009122715.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Brassica 
rapa]
Length=429

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 96/144 (67%), Gaps = 13/144 (9%)
 Frame = +1

Query  220  LLMTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRG  399
            LL  M+CFLF  DE+   PK           S  SDH    +N  S+S + + T + S G
Sbjct  18   LLGRMKCFLFQRDEQ-RSPK---------PLSPLSDHRSGFTNNGSTSGSGTSTVSSSTG  67

Query  400  RTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
            RT  P    R +NLR+F+ ++LKSATKNF+RS  IGEGGFG VY  TIK+S+DP+ +++V
Sbjct  68   RTSLPV---RENNLREFTIADLKSATKNFSRSVMIGEGGFGCVYWGTIKSSQDPSKKIEV  124

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            AVKQL +RGLQGH+EWVTEVN LG
Sbjct  125  AVKQLGKRGLQGHKEWVTEVNFLG  148



>ref|XP_010557951.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Tarenaya 
hassleriana]
Length=449

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 93/149 (62%), Gaps = 12/149 (8%)
 Frame = +1

Query  229  TMRCFLFHNDEKDEEPKIVK-------STPVLSSCSGFSDHDVKHSNLESSSQNASDTST  387
             M+CF F  +  ++EPK  K       S  + +S  G      + S  + SS+N S+TST
Sbjct  15   AMKCFYFSKERSEDEPKPRKLNSSLRSSASMSNSTEGLG----RGSGSDFSSRNISETST  70

Query  388  ESRGRTQFPSMSERPSN-LRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPA  564
             S   T F  +S + SN LR F   ELK ATKNF+RS  IGEGGFG V++  I+  ED  
Sbjct  71   ASSAMTPFADLSRKHSNNLRMFELDELKMATKNFSRSLMIGEGGFGGVFRGMIQCPEDSR  130

Query  565  SRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
             ++++AVKQLSRRGLQGH+EWVTEVNVLG
Sbjct  131  KKIEIAVKQLSRRGLQGHKEWVTEVNVLG  159



>ref|XP_010441480.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein 
At5g47260, partial [Camelina sativa]
Length=1341

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 98/150 (65%), Gaps = 12/150 (8%)
 Frame = +1

Query  208   RYPDLLMTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTST  387
             R  +L  T++ FLF   +K            +S  S  SD +V  S    +S + S TS 
Sbjct  909   RRSNLFSTVKGFLFSGGDKKG----------VSLTSNSSDREVNQSGSVFNSPDVSGTSA  958

Query  388   ES-RGR-TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDP  561
             ES  GR   +P++S R SNLR+FS ++LKSATKNF++S  IGEGGFG V++ T++N EDP
Sbjct  959   ESSMGRKNSYPTVSTRASNLREFSITDLKSATKNFSQSVMIGEGGFGRVFRGTVRNLEDP  1018

Query  562   ASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
             +  ++VAVKQL +RGLQG++EWVTE+N LG
Sbjct  1019  SITIEVAVKQLGKRGLQGYKEWVTELNFLG  1048



>gb|ABG66097.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
Length=445

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 94/153 (61%), Gaps = 12/153 (8%)
 Frame = +1

Query  229  TMRCFLFHNDEKDEE-----------PKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNAS  375
             M+CF F   E+DE                +S    S+ S  +D D + S  E S   +S
Sbjct  4    AMQCFGFAGWERDERRGRSSAVASAAAATTRSLSARSNSSTSTDRDARRSGSECSLNVSS  63

Query  376  DTSTESRGRTQFPSMSERPSN-LRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNS  552
            + S ES GR +  S+ +R SN LR F+F ELKSAT+ F+RS  +GEGGFG VY+ TI++ 
Sbjct  64   EISAESFGRYRQLSLPQRASNNLRIFTFQELKSATRGFSRSLVLGEGGFGCVYRGTIRSV  123

Query  553  EDPASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
             +P   V+VA+KQL R+GLQGH+EWVTEVNVLG
Sbjct  124  LEPRRSVEVAIKQLGRKGLQGHKEWVTEVNVLG  156



>gb|AAP53976.2| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAH00975.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51031.1| hypothetical protein OsJ_31679 [Oryza sativa Japonica Group]
Length=461

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 94/153 (61%), Gaps = 12/153 (8%)
 Frame = +1

Query  229  TMRCFLFHNDEKDEE-----------PKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNAS  375
             M+CF F   E+DE                +S    S+ S  +D D + S  E S   +S
Sbjct  20   AMQCFGFAGWERDERRGRSSAVASAAAATTRSLSARSNSSTSTDRDARRSGSECSLNVSS  79

Query  376  DTSTESRGRTQFPSMSERPSN-LRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNS  552
            + S ES GR +  S+ +R SN LR F+F ELKSAT+ F+RS  +GEGGFG VY+ TI++ 
Sbjct  80   EISAESFGRYRQLSLPQRASNNLRIFTFQELKSATRGFSRSLVLGEGGFGCVYRGTIRSV  139

Query  553  EDPASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
             +P   V+VA+KQL R+GLQGH+EWVTEVNVLG
Sbjct  140  LEPRRSVEVAIKQLGRKGLQGHKEWVTEVNVLG  172



>ref|XP_008664921.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Zea mays]
Length=452

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 96/151 (64%), Gaps = 10/151 (7%)
 Frame = +1

Query  229  TMRCFLFHN-----DEKDEEPKIVKSTPVLSSCSGFS----DHDVKHSNLESSSQNASDT  381
             M CF F +     DE+ E      +   LS+ S  S    D DV+ S  E S + +  +
Sbjct  14   AMHCFRFASWERDADERRESAAAATTGRSLSARSNGSTTSTDRDVRRSASECSLKASELS  73

Query  382  STESRGRTQFPSMSERPSN-LRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSED  558
            S  S GR +  S+S+RP N LR F+F ELKSAT+ F+R+  +GEGGFG VY+ T++++ +
Sbjct  74   SASSLGRGRQLSLSQRPPNTLRVFTFQELKSATRGFSRALMLGEGGFGCVYRGTVRSALE  133

Query  559  PASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            P   +DVA+KQL R+GLQGH+EW+TEVNVLG
Sbjct  134  PRRSLDVAIKQLGRKGLQGHKEWMTEVNVLG  164



>ref|XP_008664920.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Zea mays]
 tpg|DAA49843.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=452

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 96/151 (64%), Gaps = 10/151 (7%)
 Frame = +1

Query  229  TMRCFLFHN-----DEKDEEPKIVKSTPVLSSCSGFS----DHDVKHSNLESSSQNASDT  381
             M CF F +     DE+ E      +   LS+ S  S    D DV+ S  E S + +  +
Sbjct  14   AMHCFRFASWERDADERRESAAAATTGRSLSARSNGSTTSTDRDVRRSASECSLKASELS  73

Query  382  STESRGRTQFPSMSERPSN-LRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSED  558
            S  S GR +  S+S+RP N LR F+F ELKSAT+ F+R+  +GEGGFG VY+ T++++ +
Sbjct  74   SASSLGRGRQLSLSQRPPNTLRVFTFQELKSATRGFSRALMLGEGGFGCVYRGTVRSALE  133

Query  559  PASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            P   +DVA+KQL R+GLQGH+EW+TEVNVLG
Sbjct  134  PRRSLDVAIKQLGRKGLQGHKEWMTEVNVLG  164



>ref|XP_006340033.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006340034.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006340035.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X3 [Solanum tuberosum]
 ref|XP_006340036.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X4 [Solanum tuberosum]
Length=425

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 95/143 (66%), Gaps = 12/143 (8%)
 Frame = +1

Query  232  MRCFLFHN-DEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRG-RT  405
            M+CF F N D+ D+  K  KST   SS S F+D D+K S  E +SQN S   +     R 
Sbjct  1    MKCFQFSNSDKNDDHNKTRKSTSGQSSASVFTDPDLKGS--EYNSQNVSSDISTESSSRL  58

Query  406  QFPSMS-ERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
             F  +S ++P +L+ F+  ELKSATKNF+RS  +GEGGFG VYK  +K++       ++A
Sbjct  59   SFSCLSNKKPCHLKVFTVEELKSATKNFSRSLMLGEGGFGGVYKGVLKDT-------NIA  111

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            VKQLS+RGLQGH+EWVTEVNVLG
Sbjct  112  VKQLSQRGLQGHKEWVTEVNVLG  134



>ref|XP_008664922.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X3 [Zea mays]
 ref|XP_008664923.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X3 [Zea mays]
 tpg|DAA49844.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=438

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 96/150 (64%), Gaps = 10/150 (7%)
 Frame = +1

Query  232  MRCFLFHN-----DEKDEEPKIVKSTPVLSSCSGFS----DHDVKHSNLESSSQNASDTS  384
            M CF F +     DE+ E      +   LS+ S  S    D DV+ S  E S + +  +S
Sbjct  1    MHCFRFASWERDADERRESAAAATTGRSLSARSNGSTTSTDRDVRRSASECSLKASELSS  60

Query  385  TESRGRTQFPSMSERPSN-LRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDP  561
              S GR +  S+S+RP N LR F+F ELKSAT+ F+R+  +GEGGFG VY+ T++++ +P
Sbjct  61   ASSLGRGRQLSLSQRPPNTLRVFTFQELKSATRGFSRALMLGEGGFGCVYRGTVRSALEP  120

Query  562  ASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
               +DVA+KQL R+GLQGH+EW+TEVNVLG
Sbjct  121  RRSLDVAIKQLGRKGLQGHKEWMTEVNVLG  150



>ref|XP_004247375.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Solanum 
lycopersicum]
 ref|XP_010326559.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Solanum 
lycopersicum]
Length=415

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 95/142 (67%), Gaps = 19/142 (13%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNAS-DTSTESRGRTQ  408
            M+CF F ND+ +   K  KST   SS S F+D D+K S  E SSQN S D ST S     
Sbjct  1    MKCFQFSNDDHN---KTRKSTSGQSSASVFTDSDLKGS--EYSSQNVSTDISTVS-----  50

Query  409  FPSMS-ERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
            F  +S ++  +L+ F+  ELKSATKNF+RS  +GEGGFG VYK  +K++       ++AV
Sbjct  51   FSCLSNKKACHLKVFTVEELKSATKNFSRSLMLGEGGFGGVYKGVLKDT-------NIAV  103

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQLS+RGLQGH+EWVTEVNVLG
Sbjct  104  KQLSQRGLQGHKEWVTEVNVLG  125



>gb|EEC67045.1| hypothetical protein OsI_33788 [Oryza sativa Indica Group]
Length=466

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 94/159 (59%), Gaps = 18/159 (11%)
 Frame = +1

Query  229  TMRCFLFHNDEKDEE----------PKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASD  378
             M+CF F   E++E               +S    S+ S  +D D + S  E S   +S+
Sbjct  19   AMQCFGFAGWEREERRGRSSAVAAAAATTRSLSARSNSSTSTDRDARRSGSECSLNVSSE  78

Query  379  TSTESRGRTQFPSMSERPSN-LRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSE  555
             S ES GR +  S+ +R SN LR F+F ELKSAT+ F+RS  +GEGGFG VY+ TI++  
Sbjct  79   ISAESFGRYRQLSLPQRASNNLRIFTFQELKSATRGFSRSLVLGEGGFGCVYRGTIRSVL  138

Query  556  DPASRVDVAVKQLSRRGLQ-------GHREWVTEVNVLG  651
            +P   V+VA+KQL R+GLQ       GH+EWVTEVNVLG
Sbjct  139  EPRRSVEVAIKQLGRKGLQVINNSQHGHKEWVTEVNVLG  177



>ref|XP_010494959.1| PREDICTED: probable disease resistance protein At5g47260 isoform 
X2 [Camelina sativa]
Length=1333

 Score =   119 bits (299),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 96/150 (64%), Gaps = 12/150 (8%)
 Frame = +1

Query  208   RYPDLLMTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTST  387
             R  +L  T++ FLF   +K            +S  S  SD +V  S    +S++ S TS 
Sbjct  918   RRSNLFSTVKGFLFSGGDKKG----------VSLTSNSSDREVNQSGSVFNSRDVSGTSA  967

Query  388   ES-RGR-TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDP  561
             ES  GR   +P++S R SNLR FS ++LKSATKNF++S  IGEGGFG V++ T+ + EDP
Sbjct  968   ESSMGRKNSYPTVSTRASNLRQFSITDLKSATKNFSQSVMIGEGGFGCVFRGTVTSLEDP  1027

Query  562   ASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
             + +++VAVKQL + G+QG +EWVTEVN +G
Sbjct  1028  SIKIEVAVKQLGKIGVQGRKEWVTEVNFIG  1057



>ref|XP_010494957.1| PREDICTED: probable disease resistance protein At5g47260 isoform 
X1 [Camelina sativa]
 ref|XP_010494958.1| PREDICTED: probable disease resistance protein At5g47260 isoform 
X1 [Camelina sativa]
Length=1339

 Score =   119 bits (299),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 96/150 (64%), Gaps = 12/150 (8%)
 Frame = +1

Query  208   RYPDLLMTMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTST  387
             R  +L  T++ FLF   +K            +S  S  SD +V  S    +S++ S TS 
Sbjct  924   RRSNLFSTVKGFLFSGGDKKG----------VSLTSNSSDREVNQSGSVFNSRDVSGTSA  973

Query  388   ES-RGR-TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDP  561
             ES  GR   +P++S R SNLR FS ++LKSATKNF++S  IGEGGFG V++ T+ + EDP
Sbjct  974   ESSMGRKNSYPTVSTRASNLRQFSITDLKSATKNFSQSVMIGEGGFGCVFRGTVTSLEDP  1033

Query  562   ASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
             + +++VAVKQL + G+QG +EWVTEVN +G
Sbjct  1034  SIKIEVAVKQLGKIGVQGRKEWVTEVNFIG  1063



>emb|CDY44356.1| BnaC02g03210D [Brassica napus]
Length=409

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 16/140 (11%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CFLF   +K EE +  K  PV              S L   ++  SD S  S   +  
Sbjct  1    MKCFLFPLGDKKEEQRSPK--PV--------------SPLSDRTKTGSDGSGTSTVSSSN  44

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
            P++  R ++LR+F+ ++LK  T+NF+RS  IGEGGFG VY  TI++ +DP+ +++VAVKQ
Sbjct  45   PTLPTRENSLREFTVADLKFVTRNFSRSVMIGEGGFGCVYWGTIRSLQDPSKKIEVAVKQ  104

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L +RGLQGH+EWVTEVN LG
Sbjct  105  LGKRGLQGHKEWVTEVNFLG  124



>ref|XP_002464564.1| hypothetical protein SORBIDRAFT_01g020900 [Sorghum bicolor]
 gb|EER91562.1| hypothetical protein SORBIDRAFT_01g020900 [Sorghum bicolor]
Length=441

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 82/112 (73%), Gaps = 2/112 (2%)
 Frame = +1

Query  322  SDHDVKHSNLESSSQNASDTSTESRGRTQFPSMS-ERPSN-LRDFSFSELKSATKNFNRS  495
            +D DV+ S  E S   +  +S  S GR +  S+S +RP+N LR F+F ELKSAT+ F+R+
Sbjct  42   TDRDVRRSASECSLNASELSSAGSLGRCRQLSLSSQRPANALRVFNFQELKSATRGFSRA  101

Query  496  TKIGEGGFGPVYKATIKNSEDPASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
              +GEGGFG VY+ TI+++ +P   +DVA+KQL R+GLQGH+EW+TEVNVLG
Sbjct  102  LMLGEGGFGCVYRGTIRSALEPRRSLDVAIKQLGRKGLQGHKEWMTEVNVLG  153



>ref|XP_009125492.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Brassica 
rapa]
Length=412

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 93/143 (65%), Gaps = 19/143 (13%)
 Frame = +1

Query  232  MRCFLF-HNDEKDEE--PKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGR  402
            M+CFLF H D+KDE+  PK V     LS  +G +             +  SD+S  S   
Sbjct  1    MKCFLFPHADKKDEQRSPKPVSP---LSDRAGLT-------------KTGSDSSGTSTVS  44

Query  403  TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
            +  P++  R ++LR+F+ ++LK  T+NF+RS  IGEGGFG VY  TIK+ +DP+ +++VA
Sbjct  45   SSNPTLPTRENSLREFTVADLKFVTRNFSRSVMIGEGGFGCVYWGTIKSLQDPSKKIEVA  104

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            VKQL +RGLQGH+EWVTEVN LG
Sbjct  105  VKQLGKRGLQGHKEWVTEVNFLG  127



>emb|CDY69874.1| BnaAnng31840D [Brassica napus]
Length=412

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 93/143 (65%), Gaps = 19/143 (13%)
 Frame = +1

Query  232  MRCFLF-HNDEKDEE--PKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGR  402
            M+CFLF H D+KDE+  PK V     LS  +G +             +  SD+S  S   
Sbjct  1    MKCFLFPHADKKDEQRSPKPVSP---LSDRAGLT-------------KTGSDSSGTSTVS  44

Query  403  TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
            +  P++  R ++LR+F+ ++LK  T+NF+RS  IGEGGFG VY  TIK+ +DP+ +++VA
Sbjct  45   SSNPTLPTRENSLREFTVADLKFVTRNFSRSVMIGEGGFGCVYWGTIKSLQDPSKKIEVA  104

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            VKQL +RGLQGH+EWVTEVN LG
Sbjct  105  VKQLGKRGLQGHKEWVTEVNFLG  127



>gb|KHN39036.1| Putative receptor-like protein kinase [Glycine soja]
Length=377

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 73/96 (76%), Gaps = 10/96 (10%)
 Frame = +1

Query  364  QNASDTSTESRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATI  543
             +ASD ST+S  R+ FPS+S+RPSNLR F+ SELK+ATK+F+RS  +GEGGFG VYK  I
Sbjct  1    MDASDNSTDSLRRSSFPSLSQRPSNLRVFTVSELKTATKSFSRSVMLGEGGFGCVYKGLI  60

Query  544  KNSEDPASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            K+ +DP+++++VA          GH+EWVTEVNVLG
Sbjct  61   KSVDDPSTKIEVA----------GHKEWVTEVNVLG  86



>dbj|BAK00090.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 76/105 (72%), Gaps = 6/105 (6%)
 Frame = +1

Query  355  SSSQNASDTSTESRGR-TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVY  531
            + S NASD S +S  R  Q+PS ++RP+NLR F++SEL++AT+N +RS  +GEGGFG VY
Sbjct  54   TGSINASDMSADSIQRPQQYPSFADRPANLRVFAYSELRAATRNLSRSLMLGEGGFGCVY  113

Query  532  KATIKNSEDP-----ASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            + TIK    P        ++VAVK L+R GLQGH+EW+TEVNVLG
Sbjct  114  RGTIKVDAGPEDVTTPPAMEVAVKHLNRNGLQGHKEWLTEVNVLG  158



>dbj|BAJ90857.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=467

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 76/105 (72%), Gaps = 6/105 (6%)
 Frame = +1

Query  355  SSSQNASDTSTESRGR-TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVY  531
            + S NASD S +S  R  Q+PS ++RP+NLR F++SEL++AT+N +RS  +GEGGFG VY
Sbjct  77   TGSINASDMSADSIQRPQQYPSFADRPANLRVFAYSELRAATRNLSRSLMLGEGGFGCVY  136

Query  532  KATIKNSEDP-----ASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            + TIK    P        ++VAVK L+R GLQGH+EW+TEVNVLG
Sbjct  137  RGTIKVDAGPEDVTTPPAMEVAVKHLNRNGLQGHKEWLTEVNVLG  181



>ref|XP_003573979.2| PREDICTED: probable receptor-like protein kinase At3g55450 [Brachypodium 
distachyon]
Length=443

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 92/144 (64%), Gaps = 6/144 (4%)
 Frame = +1

Query  229  TMRCFLFHNDEKDE--EPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQN-ASDTSTESRG  399
             M CF F   E+++  E    +  P  S  S  S+  +  S  E  S N +S+   ES G
Sbjct  15   AMPCFRFAGWEREQGKEGGEERQGPARSQ-SARSNSSISGS--ECCSLNVSSEIGGESFG  71

Query  400  RTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
            R +  S+S+RP  LR F+F ELKSAT++F+R+  IGEGGFG VY+ TI+++ +P   +DV
Sbjct  72   RYRQLSLSQRPDTLRVFTFQELKSATRSFSRALMIGEGGFGCVYRGTIRSTLEPRRSLDV  131

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            A+KQL R+GLQG +EWVTEVN LG
Sbjct  132  AIKQLGRKGLQGQKEWVTEVNFLG  155



>ref|XP_007208565.1| hypothetical protein PRUPE_ppa023937mg [Prunus persica]
 gb|EMJ09764.1| hypothetical protein PRUPE_ppa023937mg [Prunus persica]
Length=444

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 93/148 (63%), Gaps = 13/148 (9%)
 Frame = +1

Query  232  MRCFLFHNDEK--DEEPKIV-----KSTPVLSSCSGFSDHDV-KHSNLESSSQNASDTST  387
            M+CF F N E+  DEEP IV     K +   S     S +D  + S  +  S++ SD   
Sbjct  1    MKCFHFTNGERRDDEEPGIVCRAASKVSWARSLSVASSSYDTTRRSEFDLDSRDLSD---  57

Query  388  ESRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPAS  567
             S    +  S+  R ++LR F FSELKSA++ F+R+  IGEGGFG VY+  +K S+D A+
Sbjct  58   -SVAFQELLSL-RRANDLRVFKFSELKSASRGFSRALLIGEGGFGCVYRGIVKGSDDDAT  115

Query  568  RVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            ++DVA+KQL+R G QGH+EW+ EVN+LG
Sbjct  116  KMDVAIKQLNRNGFQGHKEWINEVNLLG  143



>ref|XP_006662393.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
[Oryza brachyantha]
Length=417

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 88/141 (62%), Gaps = 15/141 (11%)
 Frame = +1

Query  229  TMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQ  408
             M+CF F   E++E      ++ V ++    S            +++ S TST+   R  
Sbjct  4    AMQCFGFAAWEREERRGRSAASVVAATTRSLS------------ARSNSSTSTDRDARR-  50

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
              + SER +NLR F+F ELKSAT+ F+RS  +GEGGFG VY+ TI++  +P   V+VA+K
Sbjct  51   --AGSERSNNLRIFTFQELKSATRGFSRSLVLGEGGFGCVYRGTIRSVLEPRRSVEVAIK  108

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QL R+GLQGH+EWVTEVNVLG
Sbjct  109  QLGRKGLQGHKEWVTEVNVLG  129



>ref|XP_008223696.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Prunus mume]
Length=444

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 93/148 (63%), Gaps = 13/148 (9%)
 Frame = +1

Query  232  MRCFLFHNDEK--DEEPKIV-----KSTPVLSSCSGFSDHDV-KHSNLESSSQNASDTST  387
            M+CF F N E+  DEEP +V     K +   S     S +D  + S  +  S++ SD   
Sbjct  1    MKCFHFTNGERRDDEEPGVVCRAASKVSWARSLSVASSSYDTTRRSEFDLDSRDLSD---  57

Query  388  ESRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPAS  567
             S    +  S+  R ++LR F FSELKSA++ F+R+  IGEGGFG VY+  +K S+D A+
Sbjct  58   -SVAFQELLSL-RRANDLRVFKFSELKSASRGFSRALLIGEGGFGCVYRGIVKGSDDDAT  115

Query  568  RVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            ++DVA+KQL+R G QGH+EW+ EVN+LG
Sbjct  116  KMDVAIKQLNRNGFQGHKEWINEVNLLG  143



>ref|XP_008223689.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Prunus mume]
Length=452

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 93/148 (63%), Gaps = 13/148 (9%)
 Frame = +1

Query  232  MRCFLFHNDEK--DEEPKIV-----KSTPVLSSCSGFSDHDV-KHSNLESSSQNASDTST  387
            M+CF F N E+  DEEP +V     K +   S     S +D  + S  +  S++ SD   
Sbjct  1    MKCFHFTNGERRDDEEPGVVCRAASKVSWARSLSVASSSYDTTRRSEFDLDSRDLSD---  57

Query  388  ESRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPAS  567
             S    +  S+  R ++LR F FSELKSA++ F+R+  IGEGGFG VY+  +K S+D A+
Sbjct  58   -SVAFQELLSL-RRANDLRVFKFSELKSASRGFSRALLIGEGGFGCVYRGIVKGSDDDAT  115

Query  568  RVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            ++DVA+KQL+R G QGH+EW+ EVN+LG
Sbjct  116  KMDVAIKQLNRNGFQGHKEWINEVNLLG  143



>ref|XP_004983005.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X1 [Setaria italica]
 ref|XP_004983006.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X2 [Setaria italica]
 ref|XP_004983007.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X3 [Setaria italica]
 ref|XP_004983008.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X4 [Setaria italica]
 ref|XP_004983009.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
isoform X5 [Setaria italica]
Length=446

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 83/113 (73%), Gaps = 4/113 (4%)
 Frame = +1

Query  325  DHDVKHSNLESSSQNASDTSTE-SRGRTQFPSMS-ERPSN-LRDFSFSELKSATKNFNRS  495
            D DV+ S  E  S NAS+ S+  S GR +  S+S +RP N LR F+F EL+SAT+ F+R+
Sbjct  46   DPDVRRSASECCSLNASELSSAGSLGRCRQLSLSSQRPPNALRVFTFQELRSATRGFSRA  105

Query  496  TKIGEGGFGPVYKATIKNSE-DPASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
              +GEGGFG VY+  ++++  +P   +DVA+KQLSR+GLQGH+EW+TEVNVLG
Sbjct  106  QMLGEGGFGCVYRGNVRSAAGEPRRSIDVAIKQLSRKGLQGHKEWMTEVNVLG  158



>ref|XP_010264440.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Nelumbo nucifera]
Length=444

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 94/147 (64%), Gaps = 13/147 (9%)
 Frame = +1

Query  232  MRCFLFHNDEK--DEEPKIVKSTPVLSSCSGFS----DHDVKHSNLESSSQNASDTSTES  393
            M+CF F N EK  D +  I +++ V S    FS    + DV+ S   S S++ S     S
Sbjct  1    MKCFHFSNGEKREDNDCSISRASKV-SWARSFSVASSNADVRRSEFGSDSRDFSG----S  55

Query  394  RGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSED-PASR  570
             G   F S+  R ++LR FSFSEL+ AT+ F+R+  IGEGGFG VY+  +  S+D P ++
Sbjct  56   LGFHDFLSL-RRSNDLRVFSFSELRRATRGFSRALMIGEGGFGCVYRGVVSISDDDPDAK  114

Query  571  VDVAVKQLSRRGLQGHREWVTEVNVLG  651
            +DVAVKQL+R GLQGH+EW+TEVN LG
Sbjct  115  LDVAVKQLNRNGLQGHKEWITEVNFLG  141



>ref|XP_010256920.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nelumbo 
nucifera]
Length=442

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 96/148 (65%), Gaps = 15/148 (10%)
 Frame = +1

Query  232  MRCFLFHNDEKDE--EPKIVKSTPVLSSCSGFS----DHDVKHSNLESSSQNASDTSTES  393
            M+CF F N EK E  +  I +++ V S    FS    + DV+ S  +S S++ S     S
Sbjct  1    MKCFHFSNGEKRENDDGSISRASKV-SWARSFSVASSNVDVRCSEFDSYSRDFSG----S  55

Query  394  RGRTQFPSMSERPSN-LRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSED-PAS  567
             G   F  + +R SN LR FSFSEL++AT+ F+R+  IGEGGFG VY+  I  S+D P +
Sbjct  56   LGFNDF--LYQRRSNDLRVFSFSELRAATRGFSRALMIGEGGFGCVYRGVISISDDDPDA  113

Query  568  RVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            ++DVAVKQL+R GLQGH+EWVTEVN LG
Sbjct  114  KLDVAVKQLNRNGLQGHKEWVTEVNFLG  141



>gb|ERN07884.1| hypothetical protein AMTR_s00012p00223410 [Amborella trichopoda]
Length=428

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 90/140 (64%), Gaps = 9/140 (6%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F   EK E  +   ST  +S     ++ + + S  +++S + SD+ +       F
Sbjct  1    MKCFHFSPGEKKEGDRT--STSRVSWIHS-NNGEARRSEFDTNSADFSDSDS------GF  51

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
             S+S+RP+NL  F FSELK+AT+ F+R+  IGEGGFG VY+  I   + P++++DVAVK+
Sbjct  52   CSLSQRPNNLYVFKFSELKAATRGFSRALMIGEGGFGCVYRGVIDVPDVPSTKIDVAVKK  111

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L + G QGH+EWVTEVN LG
Sbjct  112  LDKSGFQGHKEWVTEVNFLG  131



>gb|KGN47838.1| hypothetical protein Csa_6G406010 [Cucumis sativus]
Length=437

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 68/97 (70%), Gaps = 11/97 (11%)
 Frame = +1

Query  361  SQNASDTSTESRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKAT  540
            SQN S+ S  S     F ++S+R SNLR+F+FSELK+ATKNF+RS  +GEGGFG VY+  
Sbjct  65   SQNVSEISVASSA-VSFAALSQRQSNLREFTFSELKAATKNFSRSLMVGEGGFGSVYRGA  123

Query  541  IKNSEDPASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            I+NSEDP  R+D+A          GH+EWVTEVN LG
Sbjct  124  IRNSEDPHKRIDIA----------GHKEWVTEVNFLG  150



>gb|EYU38549.1| hypothetical protein MIMGU_mgv1a022350mg, partial [Erythranthe 
guttata]
Length=344

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 77/141 (55%), Gaps = 34/141 (24%)
 Frame = +1

Query  229  TMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQ  408
             M CF F N E+ E  K  K   V SS   FS H            N S           
Sbjct  1    MMSCFKFCNGEEKENAKTPKPKSVESS---FSSH------------NGS-----------  34

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
                     NL+ F+F ELK AT NF+ S K+GEGGFG V+K  IK S+DP  ++DVAVK
Sbjct  35   --------RNLKAFTFLELKQATNNFSNSGKLGEGGFGSVFKGVIKISDDPPRKIDVAVK  86

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QL R+GLQGH+EWVTEVNVLG
Sbjct  87   QLLRKGLQGHKEWVTEVNVLG  107



>ref|XP_002283598.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Vitis 
vinifera]
Length=443

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 88/147 (60%), Gaps = 12/147 (8%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIV-----KSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESR  396
            M+CF F+N E+ EE   V     K +   S     S  DV+ S  +  S++ SD+ +   
Sbjct  1    MKCFHFNNGERREEEDGVLSRASKVSWARSLSVASSSADVRRSEFDFDSRDLSDSVSFHE  60

Query  397  GRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSED--PASR  570
               Q      R ++LR F+FSELKSAT+ F+R+  IGEGGFG VY+  ++   D  P S+
Sbjct  61   FLAQ-----RRANDLRVFTFSELKSATRGFSRALMIGEGGFGCVYRGVVRVHADEAPDSK  115

Query  571  VDVAVKQLSRRGLQGHREWVTEVNVLG  651
            +DVAVKQL+R G QGH+EW+ EVN LG
Sbjct  116  MDVAVKQLNRNGFQGHKEWINEVNFLG  142



>ref|XP_009141782.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
 ref|XP_009141783.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
 ref|XP_009141784.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
 ref|XP_009141785.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
 ref|XP_009141786.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
Length=437

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 83/141 (59%), Gaps = 8/141 (6%)
 Frame = +1

Query  229  TMRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQ  408
            TM+CF F  D+  +E K  K       C       +       S  N+  ++T +     
Sbjct  15   TMKCFHFSKDKSQDEVKTKK-------CDSIRSSSIARGGSVGSEFNSQTSTTTTTTSLH  67

Query  409  FPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
              S +   +NL+ F   +LK+AT NF+RS  IGEGGFG V++  I++ EDP  ++++AVK
Sbjct  68   VLSETH-INNLKVFPLDDLKTATNNFSRSLMIGEGGFGGVFRGIIQSPEDPRKKIEIAVK  126

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            QLSRRGLQGH+EWVTEVNVLG
Sbjct  127  QLSRRGLQGHKEWVTEVNVLG  147



>ref|XP_009143340.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Brassica 
rapa]
Length=430

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  433  SNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQLSRRGLQ  612
            +NL+ F+  +LK+ATKNF+RS  IGEGGFG V++  I+N +D   ++D+AVKQLSRRGLQ
Sbjct  69   NNLKVFALDDLKTATKNFSRSLMIGEGGFGGVFRGIIQNPQDSRKKIDIAVKQLSRRGLQ  128

Query  613  GHREWVTEVNVLG  651
            GH+EWVTEVNVLG
Sbjct  129  GHKEWVTEVNVLG  141



>emb|CDY18353.1| BnaA04g22340D [Brassica napus]
Length=422

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 82/140 (59%), Gaps = 8/140 (6%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F  D+  +E K  K       C       +       S  N+  ++T +      
Sbjct  1    MKCFHFSKDKSQDEVKTKK-------CDSIRSSSIARGGSVGSEFNSQTSTTTTTTSLHV  53

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
             S +   +NL+ F   +LK+AT NF+RS  IGEGGFG V++  I++ EDP  ++++AVKQ
Sbjct  54   LSETH-INNLKVFPLDDLKTATNNFSRSLMIGEGGFGGVFRGIIQSPEDPRKKIEIAVKQ  112

Query  592  LSRRGLQGHREWVTEVNVLG  651
            LSRRGLQGH+EWVTEVNVLG
Sbjct  113  LSRRGLQGHKEWVTEVNVLG  132



>emb|CDX93286.1| BnaC04g46100D [Brassica napus]
Length=422

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 81/140 (58%), Gaps = 8/140 (6%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF F  D+  +E K  K       C       +       S  N+  ++T +      
Sbjct  1    MKCFHFSKDKSQDEVKTKK-------CDSIQSSSIARGGSGGSEFNSQTSTTTTTTSLHV  53

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
             S +   +NL+ F   +LK+AT NFNRS  IGEGGFG V++  I++ ED   +V++AVKQ
Sbjct  54   LSETH-INNLKAFPLDDLKTATNNFNRSLMIGEGGFGGVFRGIIQSPEDSRKKVEIAVKQ  112

Query  592  LSRRGLQGHREWVTEVNVLG  651
            LSRRGLQGH+EWVTEVNVLG
Sbjct  113  LSRRGLQGHKEWVTEVNVLG  132



>ref|XP_002313435.2| hypothetical protein POPTR_0009s03680g [Populus trichocarpa]
 gb|EEE87390.2| hypothetical protein POPTR_0009s03680g [Populus trichocarpa]
Length=450

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 92/151 (61%), Gaps = 15/151 (10%)
 Frame = +1

Query  232  MRCFLFHNDEK--DEEPKIVKSTPV-----LSSCSGFSDHDVKHSNLESSSQ-NASDTST  387
            M+CF F N E+  DE+  + K + V     LS  S  S  D + S L+S S   +S   +
Sbjct  1    MKCFHFSNGERREDEDAPVSKVSRVSWARSLSVAS--SSLDTRRSELDSDSYCYSSRDLS  58

Query  388  ESRGRTQFPSMSERPSN-LRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSED--  558
            +S G   F  +S+R +N LR F FSELKSAT+ F+R   IGEGGFG VY+  +K   D  
Sbjct  59   DSVG--LFELLSQRRANDLRVFGFSELKSATRGFSRGLLIGEGGFGCVYRGVVKVPADHE  116

Query  559  PASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
              S++DVA+KQL+R G QGHREW+ EVN LG
Sbjct  117  SGSKMDVAIKQLNRHGFQGHREWINEVNFLG  147



>ref|XP_010264439.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Nelumbo nucifera]
Length=448

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 94/151 (62%), Gaps = 17/151 (11%)
 Frame = +1

Query  232  MRCFLFHNDEK--DEEPKIVKSTPVLSSCSGFS----DHDVKHSNLESSSQNASDTSTES  393
            M+CF F N EK  D +  I +++ V S    FS    + DV+ S   S S++ S     S
Sbjct  1    MKCFHFSNGEKREDNDCSISRASKV-SWARSFSVASSNADVRRSEFGSDSRDFSG----S  55

Query  394  RGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNS-EDPASR  570
             G   F S+  R ++LR FSFSEL+ AT+ F+R+  IGEGGFG VY+  +  S +DP ++
Sbjct  56   LGFHDFLSL-RRSNDLRVFSFSELRRATRGFSRALMIGEGGFGCVYRGVVSISDDDPDAK  114

Query  571  VDVAVKQLSRRGL----QGHREWVTEVNVLG  651
            +DVAVKQL+R GL    QGH+EW+TEVN LG
Sbjct  115  LDVAVKQLNRNGLQASIQGHKEWITEVNFLG  145



>ref|XP_011042708.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Populus 
euphratica]
Length=450

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 91/151 (60%), Gaps = 15/151 (10%)
 Frame = +1

Query  232  MRCFLFHNDEK--DEEPKIVKSTPV-----LSSCSGFSDHDVKHSNLESSSQ-NASDTST  387
            M+CF F N E+  DE+  + K + V     LS  S  S  D + S L S S   +S   +
Sbjct  1    MKCFHFSNGERREDEDAPVSKVSRVSWARSLSVAS--SSLDTRRSELNSDSYCYSSRDLS  58

Query  388  ESRGRTQFPSMSERPSN-LRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSED--  558
            +S G   F  +S+R +N LR F FSELKSAT+ F+R   IGEGGFG VY+  +K   D  
Sbjct  59   DSVG--LFELLSQRRANDLRVFGFSELKSATRGFSRGLLIGEGGFGCVYRGVVKVPADHE  116

Query  559  PASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
              S++DVA+KQL+R G QGHREW+ EVN LG
Sbjct  117  SGSKMDVAIKQLNRHGFQGHREWINEVNFLG  147



>ref|XP_009364394.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Pyrus 
x bretschneideri]
Length=443

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 88/143 (62%), Gaps = 4/143 (3%)
 Frame = +1

Query  232  MRCFLFHNDEK--DEEPKIV-KSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGR  402
            M+CF F N E+  D+EP +V ++T  +S     S    ++    S   + S   ++S   
Sbjct  1    MKCFHFTNGERRDDDEPGVVPRTTSKVSWVRSLSVASSRYDTRRSEFDSDSRDLSDSLAF  60

Query  403  TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
             +  SM  R ++LR F+FSELK+AT+ F+R+  IGEGGFG VY+  +   +    ++DVA
Sbjct  61   QELLSM-RRANDLRVFTFSELKAATRGFSRALLIGEGGFGCVYRGIVSRCDVGDGKLDVA  119

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            +KQLSR G QGH+EW+ EVN+LG
Sbjct  120  IKQLSRNGFQGHKEWINEVNLLG  142



>ref|XP_004294512.2| PREDICTED: probable receptor-like protein kinase At5g47070 [Fragaria 
vesca subsp. vesca]
Length=471

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 88/150 (59%), Gaps = 13/150 (9%)
 Frame = +1

Query  232  MRCFLFHNDEK----DEEPKIVKSTPVLSSCS-----GFSDHDVKHSNLESSSQNASDTS  384
            M+CF F N E+    D+ P +V   P   S +       S +D  + N   S  + SD+ 
Sbjct  21   MKCFHFTNGERRGDDDDAPGVVSRAPSKVSWARSLSVASSSYDNTNYNNRRSEFDNSDSR  80

Query  385  TESRGRTQFPSMSERPSN-LRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDP  561
              S     F  +S+R +N LR F+FSELKSA++ F+R+  IGEGGFG VY+  +    D 
Sbjct  81   DISDSAAFFDLLSQRRANDLRVFAFSELKSASRGFSRALLIGEGGFGCVYRGIVN---DD  137

Query  562  ASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
             +++DVA+KQL+R G QGH+EW+ EVN LG
Sbjct  138  GAKMDVAIKQLNRNGFQGHKEWINEVNFLG  167



>ref|XP_008357170.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Malus 
domestica]
Length=444

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 87/143 (61%), Gaps = 4/143 (3%)
 Frame = +1

Query  232  MRCFLFHNDEK--DEEPKIV-KSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGR  402
            M+CF F N E+  D+EP +V ++T  +S     S     +    S   + S   ++S   
Sbjct  1    MKCFHFTNGERRDDDEPGVVPRTTSKVSWVRSLSVASSSYDTRRSEFDSDSRDLSDSLAF  60

Query  403  TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
             +  SM  R ++LR F+FSELK+AT+ F+R+  IGEGGFG VY+  +   +    ++DVA
Sbjct  61   QELLSM-RRANDLRVFTFSELKAATRGFSRALLIGEGGFGCVYRGIVSGCDVGDGKLDVA  119

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            +KQLSR G QGH+EW+ EVN+LG
Sbjct  120  IKQLSRNGFQGHKEWINEVNLLG  142



>ref|XP_002969082.1| hypothetical protein SELMODRAFT_170305 [Selaginella moellendorffii]
 gb|EFJ30198.1| hypothetical protein SELMODRAFT_170305 [Selaginella moellendorffii]
Length=423

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 92/145 (63%), Gaps = 5/145 (3%)
 Frame = +1

Query  232  MRCFLFHNDEKDE--EPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQ-NASDTSTESRGR  402
            M+C  F +   D+  EP+  KS   LSS  G +  + + S  E++SQ +AS +   S   
Sbjct  1    MKCIRFSHSGGDKRPEPRSRKSIWNLSSSGGSNPDNARRSGSEANSQTDASGSGQGSPAS  60

Query  403  TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIK--NSEDPASRVD  576
                S S R + L+ FSF+ELK+AT+NF+R+  +GEGGFG VYK  IK   ++   S+V+
Sbjct  61   NFLLSSSMRQNELKVFSFAELKAATRNFHRTHWLGEGGFGCVYKGFIKVNRTDGTESKVE  120

Query  577  VAVKQLSRRGLQGHREWVTEVNVLG  651
            VAVKQL+ +GLQGH+EW++E+  LG
Sbjct  121  VAVKQLNGKGLQGHKEWLSEIRYLG  145



>ref|XP_008779202.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Phoenix 
dactylifera]
Length=442

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 82/146 (56%), Gaps = 12/146 (8%)
 Frame = +1

Query  232  MRCFLF--HNDEKDEEPKIVKSTPV--LSSCSGFSDHDVKHSNLESSSQNASDTSTESRG  399
            M+CF F    DE    P+  + +    LS  S     ++ H   + S     D S   R 
Sbjct  1    MKCFHFSAAGDEAGPGPRPSRFSWARSLSVASAGWRAELDHGPRDLSRLEEEDLSPPLRL  60

Query  400  RTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKA--TIKNSEDPASRV  573
            + Q P        LR F+F+ELK+AT+ F+R+  IGEGGFG VY+   T+   +D A  +
Sbjct  61   QGQLPD------GLRAFTFAELKAATRGFSRALLIGEGGFGCVYRGVLTVPGEDDVAESM  114

Query  574  DVAVKQLSRRGLQGHREWVTEVNVLG  651
            DVAVKQL+R GLQGHREWVTEVN LG
Sbjct  115  DVAVKQLNRNGLQGHREWVTEVNFLG  140



>emb|CDP09392.1| unnamed protein product [Coffea canephora]
Length=436

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 77/145 (53%), Gaps = 8/145 (6%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRG----  399
            M+CF +  D    + +  +S P+L  C   SD        +SS    S+    S G    
Sbjct  1    MKCFHYFKDRTKSKEQ--RSAPILK-CESKSDISAADRVSKSSCSATSERVARSSGSTTS  57

Query  400  -RTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVD  576
             R+      ER  NLR FSFSEL  AT NFNR  KIGEGGFG VYK TIK        + 
Sbjct  58   LRSVTELYEERAQNLRVFSFSELARATNNFNRLLKIGEGGFGSVYKGTIKPVGGKGDPIV  117

Query  577  VAVKQLSRRGLQGHREWVTEVNVLG  651
            VA+K+L+R G QGH++WV EV  LG
Sbjct  118  VAIKKLNRDGFQGHKQWVAEVQFLG  142



>ref|XP_011093490.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
 ref|XP_011093491.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
 ref|XP_011093492.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
Length=426

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 84/141 (60%), Gaps = 12/141 (9%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF +  D    + ++ KS PVL+S S     D+  ++  + S + S TS  S      
Sbjct  1    MKCFYYFKDR--NKSRVQKSAPVLNSQS---KSDISETDRVTKS-SCSATSPRS-----I  49

Query  412  PSM-SERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
            P +  E+  NLR F+FSEL+ AT NF+R  KIGEGGFG VYK TIK  +     + VA+K
Sbjct  50   PELYEEKAQNLRVFTFSELRQATNNFSRLLKIGEGGFGCVYKGTIKPVDGKGDLLLVAIK  109

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            +L+R G QGH++WV EV  LG
Sbjct  110  KLNRDGYQGHKQWVAEVQFLG  130



>ref|XP_002973981.1| hypothetical protein SELMODRAFT_173964 [Selaginella moellendorffii]
 gb|EFJ24936.1| hypothetical protein SELMODRAFT_173964 [Selaginella moellendorffii]
Length=423

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 91/145 (63%), Gaps = 5/145 (3%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIV--KSTPVLSSCSGFSDHDVKHSNLESSSQ-NASDTSTESRGR  402
            M+C  F +   D+ P+    KS   LSS  G +  + + S  E++SQ +AS +   S   
Sbjct  1    MKCIRFSHSGGDKRPEARSRKSIWNLSSSGGSNPDNARRSGSEANSQTDASGSGQGSPAS  60

Query  403  TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIK--NSEDPASRVD  576
                S S R + L+ FSF+ELK+AT+NF+R+  +GEGGFG VYK  IK   ++   S+V+
Sbjct  61   NFLLSSSMRQNELKVFSFAELKAATRNFHRTHWLGEGGFGCVYKGFIKVNRTDGTESKVE  120

Query  577  VAVKQLSRRGLQGHREWVTEVNVLG  651
            VAVKQL+ +GLQGH+EW++E+  LG
Sbjct  121  VAVKQLNGKGLQGHKEWLSEIRYLG  145



>ref|XP_002298354.2| hypothetical protein POPTR_0001s24730g [Populus trichocarpa]
 gb|EEE83159.2| hypothetical protein POPTR_0001s24730g [Populus trichocarpa]
Length=451

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 92/149 (62%), Gaps = 11/149 (7%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCS-----GFSDHDVKHSNLESSSQ-NASDTSTES  393
            M+CF F N E+ E+  +V S     S +       S  D + S+L+S S   +S   +ES
Sbjct  1    MKCFHFTNGERREDEDVVVSKVSRVSWARSFSVASSSLDARRSDLDSDSYCYSSRDLSES  60

Query  394  RGRTQFPSMSERPSN-LRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIK--NSEDPA  564
             G   F  +S+R +N LR FSFSELKSAT+ F+R   IGEGGFG VY+  +K  +  D  
Sbjct  61   VGF--FELLSQRRANDLRVFSFSELKSATRGFSRGLLIGEGGFGCVYRGVVKVPDDHDSN  118

Query  565  SRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            S++DVA+KQL+R G QGH+EW+ EV+ LG
Sbjct  119  SKMDVAIKQLNRHGFQGHKEWINEVSFLG  147



>gb|EPS66576.1| hypothetical protein M569_08202, partial [Genlisea aurea]
Length=327

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 69/98 (70%), Gaps = 2/98 (2%)
 Frame = +1

Query  358  SSQNASDTSTESRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKA  537
            SS  +  T TE+ G      + ++ +NL+ F+++ELK AT+NF+ + K+GEGGFG VY+ 
Sbjct  1    SSAESVTTGTETSGSPLI--VPQKSTNLKAFTYAELKLATRNFSTAAKLGEGGFGSVYRG  58

Query  538  TIKNSEDPASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
             I + +DP+ +V VAVKQL+ RG QGH+EW TEVN+L 
Sbjct  59   IINSPDDPSKKVIVAVKQLNNRGFQGHKEWATEVNLLA  96



>ref|XP_010931273.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Elaeis 
guineensis]
Length=442

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = +1

Query  430  PSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKA--TIKNSEDPASRVDVAVKQLSRR  603
            P  LR F+F+ELK+AT+ F+R+  IGEGGFG VY+   T+   +D A  +DVAVKQL+R 
Sbjct  65   PDGLRAFTFAELKAATRGFSRALMIGEGGFGCVYRGVLTVPGEDDDAETMDVAVKQLNRN  124

Query  604  GLQGHREWVTEVNVLG  651
            GLQGHREWVTEVN LG
Sbjct  125  GLQGHREWVTEVNFLG  140



>ref|XP_009388614.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Musa 
acuminata subsp. malaccensis]
Length=442

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 59/82 (72%), Gaps = 2/82 (2%)
 Frame = +1

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYK--ATIKNSEDPASRVDVAV  585
            P+ +  P  LR F+FSELK+AT+ F RS  IGEGGFG VY+   T+   +  A  +DVAV
Sbjct  58   PATAGPPEGLRAFAFSELKAATRGFGRSLLIGEGGFGCVYRGVVTVAGDDGAAETMDVAV  117

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            KQL+R GLQGH+EWVTEVN LG
Sbjct  118  KQLNRHGLQGHKEWVTEVNFLG  139



>ref|XP_004505859.1| PREDICTED: probable receptor-like protein kinase At5g15080-like 
[Cicer arietinum]
Length=443

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 85/146 (58%), Gaps = 15/146 (10%)
 Frame = +1

Query  232  MRCFLFHND------EKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTES  393
            M+CF F N       E +E       T  +S     S  D + S  +S S++ SDT    
Sbjct  1    MKCFHFSNGSEKRGVEDEEASASSSRTSRVSWARSLSLMDSRRSEFDSDSRDFSDT----  56

Query  394  RGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRV  573
             G  +F S   R ++L  FSFS+LK AT+ FNRS  IGEGGFG VY+ T+ +     S++
Sbjct  57   LGFHEFLS-QRRANHLHLFSFSDLKLATRGFNRSLLIGEGGFGSVYRGTVNHR----SQI  111

Query  574  DVAVKQLSRRGLQGHREWVTEVNVLG  651
            DVAVKQL+R G QGH+EW+ EVN+LG
Sbjct  112  DVAVKQLNRNGHQGHKEWINEVNLLG  137



>ref|XP_009759488.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nicotiana 
sylvestris]
 ref|XP_009759489.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nicotiana 
sylvestris]
 ref|XP_009759490.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nicotiana 
sylvestris]
Length=429

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 79/142 (56%), Gaps = 11/142 (8%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESS-SQNASDTSTESRGRTQ  408
            M+CF +  D      +  KS PV+         D+  S++    ++  + +S  +     
Sbjct  1    MKCFFYFKDRNRNRER--KSAPVVL-------QDLSKSDISGGGAERVTKSSCSTSSPRS  51

Query  409  FPSMSE-RPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
            F  + E +  NLR F+FSELK AT NFNR  KIGEGGFG VYK TIK ++       VA+
Sbjct  52   FSDLYEGKAQNLRVFTFSELKQATNNFNRLLKIGEGGFGCVYKGTIKPADGKGESTVVAI  111

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            K+L+R G QGH++WV EV  LG
Sbjct  112  KKLNRDGYQGHKQWVAEVQFLG  133



>ref|XP_009594763.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nicotiana 
tomentosiformis]
 ref|XP_009594764.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nicotiana 
tomentosiformis]
 ref|XP_009594765.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nicotiana 
tomentosiformis]
Length=429

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 79/142 (56%), Gaps = 11/142 (8%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESS-SQNASDTSTESRGRTQ  408
            M+CF +  D      +  KS PV+         D+  S++    ++  + +S  +     
Sbjct  1    MKCFFYFKDRNRNRER--KSAPVVL-------QDLSKSDISGGGAERVTKSSCSTSSPRS  51

Query  409  FPSMSE-RPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
            F  + E +  NLR F+FSELK AT NFNR  KIGEGGFG VYK TIK ++       VA+
Sbjct  52   FSDLYEGKAQNLRVFTFSELKQATNNFNRLLKIGEGGFGCVYKGTIKPADGKGESTVVAI  111

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            K+L+R G QGH++WV EV  LG
Sbjct  112  KKLNRDGYQGHKQWVAEVQFLG  133



>ref|XP_011035308.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Populus 
euphratica]
Length=451

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 92/149 (62%), Gaps = 11/149 (7%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCS-----GFSDHDVKHSNLESSSQ-NASDTSTES  393
            M+CF F + E+ E+  +V S     S +       S  D + S+L+S S   +S   +ES
Sbjct  1    MKCFHFTSGERREDEDVVVSKVSRVSWARSFSVASSSLDARRSDLDSDSYCYSSRDLSES  60

Query  394  RGRTQFPSMSERPSN-LRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIK--NSEDPA  564
             G   F  +S+R +N LR FSFSELKSAT+ F+R   IGEGGFG VY+  +K  +  D  
Sbjct  61   VGF--FELLSQRRANDLRVFSFSELKSATRGFSRGLLIGEGGFGCVYRGVVKVPDDHDSN  118

Query  565  SRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            S++DVA+KQL+R G QGH+EW+ EV+ LG
Sbjct  119  SKMDVAIKQLNRHGFQGHKEWINEVSFLG  147



>gb|KHG03664.1| hypothetical protein F383_05225 [Gossypium arboreum]
Length=210

 Score = 96.7 bits (239),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 82/144 (57%), Gaps = 15/144 (10%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSS---CSGFSDHDVKHSNLESSSQNASDTSTESRGR  402
            M+CF +  D+   + +  +S P L       G+S  D     +  SS + S  S  S   
Sbjct  1    MKCFHYFKDKSRSKGQ--RSAPELKQERKSEGYSGPD----RITKSSCSTSVASPRS---  51

Query  403  TQFPSMSE-RPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
               P + E +  NLR FSFSELK AT++FN   KIGEGGFG VYK TIK ++      +V
Sbjct  52   --IPELYEAKAHNLRVFSFSELKQATRDFNLLHKIGEGGFGSVYKGTIKPADGKGEPFEV  109

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            A+K+L++ GLQGH++WV EV  LG
Sbjct  110  AIKKLNKNGLQGHKQWVAEVQFLG  133



>ref|XP_008464123.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Cucumis 
melo]
Length=448

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 88/147 (60%), Gaps = 11/147 (7%)
 Frame = +1

Query  232  MRCFLFHNDEK-DEEPKIVKSTPVLSSCSGFS----DHDVKHSNLESSSQNASDTSTESR  396
            M+CF F N E+ D+E  +V  T  +S     S      D + S  +S   + S   ++S 
Sbjct  1    MKCFHFTNGERRDDEDGVVSRTSKVSWARSLSMASSTFDTRRSEFDS---DYSRDFSDSI  57

Query  397  GRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPAS--R  570
            G  +F +   R ++LR FSFSEL+SAT+ F+R+  IGEGGFG V+K  +    +  S  +
Sbjct  58   GFYEFLT-HRRANDLRVFSFSELRSATRGFSRALLIGEGGFGCVFKGVVNGDSNSKSDLK  116

Query  571  VDVAVKQLSRRGLQGHREWVTEVNVLG  651
            ++VAVKQL+R G QGH+EW+ EVN LG
Sbjct  117  MEVAVKQLNRNGFQGHKEWINEVNFLG  143



>ref|XP_004240362.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Solanum lycopersicum]
Length=444

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 84/148 (57%), Gaps = 16/148 (11%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKI------VKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTES  393
            M+CF F  DE++E   +      V     LS  S   D     S+L+S S++ ++T    
Sbjct  1    MKCFYFTKDEEEEGGTLSSRESKVSWVRSLSVASSSVDTRKSRSDLDSESRDFTETFEFY  60

Query  394  RGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPAS--  567
               TQ      R ++LR FSFSELK ATK F+R   IGEGGFG VY+  +     P S  
Sbjct  61   EFLTQ-----RRANDLRVFSFSELKMATKGFSRGLMIGEGGFGCVYRGIVSA---PCSDL  112

Query  568  RVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            +++VAVK+L+R G QGH+EW+ EVN LG
Sbjct  113  KMEVAVKRLNRHGFQGHKEWINEVNFLG  140



>gb|KJB83775.1| hypothetical protein B456_013G263500 [Gossypium raimondii]
Length=459

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 88/155 (57%), Gaps = 14/155 (9%)
 Frame = +1

Query  226  MTMRCFLFHNDE-KDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGR  402
            M M+CF F N E +DE   +     V+S  S       +  ++ SSS +   +  +S   
Sbjct  1    MVMKCFHFTNGEGRDEGEDVSGGGGVVSRMSSKVTW-TRSLSVASSSADTRRSEFDSEST  59

Query  403  TQFPSMS--------ERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSED  558
              F S +         R ++LR F+F+ELKSAT+ F+R+  IGEGGFG VY+  +  S++
Sbjct  60   RDFASAASFCEFLTQRRANDLRVFTFAELKSATRGFSRALLIGEGGFGCVYRGAVDVSDE  119

Query  559  P----ASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
                  S++DVA+KQL+R G QGH+EW+ EVN LG
Sbjct  120  VNGGRYSKLDVAIKQLNRHGFQGHKEWINEVNFLG  154



>ref|XP_004229716.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Solanum 
lycopersicum]
 ref|XP_010325063.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Solanum 
lycopersicum]
Length=429

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 77/141 (55%), Gaps = 10/141 (7%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF +  +      +  KS PV+         D   S++   ++  + +S  +     F
Sbjct  1    MKCFFYFKERNRNRER--KSAPVIL-------QDQSKSDISGGAERVTKSSCSTSSARSF  51

Query  412  PSMSE-RPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
              + E +  NLR F+F ELK AT NFNR  KIGEGGFG VYK  IK ++     + VA+K
Sbjct  52   SDVYEGKGQNLRVFTFPELKQATNNFNRLLKIGEGGFGCVYKGNIKPADGKGESIIVAIK  111

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            +L+R G QGH++WV EV  LG
Sbjct  112  KLNRDGYQGHKQWVAEVQFLG  132



>ref|XP_012083746.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Jatropha 
curcas]
 gb|KDP28896.1| hypothetical protein JCGZ_14667 [Jatropha curcas]
Length=426

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 80/141 (57%), Gaps = 13/141 (9%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF +  D      +  +S P L      +D D    N   +  + S+TST        
Sbjct  1    MKCFHYFKDRNKSRQQ--RSAPELKEQRK-TDTD----NHRIAKSSCSETSTPG-----I  48

Query  412  PSM-SERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
            P +  ER  NLR+FSFSEL+ AT +F+R  KIGEGGFG VYK +IK +      V VA+K
Sbjct  49   PQLYEERAHNLREFSFSELRRATNDFSRQLKIGEGGFGMVYKGSIKPAGGNGDPVVVAIK  108

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            +L+R GLQGH++WV EV  LG
Sbjct  109  KLNREGLQGHKQWVAEVQFLG  129



>ref|XP_011085500.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
 ref|XP_011085508.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
 ref|XP_011085517.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
 ref|XP_011085525.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
 ref|XP_011085534.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
 ref|XP_011085542.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
 ref|XP_011085550.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
 ref|XP_011085558.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
 ref|XP_011085565.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
 ref|XP_011085573.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
 ref|XP_011085581.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
Length=426

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 80/150 (53%), Gaps = 30/150 (20%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTS-----TESR  396
            M+CF  H+ +   + ++ KS P+L +                  QN SDTS     T+S 
Sbjct  1    MKCF--HHFKDRVKSRVQKSAPILKN------------------QNKSDTSEAERVTKSS  40

Query  397  GRTQFPS-----MSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDP  561
            G    P        E+  NLR F+F+EL+ AT NF+R  KIGEGGFG VYK TIK  +  
Sbjct  41   GSGSLPRTIPEIYEEKAQNLRVFTFAELRQATSNFSRLLKIGEGGFGCVYKGTIKPVDGK  100

Query  562  ASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
                 VA+K+L+R G QGH++WV EV  LG
Sbjct  101  GEPSVVAIKKLNRDGYQGHKQWVAEVQFLG  130



>ref|XP_004143119.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Cucumis 
sativus]
 gb|KGN47145.1| hypothetical protein Csa_6G190360 [Cucumis sativus]
Length=448

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 87/147 (59%), Gaps = 11/147 (7%)
 Frame = +1

Query  232  MRCFLFHNDEK-DEEPKIVKSTPVLSSCSGFS----DHDVKHSNLESSSQNASDTSTESR  396
            M+CF F N E+ D+E  +   T  +S     S      D + S  +S   + S   ++S 
Sbjct  1    MKCFHFTNGERRDDEDGVASRTSKVSWARSLSMASSTFDTRRSEFDS---DYSRDFSDSI  57

Query  397  GRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPAS--R  570
            G  +F +   R ++LR FSFSEL+SAT+ F+R+  IGEGGFG V+K  +    +  S  +
Sbjct  58   GFYEFLT-HRRANDLRVFSFSELRSATRGFSRALLIGEGGFGCVFKGVVNGDSNSKSDLK  116

Query  571  VDVAVKQLSRRGLQGHREWVTEVNVLG  651
            ++VAVKQL+R G QGH+EW+ EVN LG
Sbjct  117  MEVAVKQLNRNGFQGHKEWINEVNFLG  143



>ref|XP_006424839.1| hypothetical protein CICLE_v10028420mg [Citrus clementina]
 ref|XP_006488336.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
[Citrus sinensis]
 gb|ESR38079.1| hypothetical protein CICLE_v10028420mg [Citrus clementina]
Length=453

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 87/153 (57%), Gaps = 16/153 (10%)
 Frame = +1

Query  232  MRCFLFHNDEKD-----EEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESR  396
            M+CF F N E++     ++  +V  T  +S     S   V  S++++        S +  
Sbjct  1    MKCFHFSNGERERRDGGDDGGVVSRTSKVSWARSLS---VASSSVDTRRSEFDSDSRDWS  57

Query  397  GRTQFPSM--SERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPA--  564
                F  +    R ++LR FSF+ELKSAT+ F+R+  IGEGGFG VY+  ++ S D    
Sbjct  58   DSLAFYELLSQRRANDLRVFSFAELKSATRGFSRALLIGEGGFGCVYRGVVRVSSDDHQI  117

Query  565  ----SRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
                S++DVA+KQL+R+G QGH+EW+ EVN LG
Sbjct  118  SGHDSKLDVAIKQLNRQGFQGHKEWINEVNFLG  150



>gb|KDO72842.1| hypothetical protein CISIN_1g043568mg [Citrus sinensis]
Length=453

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 87/153 (57%), Gaps = 16/153 (10%)
 Frame = +1

Query  232  MRCFLFHNDEKD-----EEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESR  396
            M+CF F N E++     ++  +V  T  +S     S   V  S++++        S +  
Sbjct  1    MKCFHFSNGERERRDGGDDGGVVSRTSKVSWARSLS---VASSSVDTRRSEFDSDSRDWS  57

Query  397  GRTQFPSM--SERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPA--  564
                F  +    R ++LR FSF+ELKSAT+ F+R+  IGEGGFG VY+  ++ S D    
Sbjct  58   DSLAFYELLSQRRANDLRVFSFAELKSATRGFSRALLIGEGGFGCVYRGVVRVSSDDHQT  117

Query  565  ----SRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
                S++DVA+KQL+R+G QGH+EW+ EVN LG
Sbjct  118  SGHDSKLDVAIKQLNRQGFQGHKEWINEVNFLG  150



>ref|XP_010274546.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nelumbo 
nucifera]
Length=394

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 77/141 (55%), Gaps = 14/141 (10%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF +  D+     +  KS P           + K  +   +SQ    ++  +  R   
Sbjct  1    MKCFFYFKDKPKSSKQ--KSAP-----------EFKDRSQPDNSQRGDKSAGSAASRRTI  47

Query  412  PSM-SERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
            P +  E+  NLR FSFSEL++AT +FNR  KIGEGGFG VYK  I   +    +  VA+K
Sbjct  48   PELYEEKAHNLRVFSFSELRNATNDFNRMLKIGEGGFGSVYKGFIGPPDGQGEKTVVAIK  107

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            +L+R GLQGH++W+ EV  LG
Sbjct  108  KLNREGLQGHKQWMAEVQFLG  128



>ref|XP_010941253.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Elaeis guineensis]
Length=399

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = +1

Query  409  FPSM-SERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             P+M  ER  NLR F F EL++ T +F+R  KIGEGGFG VYKA IK  +    R+ VAV
Sbjct  63   IPAMYEERAHNLRVFEFDELRNVTNDFSRMNKIGEGGFGSVYKAYIKPLDGKGDRIAVAV  122

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            K+L++RGLQGH++W+ EV  LG
Sbjct  123  KRLNQRGLQGHKQWLAEVQFLG  144



>ref|XP_004245841.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Solanum 
lycopersicum]
Length=409

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 56/82 (68%), Gaps = 1/82 (1%)
 Frame = +1

Query  409  FPSM-SERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             P M  ER  NLR F+ SELK AT+NFNR  KIGEGGFG VYK +I+ S      V VAV
Sbjct  52   IPEMYREREQNLRVFTLSELKEATRNFNRLLKIGEGGFGSVYKGSIQPSNGKGDPVVVAV  111

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            K+L+  GLQGHR+W+ EV  LG
Sbjct  112  KKLNTLGLQGHRQWIAEVQFLG  133



>gb|KHN01616.1| Putative receptor-like protein kinase [Glycine soja]
Length=430

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 84/140 (60%), Gaps = 10/140 (7%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF +  D+     +  +S P L          ++ S  E  ++ +S +ST  RG  + 
Sbjct  1    MKCFYYFRDKSRSSKQ--RSAPELKE-----QEKLEFSGPERVTK-SSCSSTSPRGIPEL  52

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
                E+  NLRDFSF+ELK AT +F+R  KIGEGGFG V+K TIK ++   + V VA+K+
Sbjct  53   --YEEKGHNLRDFSFTELKRATSDFSRLLKIGEGGFGSVFKGTIKPADGNGNSVLVAIKR  110

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L++  LQGH++W+TEV  LG
Sbjct  111  LNKNALQGHKQWLTEVQFLG  130



>emb|CDX74866.1| BnaA05g06120D [Brassica napus]
Length=430

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  433  SNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQLSRRGLQ  612
            +NL+ F+  +LK+ATKNF+RS  IGEGGFG V++  I+N +D   ++D+AVKQL+ +  +
Sbjct  69   NNLKVFALDDLKTATKNFSRSLMIGEGGFGGVFRGIIQNPQDSRKKIDIAVKQLNYKYFK  128

Query  613  GHREWVTEVNVLG  651
            GH+EWVTEVNVLG
Sbjct  129  GHKEWVTEVNVLG  141



>ref|XP_001757199.1| predicted protein [Physcomitrella patens]
 gb|EDQ78058.1| predicted protein, partial [Physcomitrella patens]
Length=385

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 60/78 (77%), Gaps = 3/78 (4%)
 Frame = +1

Query  427  RPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPAS---RVDVAVKQLS  597
            +P++LRDF+F EL+ ATKNF+R + +GEGGFG V+K TI+  ++      ++DVAVKQL+
Sbjct  76   KPNDLRDFTFHELRYATKNFDRKSLLGEGGFGQVFKGTIRQKQNFGGGEEKIDVAVKQLN  135

Query  598  RRGLQGHREWVTEVNVLG  651
             RG QGH+EW+ EV+ LG
Sbjct  136  SRGEQGHKEWLAEVHFLG  153



>ref|XP_006354647.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X3 [Solanum tuberosum]
Length=407

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 75/141 (53%), Gaps = 9/141 (6%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF +  D      +  KS PV+      SD           ++  + +S  +     F
Sbjct  1    MKCFFYFKDRHRNRER--KSAPVVLQDQSKSDIS------GGGAERVTKSSCSTSSARSF  52

Query  412  PSMSE-RPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
              + E +  NLR F+FSELK AT NFNR  KIGEGGFG VYK  IK ++       VA+K
Sbjct  53   SDVYEGKGQNLRVFTFSELKQATNNFNRLLKIGEGGFGCVYKGNIKPADGKGESTTVAIK  112

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            +L+R G QGH++WV EV  LG
Sbjct  113  KLNRDGYQGHKQWVAEVQFLG  133



>ref|XP_004133967.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Cucumis 
sativus]
 gb|KGN56688.1| hypothetical protein Csa_3G128960 [Cucumis sativus]
Length=426

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 81/140 (58%), Gaps = 10/140 (7%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF +  D+     +  +S P L         + + S+    S+ A+ + + +  R+  
Sbjct  1    MKCFYYFKDKSRSRRQ--RSAPQLK--------EQQESDFSGCSRTAASSCSLTSPRSVP  50

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
                E+  NLR FSF+EL+ AT++FNR  KIG+GGFG V+K +IK  +     + VA+KQ
Sbjct  51   ELYEEKAHNLRVFSFTELRQATQDFNRLLKIGQGGFGSVFKGSIKPVDGNGDPLVVAIKQ  110

Query  592  LSRRGLQGHREWVTEVNVLG  651
            LS+ GLQGH++W+ EV  LG
Sbjct  111  LSKDGLQGHKQWLAEVQFLG  130



>ref|XP_003530124.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X1 [Glycine max]
 ref|XP_006583518.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X2 [Glycine max]
 ref|XP_006583519.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X3 [Glycine max]
Length=430

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 84/140 (60%), Gaps = 10/140 (7%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF +  D+     +  +S P L          ++ S  E  ++ +S +ST  RG  + 
Sbjct  1    MKCFYYFRDKSRSSKQ--RSAPELKE-----QEKLEFSGPERVTK-SSCSSTSPRGIPEL  52

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
                E+  NLRDFSF+ELK AT +F+R  KIGEGGFG V+K TIK ++   + V VA+K+
Sbjct  53   --YEEKGHNLRDFSFTELKRATSDFSRLLKIGEGGFGSVFKGTIKPADGNRNSVLVAIKR  110

Query  592  LSRRGLQGHREWVTEVNVLG  651
            L++  LQGH++W+TEV  LG
Sbjct  111  LNKNALQGHKQWLTEVQFLG  130



>ref|XP_006354645.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006354646.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
isoform X2 [Solanum tuberosum]
Length=430

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 75/141 (53%), Gaps = 9/141 (6%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF +  D      +  KS PV+      SD           ++  + +S  +     F
Sbjct  1    MKCFFYFKDRHRNRER--KSAPVVLQDQSKSDIS------GGGAERVTKSSCSTSSARSF  52

Query  412  PSMSE-RPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVK  588
              + E +  NLR F+FSELK AT NFNR  KIGEGGFG VYK  IK ++       VA+K
Sbjct  53   SDVYEGKGQNLRVFTFSELKQATNNFNRLLKIGEGGFGCVYKGNIKPADGKGESTTVAIK  112

Query  589  QLSRRGLQGHREWVTEVNVLG  651
            +L+R G QGH++WV EV  LG
Sbjct  113  KLNRDGYQGHKQWVAEVQFLG  133



>gb|KCW85563.1| hypothetical protein EUGRSUZ_B02362 [Eucalyptus grandis]
Length=415

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 62/96 (65%), Gaps = 4/96 (4%)
 Frame = +1

Query  376  DTSTESRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIK---  546
            D +  S  RT       R ++LR FSF+ELKSAT+ F+R+  IGEGGFG VYK  +    
Sbjct  17   DGAVASSSRTSRLLTQRRANDLRVFSFAELKSATRGFSRALMIGEGGFGCVYKGVVAVPG  76

Query  547  -NSEDPASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
               +   +R+DVAVKQL+R G QGH+EW+ EVN LG
Sbjct  77   GAPDGSDARMDVAVKQLNRNGFQGHKEWINEVNFLG  112



>ref|XP_004307263.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Fragaria 
vesca subsp. vesca]
 ref|XP_011469537.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Fragaria 
vesca subsp. vesca]
 ref|XP_011469538.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Fragaria 
vesca subsp. vesca]
Length=427

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 80/139 (58%), Gaps = 10/139 (7%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF +  ++     +  +S P L   SG SD+      ++SS      ++   RG  + 
Sbjct  1    MKCFYYFKEKSRTREQ--RSAPELKDQSG-SDYSGASRVVKSSC-----SANSPRGIPEL  52

Query  412  PSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQ  591
                E+  NLR F+F EL+ AT +F+R  KIGEGGFG VYK +IK +E    RV VA+K+
Sbjct  53   --YEEKAHNLRVFTFQELRQATNDFHRLLKIGEGGFGNVYKGSIKPAESKGDRVVVAIKK  110

Query  592  LSRRGLQGHREWVTEVNVL  648
            L+  GLQGH++WV EV  L
Sbjct  111  LNNDGLQGHKQWVAEVQFL  129



>ref|XP_010269868.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X4 [Nelumbo nucifera]
Length=385

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  424  ERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQLSRR  603
            E+  NLR FSFSEL++AT +FNR  KIGEGGFG VYK  IK       +  VAVK+L+R 
Sbjct  53   EKAHNLRVFSFSELRNATNDFNRMLKIGEGGFGSVYKGFIKPPNGQGEKTVVAVKKLNRD  112

Query  604  GLQGHREWVTEVNVLG  651
            GLQGH++WV EV  LG
Sbjct  113  GLQGHKQWVAEVQFLG  128



>ref|XP_010089771.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXB38363.1| putative receptor-like protein kinase [Morus notabilis]
Length=428

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 80/146 (55%), Gaps = 21/146 (14%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVL-----SSCSGFSDHDVKHSNLESSSQNASDTSTESR  396
            M+CF +  D+     +  +S P L     S  SG  D  +K          +S ++   R
Sbjct  1    MKCFYYFKDKTKSRQQ--RSAPELKEQSKSQYSGADDRIIK----------SSCSANSPR  48

Query  397  GRTQFPSM-SERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRV  573
            G    P M  E+  NLR F+FS+L+ AT +F+R  KIGEGGFG VYK +IK ++     V
Sbjct  49   G---IPEMYEEKAHNLRVFTFSDLRHATHDFSRLLKIGEGGFGSVYKGSIKPADGKGDPV  105

Query  574  DVAVKQLSRRGLQGHREWVTEVNVLG  651
             VA+K+L   GLQGH++WV EV  LG
Sbjct  106  AVAIKKLDSHGLQGHKQWVAEVQFLG  131



>ref|XP_008799403.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Phoenix 
dactylifera]
Length=397

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 80/139 (58%), Gaps = 1/139 (1%)
 Frame = +1

Query  238  CFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQFPS  417
            CF     + +  P+   +T   S  +  S+     S+  S+ ++ S +S  +  +   P+
Sbjct  4    CFGLFKKKTENRPERSLATASTSVSAPPSNVSTSRSDDSSARKHTSKSSASTSSQRSIPA  63

Query  418  M-SERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQL  594
            M  ER  N+R F   EL++AT +F+R  KIGEGGFG VYK  IK  +    R+ VAVK+L
Sbjct  64   MYEERAHNMRVFELDELRNATNDFSRMLKIGEGGFGKVYKGFIKPLDGKGDRITVAVKKL  123

Query  595  SRRGLQGHREWVTEVNVLG  651
            ++RGLQGH+EW+ EV  LG
Sbjct  124  NQRGLQGHKEWLAEVQFLG  142



>ref|XP_009590399.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Nicotiana tomentosiformis]
Length=463

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 81/149 (54%), Gaps = 22/149 (15%)
 Frame = +1

Query  232  MRCFLFHNDEKDE-------EPKI--VKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTS  384
            M+CF F  DE++E       E K+  V+S  V SS S   D     S  +S S++ +D+ 
Sbjct  1    MKCFYFTKDEEEEGATLSSRESKVSWVRSLSVASS-SATVDTRRSRSEFDSDSRDYTDSF  59

Query  385  TESRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPA  564
                  TQ      R ++LR F F ELK ATK F+R   IGEGGFG VY+  +   E   
Sbjct  60   EFYEFLTQ-----RRANDLRVFGFYELKLATKGFSRGLMIGEGGFGSVYRGVVGEME---  111

Query  565  SRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
                VAVK+L+R G QGH+EW+ EVN LG
Sbjct  112  ----VAVKRLNRHGFQGHKEWINEVNFLG  136



>ref|XP_010269867.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X3 [Nelumbo nucifera]
Length=409

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  424  ERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQLSRR  603
            E+  NLR FSFSEL++AT +FNR  KIGEGGFG VYK  IK       +  VAVK+L+R 
Sbjct  53   EKAHNLRVFSFSELRNATNDFNRMLKIGEGGFGSVYKGFIKPPNGQGEKTVVAVKKLNRD  112

Query  604  GLQGHREWVTEVNVLG  651
            GLQGH++WV EV  LG
Sbjct  113  GLQGHKQWVAEVQFLG  128



>gb|EPS63005.1| hypothetical protein M569_11782 [Genlisea aurea]
Length=390

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 0/101 (0%)
 Frame = +1

Query  349  LESSSQNASDTSTESRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPV  528
            ++S S   S  S  +  R+      E+  NLR FS  EL+ AT NFNR  +IGEGGFG V
Sbjct  39   VDSRSTTVSSGSLATTARSISEMYKEKEQNLRVFSLMELREATNNFNRLHRIGEGGFGTV  98

Query  529  YKATIKNSEDPASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            YKA+IK  +   S + VA+K+L+  G+QGH++WV EV  LG
Sbjct  99   YKASIKPVDGQGSPITVAIKRLNTLGMQGHKQWVAEVQFLG  139



>ref|XP_010269866.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X2 [Nelumbo nucifera]
Length=410

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  424  ERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQLSRR  603
            E+  NLR FSFSEL++AT +FNR  KIGEGGFG VYK  IK       +  VAVK+L+R 
Sbjct  53   EKAHNLRVFSFSELRNATNDFNRMLKIGEGGFGSVYKGFIKPPNGQGEKTVVAVKKLNRD  112

Query  604  GLQGHREWVTEVNVLG  651
            GLQGH++WV EV  LG
Sbjct  113  GLQGHKQWVAEVQFLG  128



>ref|XP_006358625.1| PREDICTED: probable receptor-like protein kinase At5g47070-like 
[Solanum tuberosum]
Length=423

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 55/82 (67%), Gaps = 1/82 (1%)
 Frame = +1

Query  409  FPSM-SERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAV  585
             P M  ER  NLR F+ SELK AT+NFNR  KIGEGGFG VYK +I+        + VAV
Sbjct  52   IPEMYREREQNLRVFTLSELKEATRNFNRLLKIGEGGFGSVYKGSIQPPNGKGDPIVVAV  111

Query  586  KQLSRRGLQGHREWVTEVNVLG  651
            K+L+  GLQGHR+W+ EV  LG
Sbjct  112  KKLNTLGLQGHRQWIAEVQFLG  133



>ref|XP_011018668.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Populus 
euphratica]
Length=388

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 72/147 (49%), Gaps = 25/147 (17%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQF  411
            M+CF    D+   +     S P                  E   Q+ S++S  SR     
Sbjct  1    MKCFYIFKDKFKNKKGQANSAP------------------EPRDQSKSNSSPLSRTAKSL  42

Query  412  PS-------MSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASR  570
            PS         E+  NLR FSF ELK AT  FNR  KIGEGGFG VYK T++ +      
Sbjct  43   PSPRSIPELYKEKEHNLRVFSFQELKEATNGFNRLLKIGEGGFGSVYKGTVRPASGQGDP  102

Query  571  VDVAVKQLSRRGLQGHREWVTEVNVLG  651
            + VA+K+L+  GLQGH++W+ EV  LG
Sbjct  103  IVVAIKKLNNHGLQGHKQWLAEVQFLG  129



>ref|XP_011089472.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Sesamum 
indicum]
Length=446

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 87/151 (58%), Gaps = 14/151 (9%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLS-SCSGFSDHDVKHSNLESSSQNASDTSTESRGRTQ  408
            M+CF F + E+           V+S   S      V  +NL+S     S+  TESR    
Sbjct  1    MKCFHFTSGERRPSDDDDDQDGVVSRKVSWARSLSVASTNLDS---RRSEFDTESRRDWA  57

Query  409  FPS------MSE-RPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPA-  564
             PS      +S+ R ++LR F+FS+LKSAT+ F+RS  IGEGGFG VY+  +K  +  + 
Sbjct  58   DPSGLFQDFLSQGRANDLRVFTFSQLKSATRGFSRSLVIGEGGFGCVYRGRVKVVDSGSG  117

Query  565  --SRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
              S VDVA+KQL+R G QGH+EW+ EVN LG
Sbjct  118  LESDVDVAIKQLNRNGCQGHKEWINEVNFLG  148



>ref|NP_973556.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AAC33222.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM15076.1| putative protein kinase [Arabidopsis thaliana]
 gb|ABO45701.1| At2g28940 [Arabidopsis thaliana]
 gb|AEC08193.1| protein kinase family protein [Arabidopsis thaliana]
Length=462

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 92/166 (55%), Gaps = 33/166 (20%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQN---ASDTSTESRGR  402
            M+CF F N +K       ++T  +    G  D  V  ++  S +++   AS T+++   R
Sbjct  1    MKCFHFTNGDK-------RTTTTIEEGVGGGDSVVSRASRLSWARSLSVASSTTSDPTRR  53

Query  403  TQFPS--------------MSER------PSN-LRDFSFSELKSATKNFNRSTKIGEGGF  519
            ++F S              +S+R      P N L+ F+F ELK ATK FNR   IGEGGF
Sbjct  54   SEFDSDWSFSPERLTFPKPLSQRWIGGLVPENDLKVFTFKELKIATKGFNRGLLIGEGGF  113

Query  520  GPVYKATIKNSEDPA--SRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            G VY+  +  S+     S+++VAVKQL+R+GLQGH+EW+ EVN LG
Sbjct  114  GCVYRGVVDVSDSNGFDSKINVAVKQLNRQGLQGHKEWINEVNFLG  159



>ref|XP_012092541.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Jatropha 
curcas]
 gb|KDP20447.1| hypothetical protein JCGZ_05292 [Jatropha curcas]
Length=457

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 88/159 (55%), Gaps = 26/159 (16%)
 Frame = +1

Query  232  MRCFLFHNDEK--DEE-------------PKIVKSTPVLSSCSGFSDHDVKHSNLESSSQ  366
            M+CF F N E+  DE+                 +S  + SS       D + S  +    
Sbjct  1    MKCFHFTNGERRDDEDGGAGDVVSRVVSRVSWARSLSIASSSI-----DTRRSEFDYECN  55

Query  367  NASDTSTESRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIK  546
            ++ D S +S G  +F S   R ++LR F+F+ELKSAT+ F+R+  IGEGGFG VY+  ++
Sbjct  56   SSRDLS-DSVGFYEFLS-QRRANDLRVFTFAELKSATRGFSRALLIGEGGFGCVYRGVVR  113

Query  547  NSEDPAS----RVDVAVKQLSRRGLQGHREWVTEVNVLG  651
              +D       ++DVA+KQL+R G QGH+EW+ EVN LG
Sbjct  114  VPDDEIEGHDLKMDVAIKQLNRHGFQGHKEWINEVNFLG  152



>ref|XP_009386442.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Musa 
acuminata subsp. malaccensis]
Length=397

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +1

Query  364  QNASDTSTESRGRTQFPSM-SERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKAT  540
            QN S ++  S  +   P++  ER  NLR F + EL++AT NF+R  KIGEGGFG VYK  
Sbjct  42   QNPSRSTGPSASQRSIPALYEERAHNLRVFEYDELRAATDNFSRMNKIGEGGFGGVYKGY  101

Query  541  IKNSEDPASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            I   +    R  VA+K+L++RGLQGH++W+ EV  LG
Sbjct  102  IIPPDGEEGRTLVAIKKLNQRGLQGHKQWLVEVQFLG  138



>ref|XP_009590397.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Nicotiana tomentosiformis]
Length=475

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 81/149 (54%), Gaps = 22/149 (15%)
 Frame = +1

Query  232  MRCFLFHNDEKDE-------EPKI--VKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTS  384
            M+CF F  DE++E       E K+  V+S  V SS S   D     S  +S S++ +D+ 
Sbjct  1    MKCFYFTKDEEEEGATLSSRESKVSWVRSLSVASS-SATVDTRRSRSEFDSDSRDYTDSF  59

Query  385  TESRGRTQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPA  564
                  TQ      R ++LR F F ELK ATK F+R   IGEGGFG VY+  +   E   
Sbjct  60   EFYEFLTQ-----RRANDLRVFGFYELKLATKGFSRGLMIGEGGFGSVYRGVVGEME---  111

Query  565  SRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
                VAVK+L+R G QGH+EW+ EVN LG
Sbjct  112  ----VAVKRLNRHGFQGHKEWINEVNFLG  136



>ref|XP_010269864.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform 
X1 [Nelumbo nucifera]
Length=426

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  424  ERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQLSRR  603
            E+  NLR FSFSEL++AT +FNR  KIGEGGFG VYK  IK       +  VAVK+L+R 
Sbjct  53   EKAHNLRVFSFSELRNATNDFNRMLKIGEGGFGSVYKGFIKPPNGQGEKTVVAVKKLNRD  112

Query  604  GLQGHREWVTEVNVLG  651
            GLQGH++WV EV  LG
Sbjct  113  GLQGHKQWVAEVQFLG  128



>gb|ABE01834.1| NAK-type protein kinase [Nicotiana tabacum]
Length=412

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 61/95 (64%), Gaps = 2/95 (2%)
 Frame = +1

Query  370  ASDTSTESRGRTQFPSMS-ERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIK  546
            A  T + S  R+  P M  E+  NLR FS SELK AT++FNR  KIGEGGFG VYK TI+
Sbjct  40   AKSTGSVSSARS-IPQMYREKEQNLRVFSLSELKEATRSFNRMLKIGEGGFGSVYKGTIQ  98

Query  547  NSEDPASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
                    + VA+K+L+  GLQGHR+WV EV  LG
Sbjct  99   PPSGRGDPIVVAIKKLNTLGLQGHRQWVAEVQFLG  133



>ref|XP_009619124.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nicotiana 
tomentosiformis]
Length=412

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 61/95 (64%), Gaps = 2/95 (2%)
 Frame = +1

Query  370  ASDTSTESRGRTQFPSM-SERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIK  546
            A  T + S  R+  P M  E+  NLR FS SELK AT++FNR  KIGEGGFG VYK TI+
Sbjct  40   AKSTGSVSSARS-IPQMYREKEQNLRVFSLSELKEATRSFNRMLKIGEGGFGSVYKGTIQ  98

Query  547  NSEDPASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
                    + VA+K+L+  GLQGHR+WV EV  LG
Sbjct  99   PPSGRGDPIVVAIKKLNTLGLQGHRQWVAEVQFLG  133



>ref|XP_009795376.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Nicotiana 
sylvestris]
Length=409

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 61/95 (64%), Gaps = 2/95 (2%)
 Frame = +1

Query  370  ASDTSTESRGRTQFPSM-SERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIK  546
            A  T + S  R+  P M  E+  NLR FS SELK AT++FNR  KIGEGGFG VYK TI+
Sbjct  40   AKSTGSVSSARS-IPEMYREKEQNLRVFSLSELKEATRSFNRMLKIGEGGFGSVYKGTIQ  98

Query  547  NSEDPASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
                    + VA+K+L+  GLQGHR+WV EV  LG
Sbjct  99   PPNGRGDPIVVAIKKLNTLGLQGHRQWVAEVQFLG  133



>gb|EYU18978.1| hypothetical protein MIMGU_mgv1a006424mg [Erythranthe guttata]
Length=444

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 58/78 (74%), Gaps = 3/78 (4%)
 Frame = +1

Query  427  RPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSE---DPASRVDVAVKQLS  597
            R ++LR F+FSELKSAT+ F+RS  IGEGGFG VY+  +K ++      S VDVA+KQL+
Sbjct  79   RANDLRVFTFSELKSATRGFSRSLVIGEGGFGCVYQGRVKLADCGSGFGSEVDVAIKQLN  138

Query  598  RRGLQGHREWVTEVNVLG  651
            R G QGH+EW+ EVN LG
Sbjct  139  RNGFQGHKEWINEVNFLG  156



>gb|KJB25423.1| hypothetical protein B456_004G190600 [Gossypium raimondii]
 gb|KJB25424.1| hypothetical protein B456_004G190600 [Gossypium raimondii]
Length=389

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 77/143 (54%), Gaps = 15/143 (10%)
 Frame = +1

Query  232  MRCF-LFHNDEKDEEPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESRG--R  402
            M+CF +F  D+   + +  +S P L + S            ESS   A   +T+S    R
Sbjct  1    MKCFSIFGKDKSKSKKRETRSAPELRNQS------------ESSDNPALSRTTKSLPSPR  48

Query  403  TQFPSMSERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVA  582
            T      E+  NLR FS  EL+ AT  FNR  KIGEGGFG VYK TIK+       + VA
Sbjct  49   TIPELYKEKKHNLRVFSLDELRDATNCFNRKLKIGEGGFGSVYKGTIKSLSGRGDPIVVA  108

Query  583  VKQLSRRGLQGHREWVTEVNVLG  651
            VK+L+  GLQGH+EW+ E+  LG
Sbjct  109  VKKLNAHGLQGHKEWLAEIQFLG  131



>gb|KJB40949.1| hypothetical protein B456_007G084600 [Gossypium raimondii]
Length=436

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 80/144 (56%), Gaps = 15/144 (10%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSS---CSGFSDHDVKHSNLESSSQNASDTSTESRGR  402
            M+CF +  D+   + +  +S P L       G+S  D     +  SS + S  S  S   
Sbjct  1    MKCFHYFKDKSRSKGQ--RSAPELKQERKSEGYSGPD----RITKSSCSTSVASPRS---  51

Query  403  TQFPSMSE-RPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
               P + E +  NLR FSFSELK AT++FN   KIGEGGFG VYK TI  +       +V
Sbjct  52   --IPELYEAKAHNLRVFSFSELKQATRDFNLLHKIGEGGFGSVYKGTIGPAGGKGEPFEV  109

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            A+K+L++ GLQGH++WV EV  LG
Sbjct  110  AIKKLNKNGLQGHKQWVAEVQFLG  133



>gb|KJB40950.1| hypothetical protein B456_007G084600 [Gossypium raimondii]
 gb|KJB40951.1| hypothetical protein B456_007G084600 [Gossypium raimondii]
 gb|KJB40952.1| hypothetical protein B456_007G084600 [Gossypium raimondii]
Length=438

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 80/144 (56%), Gaps = 15/144 (10%)
 Frame = +1

Query  232  MRCFLFHNDEKDEEPKIVKSTPVLSS---CSGFSDHDVKHSNLESSSQNASDTSTESRGR  402
            M+CF +  D+   + +  +S P L       G+S  D     +  SS + S  S  S   
Sbjct  1    MKCFHYFKDKSRSKGQ--RSAPELKQERKSEGYSGPD----RITKSSCSTSVASPRS---  51

Query  403  TQFPSMSE-RPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDV  579
               P + E +  NLR FSFSELK AT++FN   KIGEGGFG VYK TI  +       +V
Sbjct  52   --IPELYEAKAHNLRVFSFSELKQATRDFNLLHKIGEGGFGSVYKGTIGPAGGKGEPFEV  109

Query  580  AVKQLSRRGLQGHREWVTEVNVLG  651
            A+K+L++ GLQGH++WV EV  LG
Sbjct  110  AIKKLNKNGLQGHKQWVAEVQFLG  133



>ref|XP_006409927.1| hypothetical protein EUTSA_v10017635mg [Eutrema salsugineum]
 gb|ESQ51380.1| hypothetical protein EUTSA_v10017635mg [Eutrema salsugineum]
Length=450

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 86/153 (56%), Gaps = 15/153 (10%)
 Frame = +1

Query  232  MRCFLFHNDEK----DE-EPKIVKSTPVLSSCSGFSDHDVKHSNLESSSQNASDTSTESR  396
            M+CF F N EK    DE E  IV     LS     S      S+    S+  SD S  S 
Sbjct  1    MKCFHFTNGEKRGGGDEGENGIVSKASRLSWARSLSVASSTASDPTRRSEFDSDWSF-SP  59

Query  397  GRTQFPS-MSER-------PSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNS  552
             R  FP  +S+R        ++L+ F++ ELK ATK FNR+  IGEGGFG VY+  +   
Sbjct  60   ERFGFPKPLSQRWIGGIAAENDLKVFTYGELKLATKGFNRALLIGEGGFGCVYRGVVV-V  118

Query  553  EDPASRVDVAVKQLSRRGLQGHREWVTEVNVLG  651
            +   S+V+VAVKQL+R+GLQGH EW+ EVN LG
Sbjct  119  DGFDSKVNVAVKQLNRQGLQGHNEWINEVNFLG  151



>ref|XP_007052402.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007052403.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX96559.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX96560.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=434

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  424  ERPSNLRDFSFSELKSATKNFNRSTKIGEGGFGPVYKATIKNSEDPASRVDVAVKQLSRR  603
            ER  NLR FSFSEL+ AT +F+   KIGEGGFG VYK TIK ++     V VA+K+L++ 
Sbjct  58   ERAHNLRVFSFSELRQATHDFSLLLKIGEGGFGSVYKGTIKPADGKGEPVVVAIKKLNKN  117

Query  604  GLQGHREWVTEVNVLG  651
            GLQGH++WV EV  LG
Sbjct  118  GLQGHKQWVAEVQFLG  133



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1021470116141