BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6603

Length=708
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002301843.1|  hypothetical protein POPTR_0002s25720g             327   2e-107   Populus trichocarpa [western balsam poplar]
gb|KJB42341.1|  hypothetical protein B456_007G150200                    324   3e-107   Gossypium raimondii
ref|XP_011024495.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    327   4e-107   Populus euphratica
gb|KJB42337.1|  hypothetical protein B456_007G150200                    325   4e-107   Gossypium raimondii
gb|KJB42340.1|  hypothetical protein B456_007G150200                    325   1e-106   Gossypium raimondii
gb|KJB42338.1|  hypothetical protein B456_007G150200                    324   2e-106   Gossypium raimondii
gb|KJB42335.1|  hypothetical protein B456_007G150200                    325   3e-106   Gossypium raimondii
ref|XP_002271401.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    324   4e-106   Vitis vinifera
gb|ABK94679.1|  unknown                                                 324   5e-106   Populus trichocarpa [western balsam poplar]
ref|XP_011080124.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    323   6e-106   Sesamum indicum [beniseed]
gb|EYU46388.1|  hypothetical protein MIMGU_mgv1a007681mg                321   6e-105   Erythranthe guttata [common monkey flower]
gb|KJB42342.1|  hypothetical protein B456_007G150200                    315   7e-105   Gossypium raimondii
ref|XP_010264829.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    317   3e-103   Nelumbo nucifera [Indian lotus]
emb|CDP03802.1|  unnamed protein product                                317   4e-103   Coffea canephora [robusta coffee]
ref|XP_008235764.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    315   6e-103   Prunus mume [ume]
ref|XP_007050145.1|  NAD(P)-binding Rossmann-fold superfamily pro...    316   9e-103   
ref|XP_007201067.1|  hypothetical protein PRUPE_ppa006705mg             315   1e-102   
ref|XP_012085214.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    314   4e-102   Jatropha curcas
ref|XP_007050147.1|  NAD(P)-binding Rossmann-fold superfamily pro...    313   9e-102   
ref|XP_008789505.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    313   1e-101   Phoenix dactylifera
gb|AFK48198.1|  unknown                                                 312   2e-101   Lotus japonicus
ref|XP_007144408.1|  hypothetical protein PHAVU_007G153700g             312   2e-101   Phaseolus vulgaris [French bean]
ref|XP_003542442.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    309   2e-100   Glycine max [soybeans]
gb|ACU23211.1|  unknown                                                 309   3e-100   Glycine max [soybeans]
ref|XP_010936110.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    307   2e-99    Elaeis guineensis
ref|XP_002321296.2|  hypothetical protein POPTR_0014s18680g             306   2e-99    
ref|XP_009395307.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    305   9e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010091822.1|  hypothetical protein L484_015891                   305   1e-98    Morus notabilis
ref|XP_009370595.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    305   2e-98    Pyrus x bretschneideri [bai li]
gb|ACJ84721.1|  unknown                                                 303   5e-98    Medicago truncatula
ref|XP_009370589.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    304   5e-98    Pyrus x bretschneideri [bai li]
ref|XP_010940664.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    303   8e-98    
ref|XP_008382707.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    303   2e-97    
ref|XP_009335235.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    301   5e-97    Pyrus x bretschneideri [bai li]
ref|XP_011458045.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    300   8e-97    Fragaria vesca subsp. vesca
ref|XP_006355892.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    298   5e-96    Solanum tuberosum [potatoes]
ref|XP_004247128.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    298   7e-96    
ref|XP_002526534.1|  NADH-ubiquinone oxidoreductase 39 kD subunit...    298   7e-96    
ref|XP_006854436.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    297   1e-95    Amborella trichopoda
ref|XP_008372401.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    296   4e-95    Malus domestica [apple tree]
ref|XP_006443722.1|  hypothetical protein CICLE_v10020464mg             294   3e-94    
ref|XP_010036149.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    292   9e-94    Eucalyptus grandis [rose gum]
ref|XP_010540921.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    292   1e-93    Tarenaya hassleriana [spider flower]
ref|XP_010684864.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    291   2e-93    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009586626.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    290   1e-92    Nicotiana tomentosiformis
ref|XP_009763970.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    286   2e-92    Nicotiana sylvestris
ref|XP_010548735.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    288   8e-92    Tarenaya hassleriana [spider flower]
ref|XP_010489051.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    286   5e-91    Camelina sativa [gold-of-pleasure]
ref|XP_008459972.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    284   3e-90    Cucumis melo [Oriental melon]
ref|XP_009102039.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    283   3e-90    Brassica rapa
emb|CDY31970.1|  BnaA07g00250D                                          283   3e-90    Brassica napus [oilseed rape]
emb|CDX81965.1|  BnaC08g36360D                                          283   4e-90    
emb|CDY05746.1|  BnaC07g00570D                                          283   5e-90    
ref|XP_011656761.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    283   5e-90    Cucumis sativus [cucumbers]
ref|XP_009117495.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    282   1e-89    Brassica rapa
emb|CDY13877.1|  BnaA09g43790D                                          282   1e-89    Brassica napus [oilseed rape]
ref|XP_006648113.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    281   1e-89    
ref|XP_006408954.1|  hypothetical protein EUTSA_v10002002mg             281   2e-89    Eutrema salsugineum [saltwater cress]
ref|XP_006296717.1|  hypothetical protein CARUB_v10014190mg             278   5e-89    
ref|NP_001048516.1|  Os02g0816800                                       280   1e-88    
ref|XP_009112664.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    279   2e-88    Brassica rapa
ref|XP_010467837.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    279   2e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010415893.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    278   3e-88    Camelina sativa [gold-of-pleasure]
ref|XP_004495054.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    278   4e-88    Cicer arietinum [garbanzo]
emb|CDY03308.1|  BnaC09g10400D                                          278   7e-88    
emb|CDY39772.1|  BnaA09g10240D                                          277   8e-88    Brassica napus [oilseed rape]
gb|EEC74241.1|  hypothetical protein OsI_09443                          277   1e-87    Oryza sativa Indica Group [Indian rice]
ref|XP_002884196.1|  catalytic/ coenzyme binding protein                274   1e-86    Arabidopsis lyrata subsp. lyrata
ref|XP_002453037.1|  hypothetical protein SORBIDRAFT_04g037200          274   2e-86    Sorghum bicolor [broomcorn]
ref|NP_565469.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomp...    272   1e-85    Arabidopsis thaliana [mouse-ear cress]
gb|EPS69627.1|  hypothetical protein M569_05135                         270   1e-85    Genlisea aurea
ref|XP_004954373.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    268   3e-84    Setaria italica
dbj|BAJ86608.1|  predicted protein                                      268   7e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK24353.1|  unknown                                                 265   3e-83    Picea sitchensis
ref|NP_001149069.1|  LOC100282690                                       265   5e-83    
gb|ACF85773.1|  unknown                                                 265   6e-83    Zea mays [maize]
gb|AFW74028.1|  NADH-ubiquinone oxidoreductase subunit                  266   8e-83    
gb|KFK40412.1|  hypothetical protein AALP_AA3G370500                    263   4e-82    Arabis alpina [alpine rockcress]
gb|KHG08643.1|  hypothetical protein F383_12346                         259   2e-81    Gossypium arboreum [tree cotton]
ref|XP_003570393.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    256   3e-79    
gb|KJB42336.1|  hypothetical protein B456_007G150200                    240   6e-74    Gossypium raimondii
dbj|BAH20309.1|  AT2G20360                                              229   4e-70    Arabidopsis thaliana [mouse-ear cress]
gb|KDO37085.1|  hypothetical protein CISIN_1g047628mg                   220   2e-66    Citrus sinensis [apfelsine]
ref|XP_001765756.1|  predicted protein                                  209   1e-61    
gb|EEE58042.1|  hypothetical protein OsJ_08874                          201   3e-59    Oryza sativa Japonica Group [Japonica rice]
dbj|BAG95473.1|  unnamed protein product                                197   8e-58    Oryza sativa Japonica Group [Japonica rice]
gb|KJB42339.1|  hypothetical protein B456_007G150200                    197   3e-57    Gossypium raimondii
ref|XP_007050148.1|  NAD(P)-binding Rossmann-fold superfamily pro...    193   3e-56    
gb|EMT17104.1|  putative NADH dehydrogenase (ubiquinone) 1 alpha ...    187   1e-53    
gb|EMS47161.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    186   1e-53    Triticum urartu
ref|XP_002976090.1|  hypothetical protein SELMODRAFT_104564             179   3e-50    
ref|XP_002968287.1|  hypothetical protein SELMODRAFT_89106              178   7e-50    
ref|XP_001757609.1|  predicted protein                                  176   5e-49    
ref|XP_004339653.1|  NADH dehydrogenase, putative                       158   4e-42    Acanthamoeba castellanii str. Neff
dbj|GAA99675.1|  hypothetical protein E5Q_06378                         157   1e-41    Mixia osmundae IAM 14324
ref|XP_001626712.1|  predicted protein                                  153   2e-40    Nematostella vectensis
ref|XP_007510295.1|  predicted protein                                  153   6e-40    Bathycoccus prasinos
ref|XP_001835685.1|  NADH dehydrogenase                                 151   8e-40    Coprinopsis cinerea okayama7#130
ref|XP_003126608.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    151   2e-39    Sus scrofa [pigs]
ref|XP_002712902.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    151   2e-39    Oryctolagus cuniculus [domestic rabbit]
ref|XP_001420142.1|  predicted protein                                  150   2e-39    Ostreococcus lucimarinus CCE9901
gb|ESA03096.1|  hypothetical protein GLOINDRAFT_336975                  150   3e-39    
gb|KIO18953.1|  hypothetical protein M407DRAFT_153532                   150   3e-39    Tulasnella calospora MUT 4182
gb|EXX58721.1|  hypothetical protein RirG_195270                        150   3e-39    Rhizophagus irregularis DAOM 197198w
ref|XP_008574858.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    150   3e-39    Galeopterus variegatus [Malayan flying lemur]
gb|KIJ17694.1|  hypothetical protein PAXINDRAFT_167681                  149   4e-39    Paxillus involutus ATCC 200175
gb|KIK91888.1|  hypothetical protein PAXRUDRAFT_830459                  149   4e-39    Paxillus rubicundulus Ve08.2h10
ref|XP_007872120.1|  hypothetical protein PNEG_00249                    149   4e-39    Pneumocystis murina B123
ref|XP_006987942.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   5e-39    
ref|XP_003390219.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   6e-39    Amphimedon queenslandica
ref|XP_005334075.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   6e-39    
ref|XP_003331391.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    149   7e-39    Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_011984769.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   9e-39    Ovis aries musimon
ref|XP_004006995.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   9e-39    
ref|XP_005681037.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   9e-39    Capra hircus [domestic goat]
ref|XP_010963120.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   9e-39    Camelus bactrianus [camel]
ref|XP_007469502.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   9e-39    Lipotes vexillifer [baiji]
ref|XP_005365322.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   1e-38    
dbj|BAK63310.1|  NADH dehydrogenase                                     147   1e-38    Pan troglodytes
gb|KDN41067.1|  putative NADH2 dehydrogenase 40K chain                  149   1e-38    Tilletiaria anomala UBC 951
ref|XP_006175621.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    148   1e-38    
ref|XP_005365321.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   1e-38    Microtus ochrogaster [prairie voles]
gb|EAW88839.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomple...    145   1e-38    Homo sapiens [man]
gb|AAH91192.1|  Ndufa9 protein                                          148   1e-38    Rattus norvegicus [brown rat]
ref|XP_003796469.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    148   1e-38    Otolemur garnettii
ref|XP_006053611.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    148   2e-38    Bubalus bubalis [domestic water buffalo]
ref|XP_011806948.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    148   2e-38    Colobus angolensis palliatus
ref|XP_009546417.1|  hypothetical protein HETIRDRAFT_475334             147   2e-38    Heterobasidion irregulare TC 32-1
ref|NP_001094222.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    148   2e-38    Rattus norvegicus [brown rat]
ref|XP_010843290.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    148   2e-38    Bison bison bison
ref|XP_011851665.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    148   2e-38    Mandrillus leucophaeus
ref|XP_006237562.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    148   2e-38    Rattus norvegicus [brown rat]
ref|XP_003988339.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    148   2e-38    Felis catus [cat]
ref|NP_001127602.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    147   3e-38    Pongo abelii [orang utan]
ref|XP_010357461.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   3e-38    Rhinopithecus roxellana
gb|ABH12231.1|  mitochondrial complex I subunit NDUFA9                  147   3e-38    Pongo pygmaeus [orang utan]
ref|NP_001073383.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    147   3e-38    Pan troglodytes
ref|XP_007170262.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   3e-38    Balaenoptera acutorostrata scammoni
emb|CCF54116.1|  probable NADH2 dehydrogenase (ubiquinone) 40K chain    147   3e-38    Ustilago hordei
ref|XP_002504449.1|  predicted protein                                  147   4e-38    Micromonas commoda
emb|CBQ67793.1|  probable NADH2 dehydrogenase (ubiquinone) 40K chain    147   4e-38    Sporisorium reilianum SRZ2
ref|NP_001013477.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    145   4e-38    
sp|Q0MQB3.2|NDUA9_GORGO  RecName: Full=NADH dehydrogenase [ubiqui...    147   4e-38    Gorilla gorilla gorilla [lowland gorilla]
gb|AAH03351.1|  Similar to NADH dehydrogenase (ubiquinone) 1 alph...    146   4e-38    Homo sapiens [man]
ref|NP_001266630.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    147   4e-38    Gorilla gorilla [gorilla]
ref|XP_005957904.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   5e-38    Pantholops hodgsonii [Tibetan antelope]
ref|XP_004279068.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   5e-38    Orcinus orca [Orca]
ref|XP_007902354.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   6e-38    Callorhinchus milii [Australian ghost shark]
gb|ABF57357.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomple...    146   6e-38    Bos taurus [bovine]
ref|NP_001279619.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    147   7e-38    Callorhinchus milii [Australian ghost shark]
ref|XP_534915.3|  PREDICTED: NADH dehydrogenase [ubiquinone] 1 al...    146   8e-38    Canis lupus familiaris [dogs]
gb|EST09999.1|  NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit    147   8e-38    Kalmanozyma brasiliensis GHG001
ref|NP_991386.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomp...    146   8e-38    Bos taurus [bovine]
dbj|GAK62286.1|  NAD(P)-binding protein                                 146   8e-38    Moesziomyces antarcticus
dbj|GAC73597.1|  NADH:ubiquinone oxidoreductase, NDUFA9/39kDa sub...    146   9e-38    Moesziomyces antarcticus T-34
gb|ETS63618.1|  hypothetical protein PaG_01917                          146   9e-38    Moesziomyces aphidis DSM 70725
gb|AIC62000.1|  NDUFA9                                                  146   9e-38    synthetic construct
gb|AAA36350.1|  NADH dehydrogenase (ubiquinone)                         146   1e-37    Homo sapiens [man]
ref|NP_004993.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomp...    146   1e-37    Homo sapiens [man]
ref|XP_007935381.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    146   1e-37    Orycteropus afer afer
gb|AAI53423.1|  Ndufa9 protein                                          146   1e-37    Danio rerio [leopard danio]
ref|XP_007503809.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   1e-37    Monodelphis domestica
ref|XP_007089756.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   1e-37    
ref|XP_004778323.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    146   1e-37    Mustela putorius furo [black ferret]
ref|XP_008823675.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    146   1e-37    Nannospalax galili
gb|AAH68378.1|  Ndufa9 protein                                          146   1e-37    Danio rerio [leopard danio]
ref|XP_005174380.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    146   1e-37    
emb|CDI51333.1|  probable NADH2 dehydrogenase (ubiquinone) 40K chain    146   1e-37    Melanopsichium pennsylvanicum 4
gb|EFB28697.1|  hypothetical protein PANDA_009221                       145   1e-37    Ailuropoda melanoleuca
ref|XP_001494651.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   1e-37    Equus caballus [domestic horse]
ref|XP_005084120.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   1e-37    Mesocricetus auratus [Syrian golden hamster]
gb|EAW88838.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomple...    146   1e-37    Homo sapiens [man]
ref|XP_008528773.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   2e-37    Equus przewalskii [Przewalski horse]
ref|XP_004381326.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   2e-37    
gb|KDQ20806.1|  hypothetical protein BOTBODRAFT_26820                   145   2e-37    Botryobasidium botryosum FD-172 SS1
gb|AAI52140.1|  Ndufa9 protein                                          145   2e-37    Danio rerio [leopard danio]
ref|XP_009989270.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   2e-37    Tauraco erythrolophus
ref|XP_006795902.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   2e-37    Neolamprologus brichardi [lyretail cichlid]
ref|XP_002736180.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   2e-37    Saccoglossus kowalevskii
ref|XP_009178281.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   2e-37    Papio anubis [baboon]
ref|XP_009178280.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   2e-37    Papio anubis [baboon]
gb|KFV03415.1|  hypothetical protein N340_03010                         145   2e-37    Tauraco erythrolophus
ref|XP_003496081.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   2e-37    Cricetulus griseus [Chinese hamsters]
ref|XP_001372251.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   2e-37    Monodelphis domestica
ref|XP_006210904.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   2e-37    Vicugna pacos
ref|XP_002920485.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   3e-37    Ailuropoda melanoleuca
ref|XP_008141973.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   3e-37    Eptesicus fuscus
ref|XP_002188497.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   3e-37    Taeniopygia guttata
ref|XP_007882091.1|  hypothetical protein PFL1_06359                    145   3e-37    Anthracocystis flocculosa PF-1
ref|XP_002920484.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   4e-37    
ref|XP_006862735.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   4e-37    Chrysochloris asiatica
ref|XP_008274666.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   4e-37    Stegastes partitus
ref|XP_003447104.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   4e-37    Oreochromis niloticus
ref|XP_003771339.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   4e-37    Sarcophilus harrisii
ref|XP_005950396.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   5e-37    Haplochromis burtoni
ref|XP_005734821.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   5e-37    Pundamilia nyererei
ref|XP_005950395.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   5e-37    Haplochromis burtoni
ref|XP_003059930.1|  predicted protein                                  144   5e-37    Micromonas pusilla CCMP1545
gb|ELR54825.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    144   5e-37    Bos mutus
ref|XP_005734820.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   5e-37    Pundamilia nyererei
gb|KIJ64483.1|  hypothetical protein HYDPIDRAFT_28424                   144   5e-37    Hydnomerulius pinastri MD-312
ref|XP_010148325.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   5e-37    Eurypyga helias
ref|XP_005533361.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   6e-37    Pseudopodoces humilis [Tibetan ground-jay]
dbj|BAF83756.1|  unnamed protein product                                144   6e-37    Homo sapiens [man]
gb|KIK69637.1|  hypothetical protein GYMLUDRAFT_992204                  144   6e-37    Gymnopus luxurians FD-317 M1
ref|XP_011386267.1|  putative NADH2 dehydrogenase (ubiquinone) 40...    144   6e-37    Ustilago maydis 521
ref|XP_007527887.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   6e-37    Erinaceus europaeus [common hedgehog]
gb|KFV92623.1|  hypothetical protein N326_00630                         140   6e-37    Eurypyga helias
ref|XP_005569923.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   7e-37    Macaca fascicularis [crab eating macaque]
gb|KIM65954.1|  hypothetical protein SCLCIDRAFT_1211966                 143   7e-37    Scleroderma citrinum Foug A
ref|XP_006633741.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   7e-37    Lepisosteus oculatus
ref|XP_005897993.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   7e-37    Bos mutus
ref|XP_004459092.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   7e-37    Dasypus novemcinctus
ref|XP_006754928.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   8e-37    Myotis davidii
gb|KFV11223.1|  hypothetical protein N339_08758                         140   8e-37    Pterocles gutturalis
ref|XP_004692611.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    145   9e-37    
ref|XP_009092324.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    143   1e-36    Serinus canaria [canary]
ref|XP_011909624.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    143   1e-36    Cercocebus atys
ref|XP_005426929.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   1e-36    Geospiza fortis
ref|XP_007353556.1|  NAD(P)-binding protein                             144   1e-36    
ref|XP_006739694.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    143   1e-36    Leptonychotes weddellii
ref|XP_002108719.1|  expressed hypothetical protein                     143   1e-36    Trichoplax adhaerens
gb|KDQ62587.1|  hypothetical protein JAAARDRAFT_30488                   143   1e-36    Jaapia argillacea MUCL 33604
ref|XP_005492469.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    143   2e-36    Zonotrichia albicollis
dbj|GAC95510.1|  hypothetical protein PHSY_003086                       143   2e-36    Pseudozyma hubeiensis SY62
ref|XP_003410681.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    143   2e-36    Loxodonta africana [African bush elephant]
ref|XP_001515711.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    143   2e-36    
ref|XP_008703115.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    143   2e-36    Ursus maritimus [white bear]
gb|EHH20407.1|  NADH-ubiquinone oxidoreductase 39 kDa subunit           143   2e-36    Macaca mulatta [rhesus macaque]
ref|XP_010076803.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   2e-36    Pterocles gutturalis
ref|XP_007965492.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   2e-36    Chlorocebus sabaeus
ref|XP_005569922.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   2e-36    Macaca fascicularis [crab eating macaque]
ref|XP_005877078.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   2e-36    Myotis brandtii
ref|XP_006957558.1|  NAD(P)-binding protein                             142   2e-36    Wallemia mellicola CBS 633.66
ref|XP_008703114.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    143   3e-36    Ursus maritimus [white bear]
dbj|GAN07940.1|  NAD(P)-binding protein                                 142   3e-36    Mucor ambiguus
emb|CEI86940.1|  Putative Genomic scaffold, msy_sf_1                    141   3e-36    Rhizopus microsporus
ref|XP_011743816.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   3e-36    Macaca nemestrina [pigtail macaque]
ref|XP_004416912.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   4e-36    Odobenus rosmarus divergens
ref|NP_001187320.1|  mitochondrial NADH dehydrogenase (ubiquinone...    142   5e-36    Ictalurus punctatus
emb|CEF99374.1|  NAD(P)-binding domain                                  141   5e-36    Ostreococcus tauri
ref|XP_006923900.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    141   5e-36    Pteropus alecto
ref|XP_004347048.1|  Ndufa9 protein                                     140   5e-36    Capsaspora owczarzaki ATCC 30864
ref|XP_007008648.1|  hypothetical protein TREMEDRAFT_72592              142   6e-36    Tremella mesenterica DSM 1558
gb|KFV38950.1|  hypothetical protein N341_11120                         138   6e-36    Tyto alba [Schleiereule]
dbj|GAM27735.1|  hypothetical protein SAMD00019534_109110               140   7e-36    Acytostelium subglobosum LB1
emb|CEJ03407.1|  Putative Genomic scaffold, msy_sf_1                    141   7e-36    Rhizopus microsporus
ref|XP_009973803.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    138   7e-36    Tyto alba [Schleiereule]
ref|XP_009954998.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   7e-36    Leptosomus discolor
ref|XP_007304718.1|  NADH dehydrogenase                                 141   7e-36    Stereum hirsutum FP-91666 SS1
ref|XP_010195242.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   8e-36    Colius striatus
gb|EFA77105.1|  NADH dehydrogenase 1 alpha subcomplex subunit 9         141   8e-36    Heterostelium album PN500
gb|KFZ63522.1|  hypothetical protein N321_03654                         140   8e-36    Antrostomus carolinensis
emb|CEG64935.1|  Putative Genomic scaffold, msy_sf_1                    141   8e-36    Rhizopus microsporus
gb|KFO62876.1|  hypothetical protein N302_08675                         140   8e-36    Corvus brachyrhynchos
ref|XP_004438802.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    141   8e-36    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_010171650.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    140   9e-36    
gb|KFP83910.1|  hypothetical protein N310_12825                         140   9e-36    Acanthisitta chloris
gb|KFQ14782.1|  hypothetical protein N330_12470                         140   9e-36    Leptosomus discolor
gb|ERE67037.1|  putative polypeptide N-acetylgalactosaminyltransf...    145   9e-36    Cricetulus griseus [Chinese hamsters]
gb|KFP29723.1|  hypothetical protein N325_09765                         140   9e-36    Colius striatus
ref|XP_009076582.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   1e-35    Acanthisitta chloris
ref|XP_004610502.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   1e-35    Sorex araneus [Eurasian shrew]
ref|XP_010408555.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   1e-35    Corvus cornix cornix
gb|EPB89825.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    140   1e-35    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_001118102.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   1e-35    
emb|CEG82390.1|  Putative Genomic scaffold, msy_sf_1                    140   1e-35    Rhizopus microsporus
ref|XP_006681739.1|  hypothetical protein BATDEDRAFT_37370              140   1e-35    Batrachochytrium dendrobatidis JAM81
ref|XP_011743817.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   1e-35    
emb|CCA67799.1|  probable NADH2 dehydrogenase (ubiquinone) 40K chain    140   1e-35    Serendipita indica DSM 11827
gb|KIK24507.1|  hypothetical protein PISMIDRAFT_401487                  140   1e-35    Pisolithus microcarpus 441
ref|XP_011743815.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   1e-35    Macaca nemestrina [pigtail macaque]
emb|CEP08222.1|  hypothetical protein                                   140   1e-35    Parasitella parasitica
ref|XP_006123105.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   1e-35    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_008636784.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   1e-35    
ref|XP_570308.1|  NADH dehydrogenase (ubiquinone)                       140   2e-35    Cryptococcus neoformans var. neoformans JEC21
gb|KFQ73922.1|  hypothetical protein N337_04487                         140   2e-35    Phoenicopterus ruber ruber
ref|XP_005148026.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   2e-35    Melopsittacus undulatus
ref|XP_003221407.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   2e-35    Anolis carolinensis [Carolina anole]
gb|KIM89048.1|  hypothetical protein PILCRDRAFT_812944                  140   2e-35    
gb|KIY67124.1|  NAD(P)-binding protein                                  140   2e-35    
gb|KFP08708.1|  hypothetical protein N300_02598                         139   2e-35    
ref|XP_010125588.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    138   2e-35    
ref|XP_003273859.2|  PREDICTED: probable polypeptide N-acetylgala...    143   2e-35    
gb|KDE07008.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    140   2e-35    
ref|XP_004210520.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   3e-35    
gb|KFO82303.1|  hypothetical protein N303_06049                         139   3e-35    
gb|KFV62438.1|  hypothetical protein N307_14752                         139   3e-35    
ref|XP_009567541.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    139   3e-35    
ref|XP_001876312.1|  predicted protein                                  138   4e-35    
gb|KFV95211.1|  hypothetical protein N327_03132                         139   4e-35    
ref|XP_009582483.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    139   4e-35    
gb|ADO28252.1|  mitochondrial NADH dehydrogenase 1 alpha subcompl...    139   4e-35    
ref|XP_010310531.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   4e-35    
ref|XP_005040230.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   4e-35    
ref|XP_008502666.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   4e-35    
ref|XP_009266962.1|  hypothetical protein J056_003464                   139   4e-35    
ref|XP_645194.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomp...    139   4e-35    
ref|XP_007870444.1|  NAD P-binding protein                              139   5e-35    
gb|KFV57640.1|  hypothetical protein N328_11892                         139   5e-35    
ref|XP_009815144.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    139   6e-35    
ref|XP_010609901.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   6e-35    
ref|XP_010021537.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   6e-35    
gb|KIR68354.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    139   6e-35    
gb|KFQ44899.1|  hypothetical protein N333_02601                         138   6e-35    
ref|XP_004992628.1|  hypothetical protein PTSG_07208                    138   7e-35    
ref|XP_010714872.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   7e-35    
ref|XP_009908154.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   8e-35    
ref|XP_004568347.1|  PREDICTED: probable polypeptide N-acetylgala...    142   8e-35    
ref|XP_010133323.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   8e-35    
gb|KFP45254.1|  hypothetical protein N324_11766                         136   8e-35    
gb|KIK47221.1|  hypothetical protein CY34DRAFT_21544                    138   8e-35    
ref|XP_004643624.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   8e-35    
gb|KFO89045.1|  hypothetical protein N320_01399                         137   8e-35    
ref|XP_010005482.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   9e-35    
ref|XP_003463318.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   9e-35    
ref|XP_009936776.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    138   1e-34    
gb|KFQ75039.1|  hypothetical protein N335_03526                         138   1e-34    
gb|KFO07725.1|  hypothetical protein N312_01006                         138   1e-34    
gb|KGB74721.1|  NADH dehydrogenase                                      139   1e-34    
ref|XP_007379939.1|  NAD(P)-binding protein                             138   1e-34    
ref|XP_003932646.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   1e-34    
gb|KFU84818.1|  hypothetical protein M959_04911                         138   1e-34    
gb|KIR57388.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    139   1e-34    
gb|ETN62206.1|  NADH-ubiquinone oxidoreductase 39 kda subunit           138   1e-34    
gb|KFR13833.1|  hypothetical protein N306_14448                         137   1e-34    
gb|KFP53101.1|  hypothetical protein N323_09262                         137   1e-34    
gb|AAH05760.1|  Ndufa9 protein                                          137   1e-34    
ref|XP_009001694.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   1e-34    
ref|XP_003193480.1|  NADH dehydrogenase (ubiquinone)                    138   1e-34    
gb|KDQ25989.1|  39kDa subunit of NDUFA9, NADH ubiquinone oxidored...    137   1e-34    
gb|KFM13739.1|  hypothetical protein AS27_14184                         137   1e-34    
gb|KIR80601.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    138   1e-34    
ref|XP_008037591.1|  NADH dehydrogenase                                 137   1e-34    
gb|KIR89560.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    138   1e-34    
emb|CCM05932.1|  predicted protein                                      137   1e-34    
gb|KFW94971.1|  hypothetical protein N336_08738                         137   1e-34    
ref|NP_079634.2|  NADH dehydrogenase [ubiquinone] 1 alpha subcomp...    137   1e-34    
ref|XP_009510411.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   1e-34    
ref|XP_007845659.1|  nadh dehydrogenase                                 137   1e-34    
ref|XP_008486857.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   2e-34    
ref|XP_005378797.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   2e-34    
ref|XP_008071131.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   2e-34    
ref|XP_007270771.1|  NADH dehydrogenase                                 137   2e-34    
ref|XP_010285464.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   2e-34    
ref|XP_007435737.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   2e-34    
gb|KIR50051.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    138   2e-34    
gb|EMD40072.1|  hypothetical protein CERSUDRAFT_112285                  137   2e-34    
gb|KFW86271.1|  hypothetical protein N305_07548                         137   2e-34    
ref|NP_001006281.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    137   2e-34    
gb|KFW67319.1|  hypothetical protein AS28_12998                         136   3e-34    
gb|KFQ91966.1|  hypothetical protein Y956_15987                         136   3e-34    
gb|KFQ30066.1|  hypothetical protein N332_01289                         136   3e-34    
gb|KIJ54415.1|  hypothetical protein M422DRAFT_775527                   136   3e-34    
ref|XP_006891427.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   3e-34    
gb|KDR23820.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    137   3e-34    
gb|KJA24071.1|  hypothetical protein HYPSUDRAFT_39211                   136   3e-34    
ref|XP_009473697.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    136   3e-34    
ref|XP_009863298.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   3e-34    
ref|XP_009634820.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    136   4e-34    
ref|XP_008928534.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   4e-34    
ref|XP_010573635.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   4e-34    
ref|XP_009917119.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   4e-34    
gb|KFP80801.1|  hypothetical protein N311_08372                         136   4e-34    
gb|KFP63610.1|  hypothetical protein N322_12220                         136   4e-34    
ref|NP_001082699.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    136   4e-34    
gb|KFP14044.1|  hypothetical protein Z169_06947                         136   5e-34    
gb|EMS25072.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    136   5e-34    
gb|KFQ03890.1|  hypothetical protein N329_07841                         136   5e-34    
emb|CDO68262.1|  hypothetical protein BN946_scf184842.g25               135   5e-34    
gb|AAH45076.1|  MGC64316 protein                                        136   5e-34    
gb|KGL84591.1|  hypothetical protein N309_12483                         136   5e-34    
ref|XP_009483609.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   6e-34    
ref|XP_005234795.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    135   6e-34    
ref|XP_005503104.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   6e-34    
gb|KIP02896.1|  hypothetical protein PHLGIDRAFT_130473                  135   6e-34    
ref|XP_007768401.1|  NAD(P)-binding protein                             135   6e-34    
ref|XP_006172086.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   7e-34    
emb|CDS05157.1|  Putative NADH dehydrogenase (Ubiquinone) 1FT alp...    135   7e-34    
gb|KFQ62461.1|  hypothetical protein N334_13818                         135   7e-34    
ref|XP_009892508.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    135   7e-34    
gb|KGL85955.1|  hypothetical protein N301_03034                         135   8e-34    
ref|XP_012049223.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    136   8e-34    
emb|CDH57814.1|  nadh-ubiquinone oxidoreductase 40 kdamitochondrial     135   8e-34    
ref|XP_010573634.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   9e-34    
ref|XP_009695607.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   9e-34    
ref|XP_010223608.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   9e-34    
ref|XP_009322637.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   9e-34    
ref|XP_006273618.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   9e-34    
ref|XP_008309204.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   1e-33    
ref|XP_786784.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1 al...    135   1e-33    
gb|EOB06411.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    135   1e-33    
ref|XP_005012705.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   1e-33    
ref|XP_011581396.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   1e-33    
ref|NP_001011432.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    135   1e-33    
gb|KFB35184.1|  AGAP010792-PA-like protein                              135   1e-33    
gb|KFV81563.1|  hypothetical protein N308_11418                         135   1e-33    
ref|XP_009673696.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   1e-33    
ref|XP_006027877.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   1e-33    
ref|XP_318516.3|  AGAP010792-PA                                         135   1e-33    
dbj|BAB22596.1|  unnamed protein product                                135   1e-33    
ref|XP_001730360.1|  hypothetical protein MGL_2742                      134   2e-33    
ref|XP_007056976.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   2e-33    
gb|KIM28918.1|  hypothetical protein M408DRAFT_328984                   134   2e-33    
ref|XP_004354956.1|  Transcription regulatory protein SNF5              139   2e-33    
ref|XP_009673695.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   2e-33    
ref|XP_001865472.1|  NADH-ubiquinone oxidoreductase 39 kda subunit      134   2e-33    
ref|XP_010176933.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   3e-33    
gb|EJT98653.1|  NADP-binding protein                                    134   3e-33    
emb|CCJ28978.1|  unnamed protein product                                134   3e-33    
ref|XP_005537134.1|  NADH dehydrogenase I alpha subcomplex 9, mit...    134   3e-33    
ref|XP_010881814.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   4e-33    
gb|KDN34620.1|  hypothetical protein RSAG8_12282                        134   4e-33    
ref|XP_007399771.1|  hypothetical protein PHACADRAFT_199484             134   4e-33    
ref|XP_009286807.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   4e-33    
ref|XP_003034456.1|  hypothetical protein SCHCODRAFT_14900              133   5e-33    
gb|EIE86946.1|  hypothetical protein RO3G_11657                         133   6e-33    
gb|KDR82718.1|  hypothetical protein GALMADRAFT_238218                  133   6e-33    
gb|EPS94725.1|  hypothetical protein FOMPIDRAFT_1133771                 133   6e-33    
ref|XP_004879593.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    133   7e-33    
gb|ENN72465.1|  hypothetical protein YQE_10807                          133   7e-33    
gb|KIK07979.1|  hypothetical protein K443DRAFT_128758                   132   8e-33    
ref|XP_001660001.1|  AAEL009414-PA                                      133   9e-33    
ref|XP_008118146.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   9e-33    
gb|ERL95049.1|  hypothetical protein D910_12319                         133   9e-33    
ref|XP_004869427.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    133   1e-32    
gb|AEE61636.1|  unknown                                                 133   1e-32    
ref|XP_005307068.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   2e-32    
emb|CAX69804.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcompl...    129   2e-32    
gb|KIM43379.1|  hypothetical protein M413DRAFT_403196                   131   2e-32    
gb|EMP38439.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    130   3e-32    
ref|XP_005188922.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   3e-32    
ref|XP_011304899.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   3e-32    
ref|XP_007319751.1|  39kDa subunit of NDUFA9, NADH:ubiquinone oxi...    131   4e-32    
ref|XP_007370168.1|  NADH dehydrogenase                                 130   5e-32    
gb|KEP53453.1|  putative NADH-ubiquinone oxidoreductase 39 kDa pr...    130   5e-32    
gb|EUC62263.1|  NADH-ubiquinone oxidoreductase 39 kDa protein, pu...    130   5e-32    
ref|XP_003286992.1|  hypothetical protein DICPUDRAFT_97564              130   6e-32    
ref|NP_001165787.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    130   7e-32    
ref|XP_006462703.1|  NdufA9 NADH ubiquinone oxidoreductase subunit      130   1e-31    
ref|XP_005840852.1|  hypothetical protein GUITHDRAFT_160957             130   1e-31    
emb|CCG80684.1|  putative NADH-ubiquinone oxidoreductase 39 kDa s...    129   1e-31    
ref|XP_009015040.1|  hypothetical protein HELRODRAFT_98836              130   1e-31    
emb|CEL51784.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcompl...    129   1e-31    
ref|XP_009162600.1|  hypothetical protein T265_00532                    129   1e-31    
ref|XP_011188849.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    130   2e-31    
gb|KII87009.1|  hypothetical protein PLICRDRAFT_700259                  129   2e-31    
ref|XP_007330075.1|  39kDa subunit of NdufA9, NADH ubiquinone oxi...    129   2e-31    
gb|AAW26486.1|  SJCHGC05906 protein                                     129   2e-31    
emb|CAX73863.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcompl...    129   2e-31    
ref|XP_001702653.1|  NADH:ubiquinone oxidoreductase 39 kDa subunit      129   2e-31    
gb|EHJ77228.1|  hypothetical protein KGM_02785                          129   3e-31    
ref|XP_010731332.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    129   3e-31    
gb|KIL67845.1|  hypothetical protein M378DRAFT_185427                   128   3e-31    
gb|KFH67974.1|  hypothetical protein MVEG_06705                         128   3e-31    
gb|KIY44806.1|  NAD(P)-binding protein                                  128   4e-31    
ref|XP_002954591.1|  NADH:ubiquinone oxidoreductase 39 kDa subunit      128   5e-31    
emb|CCO27961.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcompl...    129   7e-31    
dbj|GAA31353.2|  NADH dehydrogenase (ubiquinone) 1 alpha subcompl...    127   8e-31    
ref|XP_007409682.1|  hypothetical protein MELLADRAFT_77647              127   8e-31    
ref|XP_005651289.1|  NAD(P)-binding protein                             127   9e-31    
ref|XP_011401632.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    127   1e-30    
gb|EJT47332.1|  NADH dehydrogenase (ubiquinone)                         127   1e-30    
ref|XP_001985349.1|  GH14554                                            127   1e-30    
ref|XP_011208110.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   1e-30    
ref|XP_975235.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1 al...    127   2e-30    
ref|XP_005814600.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   2e-30    
ref|XP_001545366.1|  NADH-ubiquinone oxidoreductase 40 kDa subunit      124   2e-30    
ref|XP_005097061.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   2e-30    
ref|XP_011554984.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   2e-30    
ref|XP_010760174.1|  NADH-ubiquinone oxidoreductase 40 kDa subuni...    126   2e-30    
gb|EEH22277.2|  NADH-ubiquinone oxidoreductase 40 kDa subunit, mi...    126   2e-30    
ref|XP_007553321.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   3e-30    
ref|XP_001352990.1|  GA19302                                            126   3e-30    
ref|XP_002026863.1|  GL12793                                            126   3e-30    
ref|XP_005712083.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    126   4e-30    
gb|EEH33982.2|  NADH-ubiquinone oxidoreductase 40 kDa subunit           125   4e-30    
ref|XP_001948072.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   4e-30    
emb|CDS27417.1|  NADH dehydrogenase (ubiquinone) 1 alpha                125   4e-30    
ref|XP_002048107.1|  GJ11526                                            125   5e-30    
ref|XP_003967219.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   5e-30    
ref|XP_002008276.1|  GI13402                                            125   5e-30    
gb|ACI67333.1|  NADH dehydrogenase 1 alpha subcomplex subunit 9, ...    125   5e-30    
emb|CDQ61649.1|  unnamed protein product                                125   6e-30    
gb|EMR82952.1|  putative nadh-ubiquinone oxidoreductase 39 kda pr...    125   6e-30    
gb|ERE67036.1|  putative polypeptide N-acetylgalactosaminyltransf...    129   6e-30    
gb|ERE67038.1|  putative polypeptide N-acetylgalactosaminyltransf...    129   6e-30    
ref|XP_002040681.1|  GM22299                                            125   7e-30    
ref|XP_002086632.1|  GE23238                                            125   8e-30    
emb|CAF98876.1|  unnamed protein product                                125   8e-30    
ref|XP_005850526.1|  hypothetical protein CHLNCDRAFT_34039              125   8e-30    
gb|KIN00985.1|  hypothetical protein OIDMADRAFT_145126                  124   9e-30    
ref|XP_011256589.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    124   1e-29    
ref|XP_008434704.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    124   1e-29    
gb|ACO11138.1|  NADH dehydrogenase 1 alpha subcomplex subunit 9, ...    124   2e-29    
emb|CDQ90818.1|  unnamed protein product                                124   2e-29    
ref|XP_001973503.1|  GG16121                                            124   2e-29    
ref|XP_008549223.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    124   2e-29    
ref|XP_001957289.1|  GF10349                                            124   2e-29    
ref|XP_004069890.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    124   2e-29    



>ref|XP_002301843.1| hypothetical protein POPTR_0002s25720g [Populus trichocarpa]
 gb|EEE81116.1| hypothetical protein POPTR_0002s25720g [Populus trichocarpa]
Length=399

 Score =   327 bits (839),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 190/208 (91%), Gaps = 2/208 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDH-YGIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA++RRLGHQ LKP+ S+S+FKS   LSDH YG D PR+AS+L A+KGVGHL+RKGTGG
Sbjct  1    MQAISRRLGHQSLKPAASLSSFKSIYPLSDHHYGADHPRHASSL-AAKGVGHLIRKGTGG  59

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDE+S+KAV+AKANVVINLIGR++ETRNYSFEE+NH M EQLA ISKEHGGIMRFIQ
Sbjct  120  YNPRDENSIKAVMAKANVVINLIGRDHETRNYSFEELNHGMTEQLAMISKEHGGIMRFIQ  179

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGAS +SPSRM RAKA  E AVLRE
Sbjct  180  VSCLGASASSPSRMLRAKAAGEEAVLRE  207



>gb|KJB42341.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=312

 Score =   324 bits (830),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 187/208 (90%), Gaps = 1/208 (0%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA+TRRLGHQ L+P+ S+S+ KS   LSDHY G D PRY STL + KG+GHLVRKGTGG
Sbjct  1    MQAITRRLGHQSLRPTASISSIKSIYPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGG  60

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  61   RSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMK  120

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            Y+PRDE+S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAEQLA I+KEHGGIMRFIQ
Sbjct  121  YDPRDENSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQ  180

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLG+S +SPSR  RAKA  E AVL+E
Sbjct  181  VSCLGSSLSSPSRFLRAKAAGEEAVLKE  208



>ref|XP_011024495.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Populus euphratica]
Length=399

 Score =   327 bits (838),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 174/208 (84%), Positives = 189/208 (91%), Gaps = 2/208 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDH-YGIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQAV+RRLGHQ LKP+ S+S+FKS   LSDH YG D PR+AS+L A KGVGHL+RKGTGG
Sbjct  1    MQAVSRRLGHQSLKPAASLSSFKSIYPLSDHHYGADHPRHASSLPA-KGVGHLIRKGTGG  59

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDE+S+KAV+AKANVVINLIGR++ETRNYSFEE+NH M EQLA ISKEHGGIMRFIQ
Sbjct  120  YNPRDENSIKAVMAKANVVINLIGRDHETRNYSFEELNHGMTEQLAMISKEHGGIMRFIQ  179

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGAS +SPSRM RAKA  E AVLRE
Sbjct  180  VSCLGASASSPSRMLRAKAAGEEAVLRE  207



>gb|KJB42337.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=358

 Score =   325 bits (834),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 187/208 (90%), Gaps = 1/208 (0%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA+TRRLGHQ L+P+ S+S+ KS   LSDHY G D PRY STL + KG+GHLVRKGTGG
Sbjct  1    MQAITRRLGHQSLRPTASISSIKSIYPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGG  60

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  61   RSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMK  120

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            Y+PRDE+S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAEQLA I+KEHGGIMRFIQ
Sbjct  121  YDPRDENSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQ  180

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLG+S +SPSR  RAKA  E AVL+E
Sbjct  181  VSCLGSSLSSPSRFLRAKAAGEEAVLKE  208



>gb|KJB42340.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=383

 Score =   325 bits (833),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 187/208 (90%), Gaps = 1/208 (0%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA+TRRLGHQ L+P+ S+S+ KS   LSDHY G D PRY STL + KG+GHLVRKGTGG
Sbjct  1    MQAITRRLGHQSLRPTASISSIKSIYPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGG  60

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  61   RSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMK  120

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            Y+PRDE+S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAEQLA I+KEHGGIMRFIQ
Sbjct  121  YDPRDENSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQ  180

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLG+S +SPSR  RAKA  E AVL+E
Sbjct  181  VSCLGSSLSSPSRFLRAKAAGEEAVLKE  208



>gb|KJB42338.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=367

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 187/208 (90%), Gaps = 1/208 (0%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA+TRRLGHQ L+P+ S+S+ KS   LSDHY G D PRY STL + KG+GHLVRKGTGG
Sbjct  1    MQAITRRLGHQSLRPTASISSIKSIYPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGG  60

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  61   RSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMK  120

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            Y+PRDE+S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAEQLA I+KEHGGIMRFIQ
Sbjct  121  YDPRDENSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQ  180

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLG+S +SPSR  RAKA  E AVL+E
Sbjct  181  VSCLGSSLSSPSRFLRAKAAGEEAVLKE  208



>gb|KJB42335.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=400

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 187/208 (90%), Gaps = 1/208 (0%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA+TRRLGHQ L+P+ S+S+ KS   LSDHY G D PRY STL + KG+GHLVRKGTGG
Sbjct  1    MQAITRRLGHQSLRPTASISSIKSIYPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGG  60

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  61   RSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMK  120

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            Y+PRDE+S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAEQLA I+KEHGGIMRFIQ
Sbjct  121  YDPRDENSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQ  180

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLG+S +SPSR  RAKA  E AVL+E
Sbjct  181  VSCLGSSLSSPSRFLRAKAAGEEAVLKE  208



>ref|XP_002271401.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Vitis vinifera]
 emb|CBI37199.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   324 bits (831),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 185/208 (89%), Gaps = 2/208 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA++RRLGHQ    S ++S+ KS   LSDHY G D PR  STL A KGVGHLVRKGTGG
Sbjct  1    MQALSRRLGHQSFNQSPAISSLKSIYPLSDHYYGADHPRLGSTL-APKGVGHLVRKGTGG  59

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVA VFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVAVVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDE+S+KAV+AKANVV+NLIGREYETRNYSFEEVNH+MAEQLA ISKEHGGIMRFIQ
Sbjct  120  YNPRDENSIKAVMAKANVVLNLIGREYETRNYSFEEVNHHMAEQLAMISKEHGGIMRFIQ  179

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGASP+SPSRM  AKA AE AVLRE
Sbjct  180  VSCLGASPSSPSRMLMAKAAAEEAVLRE  207



>gb|ABK94679.1| unknown [Populus trichocarpa]
Length=399

 Score =   324 bits (830),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 189/208 (91%), Gaps = 2/208 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDH-YGIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA++RRLGHQ LKP+ S+S+FKS   LSDH YG D PR+AS+L A+KGV HL+RKGTGG
Sbjct  1    MQAISRRLGHQSLKPAASLSSFKSIYPLSDHHYGADHPRHASSL-AAKGVCHLIRKGTGG  59

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDE+S+KAV+AKANVVINLIGR++ETRNYSFEE+NH M EQLA ISKEHGGIMRFIQ
Sbjct  120  YNPRDENSIKAVMAKANVVINLIGRDHETRNYSFEELNHGMTEQLAMISKEHGGIMRFIQ  179

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGAS +SPSRM RAKA  E AVLRE
Sbjct  180  VSCLGASASSPSRMLRAKAAGEEAVLRE  207



>ref|XP_011080124.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Sesamum indicum]
Length=400

 Score =   323 bits (829),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 189/209 (90%), Gaps = 3/209 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHS-VSAFKSFDLLSDH-YGIDTPRYASTLTASKGVGHLVRKGTG  261
            MQAV RRLG+QY K S + +S FKS  LL D  YG ++ R+AS+L A+KGVGHLVRKGTG
Sbjct  1    MQAVCRRLGNQYTKQSTAPISCFKSIYLLPDQCYGAESTRFASSL-ATKGVGHLVRKGTG  59

Query  262  GRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPM  441
            GRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPM
Sbjct  60   GRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPM  119

Query  442  KYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFI  621
            KYNPRDE+S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAEQLA I+KEHGGIMR+I
Sbjct  120  KYNPRDENSIKAVMAKANVVINLIGREYETRNFSFEEVNHHMAEQLALIAKEHGGIMRYI  179

Query  622  QVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            QVSCLGASP+S SRM RAKA  E AVLRE
Sbjct  180  QVSCLGASPSSSSRMLRAKAAGEEAVLRE  208



>gb|EYU46388.1| hypothetical protein MIMGU_mgv1a007681mg [Erythranthe guttata]
 gb|EYU46389.1| hypothetical protein MIMGU_mgv1a007681mg [Erythranthe guttata]
Length=399

 Score =   321 bits (823),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 190/209 (91%), Gaps = 3/209 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHS-VSAFKS-FDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTG  261
            MQ+V RRLG+QY++ S + +S+FKS + L   +YG D PR+ASTL A+KGVGHLVRKGTG
Sbjct  1    MQSVGRRLGYQYIRHSAAPISSFKSAYSLPDQYYGADNPRWASTL-ATKGVGHLVRKGTG  59

Query  262  GRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPM  441
            GRSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPM
Sbjct  60   GRSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPM  119

Query  442  KYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFI  621
            KY+PRDE S+KAV+AKANVVINLIGR+YETRNYSFEEVNH+MAEQLA I+KEHGGIMR+I
Sbjct  120  KYDPRDEDSIKAVMAKANVVINLIGRDYETRNYSFEEVNHHMAEQLAVIAKEHGGIMRYI  179

Query  622  QVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            QVSCLGASP+SPS++ R KA AE A+LRE
Sbjct  180  QVSCLGASPSSPSKLLRTKAAAEEAILRE  208



>gb|KJB42342.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=234

 Score =   315 bits (807),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 182/202 (90%), Gaps = 1/202 (0%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA+TRRLGHQ L+P+ S+S+ KS   LSDHY G D PRY STL + KG+GHLVRKGTGG
Sbjct  1    MQAITRRLGHQSLRPTASISSIKSIYPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGG  60

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  61   RSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMK  120

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            Y+PRDE+S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAEQLA I+KEHGGIMRFIQ
Sbjct  121  YDPRDENSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQ  180

Query  625  VSCLGASPTSPSRMRRAKATAE  690
            VSCLG+S +SPSR  RAKA  E
Sbjct  181  VSCLGSSLSSPSRFLRAKAAGE  202



>ref|XP_010264829.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nelumbo nucifera]
 ref|XP_010264830.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nelumbo nucifera]
Length=397

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 183/207 (88%), Gaps = 2/207 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGGR  267
            MQA +RRLG Q+LK S ++S+  S   +SD Y  D PRY STL A KGVGHLVRKGTGGR
Sbjct  2    MQAYSRRLGQQFLKSSPAISSLNSIHPISD-YVTDHPRYGSTL-APKGVGHLVRKGTGGR  59

Query  268  SSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKY  447
            SSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY
Sbjct  60   SSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQIVPMKY  119

Query  448  NPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQV  627
            NPRDESS+KAV+AKANVV+NLIGREYETRN+SFEEVNH MAEQLA I+KEHGGIMRFIQV
Sbjct  120  NPRDESSIKAVMAKANVVLNLIGREYETRNFSFEEVNHSMAEQLAMIAKEHGGIMRFIQV  179

Query  628  SCLGASPTSPSRMRRAKATAEXAVLRE  708
            SCLGAS +SPSRM RAKA AE A+LRE
Sbjct  180  SCLGASTSSPSRMLRAKAAAEQAILRE  206



>emb|CDP03802.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   317 bits (812),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 187/211 (89%), Gaps = 5/211 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHS--VSAFKS-FDLLSDHY-GIDTPRYASTLTASKGVGHLVRKG  255
            MQA+ RRLGH  LKPS +  +S+F S F+    HY G D PRYAS LTA +G GH+VRKG
Sbjct  1    MQAIARRLGHHSLKPSATAAISSFDSSFNPYFHHYNGADNPRYASNLTA-RGTGHIVRKG  59

Query  256  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  435
            TGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIV
Sbjct  60   TGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIV  119

Query  436  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  615
            PM+YNPRDE+S+KAV+AKANVVINLIGREYETRNYSFEEVNH+MAE+LA I+KEHGGIMR
Sbjct  120  PMQYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHHMAEELAMIAKEHGGIMR  179

Query  616  FIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            FIQVSCLGASP+SPSRM RAKA  E A+L+E
Sbjct  180  FIQVSCLGASPSSPSRMLRAKAAGEEALLQE  210



>ref|XP_008235764.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Prunus mume]
Length=387

 Score =   315 bits (808),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 187/208 (90%), Gaps = 2/208 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA+++R+GHQYL PS S+S+ KS   +SDHY G D P+Y STL A+KGVGHLVRKGTGG
Sbjct  1    MQAISKRVGHQYLTPSSSISSLKSIYPVSDHYYGADRPKYGSTL-ATKGVGHLVRKGTGG  59

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVA VFG+TGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVAAVFGSTGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDE S+KAV+AKANVVINLIGR+YETRN+SFEEVNH MAEQLA ISKEHGGIMRFIQ
Sbjct  120  YNPRDEDSIKAVMAKANVVINLIGRDYETRNFSFEEVNHSMAEQLATISKEHGGIMRFIQ  179

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGAS +SPSR  RAKA AE AVLRE
Sbjct  180  VSCLGASSSSPSRFLRAKAAAEEAVLRE  207



>ref|XP_007050145.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007050146.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX94302.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX94303.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=400

 Score =   316 bits (809),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 183/208 (88%), Gaps = 1/208 (0%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKS-FDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA+TRRLG Q L+P+ S+ + +  + L   +YG D PRY STL A KG+GHLVRKGTGG
Sbjct  1    MQAITRRLGQQSLRPTPSIYSIECIYPLFHHYYGCDHPRYGSTLAAHKGLGHLVRKGTGG  60

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGI+ATVFGATGF GRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  61   RSSVSGIIATVFGATGFFGRYVVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMK  120

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            Y+PRDE+S+KAV+AKANVVINLIGREYETRNYSFEEVNH+MAEQLA I++EHGGIMRFIQ
Sbjct  121  YDPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHFMAEQLAVIAREHGGIMRFIQ  180

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLG+SP+S SR  RAKA AE AVLRE
Sbjct  181  VSCLGSSPSSASRFLRAKAAAEEAVLRE  208



>ref|XP_007201067.1| hypothetical protein PRUPE_ppa006705mg [Prunus persica]
 gb|EMJ02266.1| hypothetical protein PRUPE_ppa006705mg [Prunus persica]
Length=399

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 186/208 (89%), Gaps = 2/208 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA+++R+GHQYL PS S+S  KS   +SDHY G D P+Y STL A+KGVGHLVRKGTGG
Sbjct  1    MQAISKRVGHQYLTPSSSISLLKSIYPVSDHYYGADRPKYGSTL-ATKGVGHLVRKGTGG  59

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVA VFG+TGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVAAVFGSTGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDE S+KAV+AKANVVINLIGR+YETRN+SFEEVNH MAEQLA ISKEHGGIMRFIQ
Sbjct  120  YNPRDEDSIKAVMAKANVVINLIGRDYETRNFSFEEVNHSMAEQLATISKEHGGIMRFIQ  179

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGAS +SPSR  RAKA AE AVLRE
Sbjct  180  VSCLGASSSSPSRFLRAKAAAEEAVLRE  207



>ref|XP_012085214.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Jatropha curcas]
 gb|KDP26455.1| hypothetical protein JCGZ_17613 [Jatropha curcas]
Length=396

 Score =   314 bits (804),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 183/207 (88%), Gaps = 3/207 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGGR  267
            MQA++RRLG Q   P+ S+++ KS   L  +YG D PRY STLT  KGVGHLVRKGTGGR
Sbjct  1    MQAISRRLGQQAHNPAASIASLKSIYPL--YYGTDHPRYGSTLT-PKGVGHLVRKGTGGR  57

Query  268  SSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKY  447
            SSVSGI+ATVFGATGFLGRY+VQQLAKMG+QVLVPFRGSED HRHLKLMGDLGQIVPM Y
Sbjct  58   SSVSGIIATVFGATGFLGRYVVQQLAKMGTQVLVPFRGSEDSHRHLKLMGDLGQIVPMLY  117

Query  448  NPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQV  627
            NPRDE+S+KAV+AKANVVINLIGREYETRNYSFEEVNH MAEQLA I+KEHGGIMR+IQV
Sbjct  118  NPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHGMAEQLAMIAKEHGGIMRYIQV  177

Query  628  SCLGASPTSPSRMRRAKATAEXAVLRE  708
            SCLGAS +SPSRM RAKA AE AVLRE
Sbjct  178  SCLGASASSPSRMLRAKAAAEEAVLRE  204



>ref|XP_007050147.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOX94304.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
Length=392

 Score =   313 bits (801),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 181/207 (87%), Gaps = 7/207 (3%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGGR  267
            MQA+TRRLG Q L+P+ S+ +        ++YG D PRY STL A KG+GHLVRKGTGGR
Sbjct  1    MQAITRRLGQQSLRPTPSIYSI-------EYYGCDHPRYGSTLAAHKGLGHLVRKGTGGR  53

Query  268  SSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKY  447
            SSVSGI+ATVFGATGF GRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY
Sbjct  54   SSVSGIIATVFGATGFFGRYVVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKY  113

Query  448  NPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQV  627
            +PRDE+S+KAV+AKANVVINLIGREYETRNYSFEEVNH+MAEQLA I++EHGGIMRFIQV
Sbjct  114  DPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHFMAEQLAVIAREHGGIMRFIQV  173

Query  628  SCLGASPTSPSRMRRAKATAEXAVLRE  708
            SCLG+SP+S SR  RAKA AE AVLRE
Sbjct  174  SCLGSSPSSASRFLRAKAAAEEAVLRE  200



>ref|XP_008789505.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Phoenix dactylifera]
Length=398

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 183/208 (88%), Gaps = 2/208 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKS-FDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA  RR G + L  S ++  FKS + L SD YGID PR+ ST++  KG GH++RKGTGG
Sbjct  1    MQACWRRSGQRLLDRSPALFPFKSIYPLSSDGYGIDHPRHVSTISV-KGGGHIIRKGTGG  59

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDE+S+KAV+AKANVV+NLIGREYETRNYSFEEVNH MAEQLA I+KEHGGIMRFIQ
Sbjct  120  YNPRDENSIKAVMAKANVVLNLIGREYETRNYSFEEVNHAMAEQLAVIAKEHGGIMRFIQ  179

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGASP+SPSRM RAKA AE AVLRE
Sbjct  180  VSCLGASPSSPSRMLRAKAAAEEAVLRE  207



>gb|AFK48198.1| unknown [Lotus japonicus]
Length=396

 Score =   312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 187/208 (90%), Gaps = 5/208 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDH-YGIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA+ RR+ HQ LKPS   ++ KS   +SDH YG D  R+ ST+ A+KGVGHLVRKGTGG
Sbjct  1    MQAMARRVVHQSLKPS---TSLKSIYPISDHHYGADHERFVSTI-ATKGVGHLVRKGTGG  56

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVATVFGATGFLGRY+VQ LAKMGSQVLVPFRGSEDCHRHLKLMGDLGQ+VPMK
Sbjct  57   RSSVSGIVATVFGATGFLGRYVVQHLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQVVPMK  116

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDESSVKAV+AKANVVINLIGR++ETRNYS+E+V+++MA+QLA ISKEHGGIMRFIQ
Sbjct  117  YNPRDESSVKAVMAKANVVINLIGRDFETRNYSYEQVHYHMADQLARISKEHGGIMRFIQ  176

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGASP+SPSRM RAKA AE A+LRE
Sbjct  177  VSCLGASPSSPSRMLRAKAAAEEAILRE  204



>ref|XP_007144408.1| hypothetical protein PHAVU_007G153700g [Phaseolus vulgaris]
 gb|ESW16402.1| hypothetical protein PHAVU_007G153700g [Phaseolus vulgaris]
Length=394

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 181/207 (87%), Gaps = 3/207 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGGR  267
            MQ + RRLGHQ LK S S+ A   + +   HY  D  R+ ST+ A+KGVGHLVRKGTGGR
Sbjct  1    MQTIARRLGHQSLKSSTSLRAI--YPISDHHYVADHERFVSTI-ANKGVGHLVRKGTGGR  57

Query  268  SSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKY  447
            SSVSGI+ATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSEDC RHLKLMGDLGQIVPMKY
Sbjct  58   SSVSGIIATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDCPRHLKLMGDLGQIVPMKY  117

Query  448  NPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQV  627
            NPRDESSVKAV+AKANVVINLIGR+YETRNYSFEEVN++MAE LA ISKEHGGI+RFIQV
Sbjct  118  NPRDESSVKAVMAKANVVINLIGRDYETRNYSFEEVNYHMAENLAKISKEHGGILRFIQV  177

Query  628  SCLGASPTSPSRMRRAKATAEXAVLRE  708
            SCLGASP+SPSRM RAKA AE  VLRE
Sbjct  178  SCLGASPSSPSRMLRAKAAAEEVVLRE  204



>ref|XP_003542442.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Glycine max]
 gb|KHN48948.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Glycine soja]
Length=396

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 184/208 (88%), Gaps = 5/208 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDH-YGIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQ + RRLG Q L+PS   ++ KS   +SDH YG+D  RY STL A+KGVGHLVRKGTGG
Sbjct  1    MQTIARRLGQQSLRPS---TSLKSIYPISDHHYGMDHERYVSTL-ATKGVGHLVRKGTGG  56

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGI+ATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  57   RSSVSGIIATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMK  116

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDESSVKAV+AKANVVINLIGR+YETRNYSFEEV+++MAEQLA ISKEHGGI+RFIQ
Sbjct  117  YNPRDESSVKAVMAKANVVINLIGRDYETRNYSFEEVHYHMAEQLAKISKEHGGILRFIQ  176

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGASP+SPSRM R K+ AE  +LRE
Sbjct  177  VSCLGASPSSPSRMLRTKSAAEEMILRE  204



>gb|ACU23211.1| unknown [Glycine max]
Length=396

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 184/208 (88%), Gaps = 5/208 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDH-YGIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQ + RRLG Q L+PS S+   KS   +SDH YG+D  RY STL A+KGVGHLVRKGTGG
Sbjct  1    MQTIARRLGQQSLRPSTSL---KSIYPISDHHYGMDHERYVSTL-ATKGVGHLVRKGTGG  56

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGI+ATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  57   RSSVSGIIATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMK  116

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDESSVKAV+AKANVVINLIGR+YETRNYSFEEV+++MAEQLA ISKEHGGI+RFIQ
Sbjct  117  YNPRDESSVKAVMAKANVVINLIGRDYETRNYSFEEVHYHMAEQLAKISKEHGGILRFIQ  176

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGASP+SPSRM R K+ AE  +LRE
Sbjct  177  VSCLGASPSSPSRMLRTKSAAEEMILRE  204



>ref|XP_010936110.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Elaeis guineensis]
Length=398

 Score =   307 bits (787),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 180/207 (87%), Gaps = 2/207 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKS-FDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQ   RR G + L    ++S FKS + L SD YGID PRY ST++  KG GH+VRKGTGG
Sbjct  1    MQVCWRRSGQRLLDHYPALSPFKSIYPLSSDGYGIDHPRYVSTISI-KGAGHVVRKGTGG  59

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGI+ATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIIATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDE+S+KAV+AKANVV+NLIGREYETRNYSFEEVNH MAEQLA I+KEHGGIMRFIQ
Sbjct  120  YNPRDENSIKAVMAKANVVLNLIGREYETRNYSFEEVNHAMAEQLAVIAKEHGGIMRFIQ  179

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLR  705
            VSCLGAS +SPSRM RAKA AE +VLR
Sbjct  180  VSCLGASSSSPSRMLRAKAAAEESVLR  206



>ref|XP_002321296.2| hypothetical protein POPTR_0014s18680g [Populus trichocarpa]
 gb|EEE99611.2| hypothetical protein POPTR_0014s18680g [Populus trichocarpa]
Length=384

 Score =   306 bits (785),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 183/208 (88%), Gaps = 7/208 (3%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDH-YGIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA++RRLGH+       +S+FKS   LSDH YG D PRY STL A++GVGHL+RKGTGG
Sbjct  1    MQAISRRLGHR-----SPISSFKSIYPLSDHLYGADHPRYGSTL-ATRGVGHLIRKGTGG  54

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGS+D  RHLKLMGDLGQIVPMK
Sbjct  55   RSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSDDDPRHLKLMGDLGQIVPMK  114

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDE+S+KAV+AKANVVINLIGR+YETRNYSFEE+NH MA QLA ISKEHGGIMRFIQ
Sbjct  115  YNPRDENSIKAVMAKANVVINLIGRDYETRNYSFEELNHAMAGQLAMISKEHGGIMRFIQ  174

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGAS +SPSR+ RAKA  E AVLRE
Sbjct  175  VSCLGASASSPSRLLRAKAAGEEAVLRE  202



>ref|XP_009395307.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Musa acuminata subsp. malaccensis]
Length=397

 Score =   305 bits (782),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 180/208 (87%), Gaps = 2/208 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKS-FDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA  RR G ++L+ S ++S  KS + L S   G+D PRY ST+ A KG GHL+RKGTGG
Sbjct  2    MQAGWRRSGRRFLEQSPALSTLKSIYPLSSSECGVDRPRYGSTV-AVKGTGHLIRKGTGG  60

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVATVFGATGFLGRY+V QLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  61   RSSVSGIVATVFGATGFLGRYVVSQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  120

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDE+S+KAV+AK+NVV NLIGREYETRNYSFEEVNH MAEQLA I+KEHGGIMRF+Q
Sbjct  121  YNPRDENSIKAVMAKSNVVFNLIGREYETRNYSFEEVNHAMAEQLAVIAKEHGGIMRFVQ  180

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGAS +SPSRM RAKA AE AVLR+
Sbjct  181  VSCLGASSSSPSRMLRAKAAAEEAVLRQ  208



>ref|XP_010091822.1| hypothetical protein L484_015891 [Morus notabilis]
 gb|EXB46030.1| hypothetical protein L484_015891 [Morus notabilis]
Length=399

 Score =   305 bits (781),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 184/208 (88%), Gaps = 2/208 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSD-HYGIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQAV RRLGHQ L PS S+SA KS   L D +YG D PR  STL A+KG+GHLVRKGTGG
Sbjct  1    MQAVARRLGHQSLSPSPSISALKSIHPLFDSYYGADHPRCGSTL-ATKGLGHLVRKGTGG  59

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRG ED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGCEDSHRHLKLMGDLGQIVPMK  119

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDE+S+KAV+AKANVV+NLIGREYETRNYSFE  NH+MAEQLA I+KEHGGI+R+IQ
Sbjct  120  YNPRDEASIKAVMAKANVVVNLIGREYETRNYSFEVANHFMAEQLATIAKEHGGIIRYIQ  179

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGAS +SPSRM +AKA AE AVLRE
Sbjct  180  VSCLGASASSPSRMLKAKAAAEEAVLRE  207



>ref|XP_009370595.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Pyrus x bretschneideri]
Length=399

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 183/208 (88%), Gaps = 2/208 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQAV++R+G QYL  S S+S+ KS   LSDHY G D P+Y STL A+KGVGHLVRKGTGG
Sbjct  1    MQAVSKRVGRQYLTQSSSISSLKSIYPLSDHYYGADRPKYGSTL-ATKGVGHLVRKGTGG  59

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVA VFG+TGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVAAVFGSTGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDE S+KAV+AKANVVINLIGR+YETRN+SFEEVNH MA+QLA ISKEHGGIMRFIQ
Sbjct  120  YNPRDEDSIKAVMAKANVVINLIGRDYETRNFSFEEVNHSMAQQLATISKEHGGIMRFIQ  179

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGAS +SPSR  R KA AE AVL E
Sbjct  180  VSCLGASSSSPSRFLRTKAAAEEAVLSE  207



>gb|ACJ84721.1| unknown [Medicago truncatula]
 gb|AFK38059.1| unknown [Medicago truncatula]
 gb|KEH42458.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Medicago truncatula]
Length=396

 Score =   303 bits (777),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 185/208 (89%), Gaps = 5/208 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA+TRRLGH+ LK S   +  KS   +SDHY G++  RY ST+ A+KGVGHLVRKGTGG
Sbjct  1    MQAITRRLGHESLKSS---TLLKSSYPISDHYYGVNHERYVSTI-ATKGVGHLVRKGTGG  56

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  57   RSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQIVPMK  116

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            +NPRDESSVKAV+A+ANVVINLIGR+YETRN+S+EEV+++MAE+LA ISKEHGGIMRFIQ
Sbjct  117  FNPRDESSVKAVMARANVVINLIGRDYETRNFSYEEVHYHMAEKLAKISKEHGGIMRFIQ  176

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGASP+S SRM R KA AE AVLRE
Sbjct  177  VSCLGASPSSSSRMLRCKAAAEEAVLRE  204



>ref|XP_009370589.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Pyrus x bretschneideri]
Length=422

 Score =   304 bits (779),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 183/208 (88%), Gaps = 2/208 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQAV++R+G QYL  S S+S+ KS   LSDHY G D P+Y STL A+KGVGHLVRKGTGG
Sbjct  1    MQAVSKRVGRQYLTQSSSISSLKSIYPLSDHYYGADRPKYGSTL-ATKGVGHLVRKGTGG  59

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVA VFG+TGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVAAVFGSTGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDE S+KAV+AKANVVINLIGR+YETRN+SFEEVNH MA+QLA ISKEHGGIMRFIQ
Sbjct  120  YNPRDEDSIKAVMAKANVVINLIGRDYETRNFSFEEVNHSMAQQLATISKEHGGIMRFIQ  179

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGAS +SPSR  R KA AE AVL E
Sbjct  180  VSCLGASSSSPSRFLRTKAAAEEAVLSE  207



>ref|XP_010940664.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Elaeis guineensis]
Length=398

 Score =   303 bits (775),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 179/208 (86%), Gaps = 2/208 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKS-FDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA  RR G +    S +   FKS + L SD YG+D  R+ ST++  KG GHLVRKGTGG
Sbjct  1    MQACWRRSGQRLHDHSPAPFLFKSIYPLSSDGYGLDHLRHVSTISV-KGTGHLVRKGTGG  59

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPM 
Sbjct  60   RSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMN  119

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDE+S+KAV+AKANVV+NLIGREYETRNYSFEEVNH MAEQLA I+KEHGGIMRFIQ
Sbjct  120  YNPRDENSIKAVMAKANVVLNLIGREYETRNYSFEEVNHAMAEQLAVIAKEHGGIMRFIQ  179

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGASP+SPSRM RAKA AE AVLRE
Sbjct  180  VSCLGASPSSPSRMLRAKAAAEEAVLRE  207



>ref|XP_008382707.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Malus domestica]
Length=437

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 182/208 (88%), Gaps = 2/208 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA ++R+G QYL  S S+S+ KS   LSDHY G D P+Y STL A+KGVGHLVRKGTGG
Sbjct  39   MQAASKRVGRQYLTQSSSISSLKSIYPLSDHYYGADRPKYGSTL-ATKGVGHLVRKGTGG  97

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVA VFG+TGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  98   RSSVSGIVAAVFGSTGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  157

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDE S+KAV++KANVVINLIGR+YETRN+SFEEVNH MA+QLA ISKEHGGIMRFIQ
Sbjct  158  YNPRDEDSIKAVMSKANVVINLIGRDYETRNFSFEEVNHSMAQQLATISKEHGGIMRFIQ  217

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGAS +SPSR  R KA AE AVL E
Sbjct  218  VSCLGASSSSPSRFLRTKAAAEEAVLSE  245



>ref|XP_009335235.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Pyrus x bretschneideri]
Length=399

 Score =   301 bits (770),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 182/208 (88%), Gaps = 2/208 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQAV++R+G QYL  S S+S+ KS   LSDHY G D P+  STL A+KGVGHLVRKGTGG
Sbjct  1    MQAVSKRVGRQYLTQSSSISSLKSIYPLSDHYYGADRPKCGSTL-ATKGVGHLVRKGTGG  59

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVA VFG+TGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVAAVFGSTGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDE S+KAV+AKANVVINLIGR+YETRN+SFEEVNH MA+QLA ISKEHGGIMRFIQ
Sbjct  120  YNPRDEDSIKAVMAKANVVINLIGRDYETRNFSFEEVNHSMAQQLATISKEHGGIMRFIQ  179

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGAS +SPSR  R KA AE AVL E
Sbjct  180  VSCLGASSSSPSRFLRTKAAAEEAVLSE  207



>ref|XP_011458045.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Fragaria vesca subsp. vesca]
Length=397

 Score =   300 bits (769),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 182/206 (88%), Gaps = 4/206 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA+TRR GH+YL  S S S+ KS    SDHY G + P+Y STL A+KGVGHLVRKGTGG
Sbjct  1    MQAITRRAGHRYL--SPSSSSLKSIYPTSDHYYGAERPKYGSTL-ATKGVGHLVRKGTGG  57

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVA VFG+TGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  58   RSSVSGIVAAVFGSTGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  117

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDESS+KAV+AKANVVINLIGREYETRN+SFEEVNH MAEQLA ISKEHGGIMRFIQ
Sbjct  118  YNPRDESSIKAVMAKANVVINLIGREYETRNFSFEEVNHSMAEQLAMISKEHGGIMRFIQ  177

Query  625  VSCLGASPTSPSRMRRAKATAEXAVL  702
            VSCLGASP+S SR  RAKA AE AVL
Sbjct  178  VSCLGASPSSESRYLRAKAAAEGAVL  203



>ref|XP_006355892.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Solanum tuberosum]
Length=401

 Score =   298 bits (764),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 182/210 (87%), Gaps = 4/210 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKP-SHSVSAFKSFDLLSD--HYGIDTPRYASTLTASKGVGHLVRKGT  258
            M A+TR+LGHQ LK  S ++S+FKS   LSD  +YG  TPRYAS L A+ GVG L+RKGT
Sbjct  1    MHAITRKLGHQSLKHHSPAISSFKSLYPLSDDHYYGYLTPRYASNL-ATGGVGPLIRKGT  59

Query  259  GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVP  438
            GGRSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVP
Sbjct  60   GGRSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQIVP  119

Query  439  MKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRF  618
            MKYNPRDE+SVKAV+AKANVVINLIGR+YETRNYSF+EVN +MAEQLA I+KEHGGIMRF
Sbjct  120  MKYNPRDENSVKAVMAKANVVINLIGRDYETRNYSFDEVNLHMAEQLAMIAKEHGGIMRF  179

Query  619  IQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            IQVS LGASP S SR+ RAKA  E AV RE
Sbjct  180  IQVSSLGASPASSSRLLRAKAAGEEAVTRE  209



>ref|XP_004247128.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Solanum lycopersicum]
Length=401

 Score =   298 bits (763),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 182/210 (87%), Gaps = 4/210 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKP-SHSVSAFKSFDLLSD--HYGIDTPRYASTLTASKGVGHLVRKGT  258
            MQA+TR+LGHQ LK  S ++S+FKS   LSD  +YG  TPRYAS L A+ G G L+RKGT
Sbjct  1    MQAITRKLGHQSLKHHSPAISSFKSLYPLSDDHYYGYLTPRYASNL-ATGGAGPLIRKGT  59

Query  259  GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVP  438
            GGRSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVP
Sbjct  60   GGRSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQIVP  119

Query  439  MKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRF  618
            MKYNPRDE+SVKAV+AKANVVINLIGR+YETRNYSF+EVN ++AEQLA I+KEHGGIMRF
Sbjct  120  MKYNPRDENSVKAVMAKANVVINLIGRDYETRNYSFDEVNLHIAEQLAMIAKEHGGIMRF  179

Query  619  IQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            IQVS LGASP S SR+ RAKA  E AV RE
Sbjct  180  IQVSSLGASPASSSRLLRAKAAGEEAVTRE  209



>ref|XP_002526534.1| NADH-ubiquinone oxidoreductase 39 kD subunit, putative [Ricinus 
communis]
 gb|EEF35812.1| NADH-ubiquinone oxidoreductase 39 kD subunit, putative [Ricinus 
communis]
Length=394

 Score =   298 bits (762),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 182/209 (87%), Gaps = 3/209 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY--GIDTPRYASTLTASKGVGHLVRKGTG  261
            MQ+++RRLGH+ +    S++  KS   LS HY  G D  RY STLT  KGV HLVRKGTG
Sbjct  1    MQSISRRLGHKVVNSDGSIACLKSIYPLSHHYNGGGDQSRYVSTLT-PKGVAHLVRKGTG  59

Query  262  GRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPM  441
            GRSSVSGIVATVFGATGFLGRY+VQ+LAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPM
Sbjct  60   GRSSVSGIVATVFGATGFLGRYVVQRLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPM  119

Query  442  KYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFI  621
            KYNPRDE+S+KAV+AKANVVINLIGREYETRNYSFEEVNH MAEQLA I+KEHGGIMR+I
Sbjct  120  KYNPRDEASIKAVMAKANVVINLIGREYETRNYSFEEVNHGMAEQLAMIAKEHGGIMRYI  179

Query  622  QVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            QVSCLG+S +SPSRM RAKA AE AVLRE
Sbjct  180  QVSCLGSSSSSPSRMLRAKAAAEEAVLRE  208



>ref|XP_006854436.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Amborella trichopoda]
 gb|ERN15903.1| hypothetical protein AMTR_s00039p00218660 [Amborella trichopoda]
Length=397

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 180/207 (87%), Gaps = 3/207 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGGR  267
            MQ  +RRLGH  ++PS+ +S+ +S  L  DH  +D  RY S++ A KG G+LVRKGTGGR
Sbjct  2    MQVSSRRLGH-IIRPSNGLSSLQSLYLHPDHR-VDHARYGSSV-ALKGSGYLVRKGTGGR  58

Query  268  SSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKY  447
            SSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRG ED HRHLKLMGDLGQIVPMKY
Sbjct  59   SSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGCEDSHRHLKLMGDLGQIVPMKY  118

Query  448  NPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQV  627
            +PRDE S+KAV+AKANVVINLIGREYETRNYSFEEVNH MAEQL+ I+KEHGGIMRFIQV
Sbjct  119  DPRDEGSIKAVMAKANVVINLIGREYETRNYSFEEVNHVMAEQLSMIAKEHGGIMRFIQV  178

Query  628  SCLGASPTSPSRMRRAKATAEXAVLRE  708
            SCLGAS +SPSRM RAKA AE A+LR+
Sbjct  179  SCLGASSSSPSRMLRAKAAAEEAILRQ  205



>ref|XP_008372401.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Malus domestica]
Length=399

 Score =   296 bits (758),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 184/208 (88%), Gaps = 2/208 (1%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQAV++R+GHQYL  S S+S+ KS   LSDHY G D P+Y STL A+KGVGHLVRKGTGG
Sbjct  1    MQAVSKRVGHQYLTQSSSISSLKSIYPLSDHYYGADRPKYGSTL-ATKGVGHLVRKGTGG  59

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVA VFG+TGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVAAVFGSTGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDE S+KAV+AKANVVINLIGR++ETRN+SFEEVNH MA+QLA ISKEHGGIMRFIQ
Sbjct  120  YNPRDEDSIKAVMAKANVVINLIGRDFETRNFSFEEVNHSMAQQLATISKEHGGIMRFIQ  179

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGAS +SPSR    KATAE AVL E
Sbjct  180  VSCLGASSSSPSRFLSTKATAEEAVLSE  207



>ref|XP_006443722.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 ref|XP_006443723.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 ref|XP_006479428.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X1 [Citrus sinensis]
 gb|ESR56962.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 gb|ESR56963.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
Length=400

 Score =   294 bits (752),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 181/208 (87%), Gaps = 1/208 (0%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA+TRRLGHQ L+P+ S+S+ KS   LSD+Y G D  R+ +T  A+ G GHLVRKGTGG
Sbjct  1    MQAITRRLGHQSLQPATSISSLKSVYPLSDYYNGADHRRFGTTSIATPGTGHLVRKGTGG  60

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGI+ATVFG TGFLGRY+VQQLAKMGSQVLVPFRG ED  RHLKLMGDLGQIVPMK
Sbjct  61   RSSVSGIIATVFGTTGFLGRYVVQQLAKMGSQVLVPFRGCEDDPRHLKLMGDLGQIVPMK  120

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            +NPRD++++KA +AKANVVINLIGREYETRNYSFE+VNH+MAE++A I+KEHGGIMRFIQ
Sbjct  121  FNPRDDNTIKATMAKANVVINLIGREYETRNYSFEDVNHFMAERIAGIAKEHGGIMRFIQ  180

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            +SCLGAS +SPSR+   KA AE AVLRE
Sbjct  181  ISCLGASSSSPSRVFSTKAAAEEAVLRE  208



>ref|XP_010036149.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Eucalyptus grandis]
 gb|KCW47684.1| hypothetical protein EUGRSUZ_K01422 [Eucalyptus grandis]
Length=394

 Score =   292 bits (748),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 177/208 (85%), Gaps = 7/208 (3%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA++RRLGHQ      SV + KS   L +HY G D  RY ST+ A+KGVGHLVRKGTGG
Sbjct  1    MQAISRRLGHQ-----SSVHSLKSVYPLCNHYYGADDGRYVSTV-ATKGVGHLVRKGTGG  54

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFR SED HRHLKLMGDLGQIVPM+
Sbjct  55   RSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRCSEDSHRHLKLMGDLGQIVPMQ  114

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            +NPRDE S+KAV+AKANVVINLIGREYETRNYSFEEVNH MAE LA I+KEHGGIMR+IQ
Sbjct  115  FNPRDEGSIKAVMAKANVVINLIGREYETRNYSFEEVNHSMAEVLANIAKEHGGIMRYIQ  174

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGAS +SPS+  + KA  E A+LRE
Sbjct  175  VSCLGASSSSPSKFLQTKAAGEAALLRE  202



>ref|XP_010540921.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Tarenaya hassleriana]
Length=402

 Score =   292 bits (747),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 178/210 (85%), Gaps = 5/210 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLL---SDHY-GIDTPRYASTLTASKGVGHLVRKG  255
            MQAV+RRL H+       +       LL    DHY GID  RY+S+L A+KG+GHL RKG
Sbjct  1    MQAVSRRLAHRPFAGGAQIYPSSYLKLLYEVPDHYHGIDDRRYSSSL-ATKGMGHLARKG  59

Query  256  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  435
            TGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIV
Sbjct  60   TGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDDPRHLKLMGDLGQIV  119

Query  436  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  615
            PMK+NPRDE S+KAV+AKANVVINLIGR+YETRN+SFEEVNH+M+E+LA ++KEHGGIMR
Sbjct  120  PMKFNPRDEDSIKAVMAKANVVINLIGRDYETRNFSFEEVNHHMSEKLAMLAKEHGGIMR  179

Query  616  FIQVSCLGASPTSPSRMRRAKATAEXAVLR  705
            FIQVSCLGA+ TSPSRMRR KA AE A+L+
Sbjct  180  FIQVSCLGAAATSPSRMRRTKAAAEEAILK  209



>ref|XP_010684864.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Beta vulgaris subsp. vulgaris]
Length=395

 Score =   291 bits (745),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 180/208 (87%), Gaps = 6/208 (3%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSD-HYGIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQ+++RRL HQ    S + S+ KS   LSD  YG+D  RY STL A+KGV HL RKGTGG
Sbjct  1    MQSISRRLSHQ----SFNFSSLKSLYALSDPRYGVDHSRYGSTL-ATKGVAHLARKGTGG  55

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  56   RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQIVPMK  115

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            Y+PRDE S+KAV+AKANVVINLIGREYETRNYSFEEVNH+MAE LA I+KEHGGIMRFIQ
Sbjct  116  YDPRDECSIKAVMAKANVVINLIGREYETRNYSFEEVNHHMAEHLAMIAKEHGGIMRFIQ  175

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLGASPTS SRM +AKA AE A+LRE
Sbjct  176  VSCLGASPTSASRMLKAKAAAEEAILRE  203



>ref|XP_009586626.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586627.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586628.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586629.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586630.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
Length=397

 Score =   290 bits (741),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 172/195 (88%), Gaps = 6/195 (3%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSD--HYGIDTPRYASTLTASKGVGHLVRKGTG  261
            MQA+TR+LGHQ LK S ++S+FKS    SD  +YG    R+AS +  S G GHL RKGTG
Sbjct  1    MQAITRKLGHQSLKHSPAISSFKSLYPPSDDQYYG---SRFASNVATSGG-GHLARKGTG  56

Query  262  GRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPM  441
            GRSSVSGIVATVFGATGFLGRY+VQ+LAKMG+QVLVPFRGSED  RHLKLMGDLGQIVPM
Sbjct  57   GRSSVSGIVATVFGATGFLGRYVVQELAKMGTQVLVPFRGSEDSPRHLKLMGDLGQIVPM  116

Query  442  KYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFI  621
            KYNPRDE+SVKAV+AKANVVINLIGREYETRNYSFEEVNH+MAEQLA I+KEHGGIMRFI
Sbjct  117  KYNPRDENSVKAVMAKANVVINLIGREYETRNYSFEEVNHHMAEQLAMIAKEHGGIMRFI  176

Query  622  QVSCLGASPTSPSRM  666
            QVSCLG SPTSPSRM
Sbjct  177  QVSCLGVSPTSPSRM  191



>ref|XP_009763970.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Nicotiana sylvestris]
Length=314

 Score =   286 bits (733),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 171/194 (88%), Gaps = 4/194 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKS-FDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA+TR+LGHQ LK S ++S+FKS +    DHY     R+AS +  S G GHL RKGTGG
Sbjct  1    MQAITRKLGHQSLKHSPAISSFKSLYPPSDDHYC--GSRFASNVATSGG-GHLARKGTGG  57

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVATVFGATGFLGRY+VQ+LAKMG+QVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  58   RSSVSGIVATVFGATGFLGRYVVQELAKMGTQVLVPFRGSEDSPRHLKLMGDLGQIVPMK  117

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDE+SVKAV+AKANVVINLIGREYETRNYSFEEVNH+MAEQLA I+KEHGGI+RFIQ
Sbjct  118  YNPRDENSVKAVMAKANVVINLIGREYETRNYSFEEVNHHMAEQLAMIAKEHGGIIRFIQ  177

Query  625  VSCLGASPTSPSRM  666
            VSCLG SPTSPSRM
Sbjct  178  VSCLGVSPTSPSRM  191



>ref|XP_010548735.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Tarenaya hassleriana]
Length=402

 Score =   288 bits (736),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 179/210 (85%), Gaps = 5/210 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLK---PSHSVSAFKSF-DLLSDHYGIDTPRYASTLTASKGVGHLVRKG  255
            MQAV+RRL ++ L    P +S S   S  +  S H+G D  RY+S+L A+KGVGHL RKG
Sbjct  1    MQAVSRRLAYRPLAGGAPIYSSSYLNSICEGSSHHHGKDNRRYSSSL-AAKGVGHLARKG  59

Query  256  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  435
            TGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIV
Sbjct  60   TGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDDPRHLKLMGDLGQIV  119

Query  436  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  615
            PMK+NPRDE S+KAV+AKANVVINL GREYETRN+SFEEVNH+MAE+LA ++KEHGGIMR
Sbjct  120  PMKFNPRDEDSIKAVMAKANVVINLTGREYETRNFSFEEVNHHMAEKLALLAKEHGGIMR  179

Query  616  FIQVSCLGASPTSPSRMRRAKATAEXAVLR  705
            FIQVSCLGAS +SPS+MRR KA  E A+L+
Sbjct  180  FIQVSCLGASASSPSKMRRTKAAGEEAILK  209



>ref|XP_010489051.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Camelina sativa]
Length=403

 Score =   286 bits (731),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 177/209 (85%), Gaps = 4/209 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLL---SDHY-GIDTPRYASTLTASKGVGHLVRKG  255
            MQAV+RRL  + L    S+ ++ S   L   S+H  G D  RYAS+L    GVGHL RKG
Sbjct  1    MQAVSRRLVQRPLAGGASICSYSSLRSLYGVSNHLNGTDNRRYASSLAKKGGVGHLARKG  60

Query  256  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  435
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  61   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVV  120

Query  436  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  615
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFE+VNH++AE+LA ++KEHGGIMR
Sbjct  121  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEDVNHHIAEKLALVAKEHGGIMR  180

Query  616  FIQVSCLGASPTSPSRMRRAKATAEXAVL  702
            +IQVSCLGAS +SPSRM+RAKA AE AVL
Sbjct  181  YIQVSCLGASMSSPSRMQRAKAAAEEAVL  209



>ref|XP_008459972.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
1 alpha subcomplex subunit 9, mitochondrial [Cucumis melo]
Length=402

 Score =   284 bits (726),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 164/180 (91%), Gaps = 2/180 (1%)
 Frame = +1

Query  169  LSDHY-GIDTPRYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLA  345
            LS HY G D PRY STL A++GVGHLVRKGTGGRSSVSGIVATVFGATGFLGRY+VQQLA
Sbjct  31   LSHHYCGADRPRYDSTL-ATRGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQLA  89

Query  346  KMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREY  525
            KMGSQVLVPFRGSED  RHLK+MGDLGQIVPMKYNPRDESSVKAV+AKANVV+NLIGREY
Sbjct  90   KMGSQVLVPFRGSEDSPRHLKIMGDLGQIVPMKYNPRDESSVKAVMAKANVVLNLIGREY  149

Query  526  ETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLR  705
            ETRNYSFEEVNH MAEQLA I+KEHGGI+RFIQVSCLGAS +SPSR  R+KA  E +VL+
Sbjct  150  ETRNYSFEEVNHSMAEQLATIAKEHGGILRFIQVSCLGASSSSPSRFLRSKAAGEESVLK  209



>ref|XP_009102039.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brassica rapa]
Length=402

 Score =   283 bits (725),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 179/209 (86%), Gaps = 5/209 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLL---SDHY-GIDTPRYASTLTASKGVGHLVRKG  255
            MQAV+RRL  + L    S+ +  S   L   SDH  G D  RY+S+L A+KGVGHL RKG
Sbjct  1    MQAVSRRLIQRPLSGGASIYSSSSPRSLHGVSDHLNGSDNRRYSSSL-ATKGVGHLARKG  59

Query  256  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  435
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  60   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQVV  119

Query  436  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  615
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAE+LA ++KEHGGIMR
Sbjct  120  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNHHMAEKLALVAKEHGGIMR  179

Query  616  FIQVSCLGASPTSPSRMRRAKATAEXAVL  702
            FIQVSCLGAS +SPSRM+RAKA AE AVL
Sbjct  180  FIQVSCLGASVSSPSRMQRAKAAAEEAVL  208



>emb|CDY31970.1| BnaA07g00250D [Brassica napus]
Length=402

 Score =   283 bits (725),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 179/209 (86%), Gaps = 5/209 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLL---SDHY-GIDTPRYASTLTASKGVGHLVRKG  255
            MQAV+RRL  + L    S+ +  S   L   SDH  G D  RY+S+L A+KGVGHL RKG
Sbjct  1    MQAVSRRLIQRPLSGGASIYSSSSPRSLHGVSDHLNGSDNRRYSSSL-ATKGVGHLARKG  59

Query  256  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  435
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  60   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQVV  119

Query  436  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  615
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAE+LA ++KEHGGIMR
Sbjct  120  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNHHMAEKLALVAKEHGGIMR  179

Query  616  FIQVSCLGASPTSPSRMRRAKATAEXAVL  702
            FIQVSCLGAS +SPSRM+RAKA AE AVL
Sbjct  180  FIQVSCLGASVSSPSRMQRAKAAAEEAVL  208



>emb|CDX81965.1| BnaC08g36360D [Brassica napus]
Length=403

 Score =   283 bits (724),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 180/210 (86%), Gaps = 6/210 (3%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLL---SDHY--GIDTPRYASTLTASKGVGHLVRK  252
            MQAV+RRL  + L    S+ +  S   L   SDH+  G D  RY+S+L A+KGVGHL RK
Sbjct  1    MQAVSRRLVQRPLGGGASIYSSSSIRSLYGVSDHHLNGADNRRYSSSL-ATKGVGHLARK  59

Query  253  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  432
            GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+
Sbjct  60   GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQV  119

Query  433  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  612
            VPMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAE+LA ++KEHGGIM
Sbjct  120  VPMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNHHMAEKLALVAKEHGGIM  179

Query  613  RFIQVSCLGASPTSPSRMRRAKATAEXAVL  702
            RFIQVSCLGAS +SPSRM+RAKA AE AVL
Sbjct  180  RFIQVSCLGASLSSPSRMQRAKAAAEEAVL  209



>emb|CDY05746.1| BnaC07g00570D [Brassica napus]
Length=402

 Score =   283 bits (724),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 180/209 (86%), Gaps = 5/209 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLL---SDHY-GIDTPRYASTLTASKGVGHLVRKG  255
            MQAV+RRL  + L    S+ +  S   L   SDH+ G D  RY+S+L A+KGVGHL RKG
Sbjct  1    MQAVSRRLIQRPLAGGASIYSSSSLRSLHGVSDHFNGNDNRRYSSSL-ATKGVGHLARKG  59

Query  256  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  435
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  60   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQVV  119

Query  436  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  615
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SF+EVNH+MAE+LA ++KEHGGIMR
Sbjct  120  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFKEVNHHMAEKLALVAKEHGGIMR  179

Query  616  FIQVSCLGASPTSPSRMRRAKATAEXAVL  702
            FIQVSCLGAS +SPSRM+RAKA AE AVL
Sbjct  180  FIQVSCLGASVSSPSRMQRAKAAAEEAVL  208



>ref|XP_011656761.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Cucumis sativus]
 gb|KGN46368.1| hypothetical protein Csa_6G087960 [Cucumis sativus]
Length=401

 Score =   283 bits (723),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 180/209 (86%), Gaps = 4/209 (2%)
 Frame = +1

Query  88   MQAVTRRL--GHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGT  258
            MQA++RRL    Q L  S S+S+ K    LS HY G D PRY STL A++GVGHLVRKGT
Sbjct  1    MQALSRRLVQQQQSLSSSSSISSIKFIYPLSHHYCGADRPRYDSTL-ATRGVGHLVRKGT  59

Query  259  GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVP  438
            GGRSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLK+MGDLGQIVP
Sbjct  60   GGRSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSPRHLKIMGDLGQIVP  119

Query  439  MKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRF  618
            MKYNPRDE+SVKAV+AKANVV+NLIGREYETRNYSFEEVNH MAEQLA I+KEHGGI+RF
Sbjct  120  MKYNPRDENSVKAVMAKANVVLNLIGREYETRNYSFEEVNHSMAEQLATIAKEHGGILRF  179

Query  619  IQVSCLGASPTSPSRMRRAKATAEXAVLR  705
            IQVSCLGAS +SPSR  R+KA  E +VL+
Sbjct  180  IQVSCLGASSSSPSRFLRSKAAGEESVLK  208



>ref|XP_009117495.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brassica rapa]
Length=403

 Score =   282 bits (721),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 180/210 (86%), Gaps = 6/210 (3%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDL---LSDHY--GIDTPRYASTLTASKGVGHLVRK  252
            MQAV+RRL  + L    S+ +  S      +SDH+  G D  RY+S+L A+KGVGHL RK
Sbjct  1    MQAVSRRLVQRPLGGGASIYSSSSLRSLYGVSDHHLNGADNRRYSSSL-ATKGVGHLARK  59

Query  253  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  432
            GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+
Sbjct  60   GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQV  119

Query  433  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  612
            VPMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAE+LA ++KEHGGIM
Sbjct  120  VPMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNHHMAEKLALVAKEHGGIM  179

Query  613  RFIQVSCLGASPTSPSRMRRAKATAEXAVL  702
            RFIQVSCLGAS +SPSRM+RAKA AE AVL
Sbjct  180  RFIQVSCLGASLSSPSRMQRAKAAAEEAVL  209



>emb|CDY13877.1| BnaA09g43790D [Brassica napus]
Length=403

 Score =   282 bits (721),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 180/210 (86%), Gaps = 6/210 (3%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDL---LSDHY--GIDTPRYASTLTASKGVGHLVRK  252
            MQAV+RRL  + L    S+ +  S      +SDH+  G D  RY+S+L A+KGVGHL RK
Sbjct  1    MQAVSRRLVQRPLGGGASIYSSSSLRSLYGVSDHHLNGADNRRYSSSL-ATKGVGHLARK  59

Query  253  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  432
            GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+
Sbjct  60   GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQV  119

Query  433  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  612
            VPMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAE+LA ++KEHGGIM
Sbjct  120  VPMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNHHMAEKLALVAKEHGGIM  179

Query  613  RFIQVSCLGASPTSPSRMRRAKATAEXAVL  702
            RFIQVSCLGAS +SPSRM+RAKA AE AVL
Sbjct  180  RFIQVSCLGASLSSPSRMQRAKAAAEEAVL  209



>ref|XP_006648113.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Oryza brachyantha]
Length=360

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  220  ASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHR  399
            A KG GHLVRKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMG+QVLVPFRGSEDCHR
Sbjct  7    AVKGTGHLVRKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGTQVLVPFRGSEDCHR  66

Query  400  HLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQL  579
            HLKLMGDLGQIVPMKYNPRD +S+KAV+AK+NVVINLIGREYETRNY FEEVNH+MAEQL
Sbjct  67   HLKLMGDLGQIVPMKYNPRDVNSIKAVMAKSNVVINLIGREYETRNYGFEEVNHHMAEQL  126

Query  580  AAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            A ISKEHGGIMRFIQVSCLGAS +SPSRM RAKA  E +VL+E
Sbjct  127  AMISKEHGGIMRFIQVSCLGASASSPSRMLRAKAAGEESVLKE  169



>ref|XP_006408954.1| hypothetical protein EUTSA_v10002002mg [Eutrema salsugineum]
 gb|ESQ50407.1| hypothetical protein EUTSA_v10002002mg [Eutrema salsugineum]
Length=402

 Score =   281 bits (720),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 179/209 (86%), Gaps = 5/209 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLL---SDHY-GIDTPRYASTLTASKGVGHLVRKG  255
            MQA++R+L  + L    S+ +  S   L   SDH  G D+ RY+S+L A+KGVGHL RKG
Sbjct  1    MQALSRKLVQRPLAGGASIYSSSSIRSLYGVSDHLNGTDSRRYSSSL-ATKGVGHLARKG  59

Query  256  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  435
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  60   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVV  119

Query  436  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  615
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFEE NH+MAE+LA ++KEHGGIMR
Sbjct  120  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEANHHMAEKLALVAKEHGGIMR  179

Query  616  FIQVSCLGASPTSPSRMRRAKATAEXAVL  702
            FIQVSCLGAS +SPSRM+RAKA AE AVL
Sbjct  180  FIQVSCLGASVSSPSRMQRAKAAAEEAVL  208



>ref|XP_006296717.1| hypothetical protein CARUB_v10014190mg [Capsella rubella]
 gb|EOA29615.1| hypothetical protein CARUB_v10014190mg [Capsella rubella]
Length=323

 Score =   278 bits (710),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 156/209 (75%), Positives = 179/209 (86%), Gaps = 5/209 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDL---LSDHY-GIDTPRYASTLTASKGVGHLVRKG  255
            MQAV+RRL  + L    S+ +  S      +S+H  G D  RY+S+L A+KGVGHL RKG
Sbjct  1    MQAVSRRLVQRPLAEGASIYSSSSLRSLYGVSNHLNGSDNRRYSSSL-ATKGVGHLARKG  59

Query  256  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  435
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  60   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVV  119

Query  436  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  615
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFEEVNH++AE+LA ++KEHGGIMR
Sbjct  120  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNHHIAEKLALVAKEHGGIMR  179

Query  616  FIQVSCLGASPTSPSRMRRAKATAEXAVL  702
            +IQVSCLGAS +SPSRM+RAKA AE AVL
Sbjct  180  YIQVSCLGASMSSPSRMQRAKAAAEEAVL  208



>ref|NP_001048516.1| Os02g0816800 [Oryza sativa Japonica Group]
 dbj|BAD21515.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAD22016.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF10430.1| Os02g0816800 [Oryza sativa Japonica Group]
Length=408

 Score =   280 bits (715),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 156/176 (89%), Gaps = 1/176 (1%)
 Frame = +1

Query  184  GIDTPRYAST-LTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQ  360
            G D  RY S    A KG GHLVRKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQ
Sbjct  42   GADGARYMSARAPAVKGTGHLVRKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGSQ  101

Query  361  VLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNY  540
            VLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRD  S+KAV+AK+NVVINLIGREYETRNY
Sbjct  102  VLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDVDSIKAVMAKSNVVINLIGREYETRNY  161

Query  541  SFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
             F+EVNH+MAEQLA ISKEHGGIMRFIQVS LGAS +SPSRM RAKA  E +VL+E
Sbjct  162  GFDEVNHHMAEQLAMISKEHGGIMRFIQVSSLGASASSPSRMLRAKAAGEESVLKE  217



>ref|XP_009112664.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Brassica rapa]
Length=403

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 161/173 (93%), Gaps = 1/173 (1%)
 Frame = +1

Query  184  GIDTPRYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQV  363
            G D  RY+S+L A+KGVGHL RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQV
Sbjct  38   GSDNRRYSSSL-ATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQV  96

Query  364  LVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYS  543
            LVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE S+KAV+AKANVVINLIGREYETRN+S
Sbjct  97   LVPFRGSEDNPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFS  156

Query  544  FEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVL  702
            FEEVNH+MAE+LA ++KEHGGIMRFIQVSCLGAS TSPSRM+RAKA AE AVL
Sbjct  157  FEEVNHHMAEKLALVAKEHGGIMRFIQVSCLGASVTSPSRMQRAKAAAEEAVL  209



>ref|XP_010467837.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Camelina sativa]
Length=403

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 176/209 (84%), Gaps = 4/209 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLL---SDHY-GIDTPRYASTLTASKGVGHLVRKG  255
            MQAV+RRL  + L    S+ +  S   L   S+H  G D  RYAS+L    GVGHL RKG
Sbjct  1    MQAVSRRLVQRPLAGGASICSSSSLRSLYGVSNHLNGTDNRRYASSLANKWGVGHLARKG  60

Query  256  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  435
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  61   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVV  120

Query  436  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  615
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFE+VNH++AE+LA ++KEHGGIMR
Sbjct  121  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEDVNHHIAEKLALVAKEHGGIMR  180

Query  616  FIQVSCLGASPTSPSRMRRAKATAEXAVL  702
            +IQVSCLGAS +SPSRM+RAKA AE AVL
Sbjct  181  YIQVSCLGASMSSPSRMQRAKAAAEEAVL  209



>ref|XP_010415893.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Camelina sativa]
Length=403

 Score =   278 bits (712),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 176/209 (84%), Gaps = 4/209 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLL---SDHY-GIDTPRYASTLTASKGVGHLVRKG  255
            MQAV+RRL  + L    S+ +  S   L   S+H  G D  RYAS+L    GVGHL RKG
Sbjct  1    MQAVSRRLVQRPLAGGASICSSSSLRSLYGFSNHLNGTDNRRYASSLANKGGVGHLARKG  60

Query  256  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  435
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  61   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVV  120

Query  436  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  615
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFE+VNH++AE+LA ++KEHGGIMR
Sbjct  121  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEDVNHHIAEKLALVAKEHGGIMR  180

Query  616  FIQVSCLGASPTSPSRMRRAKATAEXAVL  702
            +IQVSCLGAS +SPSRM+RAKA AE AVL
Sbjct  181  YIQVSCLGASMSSPSRMQRAKAAAEEAVL  209



>ref|XP_004495054.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Cicer arietinum]
Length=396

 Score =   278 bits (711),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 184/208 (88%), Gaps = 5/208 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA+TRRLGHQ LK S S+ +      +SDHY G+D  RY ST+ A+KGVGHLVRKGTGG
Sbjct  1    MQAITRRLGHQSLKSSTSLKSIYP---ISDHYYGVDHERYVSTV-ATKGVGHLVRKGTGG  56

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGIVATVFGATGFLGRY+VQQLAKMGSQ+LVPFRGSEDC RHLKLMGDLGQ+VPMK
Sbjct  57   RSSVSGIVATVFGATGFLGRYVVQQLAKMGSQILVPFRGSEDCPRHLKLMGDLGQVVPMK  116

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            YNPRDESSVKAV+A+ANVVINL+GR+YETRNYSFEEV+++MAE+ A I+KEHGGIMRFIQ
Sbjct  117  YNPRDESSVKAVMARANVVINLLGRDYETRNYSFEEVHYHMAEKFAKIAKEHGGIMRFIQ  176

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VS LGASP+S SRM R KA AE A+LRE
Sbjct  177  VSSLGASPSSSSRMLRCKAAAEEAILRE  204



>emb|CDY03308.1| BnaC09g10400D [Brassica napus]
Length=402

 Score =   278 bits (710),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 156/209 (75%), Positives = 177/209 (85%), Gaps = 5/209 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDL---LSDHY-GIDTPRYASTLTASKGVGHLVRKG  255
            MQAV+RRL  + L    S+ +  S      + D+  G D  RY+S+L A+KGVGHL RKG
Sbjct  1    MQAVSRRLVQRPLAGETSIYSSSSLRSLYGVPDYLNGSDNRRYSSSL-ATKGVGHLARKG  59

Query  256  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  435
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  60   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQVV  119

Query  436  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  615
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAE+LA ++KEHGGIMR
Sbjct  120  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNHHMAEKLALVAKEHGGIMR  179

Query  616  FIQVSCLGASPTSPSRMRRAKATAEXAVL  702
            FIQVSCLGAS +SPSRM+RAKA AE AV 
Sbjct  180  FIQVSCLGASVSSPSRMQRAKAAAEEAVF  208



>emb|CDY39772.1| BnaA09g10240D [Brassica napus]
Length=403

 Score =   277 bits (709),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 156/209 (75%), Positives = 177/209 (85%), Gaps = 5/209 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDL---LSDHY-GIDTPRYASTLTASKGVGHLVRKG  255
            MQA +RRL  + L    S+ +  S      +SD+  G D  RY+S+L A+KGVGHL RKG
Sbjct  2    MQAASRRLVQRPLAGETSIYSSSSLRSLYGVSDYLNGSDNRRYSSSL-ATKGVGHLARKG  60

Query  256  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  435
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  61   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQVV  120

Query  436  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  615
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAE+LA ++KEHGGIMR
Sbjct  121  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNHHMAEKLALVAKEHGGIMR  180

Query  616  FIQVSCLGASPTSPSRMRRAKATAEXAVL  702
            FIQVSCLGAS +SPSRM+RAKA AE AV 
Sbjct  181  FIQVSCLGASVSSPSRMQRAKAAAEEAVF  209



>gb|EEC74241.1| hypothetical protein OsI_09443 [Oryza sativa Indica Group]
Length=408

 Score =   277 bits (708),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 155/176 (88%), Gaps = 1/176 (1%)
 Frame = +1

Query  184  GIDTPRYAST-LTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQ  360
            G D  RY S    A KG GHLVRKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQ
Sbjct  42   GADGARYMSARAPAVKGTGHLVRKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGSQ  101

Query  361  VLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNY  540
            VLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRD  S+KAV+AK+NVVINLIGREYETRNY
Sbjct  102  VLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDVDSIKAVMAKSNVVINLIGREYETRNY  161

Query  541  SFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
             F+EVNH+MAEQLA ISKEHGGIMRFI VS LGAS +SPSRM RAKA  E +VL+E
Sbjct  162  GFDEVNHHMAEQLAMISKEHGGIMRFIHVSSLGASASSPSRMLRAKAAGEESVLKE  217



>ref|XP_002884196.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60455.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
Length=402

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 177/209 (85%), Gaps = 5/209 (2%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDL---LSDHY-GIDTPRYASTLTASKGVGHLVRKG  255
            MQA++RRL  + L    S+ +  S      +S+H  G D  RY+S+L A+KGVGHL RKG
Sbjct  1    MQALSRRLVQRPLTGEASIYSSSSLRSLYGVSNHLNGTDNRRYSSSL-ATKGVGHLARKG  59

Query  256  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  435
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  60   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVV  119

Query  436  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  615
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFE+ NH++AE+LA ++KEHGGIMR
Sbjct  120  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEDANHHIAEKLALVAKEHGGIMR  179

Query  616  FIQVSCLGASPTSPSRMRRAKATAEXAVL  702
            +IQVSCLGAS +SPSRM RAKA AE AVL
Sbjct  180  YIQVSCLGASASSPSRMLRAKAAAEEAVL  208



>ref|XP_002453037.1| hypothetical protein SORBIDRAFT_04g037200 [Sorghum bicolor]
 gb|EES06013.1| hypothetical protein SORBIDRAFT_04g037200 [Sorghum bicolor]
Length=408

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 156/217 (72%), Positives = 174/217 (80%), Gaps = 10/217 (5%)
 Frame = +1

Query  88   MQAVT--RRLGHQYLKPSHS--VSAFKSFDL--LSDH--YGIDTPRYASTLTAS--KGVG  237
            MQA    R L   +L PS S  ++AF+S     L+     G D  RY S+  A   KG G
Sbjct  1    MQAAAWRRHLLDHHLSPSTSAAIAAFRSASQPGLAPQGLCGADGARYMSSARAPAVKGSG  60

Query  238  HLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMG  417
            HLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG ED HRHLK+MG
Sbjct  61   HLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGCEDSHRHLKIMG  120

Query  418  DLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKE  597
            DLGQIVPMKY+PRD  S+KAV+AK+NVVINLIGREYETRNYSFEEVNH+MAEQLA I+KE
Sbjct  121  DLGQIVPMKYHPRDVDSIKAVMAKSNVVINLIGREYETRNYSFEEVNHHMAEQLATIAKE  180

Query  598  HGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            HGGIMRFIQVSCLGASP+S SR+ R KA  E ++L+E
Sbjct  181  HGGIMRFIQVSCLGASPSSESRLLRTKAAGEQSILKE  217



>ref|NP_565469.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Arabidopsis 
thaliana]
 sp|Q9SK66.2|NDUA9_ARATH RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK59545.1| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAK93749.1| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAD21752.2| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAT68351.1| hypothetical protein At2g20360 [Arabidopsis thaliana]
 gb|AAX23820.1| hypothetical protein At2g20360 [Arabidopsis thaliana]
 gb|AEC06997.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Arabidopsis 
thaliana]
Length=402

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 163/179 (91%), Gaps = 2/179 (1%)
 Frame = +1

Query  169  LSDHY-GIDTPRYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLA  345
            +S+H  G D  RY+S+L A+KGVGHL RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLA
Sbjct  31   VSNHLNGTDNCRYSSSL-ATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLA  89

Query  346  KMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREY  525
            KMGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE S+KAV+AKANVVINLIGREY
Sbjct  90   KMGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREY  149

Query  526  ETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVL  702
            ETRN+SFE+ NH++AE+LA ++KEHGGIMR+IQVSCLGAS +SPSRM RAKA AE AVL
Sbjct  150  ETRNFSFEDANHHIAEKLALVAKEHGGIMRYIQVSCLGASVSSPSRMLRAKAAAEEAVL  208



>gb|EPS69627.1| hypothetical protein M569_05135, partial [Genlisea aurea]
Length=360

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  208  STLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  387
            S+  A+KGVGHL+RKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAK GSQVLVPFRGSE
Sbjct  2    SSNLATKGVGHLIRKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKNGSQVLVPFRGSE  61

Query  388  DCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYM  567
            D  RHLKLMGDLGQIVPMKYNPRDE S+KAV+AKANVVINLIGREYETRN+SFEEVNH M
Sbjct  62   DSSRHLKLMGDLGQIVPMKYNPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNHRM  121

Query  568  AEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            AEQLAAI++EHGGIMRFIQVSCLGAS  S SRM R KA AE +V RE
Sbjct  122  AEQLAAIAREHGGIMRFIQVSCLGASLASQSRMLRTKAAAEESVFRE  168



>ref|XP_004954373.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Setaria italica]
Length=408

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 172/213 (81%), Gaps = 8/213 (4%)
 Frame = +1

Query  94   AVTRRLGHQYLKPSHS--VSAFKSFDL--LSDH--YGIDTPRYASTLTAS--KGVGHLVR  249
            A  R L   +L PS S  ++AF+S     L+     G D  R  S+  A   +G G+LVR
Sbjct  5    AWRRHLLDHHLSPSTSAAIAAFRSASQPGLTPQGLCGADGARCMSSARAPAVEGSGYLVR  64

Query  250  KGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQ  429
            KGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLK+MGDLGQ
Sbjct  65   KGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKIMGDLGQ  124

Query  430  IVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGI  609
            IVPMKYNPRD  S+KAV+AK+NVV+NLIGREYETRNYSFEEVNH+MA QLA I+KEHGGI
Sbjct  125  IVPMKYNPRDVDSIKAVMAKSNVVVNLIGREYETRNYSFEEVNHHMAGQLAMIAKEHGGI  184

Query  610  MRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            MRFIQVSCLGASP+S S+M RAKA  E ++L+E
Sbjct  185  MRFIQVSCLGASPSSESKMLRAKAAGEESILKE  217



>dbj|BAJ86608.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96242.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88789.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=413

 Score =   268 bits (684),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 151/176 (86%), Gaps = 1/176 (1%)
 Frame = +1

Query  184  GIDTPRYAST-LTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQ  360
            G D  RY S    A KG GHLVRKGTGGRSSVSGIVATVFGATGFLGRY+VQQLAKMGSQ
Sbjct  43   GADGARYMSARAPAVKGAGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQLAKMGSQ  102

Query  361  VLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNY  540
            VLVPFRG ED HRHLKLMGDLGQIVPM YNPRD +S+K  VAK+NVVINLIGREYETRNY
Sbjct  103  VLVPFRGCEDSHRHLKLMGDLGQIVPMNYNPRDVNSIKTAVAKSNVVINLIGREYETRNY  162

Query  541  SFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
             FEEVNH MAEQLA ISKEHGGI+RFIQVS LGAS +SPSR+ RAKA  E +VL+E
Sbjct  163  GFEEVNHQMAEQLAMISKEHGGIVRFIQVSALGASASSPSRLLRAKAAGEESVLKE  218



>gb|ABK24353.1| unknown [Picea sitchensis]
Length=401

 Score =   265 bits (678),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 157/179 (88%), Gaps = 1/179 (1%)
 Frame = +1

Query  172  SDHYGIDTPRYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKM  351
            S  Y  D  R AS+LT  KG+GHL+RKGTGGRSSVSGI+ATVFGATGFLGRY+VQQLAK 
Sbjct  33   SSEYKFDHSRSASSLT-DKGIGHLIRKGTGGRSSVSGIIATVFGATGFLGRYVVQQLAKT  91

Query  352  GSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYET  531
            GSQVLVPFRGSED  RHLKLMGDLGQIVPMKYNPRDESS+KAV+AK+NVVINLIGREYET
Sbjct  92   GSQVLVPFRGSEDSPRHLKLMGDLGQIVPMKYNPRDESSIKAVMAKSNVVINLIGREYET  151

Query  532  RNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            RN+SFEEVN  ++E LA I+KEHGGI+RFIQ+SCLGAS +SPS+M+R KA AE  V RE
Sbjct  152  RNFSFEEVNVDISEHLAKIAKEHGGIVRFIQLSCLGASSSSPSKMQRTKAAAEEVVRRE  210



>ref|NP_001149069.1| LOC100282690 [Zea mays]
 gb|ACG34074.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Zea mays]
Length=407

 Score =   265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 168/212 (79%), Gaps = 7/212 (3%)
 Frame = +1

Query  94   AVTRRLGHQYLKPSHS--VSAFKSFDL--LSDH--YGIDTPRYAST-LTASKGVGHLVRK  252
            A  R L   +L PS S  ++AF+S     L+    +G D  R  S    A KG GHLVRK
Sbjct  5    AWRRHLLDHHLSPSTSAAIAAFRSASQPGLAPQGLFGADGARCMSARAPAVKGSGHLVRK  64

Query  253  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  432
            GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG ED  RHLK+MGDLGQI
Sbjct  65   GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGCEDSPRHLKIMGDLGQI  124

Query  433  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  612
            VPMKY+PRD  S+KAV+AK+NVVINLIGREYETRNYSFEEVNH+M EQLA I+KEHGGI+
Sbjct  125  VPMKYHPRDVDSIKAVMAKSNVVINLIGREYETRNYSFEEVNHHMPEQLATIAKEHGGII  184

Query  613  RFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            RFIQVSCLGASP+S SRM R KA  E +V +E
Sbjct  185  RFIQVSCLGASPSSESRMLRTKAAGEQSVFKE  216



>gb|ACF85773.1| unknown [Zea mays]
 gb|ACR35734.1| unknown [Zea mays]
Length=407

 Score =   265 bits (677),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 168/212 (79%), Gaps = 7/212 (3%)
 Frame = +1

Query  94   AVTRRLGHQYLKPSHS--VSAFKSFDL--LSDH--YGIDTPRYAST-LTASKGVGHLVRK  252
            A  R L   +L PS S  ++AF+S     L+    +G D  R  S    A KG GHLVRK
Sbjct  5    AWRRHLLDHHLSPSTSAAIAAFRSASQPGLAPQGLFGADGARCMSARAPAVKGSGHLVRK  64

Query  253  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  432
            GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG ED  RHLK+MGDLGQI
Sbjct  65   GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGCEDSPRHLKIMGDLGQI  124

Query  433  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  612
            VPMKY+PRD  S+KAV+AK+NVVINLIGREYETRNYSFEEVNH+M EQLA I+KEHGGI+
Sbjct  125  VPMKYHPRDVDSIKAVMAKSNVVINLIGREYETRNYSFEEVNHHMPEQLATIAKEHGGII  184

Query  613  RFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            RFIQVSCLGASP+S SRM R KA  E +V +E
Sbjct  185  RFIQVSCLGASPSSESRMLRTKAAGEQSVFKE  216



>gb|AFW74028.1| NADH-ubiquinone oxidoreductase subunit [Zea mays]
Length=460

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 171/217 (79%), Gaps = 9/217 (4%)
 Frame = +1

Query  85   TMQ--AVTRRLGHQYLKPSHS--VSAFKSFDL--LSDH--YGIDTPRYAST-LTASKGVG  237
            TMQ  A  R L   +L PS S  ++AF+S     L+    +G D  R  S    A KG G
Sbjct  53   TMQSAAWRRHLLDHHLSPSTSAAIAAFRSASQPGLAPQGLFGADGARCMSARAPAVKGSG  112

Query  238  HLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMG  417
            HLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG ED  RHLK+MG
Sbjct  113  HLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGCEDSPRHLKIMG  172

Query  418  DLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKE  597
            DLGQIVPMKY+PRD  S+KAV+AK+NVVINLIGREYETRNYSFEEVNH+M EQLA I+KE
Sbjct  173  DLGQIVPMKYHPRDVDSIKAVMAKSNVVINLIGREYETRNYSFEEVNHHMPEQLATIAKE  232

Query  598  HGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            HGGI+RFIQVSCLGASP+S SRM R KA  E +V +E
Sbjct  233  HGGIIRFIQVSCLGASPSSESRMLRTKAAGEQSVFKE  269



>gb|KFK40412.1| hypothetical protein AALP_AA3G370500 [Arabis alpina]
Length=404

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 168/202 (83%), Gaps = 13/202 (6%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDL--------LSDHY-GIDTPRYASTLTASKGVGH  240
            MQAV+RRL     +PS +  A              +SDH  G D  RY+S+L A+KGVGH
Sbjct  1    MQAVSRRLLQ---RPSLNGGASIYSSSSLRSPLYGVSDHLNGTDNRRYSSSL-ATKGVGH  56

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGD
Sbjct  57   LARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDDPRHLKLMGD  116

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ+VPMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFE+VNH+MAE+LA ++KEH
Sbjct  117  LGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEDVNHHMAEKLALVAKEH  176

Query  601  GGIMRFIQVSCLGASPTSPSRM  666
            GGIMR+IQVSCLGAS +SPSRM
Sbjct  177  GGIMRYIQVSCLGASVSSPSRM  198



>gb|KHG08643.1| hypothetical protein F383_12346 [Gossypium arboreum]
Length=370

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 154/208 (74%), Gaps = 31/208 (15%)
 Frame = +1

Query  88   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  264
            MQA+TRRLGHQ L+P+ S+S+ KS   LSDHY G D PRY STL + KG+GHLVRKGTGG
Sbjct  1    MQAITRRLGHQSLRPTASISSIKSICALSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGG  60

Query  265  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  444
            RSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  61   RSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMK  120

Query  445  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  624
            Y+PRDE+S                            +   MA+  A I+KEHGGIMRFIQ
Sbjct  121  YDPRDENS----------------------------IKAVMAK--ANIAKEHGGIMRFIQ  150

Query  625  VSCLGASPTSPSRMRRAKATAEXAVLRE  708
            VSCLG+S TSPSR  RAKA  E AVL+E
Sbjct  151  VSCLGSSLTSPSRFLRAKAAGEEAVLKE  178



>ref|XP_003570393.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brachypodium distachyon]
Length=412

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 154/176 (88%), Gaps = 1/176 (1%)
 Frame = +1

Query  184  GIDTPRYASTLT-ASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQ  360
            G+D  RY S  T A KG GHLVRKGTGGRSSVSGIVATVFGATGFLGRY+VQQLAKMGSQ
Sbjct  42   GVDGARYMSARTPAVKGAGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQLAKMGSQ  101

Query  361  VLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNY  540
            VLVPFRG ED HRHLKLMGDLGQIVPMKYNPRD  S+K  VAK+NVVINLIGREYETRNY
Sbjct  102  VLVPFRGCEDSHRHLKLMGDLGQIVPMKYNPRDVDSIKTAVAKSNVVINLIGREYETRNY  161

Query  541  SFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
             FEEVNH+MAEQLA ISKEHGGI+RFIQVS LGAS +SPSRM RAKA  E +VL+E
Sbjct  162  GFEEVNHHMAEQLAMISKEHGGIVRFIQVSSLGASSSSPSRMLRAKAAGEESVLKE  217



>gb|KJB42336.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=345

 Score =   240 bits (612),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +1

Query  277  SGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPR  456
            SGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PR
Sbjct  10   SGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPR  69

Query  457  DESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCL  636
            DE+S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAEQLA I+KEHGGIMRFIQVSCL
Sbjct  70   DENSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQVSCL  129

Query  637  GASPTSPSRMRRAKATAEXAVLRE  708
            G+S +SPSR  RAKA  E AVL+E
Sbjct  130  GSSLSSPSRFLRAKAAGEEAVLKE  153



>dbj|BAH20309.1| AT2G20360 [Arabidopsis thaliana]
Length=335

 Score =   229 bits (585),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = +1

Query  280  GIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRD  459
            GIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRD
Sbjct  1    GIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRD  60

Query  460  ESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLG  639
            E S+KAV+AKANVVINLIGREYETRN+SFE+ NH++AE+LA ++KEHGGIMR+IQVSCLG
Sbjct  61   EDSIKAVMAKANVVINLIGREYETRNFSFEDANHHIAEKLALVAKEHGGIMRYIQVSCLG  120

Query  640  ASPTSPSRMRRAKATAEXAVL  702
            AS +SPSRM RAKA AE AVL
Sbjct  121  ASVSSPSRMLRAKAAAEEAVL  141



>gb|KDO37085.1| hypothetical protein CISIN_1g047628mg, partial [Citrus sinensis]
Length=327

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +1

Query  277  SGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPR  456
            SGI+ATVFG TGFLGRY+VQQLAKMGSQVLVPFRG ED  RHLKLMGDLGQIVPMK+NPR
Sbjct  6    SGIIATVFGTTGFLGRYVVQQLAKMGSQVLVPFRGCEDDPRHLKLMGDLGQIVPMKFNPR  65

Query  457  DESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCL  636
            D++++KA +AKANVVINLIGREYETRNYSFE+VNH+MAE++A I+KEHGGIMRFIQ+SCL
Sbjct  66   DDNTIKATMAKANVVINLIGREYETRNYSFEDVNHFMAERIAGIAKEHGGIMRFIQISCL  125

Query  637  GASPTSPSRMRRAKATAEXAVLRE  708
            GAS +SPSR+   KA AE AVLRE
Sbjct  126  GASSSSPSRVFSTKAAAEEAVLRE  149



>ref|XP_001765756.1| predicted protein [Physcomitrella patens]
 gb|EDQ69347.1| predicted protein [Physcomitrella patens]
Length=405

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 148/183 (81%), Gaps = 4/183 (2%)
 Frame = +1

Query  160  FDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQ  339
            FDL    +G    R +S+L  S G    V++GTGGRSSVSG+VATVFGATGFLGRY+VQQ
Sbjct  37   FDL---GFGSGRVRESSSLAVS-GSHRPVKRGTGGRSSVSGVVATVFGATGFLGRYVVQQ  92

Query  340  LAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGR  519
            LA+MGSQV+VP+RG ++  RHLKLMGDLGQIVP+KY+ RDE S+KA +A +NV++N IG+
Sbjct  93   LARMGSQVMVPYRGLDEEWRHLKLMGDLGQIVPIKYDARDEDSIKAAIANSNVIVNCIGK  152

Query  520  EYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            EYETRN+SF++VN+ ++ +++ ++KEHGGI++++Q+SCL A P SPSR+ R+K  AE AV
Sbjct  153  EYETRNFSFDDVNYGISNRISKLAKEHGGILKYVQMSCLAADPHSPSRLIRSKHAAEEAV  212

Query  700  LRE  708
            ++ 
Sbjct  213  MQN  215



>gb|EEE58042.1| hypothetical protein OsJ_08874 [Oryza sativa Japonica Group]
Length=310

 Score =   201 bits (510),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +1

Query  343  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGRE  522
            AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRD  S+KAV+AK+NVVINLIGRE
Sbjct  39   AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDVDSIKAVMAKSNVVINLIGRE  98

Query  523  YETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVL  702
            YETRNY F+EVNH+MAEQLA ISKEHGGIMRFIQVS LGAS +SPSRM RAKA  E +VL
Sbjct  99   YETRNYGFDEVNHHMAEQLAMISKEHGGIMRFIQVSSLGASASSPSRMLRAKAAGEESVL  158

Query  703  RE  708
            +E
Sbjct  159  KE  160



>dbj|BAG95473.1| unnamed protein product [Oryza sativa Japonica Group]
Length=311

 Score =   197 bits (501),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  349  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYE  528
            MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRD  S+KAV+AK+NVVINLIGREYE
Sbjct  1    MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDVDSIKAVMAKSNVVINLIGREYE  60

Query  529  TRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            TRNY F+EVNH+MAEQLA ISKEHGGIMRFIQVS LGAS +SPSRM RAKA  E +VL+E
Sbjct  61   TRNYGFDEVNHHMAEQLAMISKEHGGIMRFIQVSSLGASASSPSRMLRAKAAGEESVLKE  120



>gb|KJB42339.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=356

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  340  LAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGR  519
            ++KMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE+S+KAV+AKANVVINLIGR
Sbjct  42   MSKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDENSIKAVMAKANVVINLIGR  101

Query  520  EYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            EYETRN+SFEEVNH+MAEQLA I+KEHGGIMRFIQVSCLG+S +SPSR  RAKA  E AV
Sbjct  102  EYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQVSCLGSSLSSPSRFLRAKAAGEEAV  161

Query  700  LRE  708
            L+E
Sbjct  162  LKE  164



>ref|XP_007050148.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOX94305.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 4 [Theobroma 
cacao]
Length=313

 Score =   193 bits (490),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 112/121 (93%), Gaps = 1/121 (1%)
 Frame = +1

Query  349  MGSQVLVPFRGSEDCHRHLKLMGDLGQ-IVPMKYNPRDESSvkavvakanvvINLIGREY  525
            MGSQVLVPFRGSED  RHLKLMGDLGQ IVPMKY+PRDE+S+KAV+AKANVVINLIGREY
Sbjct  1    MGSQVLVPFRGSEDNPRHLKLMGDLGQQIVPMKYDPRDENSIKAVMAKANVVINLIGREY  60

Query  526  ETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLR  705
            ETRNYSFEEVNH+MAEQLA I++EHGGIMRFIQVSCLG+SP+S SR  RAKA AE AVLR
Sbjct  61   ETRNYSFEEVNHFMAEQLAVIAREHGGIMRFIQVSCLGSSPSSASRFLRAKAAAEEAVLR  120

Query  706  E  708
            E
Sbjct  121  E  121



>gb|EMT17104.1| putative NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 
9, mitochondrial [Aegilops tauschii]
Length=315

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  349  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYE  528
            MGSQVLVPFRG ED HRHLKLMGDLGQIVPM YNPRD +S+K  VAK+NVVINLIGREYE
Sbjct  1    MGSQVLVPFRGCEDSHRHLKLMGDLGQIVPMNYNPRDVNSIKTAVAKSNVVINLIGREYE  60

Query  529  TRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            TRNY FEEVNH MAEQLA ISKEHGGI+RFIQVS LGAS +SPSR+ RAKA  E +VL+E
Sbjct  61   TRNYGFEEVNHQMAEQLAMISKEHGGIVRFIQVSALGASASSPSRLLRAKAAGEESVLKE  120



>gb|EMS47161.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Triticum urartu]
Length=315

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  349  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYE  528
            MGSQVLVPFRG ED HRHLKLMGDLGQIVPM YNPRD +S+K  VAK+NVVINLIGREYE
Sbjct  1    MGSQVLVPFRGCEDSHRHLKLMGDLGQIVPMNYNPRDVNSIKTAVAKSNVVINLIGREYE  60

Query  529  TRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            TRNY FEEVNH MAEQLA ISKEHGGI+RFIQVS LGAS +SPSR+ RAKA  E +VL+E
Sbjct  61   TRNYGFEEVNHQMAEQLAMISKEHGGIVRFIQVSSLGASASSPSRLLRAKAAGEESVLKE  120



>ref|XP_002976090.1| hypothetical protein SELMODRAFT_104564, partial [Selaginella 
moellendorffii]
 gb|EFJ22995.1| hypothetical protein SELMODRAFT_104564, partial [Selaginella 
moellendorffii]
Length=353

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 127/170 (75%), Gaps = 1/170 (1%)
 Frame = +1

Query  199  RYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFR  378
            R+A  L A++G   LV K  GG S+ +G + T+FG+TG LGR +V  LAK+G+Q ++P+R
Sbjct  1    RHAFNL-ATRGGTPLVVKTAGGLSAATGFIVTIFGSTGMLGRAVVNNLAKIGAQCMIPYR  59

Query  379  GSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVN  558
            G ED  RHLK+MGDLGQIVP   N RDE +++A +AK+NVVINLIG+EYETRNY FEEVN
Sbjct  60   GLEDKPRHLKVMGDLGQIVPFVCNIRDEDAIRAAIAKSNVVINLIGQEYETRNYGFEEVN  119

Query  559  HYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
              +A+++A ISKEHGGI+R+I  SC+GA   SPS+  R KA  E AV +E
Sbjct  120  IDIAQRIARISKEHGGIVRYIHTSCVGADENSPSKQHRTKALGEEAVRQE  169



>ref|XP_002968287.1| hypothetical protein SELMODRAFT_89106, partial [Selaginella moellendorffii]
 gb|EFJ30541.1| hypothetical protein SELMODRAFT_89106, partial [Selaginella moellendorffii]
Length=362

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 127/170 (75%), Gaps = 1/170 (1%)
 Frame = +1

Query  199  RYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFR  378
            R+A  L A++G   LV K  GG S+ +G + T+FG+TG LGR +V  LAK+G+Q ++P+R
Sbjct  10   RHAFNL-ATRGGTPLVVKTAGGLSAATGFIVTIFGSTGMLGRAVVNNLAKIGAQCMIPYR  68

Query  379  GSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVN  558
            G ED  RHLK+MGDLGQIVP   N RD+ +++A +AK+NVVINLIG+EYETRNY FEEVN
Sbjct  69   GLEDKPRHLKVMGDLGQIVPFVCNIRDDDAIRAAIAKSNVVINLIGQEYETRNYGFEEVN  128

Query  559  HYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
              +A+++A ISKEHGGI+R+I  SC+GA   SPS+  R KA  E AV +E
Sbjct  129  IDIAQRIARISKEHGGIVRYIHTSCVGADENSPSKQHRTKALGEEAVRQE  178



>ref|XP_001757609.1| predicted protein [Physcomitrella patens]
 gb|EDQ77666.1| predicted protein [Physcomitrella patens]
Length=393

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 131/173 (76%), Gaps = 12/173 (7%)
 Frame = +1

Query  181  YGIDTPRYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQ  360
            +G    R++S+L  S G    V++GTGGRSSVSG+VATVFGATGFLGRY++QQLA+MGSQ
Sbjct  40   FGNAAVRHSSSLAVS-GSHRPVKRGTGGRSSVSGVVATVFGATGFLGRYVIQQLARMGSQ  98

Query  361  VLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNY  540
            V+             +  G LGQIVP+KY+ RDE S+K V+A +NV++N IG+EYETRN+
Sbjct  99   VMA-----------FEAHGRLGQIVPIKYDARDEGSIKPVIANSNVIVNCIGKEYETRNF  147

Query  541  SFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            SFE+VNH ++ +++ +++EHGGI++++Q+SCL A+P SPSR+ R+K  AE  V
Sbjct  148  SFEDVNHGISNRISKLAREHGGILKYVQMSCLAAAPDSPSRLLRSKHAAEEVV  200



>ref|XP_004339653.1| NADH dehydrogenase, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR17640.1| NADH dehydrogenase, putative [Acanthamoeba castellanii str. Neff]
Length=376

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = +1

Query  259  GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVP  438
            GGRSSVSG+VATVFG TGFLGR++V +L K+GSQV+VP+RG E   RHLK+MGDLGQI P
Sbjct  37   GGRSSVSGVVATVFGCTGFLGRFVVNRLGKIGSQVIVPYRGEESAFRHLKVMGDLGQIAP  96

Query  439  MKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRF  618
            + ++ RD+ +V+  V  +NVVINL+G+ +ETRN+SF++V+      +A  +KE  G+ RF
Sbjct  97   VWFDLRDKETVRRAVQYSNVVINLLGKRWETRNFSFDDVHPEATRTIAEAAKE-AGVERF  155

Query  619  IQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            IQVS  GA   SPS   R+K  +E  VLRE
Sbjct  156  IQVSAAGADVNSPSAFARSKGESEK-VLRE  184



>dbj|GAA99675.1| hypothetical protein E5Q_06378 [Mixia osmundae IAM 14324]
 gb|KEI40362.1| hypothetical protein L969DRAFT_94166 [Mixia osmundae IAM 14324]
Length=386

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 118/168 (70%), Gaps = 3/168 (2%)
 Frame = +1

Query  199  RYASTLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPF  375
            RY   LT  +  G  ++R G GGR S +G VATVFG TGFLGRYLV +LAK G+QV++P+
Sbjct  32   RYQHDLTIKQKDGRPILRSGPGGRHSFTGHVATVFGCTGFLGRYLVHKLAKKGTQVIIPY  91

Query  376  RGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEV  555
            R  ED  RHLK+MGDLGQIVPM+++ R++S ++  V  ++VV NL+GR+YET+N+ F EV
Sbjct  92   R-DEDEKRHLKVMGDLGQIVPMEWDIRNDSQIEEAVRHSDVVYNLVGRDYETKNFKFHEV  150

Query  556  NHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            +   A ++A+I+ +  G+ R I VS L A P SPS + R KA  E AV
Sbjct  151  HIDGARRIASIA-QLAGVSRLIHVSHLNADPDSPSAVLRCKAEGEEAV  197



>ref|XP_001626712.1| predicted protein [Nematostella vectensis]
 gb|EDO34612.1| predicted protein [Nematostella vectensis]
Length=372

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 118/171 (69%), Gaps = 1/171 (1%)
 Frame = +1

Query  196  PRYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPF  375
            P   + + +++ + +L +KGTGGRSS +G+ ATVFGATGFLGRY++ +L ++G+Q+ VP+
Sbjct  17   PLIGTAVVSTRKISYLPKKGTGGRSSFNGVSATVFGATGFLGRYVINRLGRVGTQLTVPY  76

Query  376  RGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEV  555
            RG E   RHL+LMGDLGQI    ++ +DE S+  +V  +NVV+NLIGR +ETRN++FEEV
Sbjct  77   RGDEHDIRHLRLMGDLGQIDFFDFHLKDEESIAKMVKHSNVVVNLIGRGFETRNFNFEEV  136

Query  556  NHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            +   A  +A  +KE  G+ R I VS L A+  SPS+    KA  E AV  E
Sbjct  137  HVDGARTIAKAAKE-AGVERLIHVSALNAAVDSPSKFLHTKALGEQAVREE  186



>ref|XP_007510295.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18640.1| predicted protein [Bathycoccus prasinos]
Length=431

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 107/153 (70%), Gaps = 0/153 (0%)
 Frame = +1

Query  247  RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLG  426
            +KGTGGRSS SGI A VFG+TGFLGRY+V  LAK GS+VLVP R SE+  +HLK MGDLG
Sbjct  82   KKGTGGRSSYSGITAAVFGSTGFLGRYVVNHLAKNGSRVLVPTRCSENHRQHLKPMGDLG  141

Query  427  QIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGG  606
            QIV   Y+ RD+ ++K  V +ANVVIN++GRE+ETRN+SFE+V+     +LA   KE   
Sbjct  142  QIVQFDYSMRDDEAIKYAVERANVVINMVGREWETRNFSFEDVHRDFPRRLAEACKESSS  201

Query  607  IMRFIQVSCLGASPTSPSRMRRAKATAEXAVLR  705
            + R I VS LGA   + S+  R KA  +  V R
Sbjct  202  VKRLIHVSALGADVNAKSKYYRTKAEGDEEVRR  234



>ref|XP_001835685.1| NADH dehydrogenase [Coprinopsis cinerea okayama7#130]
 gb|EAU86256.1| NADH dehydrogenase [Coprinopsis cinerea okayama7#130]
Length=366

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 113/164 (69%), Gaps = 5/164 (3%)
 Frame = +1

Query  211  TLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  390
            TL + K V   V  G  G S+VSG   TVFG TGFLGRYLV +L K+G+QV+ P+R  ED
Sbjct  27   TLPSKKPV---VSYGPPGYSAVSGHTVTVFGCTGFLGRYLVSKLGKIGTQVVAPYR-DED  82

Query  391  CHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMA  570
              RHLKLMGDLGQIV M+++ RDE S+   +  ++ VINL+GR+Y T+N+ F++VN   A
Sbjct  83   ESRHLKLMGDLGQIVRMEWDLRDEKSIAECLRHSDTVINLVGRDYTTKNFDFKQVNALGA  142

Query  571  EQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVL  702
            E++A I+ E+ G+ RFIQVS L AS  SPS+   +KA  E  VL
Sbjct  143  ERIAKIAAEN-GVSRFIQVSHLNASENSPSKFYASKAEGEARVL  185



>ref|XP_003126608.2| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Sus scrofa]
Length=377

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ M++N +D+ S++ VV  +NVVINL+GRE+ET+N+ FE+V   +   +A +SKE 
Sbjct  100  LGQIIFMEWNGKDKDSIRKVVEHSNVVINLVGREWETKNFDFEDVFVKIPHAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ + I +S L A   SPSR  R+KA  E  V
Sbjct  159  AGVEKLIHISHLNADIKSPSRYLRSKAVGEKEV  191



>ref|XP_002712902.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Oryctolagus cuniculus]
Length=377

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDIMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ +++N RD+ S++  V  +NVVINL+GRE+ETRN+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWNGRDKDSIRRAVQHSNVVINLVGREWETRNFDFEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A   S SR  R KA  E AV
Sbjct  159  AGVEKFIHVSHLNADIKSSSRYLRNKAVGEKAV  191



>ref|XP_001420142.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98435.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=366

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = +1

Query  253  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  432
            GTGGRSS SGI  TVFG+TGFLGRY+V  +AK GS++++P R SE+  +HLK+MGDLGQI
Sbjct  22   GTGGRSSFSGITCTVFGSTGFLGRYVVHHVAKSGSRMILPTRCSENDRQHLKVMGDLGQI  81

Query  433  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  612
            V + Y  RDE +++  V ++NVVIN++GRE+ETRN+SFE+VN    ++LA I  +  G+ 
Sbjct  82   VQLDYGIRDEETIRYAVERSNVVINMVGREWETRNFSFEDVNVTFPKKLAEICAD-VGVR  140

Query  613  RFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            R + VS LGA    PS   R+KA  E AV
Sbjct  141  RLVHVSALGAEEDHPSAYYRSKAAGEAAV  169



>gb|ESA03096.1| hypothetical protein GLOINDRAFT_336975 [Rhizophagus irregularis 
DAOM 181602]
Length=384

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 118/168 (70%), Gaps = 3/168 (2%)
 Frame = +1

Query  199  RYASTLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPF  375
            R+A  L   K  G  +++ G GGRSSVSG +ATVFG+TGFLGRYLV +LAK G+QV++P+
Sbjct  28   RFAHDLVVRKTTGKPIIKYGPGGRSSVSGHIATVFGSTGFLGRYLVSKLAKHGTQVVLPY  87

Query  376  RGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEV  555
            R  ED  RHLK+ GDLGQ+V ++++ R+E ++   V  +++V NLIGR+YET+N+++E+V
Sbjct  88   R-DEDAKRHLKVTGDLGQVVFLEFDLRNEQNIIEAVRHSDIVYNLIGRDYETKNFTYEKV  146

Query  556  NHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            +   AE++A + K+   + R + VS L A   SPSR  R KA  E AV
Sbjct  147  HIEGAERIAKLCKKF-DVSRLVHVSALNADINSPSRFLRTKALGEKAV  193



>gb|KIO18953.1| hypothetical protein M407DRAFT_153532 [Tulasnella calospora MUT 
4182]
Length=374

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 109/165 (66%), Gaps = 2/165 (1%)
 Frame = +1

Query  205  ASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  384
            A  LT       ++  G  GRSSVSG VATVFG TGFLGRYLV +LAK G+QV+VPFR  
Sbjct  19   AQQLTVPPRSNPVISYGPAGRSSVSGHVATVFGCTGFLGRYLVSKLAKAGTQVIVPFR-D  77

Query  385  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  564
            ED  RHLK+MGDLGQ++P+ ++ RD  ++   V  ++VV NL GREYET+N++FE+VN  
Sbjct  78   EDEKRHLKVMGDLGQVIPLMWDMRDPDTIAECVRHSDVVYNLAGREYETKNFTFEDVNVT  137

Query  565  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             A+ +A +S  +  +  FI VS L A+  SPSR    KA  E  V
Sbjct  138  GAQLIAEVSMAN-SVSNFIHVSHLNANANSPSRFYATKAAGEEVV  181



>gb|EXX58721.1| hypothetical protein RirG_195270 [Rhizophagus irregularis DAOM 
197198w]
Length=386

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 118/168 (70%), Gaps = 3/168 (2%)
 Frame = +1

Query  199  RYASTLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPF  375
            R+A  L   K  G  +++ G GGRSSVSG +ATVFG+TGFLGRYLV +LAK G+QV++P+
Sbjct  30   RFAHDLVVRKTTGKPIIKYGPGGRSSVSGHIATVFGSTGFLGRYLVSKLAKHGTQVVLPY  89

Query  376  RGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEV  555
            R  ED  RHLK+ GDLGQ+V ++++ R+E ++   V  +++V NLIGR+YET+N+++E+V
Sbjct  90   R-DEDAKRHLKVTGDLGQVVFLEFDLRNEQNIIEAVRHSDIVYNLIGRDYETKNFTYEKV  148

Query  556  NHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            +   AE++A + K+   + R + VS L A   SPSR  R KA  E AV
Sbjct  149  HIEGAERIAKLCKKF-DVSRLVHVSALNADINSPSRFLRTKALGEKAV  195



>ref|XP_008574858.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Galeopterus variegatus]
Length=377

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++PFR       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPFRCERYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ +++N RD+ S++  V  +NVVINLIGRE+ETRN+ FE+V   + + +A +SKE 
Sbjct  100  LGQLIFLEWNGRDKDSIQRAVQHSNVVINLIGREWETRNFYFEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A   S SR  R KA  E  V
Sbjct  159  AGVEKFIHVSHLNADIKSSSRYLRNKAVGEKEV  191



>gb|KIJ17694.1| hypothetical protein PAXINDRAFT_167681 [Paxillus involutus ATCC 
200175]
Length=359

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 115/164 (70%), Gaps = 5/164 (3%)
 Frame = +1

Query  208  STLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  387
            +TL   K V   V +GT G S+VSG V TVFG TGFLGRYLV +LA+MG+QV+VP+R  E
Sbjct  26   ATLPGRKAV---VSQGTPGYSAVSGHVVTVFGCTGFLGRYLVSKLARMGTQVIVPYR-EE  81

Query  388  DCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYM  567
            D  RHLKLMGDLGQIVPM+++ R+E+ +   +  +++V NL+GR+YET+N+ + +V+   
Sbjct  82   DEKRHLKLMGDLGQIVPMEWDIRNENQIAECLRHSDIVYNLVGRDYETKNFKYADVHVTG  141

Query  568  AEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            AE++A ++ E  G+ RF+Q+S L ASP S S   R K   E  V
Sbjct  142  AERIAKLASE-TGVQRFVQLSHLNASPDSTSAFFRTKFEGEERV  184



>gb|KIK91888.1| hypothetical protein PAXRUDRAFT_830459 [Paxillus rubicundulus 
Ve08.2h10]
Length=359

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 114/164 (70%), Gaps = 5/164 (3%)
 Frame = +1

Query  208  STLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  387
            +TL   K V   V +GT G S+VSG V TVFG TGFLGRYLV +LA+MG+QV+VP+R  E
Sbjct  26   ATLPGRKAV---VSQGTPGYSAVSGHVVTVFGCTGFLGRYLVSKLARMGTQVIVPYR-EE  81

Query  388  DCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYM  567
            D  RHLKLMGDLGQIVPM+++ R+E  +   +  +++V NL+GR+YET+N+ + +V+   
Sbjct  82   DEKRHLKLMGDLGQIVPMEWDIRNEDQIAECLRHSDIVYNLVGRDYETKNFKYADVHVTG  141

Query  568  AEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            AE++A ++ E  G+ RF+Q+S L ASP S S   R K   E  V
Sbjct  142  AERIAKLASEL-GVQRFVQLSHLNASPDSTSEFYRTKFEGEERV  184



>ref|XP_007872120.1| hypothetical protein PNEG_00249 [Pneumocystis murina B123]
 gb|EMR11825.1| hypothetical protein PNEG_00249 [Pneumocystis murina B123]
Length=361

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 111/153 (73%), Gaps = 2/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L++KGT GRSS+SG +AT+FGATGFLGRYLV  LAK G+ +++P+R  +D  RHLK++GD
Sbjct  43   LIKKGTEGRSSISGHIATIFGATGFLGRYLVNNLAKQGTTIIIPWR-DQDSKRHLKVLGD  101

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQIV M+++ RDE S+K  V  +N+V NLIGR+YET+N+S+E+V+ + A ++A    E+
Sbjct  102  LGQIVMMEFDLRDEISIKESVRHSNIVYNLIGRDYETKNFSYEDVHIHGAAKIAKACVEY  161

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
              I R I +S L A+  SPS   + KA  E  V
Sbjct  162  -NIDRLIHISTLNANIKSPSNFYKTKALGEETV  193



>ref|XP_006987942.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Peromyscus maniculatus bairdii]
Length=377

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = +1

Query  253  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  432
            G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGDLGQI
Sbjct  44   GKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDVYDTMHLRPMGDLGQI  103

Query  433  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  612
            + ++++ RD+ S++  V  +NVVINLIGR++ETRN+ FE+V   + + +A +SKE  G+ 
Sbjct  104  IFLEWDARDKDSIRRAVQHSNVVINLIGRDWETRNFDFEDVFVKIPQVIAQLSKE-AGVE  162

Query  613  RFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            RFI VS L AS  S SR  R+KA  E  V
Sbjct  163  RFIHVSHLNASMKSSSRYLRSKAVGEKEV  191



>ref|XP_003390219.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Amphimedon queenslandica]
Length=367

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 113/169 (67%), Gaps = 2/169 (1%)
 Frame = +1

Query  196  PRYASTLTASK-GVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVP  372
            PR +  +  +K  +   V++GTGGRSS SG VATVFG TGF GRY+V +L ++GSQ++ P
Sbjct  15   PRTSCIIELTKKSISSDVKRGTGGRSSFSGTVATVFGCTGFCGRYIVNRLGQVGSQIVAP  74

Query  373  FRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEE  552
            +RG E  +RHL+ MGDLGQI+   +N RD  SV   +  +NVV+N IGR+YETRN+ F++
Sbjct  75   YRGDEHDYRHLRPMGDLGQILFRSFNLRDPESVTKTLEYSNVVVNAIGRDYETRNFKFDD  134

Query  553  VNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            V H    ++ A + +  G+ R I  S LGAS  SPS+  ++KA  E AV
Sbjct  135  V-HVQGSRVIAEAAKKAGVKRLIHFSALGASKDSPSKFLQSKAAGEEAV  182



>ref|XP_005334075.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Ictidomys tridecemlineatus]
Length=354

 Score =   149 bits (375),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDPYDVMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ +++N RD+ S++  V  +NVVINL+GR++ETRN+ FE+V   + + +A ISKE 
Sbjct  100  LGQIIFLEWNGRDKDSIRRAVEHSNVVINLVGRDWETRNFDFEDVFVKIPQTIAQISKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E  V
Sbjct  159  AGVEKFIHVSHLNANIRSSSRYLRNKAVGENEV  191



>ref|XP_003331391.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Puccinia 
graminis f. sp. tritici CRL 75-36-700-3]
 gb|EFP86972.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Puccinia 
graminis f. sp. tritici CRL 75-36-700-3]
Length=386

 Score =   149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 118/171 (69%), Gaps = 3/171 (2%)
 Frame = +1

Query  190  DTPRYASTLTASKGVGHLVRK-GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVL  366
            +T R+   L    G G +++  G  GR S +G+VATVFGATGFLGRYLV +LAK G+QV+
Sbjct  27   ETKRWRHDLIKQSGTGKVIQSSGPSGRHSNTGLVATVFGATGFLGRYLVHKLAKQGTQVI  86

Query  367  VPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSF  546
            VP+R  ED  RHL++MGDLGQIVP++++  +E  +   V  ++VV NL+GRE+ET+NYSF
Sbjct  87   VPYR-DEDSKRHLRVMGDLGQIVPLEFDLENEGFINECVRHSHVVYNLLGREHETKNYSF  145

Query  547  EEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            + +    A ++  I+KE+ G+ R I VS L AS  SPS++ +AKA  E  V
Sbjct  146  DRLFIEGASKITRIAKEN-GVGRLIHVSHLNASLDSPSKLYKAKAAGESVV  195



>ref|XP_011984769.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Ovis aries musimon]
Length=380

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRYLV  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYLVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ M +N RD+ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI +S L A   S S+  R KA  E  V
Sbjct  159  AGVEKFIHISHLNADIKSSSKYLRNKAVGEKEV  191



>ref|XP_004006995.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Ovis aries]
Length=380

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRYLV  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYLVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ M +N RD+ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI +S L A   S S+  R KA  E  V
Sbjct  159  AGVEKFIHISHLNADIKSSSKYLRNKAVGEKEV  191



>ref|XP_005681037.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Capra hircus]
Length=380

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRYLV  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYLVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ M +N RD+ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI +S L A   S S+  R KA  E  V
Sbjct  159  AGVEKFIHISHLNADIKSSSKYLRNKAVGEKEV  191



>ref|XP_010963120.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Camelus bactrianus]
Length=377

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = +1

Query  253  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  432
            G GGRSSVSGIVATVFGATG+LGRY+V  L +MGSQV+VP+R       HL+ MGDLGQI
Sbjct  44   GKGGRSSVSGIVATVFGATGYLGRYIVNHLGRMGSQVVVPYRCEPYDTMHLRPMGDLGQI  103

Query  433  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  612
            + ++++ RD+ S++  V  +NVVINL+GRE+ETRN+ FE+V   + + +A +SKE  G+ 
Sbjct  104  LFLEWDGRDKDSIRRAVEHSNVVINLVGREWETRNFDFEDVFVKIPQAIAQVSKE-AGVE  162

Query  613  RFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            R I VS L A   SPSR  R+KA  E  V
Sbjct  163  RLIHVSHLNADIKSPSRYLRSKAVGEKEV  191



>ref|XP_007469502.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Lipotes vexillifer]
Length=377

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ +++N RD+ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A   S S+  R KA  E  V
Sbjct  159  AGVEKFIHVSHLNADIKSSSKYLRNKAAGEKEV  191



>ref|XP_005365322.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Microtus ochrogaster]
Length=377

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 110/153 (72%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGQGGRSSVSGVVATVFGATGFLGRYVVNALGRMGSQVIIPYRCDIYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ETRN+ FE+V   + + +A +SKE 
Sbjct  100  LGQLIFLEWDARDKDSIRRAVQHSNVVINLIGRDWETRNFDFEDVFVKIPQTIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ RFI VS L A+  S SR  R+KA  E  V
Sbjct  159  AGVERFIHVSHLNANMKSSSRYLRSKAVGEKEV  191



>dbj|BAK63310.1| NADH dehydrogenase [Pan troglodytes]
Length=284

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 109/149 (73%), Gaps = 1/149 (1%)
 Frame = +1

Query  253  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  432
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGDLGQ+
Sbjct  4    GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCGKYDIMHLRPMGDLGQL  63

Query  433  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  612
            + ++++ RD+ S++ VV  +NVVINLIGR++ET+NY FE+V   + + +A +SKE  G+ 
Sbjct  64   LFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNYDFEDVFVKIPQAIAQLSKE-AGVE  122

Query  613  RFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            +FI VS L A+  S SR  R KA  E  V
Sbjct  123  KFIHVSHLNANIKSSSRYLRNKAVGEKVV  151



>gb|KDN41067.1| putative NADH2 dehydrogenase 40K chain [Tilletiaria anomala UBC 
951]
Length=398

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 113/174 (65%), Gaps = 5/174 (3%)
 Frame = +1

Query  187  IDTPRYASTLTASKGVGHLVRKGT---GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGS  357
            I   R+   LT  +  G  V +     GGR+SVSG VATVFG TGFLGRYLV +LA+ G+
Sbjct  37   IQQRRFGHDLTIKRKTGKPVIEAGPYGGGRNSVSGHVATVFGCTGFLGRYLVSRLAQKGT  96

Query  358  QVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRN  537
            QV+VPFR  ED  RHLK+MGDLGQ+VPM+++ RDE  ++  +  ++ V NL GR YET+N
Sbjct  97   QVIVPFR-DEDEKRHLKIMGDLGQVVPMEWDIRDEGMIEECLRHSDTVYNLTGRAYETKN  155

Query  538  YSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            +SF +VN   A ++A ++ E  G+ RFI VS L A   S S   R KA  E AV
Sbjct  156  FSFADVNRDGARRIAEVA-EASGVSRFIHVSHLNADANSESVFLRTKAEGEEAV  208



>ref|XP_006175621.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Camelus ferus]
 ref|XP_010981110.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Camelus dromedarius]
Length=363

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = +1

Query  253  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  432
            G GGRSSVSGIVATVFGATG+LGRY+V  L +MGSQV+VP+R       HL+ MGDLGQI
Sbjct  30   GKGGRSSVSGIVATVFGATGYLGRYVVNHLGRMGSQVVVPYRCEPYDTMHLRPMGDLGQI  89

Query  433  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  612
            + ++++ RD+ S++  V  +NVVINL+GRE+ETRN+ FE+V   + + +A +SKE  G+ 
Sbjct  90   LFLEWDGRDKDSIRRAVEHSNVVINLVGREWETRNFDFEDVFVKIPQAIAQVSKE-AGVE  148

Query  613  RFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            R I VS L A   SPSR  R+KA  E  V
Sbjct  149  RLIHVSHLNADIKSPSRYLRSKAVGEKEV  177



>ref|XP_005365321.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Microtus ochrogaster]
Length=377

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 110/153 (72%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGQGGRSSVSGVVATVFGATGFLGRYVVNALGRMGSQVIIPYRCDIYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ETRN+ FE+V   + + +A +SKE 
Sbjct  100  LGQLIFLEWDARDKDSIRRAVQHSNVVINLIGRDWETRNFDFEDVFVKIPQTIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ RFI VS L A+  S SR  R+KA  E  V
Sbjct  159  AGVERFIHVSHLNANMKSSSRYLRSKAVGEKEV  191



>gb|EAW88839.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, 
isoform CRA_c [Homo sapiens]
Length=254

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  19   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  78

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  79   LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-  137

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E  V
Sbjct  138  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVV  170



>gb|AAH91192.1| Ndufa9 protein, partial [Rattus norvegicus]
Length=370

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+LMGD
Sbjct  33   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDIYDTMHLRLMGD  92

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++  V  +NVVINLIGRE+ETRN+ FE+V   +   +A  SKE 
Sbjct  93   LGQLIFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFEDVFVNIPRAIAQASKE-  151

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ RFI VS L AS  S ++  R+KA  E  V
Sbjct  152  AGVERFIHVSHLNASMKSSAKSLRSKAVGEKEV  184



>ref|XP_003796469.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Otolemur garnettii]
Length=377

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDFMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ +++N RD+ S++  V  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQLIFLEWNGRDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E  V
Sbjct  159  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKEV  191



>ref|XP_006053611.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Bubalus bubalis]
Length=380

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ M +N RD+ S++  V  ++VVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI +S L A   S S+  R+KA  E  V
Sbjct  159  AGVEKFIHISHLNADIKSSSKYLRSKAVGEKEV  191



>ref|XP_011806948.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Colobus angolensis palliatus]
Length=377

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVVIPYRCDTYDIMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ETRN+ FE+V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRVVEHSNVVINLIGRDWETRNFDFEDVYVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E AV
Sbjct  159  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKAV  191



>ref|XP_009546417.1| hypothetical protein HETIRDRAFT_475334 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW81816.1| hypothetical protein HETIRDRAFT_475334 [Heterobasidion irregulare 
TC 32-1]
Length=347

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 108/149 (72%), Gaps = 2/149 (1%)
 Frame = +1

Query  253  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  432
            G  GRS+V+G VATVFG TGFLGRYLV +LAK G+QV++P+R  ED  RHLK+MGDLGQI
Sbjct  24   GPAGRSAVTGHVATVFGCTGFLGRYLVSKLAKTGTQVIIPYR-DEDEKRHLKVMGDLGQI  82

Query  433  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  612
            VPM+++ R+++  +  V  +++V NL+GREYET+N+S+ + N     ++A IS +  G+ 
Sbjct  83   VPMEWDLRNDNQTEECVRHSDIVYNLVGREYETKNFSYRDANALGPARIADISAK-SGVS  141

Query  613  RFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            RF+ VS L A+  SPS+  +AKA  E  V
Sbjct  142  RFVHVSHLNAAADSPSKFYQAKAEGEALV  170



>ref|NP_001094222.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Rattus norvegicus]
 sp|Q5BK63.2|NDUA9_RAT RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; AltName: Full=Sperm flagella protein 3; Flags: 
Precursor [Rattus norvegicus]
 gb|EDM01826.1| rCG30092 [Rattus norvegicus]
 gb|AAI68777.1| Ndufa9 protein [Rattus norvegicus]
Length=377

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+LMGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDIYDTMHLRLMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++  V  +NVVINLIGRE+ETRN+ FE+V   +   +A  SKE 
Sbjct  100  LGQLIFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFEDVFVNIPRAIAQASKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ RFI VS L AS  S ++  R+KA  E  V
Sbjct  159  AGVERFIHVSHLNASMKSSAKSLRSKAVGEKEV  191



>ref|XP_010843290.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Bison bison bison]
Length=376

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP R       HL+ MGD
Sbjct  36   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGD  95

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ M +N RD+ S++  V  ++VVINL+GRE+ETRN+ FE+V   + + +A +SKE 
Sbjct  96   LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETRNFDFEDVFVKIPQAIAQVSKE-  154

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI +S L A   S S+  R+KA  E  V
Sbjct  155  AGVEKFIHISHLNADIKSSSKYLRSKAVGEKEV  187



>ref|XP_011851665.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Mandrillus leucophaeus]
Length=377

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L ++GSQV++P+R       HL+LMGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRIGSQVIIPYRCDIYDTMHLRLMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVYVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E AV
Sbjct  159  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKAV  191



>ref|XP_006237562.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Rattus norvegicus]
Length=373

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+LMGD
Sbjct  36   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDIYDTMHLRLMGD  95

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++  V  +NVVINLIGRE+ETRN+ FE+V   +   +A  SKE 
Sbjct  96   LGQLIFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFEDVFVNIPRAIAQASKE-  154

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ RFI VS L AS  S ++  R+KA  E  V
Sbjct  155  AGVERFIHVSHLNASMKSSAKSLRSKAVGEKEV  187



>ref|XP_003988339.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Felis catus]
Length=377

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSG+VATVFGATGFLGRY+V +L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNRLGRMGSQVIIPYRCEAYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ +++N +D+ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWNGKDKDSIRRAVKHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A   S SR  R KA  E  V
Sbjct  159  AGVEKFIHVSHLNADIKSSSRYLRNKAVGEKEV  191



>ref|NP_001127602.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial precursor [Pongo abelii]
 sp|P0CB81.1|NDUA9_PONAB RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Pongo abelii]
 sp|P0CB82.1|NDUA9_PONPY RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Pongo pygmaeus]
 emb|CAH92896.1| hypothetical protein [Pongo abelii]
Length=377

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 110/153 (72%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDIMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ETRN+ FE+V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETRNFDFEDVFVKIPQAIAQLSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E  V
Sbjct  159  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVV  191



>ref|XP_010357461.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Rhinopithecus roxellana]
Length=377

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 110/153 (72%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDIMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVYVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E AV
Sbjct  159  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKAV  191



>gb|ABH12231.1| mitochondrial complex I subunit NDUFA9 [Pongo pygmaeus]
Length=381

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 110/153 (72%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  44   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDIMHLRPMGD  103

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ETRN+ FE+V   + + +A +SKE 
Sbjct  104  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETRNFDFEDVFVKIPQAIAQLSKE-  162

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E  V
Sbjct  163  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVV  195



>ref|NP_001073383.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial precursor [Pan troglodytes]
 ref|XP_008972004.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Pan paniscus]
 sp|Q0MQB4.1|NDUA9_PANTR RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Pan troglodytes]
 gb|ABH12229.1| mitochondrial complex I subunit NDUFA9 [Pan troglodytes]
Length=377

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  40   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ET+NY FE+V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNYDFEDVFVKIPQAIAQLSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E  V
Sbjct  159  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVV  191



>ref|XP_007170262.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Balaenoptera acutorostrata scammoni]
Length=377

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ M+++ RD+ S++  V  +NVV+NL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFMEWSGRDKDSIRRAVEHSNVVVNLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ + I VS L A   SPS+  R KA  E  V
Sbjct  159  AGVEKLIHVSHLNADIKSPSKYLRNKAAGEKEV  191



>emb|CCF54116.1| probable NADH2 dehydrogenase (ubiquinone) 40K chain [Ustilago 
hordei]
Length=392

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 117/167 (70%), Gaps = 5/167 (3%)
 Frame = +1

Query  214  LTASKGVGH-LVRKGT--GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  384
            LT ++  G  +++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV++P+R  
Sbjct  40   LTINRKTGKPIIKSGPYGGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIIPYR-D  98

Query  385  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  564
            ED  RHLK+MGDLGQ+VPM+++ R++  ++  V  ++VV NL GR YET+N++F +V+  
Sbjct  99   EDEKRHLKVMGDLGQVVPMEWDLRNDEQIEECVRHSDVVYNLTGRHYETKNFTFNDVHAT  158

Query  565  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLR  705
             A+++A I+ E  G+ RFI VS L A   SPS   R+KA  E AV R
Sbjct  159  GAQRIAQIA-EAAGVGRFIHVSHLNADANSPSAFLRSKAEGEAAVKR  204



>ref|XP_002504449.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65707.1| predicted protein [Micromonas sp. RCC299]
Length=390

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 113/150 (75%), Gaps = 1/150 (1%)
 Frame = +1

Query  250  KGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQ  429
            +GTGGRSS+SGI +TVFG++GFLGRY+V  + K GS++++P R +E+  +HLK+MGDLGQ
Sbjct  48   RGTGGRSSISGITSTVFGSSGFLGRYVVNHIGKSGSKMILPNRCNENARQHLKVMGDLGQ  107

Query  430  IVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGI  609
            IV + ++ RD  ++K  V ++NVV+N++GRE+ETRN+SFE+V+     +LA I KE  G+
Sbjct  108  IVHLDFSIRDADAIKYAVERSNVVVNMVGREWETRNFSFEDVHVEFPAKLAEICKE-VGV  166

Query  610  MRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             R + VS LGAS T+PS+  + KA  + AV
Sbjct  167  ERLVHVSALGASHTNPSKYYQTKAAGDDAV  196



>emb|CBQ67793.1| probable NADH2 dehydrogenase (ubiquinone) 40K chain [Sporisorium 
reilianum SRZ2]
Length=392

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 115/172 (67%), Gaps = 5/172 (3%)
 Frame = +1

Query  199  RYASTLTASKGVGHLVRKG---TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  369
            R    LT ++  G  + K     GGRSSVSG V TVFG TGFLGRYLV +LA+ G+QV++
Sbjct  35   RNVHDLTINRKTGKPIIKSGPYAGGRSSVSGHVVTVFGCTGFLGRYLVNRLAQKGTQVII  94

Query  370  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFE  549
            P+R  ED  RHLK+MGDLGQIVPM+++ R +  ++  V  ++VV NL+GR YET+N++F 
Sbjct  95   PYR-DEDEKRHLKVMGDLGQIVPMEWDLRHDEQIEECVRHSDVVYNLVGRHYETKNFTFN  153

Query  550  EVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLR  705
            +V+   A+++A I+ E  G+ RFI VS L A   SPS   R+KA  E  V R
Sbjct  154  DVHVTGAQRIAQIA-ESAGVGRFIHVSHLNADANSPSAFLRSKAEGEAVVKR  204



>ref|NP_001013477.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Danio rerio]
 gb|AAH91545.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 [Danio 
rerio]
 gb|AAI64086.1| Ndufa9 protein [Danio rerio]
Length=309

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 113/156 (72%), Gaps = 1/156 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            +V +G GGRSS+SG+ ATVFGATGFLGRY+V +L +MGSQV++P+R  +    +L+ MGD
Sbjct  42   VVPRGKGGRSSISGLAATVFGATGFLGRYVVNRLGRMGSQVVIPYRCDQYDLMYLRPMGD  101

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ M+++PR++ S++  ++ +NVVINL+GRE+ET NY +E+V   +  Q+A  ++E 
Sbjct  102  LGQIIFMEWDPRNKESIQRAISHSNVVINLVGREWETSNYKYEDVFVSIPLQIARATRE-  160

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
             GI +FI +S L A   SPS+  R KA  E AV  E
Sbjct  161  AGIKKFIHMSHLNADIRSPSKYLRNKAVGEEAVRNE  196



>sp|Q0MQB3.2|NDUA9_GORGO RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Gorilla gorilla gorilla]
Length=377

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E  V
Sbjct  159  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVV  191



>gb|AAH03351.1| Similar to NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 
9 (39kD), partial [Homo sapiens]
Length=338

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  1    LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  60

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  61   LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-  119

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E  V
Sbjct  120  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVV  152



>ref|NP_001266630.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Gorilla gorilla]
 gb|ABH12230.1| mitochondrial complex I subunit NDUFA9 [Gorilla gorilla]
Length=381

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  44   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  103

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  104  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-  162

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E  V
Sbjct  163  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVV  195



>ref|XP_005957904.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Pantholops hodgsonii]
Length=380

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ M +N RD+ S++  V  ++VVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQVIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI +S L A   S S+  R KA  E  V
Sbjct  159  AGVEKFIHISHLNADIKSSSKYLRNKAVGEKEV  191



>ref|XP_004279068.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Orcinus orca]
Length=377

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L   G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LTPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ +++N RD+ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWNGRDKDSIRRAVEHSNVVINLVGREWETKNFGFEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A   S S+  R KA  E  V
Sbjct  159  AGVEKFIHVSHLNADIKSSSKYLRNKAAGEKEV  191



>ref|XP_007902354.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Callorhinchus milii]
Length=370

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 109/156 (70%), Gaps = 1/156 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++ +G GGRSS SGIVATVFGATGFLGRY+V +L ++GSQ+++P+R       HLK MGD
Sbjct  32   IIPRGKGGRSSFSGIVATVFGATGFLGRYVVNRLGRIGSQIVIPYRCDPYDTMHLKPMGD  91

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI  + ++ RD+ S++  V  +NVVINL+GRE+ET NY FE+VN  +  Q+A  ++E 
Sbjct  92   LGQITLLHWDARDKDSIRRAVENSNVVINLVGREWETWNYKFEDVNINIPRQIALAARE-  150

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
             G+ +FI +S L A+  S S++ R KA  E  V  E
Sbjct  151  AGVEKFIHISHLNANIKSISKLLRTKAVGEQVVREE  186



>gb|ABF57357.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Bos taurus]
Length=369

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP R       HL+ MGD
Sbjct  29   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGD  88

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ M +N RD+ S++  V  ++VVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  89   LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQVSKE-  147

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI +S L A   S S+  R+KA  E  V
Sbjct  148  AGVEKFIHISHLNADIKSSSKYLRSKAVGEKEV  180



>ref|NP_001279619.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Callorhinchus milii]
 gb|AFK11425.1| Ndufa9 protein [Callorhinchus milii]
Length=380

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 109/156 (70%), Gaps = 1/156 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++ +G GGRSS SGIVATVFGATGFLGRY+V +L ++GSQ+++P+R       HLK MGD
Sbjct  42   IIPRGKGGRSSFSGIVATVFGATGFLGRYVVNRLGRIGSQIVIPYRCDPYDTMHLKPMGD  101

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI  + ++ RD+ S++  V  +NVVINL+GRE+ET NY FE+VN  +  Q+A  ++E 
Sbjct  102  LGQITLLHWDARDKDSIRRAVENSNVVINLVGREWETWNYKFEDVNINIPRQIALAARE-  160

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
             G+ +FI +S L A+  S S++ R KA  E  V  E
Sbjct  161  AGVEKFIHISHLNANIKSISKLLRTKAVGEQVVREE  196



>ref|XP_534915.3| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform 1 [Canis lupus familiaris]
Length=377

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDPYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ ++++ R++ S++  V  +NVVINLIGRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWDGRNKDSIQRAVKHSNVVINLIGREWETKNFDFEDVFVKIPQAIAKVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A   S SR  R KA  E  V
Sbjct  159  AGVEKFIHVSHLNADIKSSSRYLRNKAVGEKEV  191



>gb|EST09999.1| NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Pseudozyma 
brasiliensis GHG001]
Length=392

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 118/172 (69%), Gaps = 5/172 (3%)
 Frame = +1

Query  199  RYASTLTASKGVGH-LVRKGT--GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  369
            R    LT ++  G  +++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV+V
Sbjct  35   RSVHDLTINRKTGKPIIKSGPYGGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIV  94

Query  370  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFE  549
            P+R  ED  RHLK+MGDLGQ+VPM+++ R +  ++  V  ++VV NL GR YET+N++F 
Sbjct  95   PYR-DEDEKRHLKVMGDLGQVVPMEWDLRHDEQIEECVRHSDVVYNLTGRHYETKNFTFN  153

Query  550  EVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLR  705
            +V+   A+++A I+ E  G+ RFI VS L A+  SPS   R+KA  E AV R
Sbjct  154  DVHVTGAQRIAQIA-EAAGVGRFIHVSHLNAAADSPSAFLRSKAEGEAAVKR  204



>ref|NP_991386.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial precursor [Bos taurus]
 sp|P34943.1|NDUA9_BOVIN RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Bos taurus]
 emb|CAA42053.1| NADH dehydrogenase (ubiquinone) 42 kDa subunit [Bos taurus]
 gb|AAI02360.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Bos taurus]
 tpg|DAA29189.1| TPA: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 
9, mitochondrial precursor [Bos taurus]
Length=380

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ M +N RD+ S++  V  ++VVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI +S L A   S S+  R+KA  E  V
Sbjct  159  AGVEKFIHISHLNADIKSSSKYLRSKAVGEKEV  191



>dbj|GAK62286.1| NAD(P)-binding protein [Pseudozyma antarctica]
Length=386

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 115/172 (67%), Gaps = 5/172 (3%)
 Frame = +1

Query  199  RYASTLTASKGVGHLVRKG---TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  369
            R    LT ++  G  + K     GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV++
Sbjct  29   RAIHDLTINRKTGKPIIKSGPYAGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVII  88

Query  370  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFE  549
            P+R  ED  RHLK+MGDLGQIVPM+++ R++  ++  V  ++VV NL GR YET+N+SF 
Sbjct  89   PYR-DEDEKRHLKVMGDLGQIVPMEWDLRNDEQIEECVRHSDVVYNLTGRHYETKNFSFN  147

Query  550  EVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLR  705
            +V+   A+++A I+ E  G+ R I VS L A   SPS   R+KA  E AV R
Sbjct  148  DVHVAGAQRIAQIA-ESAGVGRLIHVSHLNADADSPSSFLRSKAEGEAAVKR  198



>dbj|GAC73597.1| NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Pseudozyma 
antarctica T-34]
Length=385

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 114/167 (68%), Gaps = 5/167 (3%)
 Frame = +1

Query  214  LTASKGVGHLVRKG---TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  384
            LT ++  G  + K     GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV++P+R  
Sbjct  33   LTINRKTGKPIIKSGPYAGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIIPYR-D  91

Query  385  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  564
            ED  RHLK+MGDLGQIVPM+++ R++  ++  V  ++VV NL GR YET+N+SF +V+  
Sbjct  92   EDEKRHLKVMGDLGQIVPMEWDLRNDEQIEECVRHSDVVYNLTGRHYETKNFSFNDVHVA  151

Query  565  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLR  705
             A+++A I+ E  G+ R I VS L A   SPS   R+KA  E AV R
Sbjct  152  GAQRIAQIA-ESAGVGRLIHVSHLNADADSPSSFLRSKAEGEAAVKR  197



>gb|ETS63618.1| hypothetical protein PaG_01917 [Pseudozyma aphidis DSM 70725]
Length=385

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 114/167 (68%), Gaps = 5/167 (3%)
 Frame = +1

Query  214  LTASKGVGHLVRKG---TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  384
            LT ++  G  + K     GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV++P+R  
Sbjct  33   LTINRKTGKPIIKSGPYAGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIIPYR-D  91

Query  385  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  564
            ED  RHLK+MGDLGQIVPM+++ R++  ++  V  ++VV NL GR YET+N+SF +V+  
Sbjct  92   EDEKRHLKVMGDLGQIVPMEWDLRNDEQIEECVRHSDVVYNLTGRHYETKNFSFNDVHVA  151

Query  565  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLR  705
             A+++A I+ E  G+ R I VS L A   SPS   R+KA  E AV R
Sbjct  152  GAQRIAQIA-ESAGVGRLIHVSHLNADADSPSSFLRSKAEGEAAVKR  197



>gb|AIC62000.1| NDUFA9, partial [synthetic construct]
Length=377

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  40   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E  V
Sbjct  159  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVV  191



>gb|AAA36350.1| NADH dehydrogenase (ubiquinone), partial [Homo sapiens]
Length=375

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  38   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  97

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  98   LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-  156

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E  V
Sbjct  157  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVV  189



>ref|NP_004993.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial precursor [Homo sapiens]
 sp|Q16795.2|NDUA9_HUMAN RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Homo sapiens]
 gb|AAD42055.1|AF050641_1 NADH-ubiquinone oxidoreductase 39kDa subunit [Homo sapiens]
 gb|AAH09311.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Homo sapiens]
 gb|AAH15837.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Homo sapiens]
 gb|AAI11547.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Homo sapiens]
 gb|EAW88837.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, 
isoform CRA_a [Homo sapiens]
 gb|ADQ31784.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[synthetic construct]
 gb|AIC49261.1| NDUFA9, partial [synthetic construct]
Length=377

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  40   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E  V
Sbjct  159  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVV  191



>ref|XP_007935381.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Orycteropus afer afer]
Length=377

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDPYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ +++N RD+ S++  V  +NVVINL+GRE+ET+N+ FE++   + + +A +SKE 
Sbjct  100  LGQIIFLEWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDFEDIFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ + I VS L A+  S SR  R KA  E  V
Sbjct  159  AGVEKLIHVSHLNANIKSSSRYLRNKAVGEKEV  191



>gb|AAI53423.1| Ndufa9 protein [Danio rerio]
Length=380

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 113/156 (72%), Gaps = 1/156 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            +V +G GGRSS+SG+ ATVFGATGFLGRY+V +L +MGSQV++P+R  +    +L+ MGD
Sbjct  42   IVPRGKGGRSSISGLAATVFGATGFLGRYVVNRLGRMGSQVVIPYRCDQYDLMYLRPMGD  101

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ M+++PR++ S++  ++ +NVVINL+GRE+ET NY +E+V   +  Q+A  ++E 
Sbjct  102  LGQIIFMEWDPRNKESIQRAISHSNVVINLVGREWETSNYKYEDVFVSIPLQIARATRE-  160

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
             GI +FI +S L A   SPS+  R KA  E AV  E
Sbjct  161  AGIKKFIHMSHLNADIRSPSKYLRNKAVGEEAVRNE  196



>ref|XP_007503809.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Monodelphis domestica]
Length=345

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       +L+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDFTYLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ +++N +D+SS++  +  +NVVINL+GR++ETRN+ F +V   + E +A ++KE 
Sbjct  100  LGQIIFLEWNSKDKSSIQRALEHSNVVINLVGRDWETRNFDFTDVFADIPESIAQLAKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+  FI VS L A   S S+  R KA  E AV
Sbjct  159  AGVETFIHVSHLNADIKSTSKYLRNKAVGEKAV  191



>ref|XP_007089756.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Panthera tigris altaica]
Length=462

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSG+VATVFGATGFLGRY+V +L +MGSQV++P+R       HL+ MGD
Sbjct  125  LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNRLGRMGSQVIIPYRCEAYDTMHLRPMGD  184

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ +++N +D+ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  185  LGQIIFLEWNGKDKDSIRRAVKHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  243

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A   S SR  R KA  E  V
Sbjct  244  AGVEKFIHVSHLNADIKSSSRYLRNKAVGEKEV  276



>ref|XP_004778323.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Mustela putorius furo]
 ref|XP_004823819.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Mustela putorius furo]
Length=377

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDPYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ ++++ R+  S+   V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWDGRNRDSIHRAVKHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A   S SR  R KA  E  V
Sbjct  159  AGVEKFIHVSHLNADIKSSSRYLRNKAVGEKEV  191



>ref|XP_008823675.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nannospalax galili]
Length=377

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 109/154 (71%), Gaps = 1/154 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ ++++ RD +S++  V  +NVVINL+GRE+ETRN+ FE V   + + +A +SKE 
Sbjct  100  LGQIIFLEWDARDRASIRRAVEYSNVVINLVGREWETRNFDFENVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVL  702
             G+ R I VS L A+  S S+  R+KA  E  V+
Sbjct  159  AGVERLIHVSHLNANIRSSSKYLRSKAVGEKEVM  192



>gb|AAH68378.1| Ndufa9 protein, partial [Danio rerio]
Length=374

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 113/156 (72%), Gaps = 1/156 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            +V +G GGRSS+SG+ ATVFGATGFLGRY+V +L +MGSQV++P+R  +    +L+ MGD
Sbjct  36   VVPRGKGGRSSISGLAATVFGATGFLGRYVVNRLGRMGSQVVIPYRCDQYDLMYLRPMGD  95

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ M+++PR++ S++  ++ +NVVINL+GRE+ET NY +E+V   +  Q+A  ++E 
Sbjct  96   LGQIIFMEWDPRNKESIQRAISHSNVVINLVGREWETSNYKYEDVFVSIPLQIARATRE-  154

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
             GI +FI +S L A   SPS+  R KA  E AV  E
Sbjct  155  AGIKKFIHMSHLNADIRSPSKYLRNKAVGEEAVRNE  190



>ref|XP_005174380.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Danio rerio]
Length=380

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 113/156 (72%), Gaps = 1/156 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            +V +G GGRSS+SG+ ATVFGATGFLGRY+V +L +MGSQV++P+R  +    +L+ MGD
Sbjct  42   VVPRGKGGRSSISGLAATVFGATGFLGRYVVNRLGRMGSQVVIPYRCDQYDLMYLRPMGD  101

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ M+++PR++ S++  ++ +NVVINL+GRE+ET NY +E+V   +  Q+A  ++E 
Sbjct  102  LGQIIFMEWDPRNKESIQRAISHSNVVINLVGREWETSNYKYEDVFVSIPLQIARATRE-  160

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
             GI +FI +S L A   SPS+  R KA  E AV  E
Sbjct  161  AGIKKFIHMSHLNADIRSPSKYLRNKAVGEEAVRNE  196



>emb|CDI51333.1| probable NADH2 dehydrogenase (ubiquinone) 40K chain [Melanopsichium 
pennsylvanicum 4]
Length=388

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 117/172 (68%), Gaps = 5/172 (3%)
 Frame = +1

Query  199  RYASTLTASKGVGH-LVRKGT--GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  369
            R    LT ++  G  +++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV+V
Sbjct  31   RNIHDLTINRKTGKPIIKSGPYGGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIV  90

Query  370  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFE  549
            P+R  ED  RHLK+MGDLGQ+VPM+++ R +  ++  V  ++VV NL GR YET+N++F 
Sbjct  91   PYR-DEDEKRHLKVMGDLGQVVPMEWDLRHDEQIEECVRHSDVVYNLTGRHYETKNFTFN  149

Query  550  EVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLR  705
            +V+   A+++A I+ E  G+ RFI VS L A   SPS   R+KA  E AV R
Sbjct  150  DVHVTGAQRIAQIA-EAAGVGRFIHVSHLNADADSPSAFLRSKAEGEAAVKR  200



>gb|EFB28697.1| hypothetical protein PANDA_009221, partial [Ailuropoda melanoleuca]
Length=360

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  23   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDPYDTMHLRPMGD  82

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ ++++ R++ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  83   LGQIIFLEWDGRNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  141

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A   S SR  R KA  E  V
Sbjct  142  AGVEKFIHVSHLNADIKSSSRYLRNKAVGEKEV  174



>ref|XP_001494651.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Equus caballus]
Length=377

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVMVPYRCDTYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ +++N R++ S++  V  +NVVINL+GRE+ET+N+ FE+V   +   +A +SKE 
Sbjct  100  LGQIIFLEWNGRNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPLAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A   S SR  R KA  E  V
Sbjct  159  AGVEKFIHVSHLNADIKSSSRYLRNKAVGEKEV  191



>ref|XP_005084120.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Mesocricetus auratus]
Length=377

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDPYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ ++++ RD+ S+K  V  +NVVINL+GR++ETRN+ FE+V   +   +A  SKE 
Sbjct  100  LGQIIFLEWDARDKDSIKRAVQHSNVVINLVGRDWETRNFDFEDVFVKIPHAIAQASKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ R I VS L AS  S SR  R+KA  E  V
Sbjct  159  AGVERLIHVSHLNASIKSSSRYLRSKAVGEKEV  191



>gb|EAW88838.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, 
isoform CRA_b [Homo sapiens]
Length=399

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  62   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  121

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  122  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-  180

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E  V
Sbjct  181  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVV  213



>ref|XP_008528773.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Equus przewalskii]
Length=377

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDTYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ +++N R++ S++  V  +NVVINL+GRE+ET+N+ FE+V   +   +A +SKE 
Sbjct  100  LGQIIFLEWNGRNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPLAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A   S SR  R KA  E  V
Sbjct  159  AGVEKFIHVSHLNADIKSSSRYLRNKAVGEKEV  191



>ref|XP_004381326.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Trichechus manatus latirostris]
Length=359

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 106/149 (71%), Gaps = 1/149 (1%)
 Frame = +1

Query  253  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  432
            G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       +L+ MGDLGQI
Sbjct  44   GKGGRSSVSGVVATVFGATGFLGRYIVNHLGRMGSQVIIPYRCDAYELMYLRPMGDLGQI  103

Query  433  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  612
            + +++N RD+ S++  V  +NVVINL+GRE+ETRN+ +++V   + + +A +SKE  G+ 
Sbjct  104  IFLEWNGRDKDSIRRAVEHSNVVINLVGREWETRNFDYDDVFVKIPQAIAQVSKE-AGVE  162

Query  613  RFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            R I VS L A   SPSR  R KA  E  V
Sbjct  163  RLIHVSHLNADIKSPSRYLRNKAVGEKEV  191



>gb|KDQ20806.1| hypothetical protein BOTBODRAFT_26820 [Botryobasidium botryosum 
FD-172 SS1]
Length=366

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 111/163 (68%), Gaps = 4/163 (2%)
 Frame = +1

Query  211  TLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  390
            T+  SK V   +  G  GRS+VSG VATVFGATGFLGRYL+ +LAK G+QV+VPFR  ED
Sbjct  25   TVLPSKPV---ISYGPAGRSAVSGHVATVFGATGFLGRYLIAKLAKGGTQVIVPFR-EED  80

Query  391  CHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMA  570
              RHL++ GDLGQIVP++++ R+E  ++  V  +++V NL+GR+YET+N+ ++ V+   A
Sbjct  81   EARHLRVTGDLGQIVPLEWDLRNEEQIRECVRHSDIVYNLVGRDYETKNFDYQSVHVKGA  140

Query  571  EQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            E +A I  E   + RF+ VS L AS  SPS   R KA  E  V
Sbjct  141  ELIAQICAESPSVSRFVHVSHLNASVDSPSAFYRTKALGEEKV  183



>gb|AAI52140.1| Ndufa9 protein [Danio rerio]
Length=380

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 113/156 (72%), Gaps = 1/156 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            +V +G GGRSS+SG+ ATVFGATGFLGRY+V +L +MGSQV++P+R  +    +L+ MGD
Sbjct  42   VVPRGKGGRSSISGLAATVFGATGFLGRYVVNRLGRMGSQVVIPYRCDQYDLMYLRPMGD  101

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ M+++PR++ S++  ++ +NVVINL+GRE+ET NY +E+V   +  Q+A  ++E 
Sbjct  102  LGQIIFMEWDPRNKESIQRAISHSNVVINLVGREWETSNYKYEDVFVSIPLQIARPTRE-  160

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
             GI +FI +S L A   SPS+  R KA  E AV  E
Sbjct  161  AGIKKFIHMSHLNADIRSPSKYLRNKAVGEEAVRNE  196



>ref|XP_009989270.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial, partial [Tauraco erythrolophus]
Length=360

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = +1

Query  208  STLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  384
            S L   + V H ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  
Sbjct  11   SVLHQHRQVHHAVIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCD  70

Query  385  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  564
            +    +L+ MGDLGQ+V ++++ +D+ S++  V  +NVVINL+G+E+ET+N+SFE+V   
Sbjct  71   QYDLMYLRPMGDLGQLVFLEWDCKDKDSIRRAVEHSNVVINLVGKEWETKNFSFEDVFVN  130

Query  565  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            + +++A I++E  G+  FI +S L AS  SPS+  R+KA  E AV  E
Sbjct  131  IPKRIAQITRE-AGVETFIHISHLNASMKSPSKYLRSKAVGEKAVREE  177



>ref|XP_006795902.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Neolamprologus brichardi]
Length=303

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 110/156 (71%), Gaps = 1/156 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  43   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  102

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ ++++ R++ S+K  +  +NVVINL+GRE+ETRN+ FE+V   + +Q+A  ++E 
Sbjct  103  LGQILFLQWDARNKDSIKRAMEHSNVVINLVGREWETRNFRFEDVYVTIPQQIARAARE-  161

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
             GI +F+ +S L A   SPS+  R KA  E AV  E
Sbjct  162  AGITKFVHMSHLNADIRSPSKYLRNKAVGENAVREE  197



>ref|XP_002736180.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Saccoglossus kowalevskii]
Length=253

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFG-ATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMG  417
            +V +G GGRSS SG++ATVFG +TGF+GRY++ +L + GSQ++VP+R   D  RHLK+MG
Sbjct  47   MVPRGRGGRSSFSGVIATVFGGSTGFVGRYVINRLGREGSQIIVPYRCDPDDIRHLKVMG  106

Query  418  DLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKE  597
            DLGQI+P+ ++   + S++ ++  +NVVINL+G++YETRNY FE+++  +A ++A+I+ E
Sbjct  107  DLGQIIPLTFDVNSDDSLREMMQHSNVVINLMGKDYETRNYRFEDIHIDIAGRVASIASE  166

Query  598  HGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
               I R I +S LG+   SPS+  R KA  E  V  E
Sbjct  167  L-KIPRLIHLSALGSDWKSPSKFLRTKAAGETIVKNE  202



>ref|XP_009178281.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Papio anubis]
Length=375

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 110/153 (72%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L ++GSQV++P+R       HL+ MGD
Sbjct  38   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRIGSQVIIPYRCDIYDTMHLRPMGD  97

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  98   LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVYVKIPQAIAQVSKE-  156

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E AV
Sbjct  157  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKAV  189



>ref|XP_009178280.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Papio anubis]
Length=377

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 110/153 (72%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L ++GSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRIGSQVIIPYRCDIYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVYVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E AV
Sbjct  159  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKAV  191



>gb|KFV03415.1| hypothetical protein N340_03010, partial [Tauraco erythrolophus]
Length=361

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = +1

Query  208  STLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  384
            S L   + V H ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  
Sbjct  12   SVLHQHRQVHHAVIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCD  71

Query  385  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  564
            +    +L+ MGDLGQ+V ++++ +D+ S++  V  +NVVINL+G+E+ET+N+SFE+V   
Sbjct  72   QYDLMYLRPMGDLGQLVFLEWDCKDKDSIRRAVEHSNVVINLVGKEWETKNFSFEDVFVN  131

Query  565  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            + +++A I++E  G+  FI +S L AS  SPS+  R+KA  E AV  E
Sbjct  132  IPKRIAQITRE-AGVETFIHISHLNASMKSPSKYLRSKAVGEKAVREE  178



>ref|XP_003496081.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Cricetulus griseus]
 ref|XP_007637435.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Cricetulus griseus]
 gb|EGV98504.1| hypothetical protein I79_001369 [Cricetulus griseus]
Length=377

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 1/155 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ETRN+ FE++   + + +A  SKE 
Sbjct  100  LGQLIFLEWDARDKDSIRRAVQHSNVVINLIGRDWETRNFDFEDIFVKIPQAIAQASKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLR  705
             G+ R I VS L AS  S SR  R KA  E  V R
Sbjct  159  AGVERLIHVSHLNASMKSSSRYLRNKAVGEKEVRR  193



>ref|XP_001372251.2| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Monodelphis domestica]
Length=377

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       +L+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDFTYLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ +++N +D+SS++  +  +NVVINL+GR++ETRN+ F +V   + E +A ++KE 
Sbjct  100  LGQIIFLEWNSKDKSSIQRALEHSNVVINLVGRDWETRNFDFTDVFADIPESIAQLAKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+  FI VS L A   S S+  R KA  E AV
Sbjct  159  AGVETFIHVSHLNADIKSTSKYLRNKAVGEKAV  191



>ref|XP_006210904.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Vicugna pacos]
Length=376

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 106/145 (73%), Gaps = 1/145 (1%)
 Frame = +1

Query  253  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  432
            G GGRSSVSGIVATVFGATG+LGRY+V  L +MGSQV+VP+R       HL+ MGDLGQI
Sbjct  44   GKGGRSSVSGIVATVFGATGYLGRYVVNHLGRMGSQVVVPYRCEPYDTMHLRPMGDLGQI  103

Query  433  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  612
            + ++++ RD+ S++  V  +NVVINL+GRE+ETRN+ FE+V   + + +A +SKE  G+ 
Sbjct  104  LFLEWDGRDKDSIRRAVEHSNVVINLVGREWETRNFDFEDVFVKIPQAIAQVSKE-AGVE  162

Query  613  RFIQVSCLGASPTSPSRMRRAKATA  687
            R I VS L A   SPSR  R+K ++
Sbjct  163  RLIHVSHLNADIKSPSRYLRSKVSS  187



>ref|XP_002920485.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Ailuropoda melanoleuca]
Length=377

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDPYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ ++++ R++ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWDGRNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A   S SR  R KA  E  V
Sbjct  159  AGVEKFIHVSHLNADIKSSSRYLRNKAVGEKEV  191



>ref|XP_008141973.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Eptesicus fuscus]
Length=377

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G  GRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R     + HL+ MGD
Sbjct  40   LIPHGRSGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDYMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ +++N R++ S++  V  +NVVINL+GR++ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWNVRNKDSIRRAVEHSNVVINLVGRDWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             GI +FI +S L A   S SR  R KA  E  V
Sbjct  159  AGIEKFIHISHLNADIKSTSRYLRNKAVGEKEV  191



>ref|XP_002188497.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Taeniopygia guttata]
Length=373

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 118/168 (70%), Gaps = 2/168 (1%)
 Frame = +1

Query  208  STLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  384
            S+L   + V H ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  
Sbjct  25   SSLQQHRQVHHAVIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCD  84

Query  385  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  564
            +    +L+ MGDLGQ++ ++++ RD+ S++  V  +NVVINLIG+E+ET+N+ FE+    
Sbjct  85   QYDLMYLRPMGDLGQLLFLEWDCRDKDSIRRAVEHSNVVINLIGKEWETKNFKFEDEFVN  144

Query  565  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            + + +A ISKE  G+ +FI VS L AS  SPS+  R KA  E AV  E
Sbjct  145  IPQSIARISKE-AGVEKFIHVSHLNASMKSPSKYLRNKAVGEEAVREE  191



>ref|XP_007882091.1| hypothetical protein PFL1_06359 [Pseudozyma flocculosa PF-1]
 gb|EPQ26151.1| hypothetical protein PFL1_06359 [Pseudozyma flocculosa PF-1]
Length=390

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 117/172 (68%), Gaps = 5/172 (3%)
 Frame = +1

Query  199  RYASTLTASKGVGH-LVRKGT--GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  369
            R    LT  +  G  ++R+G   GGRSSVSG VATVFG TGFLGRYLV +L++ G+QV+V
Sbjct  33   RSVHDLTIKRKTGKPIIRQGPYGGGRSSVSGHVATVFGCTGFLGRYLVNRLSQKGTQVIV  92

Query  370  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFE  549
            P+R  ED  RHLK+MGDLGQ+VP++++ R++  ++  +  ++ V NL GR+YET+N+SF 
Sbjct  93   PYR-DEDEKRHLKVMGDLGQVVPLEWDIRNDQQIQECIRHSDTVYNLTGRQYETKNFSFS  151

Query  550  EVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLR  705
            +V+   A ++A ++ E  G  RFI VS L A   SPS   R+KA  E AV R
Sbjct  152  DVHVTGARRIAEMA-EALGASRFIHVSHLNADKDSPSAYLRSKAEGEEAVKR  202



>ref|XP_002920484.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Ailuropoda melanoleuca]
Length=401

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  64   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDPYDTMHLRPMGD  123

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ ++++ R++ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  124  LGQIIFLEWDGRNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  182

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A   S SR  R KA  E  V
Sbjct  183  AGVEKFIHVSHLNADIKSSSRYLRNKAVGEKEV  215



>ref|XP_006862735.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Chrysochloris asiatica]
Length=377

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LMPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDTYDLMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ +++N RD+ S++  V  +NVVINL+GRE+ET+N+ +E+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDYEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ + I VS L A+  S SR  R KA  E  V
Sbjct  159  AGVEKLIHVSHLNANMKSSSRYLRNKAVGEKEV  191



>ref|XP_008274666.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Stegastes partitus]
Length=381

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 109/156 (70%), Gaps = 1/156 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++ KG GGRSS SG  ATVFGATGFLGRY+V +L +MGSQV+VP R       +++ MGD
Sbjct  43   IIPKGKGGRSSFSGFSATVFGATGFLGRYVVNRLGRMGSQVIVPHRCDRYDLMYMRPMGD  102

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ M+++ RD+ S+K  +A +NVVINL+GRE+ETRNY FE+V   + +Q+A  ++E 
Sbjct  103  LGQIIFMEWDARDKDSIKQAMASSNVVINLVGREWETRNYRFEDVFVSIPQQIAKAARE-  161

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
             GI + I +S L A   SPS+  R KA  E AV  E
Sbjct  162  AGITKLIHMSHLNADIRSPSKYLRNKAVGETAVRDE  197



>ref|XP_003447104.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Oreochromis niloticus]
Length=381

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 110/156 (71%), Gaps = 1/156 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  43   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  102

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ ++++ R++ S+K  +  ++VVINL+GRE+ETRN+ FE+V   + +Q+A  ++E 
Sbjct  103  LGQIIFLEWDARNKDSIKRAMEHSDVVINLVGREWETRNFRFEDVFVTIPQQIARAARE-  161

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
             GI +F+ +S L A   SPS+  R KA  E AV  E
Sbjct  162  AGITKFVHMSHLNADIRSPSKYLRNKAVGETAVREE  197



>ref|XP_003771339.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Sarcophilus harrisii]
Length=377

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       +L+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDFTYLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ +++N +D+SS++  +  +NVVINL+GR++ET+N+ F +V   + E +A ++K +
Sbjct  100  LGQIIFLEWNAKDKSSIQRALEHSNVVINLVGRDWETKNFDFSDVFAVIPETIAQLAK-N  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+  FI VS L A   S SR  R KA  + AV
Sbjct  159  AGVETFIHVSHLNADIKSTSRYLRNKAVGDKAV  191



>ref|XP_005950396.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X2 [Haplochromis burtoni]
Length=381

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 110/156 (71%), Gaps = 1/156 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  43   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  102

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ ++++ R++ S+K  +  +NVVINL+GRE+ETRN+ FE+V   + +Q+A  ++E 
Sbjct  103  LGQILFLEWDARNKDSIKQAMENSNVVINLVGREWETRNFRFEDVYVTIPQQIARAARE-  161

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
             GI +F+ +S L A   SPS+  R KA  E AV  E
Sbjct  162  AGITKFVHMSHLNADIRSPSKYLRNKAVGETAVREE  197



>ref|XP_005734821.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X2 [Pundamilia nyererei]
Length=381

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 110/156 (71%), Gaps = 1/156 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  43   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  102

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ ++++ R++ S+K  +  +NVVINL+GRE+ETRN+ FE+V   + +Q+A  ++E 
Sbjct  103  LGQILFLEWDARNKDSIKQAMENSNVVINLVGREWETRNFRFEDVYVTIPQQIARAARE-  161

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
             GI +F+ +S L A   SPS+  R KA  E AV  E
Sbjct  162  AGITKFVHMSHLNADIRSPSKYLRNKAVGETAVREE  197



>ref|XP_005950395.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X1 [Haplochromis burtoni]
Length=382

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 110/156 (71%), Gaps = 1/156 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  44   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  103

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ ++++ R++ S+K  +  +NVVINL+GRE+ETRN+ FE+V   + +Q+A  ++E 
Sbjct  104  LGQILFLEWDARNKDSIKQAMENSNVVINLVGREWETRNFRFEDVYVTIPQQIARAARE-  162

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
             GI +F+ +S L A   SPS+  R KA  E AV  E
Sbjct  163  AGITKFVHMSHLNADIRSPSKYLRNKAVGETAVREE  198



>ref|XP_003059930.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55882.1| predicted protein [Micromonas pusilla CCMP1545]
Length=353

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 111/151 (74%), Gaps = 2/151 (1%)
 Frame = +1

Query  250  KGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQ  429
            +GTGGRSS+SGI +TVFGATG+LGRY+V  L K GS++++P R  ++  +HLK+MGDLGQ
Sbjct  13   RGTGGRSSISGITSTVFGATGYLGRYVVNHLGKSGSRMILPTRCGDNAKQHLKVMGDLGQ  72

Query  430  IVPMK-YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGG  606
            IV +     RD+S++K  V ++NVV+NL+GRE+ETRN+SF++V+    E+LA I KE  G
Sbjct  73   IVDLAGLKIRDDSAIKYAVERSNVVVNLLGREWETRNFSFDDVHRDFPERLARICKEL-G  131

Query  607  IMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            + R + VS LGA+   PS+  R KA  + AV
Sbjct  132  VERLVHVSALGATLDHPSKYYRTKAEGDEAV  162



>gb|ELR54825.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial, partial [Bos mutus]
Length=363

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP R       HL+ MGD
Sbjct  23   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGD  82

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ M +N RD+ S++  V  ++VVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  83   LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQVSKE-  141

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ + I +S L A   S S+  R+KA  E  V
Sbjct  142  AGVEKLIHISHLNADIKSSSKYLRSKAVGEKEV  174



>ref|XP_005734820.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X1 [Pundamilia nyererei]
Length=382

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 110/156 (71%), Gaps = 1/156 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  44   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  103

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ ++++ R++ S+K  +  +NVVINL+GRE+ETRN+ FE+V   + +Q+A  ++E 
Sbjct  104  LGQILFLEWDARNKDSIKQAMENSNVVINLVGREWETRNFRFEDVYVTIPQQIARAARE-  162

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
             GI +F+ +S L A   SPS+  R KA  E AV  E
Sbjct  163  AGITKFVHMSHLNADIRSPSKYLRNKAVGETAVREE  198



>gb|KIJ64483.1| hypothetical protein HYDPIDRAFT_28424 [Hydnomerulius pinastri 
MD-312]
Length=359

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 110/162 (68%), Gaps = 2/162 (1%)
 Frame = +1

Query  214  LTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDC  393
            L    G   ++ +GT G S+VSG V TVFG TGFLGRYLV +LA+MG+QV+VP+R  ED 
Sbjct  25   LVTLPGRKPIISQGTPGYSAVSGHVVTVFGCTGFLGRYLVSKLARMGTQVIVPYR-EEDE  83

Query  394  HRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAE  573
             RHLK MGDLGQIVPM+++ R+E  +   +  +++V NL+GR+YET+N+   +V+   AE
Sbjct  84   KRHLKPMGDLGQIVPMEWDIRNEEQIAECLRHSDIVYNLVGRDYETKNFKSADVHVAGAE  143

Query  574  QLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            ++A ++ E  G+ RF+ +S L ASP S S   R KA  E  V
Sbjct  144  RVAKVAAE-SGVQRFVHLSHLNASPDSRSMFYRTKAEGEERV  184



>ref|XP_010148325.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial, partial [Eurypyga helias]
Length=224

 Score =   140 bits (354),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 118/168 (70%), Gaps = 2/168 (1%)
 Frame = +1

Query  208  STLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  384
            S L   + V H ++  G   RSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  
Sbjct  11   SVLHQHRQVHHAVIPHGKSRRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCD  70

Query  385  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  564
            +    +L+ MGDLGQ++ ++++ +D+ S++  V  +NVVINL+G+E+ET+N+SFE+V   
Sbjct  71   QYDLMYLRPMGDLGQLLFLEWDCKDKDSIRRAVEHSNVVINLVGKEWETKNFSFEDVFVN  130

Query  565  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            + + +A I++E  G+  FI VS L AS  SPS+  R+KA  E AV  E
Sbjct  131  IPKSIAQITRE-AGVETFIHVSHLNASMKSPSKYLRSKAVGEKAVREE  177



>ref|XP_005533361.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Pseudopodoces humilis]
Length=376

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 124/186 (67%), Gaps = 12/186 (6%)
 Frame = +1

Query  184  GIDTPRY---ASTLTAS-------KGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYL  330
            G+  PR    AS LTA+       + V H ++  G  GRSSVSGIVATVFGATGFLGRY+
Sbjct  10   GLRLPRAGHGASVLTAAPLVLQQHRQVHHAVIPHGRSGRSSVSGIVATVFGATGFLGRYV  69

Query  331  VQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINL  510
            V +L ++GSQV++P+R  +    +L+ MGDLGQ++ M+++ RD+ S++  V  +NVVINL
Sbjct  70   VNRLGRIGSQVIIPYRCDQYDLMYLRPMGDLGQLLFMEWDCRDKDSIRRAVEHSNVVINL  129

Query  511  IGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAE  690
            IG+E+ET+N+ FE+    + + +A ISKE  G+ +FI +S L AS  SPS+  R KA  E
Sbjct  130  IGKEWETKNFKFEDEFVNIPQNIAHISKE-AGVEKFIHISHLNASMKSPSKYLRVKAVGE  188

Query  691  XAVLRE  708
              V  E
Sbjct  189  EVVREE  194



>dbj|BAF83756.1| unnamed protein product [Homo sapiens]
Length=377

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 110/153 (72%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  40   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ET+N+ FE V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEGVFVKIPQAIAQLSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E  V
Sbjct  159  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVV  191



>gb|KIK69637.1| hypothetical protein GYMLUDRAFT_992204 [Gymnopus luxurians FD-317 
M1]
Length=369

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 119/186 (64%), Gaps = 2/186 (1%)
 Frame = +1

Query  142  VSAFKSFDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLG  321
            +SA  SF  L     ++  R    LT       +V +G  G S+VSG V TVFG TGFLG
Sbjct  1    MSASSSFLRLQRAANLNGKRAYHDLTTLPSKKPIVAQGPPGYSAVSGHVVTVFGCTGFLG  60

Query  322  RYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvv  501
            RYLV +LA+MG+QV+VP+R  ED  RHLK MGDLGQIVPM+++ R+E+ +   V  +++V
Sbjct  61   RYLVSKLARMGTQVIVPYR-DEDEKRHLKPMGDLGQIVPMEWDLRNENQIAECVRHSDIV  119

Query  502  INLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKA  681
             NL+GR+Y T+++ F  V    AE++A I+ +  G+ R + VS L AS TSPS++ + KA
Sbjct  120  FNLVGRDYATKSFDFASVQVDGAERIAQIAAQ-SGVPRLVHVSHLNASATSPSKLYQTKA  178

Query  682  TAEXAV  699
              E  V
Sbjct  179  EGEARV  184



>ref|XP_011386267.1| putative NADH2 dehydrogenase (ubiquinone) 40K chain [Ustilago 
maydis 521]
 gb|KIS71955.1| putative NADH2 dehydrogenase (ubiquinone) 40K chain [Ustilago 
maydis 521]
Length=392

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 116/172 (67%), Gaps = 5/172 (3%)
 Frame = +1

Query  199  RYASTLTASKGVGH-LVRKGT--GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  369
            R    LT ++  G  +++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV+V
Sbjct  35   RNVHDLTINRKTGKPIIKSGPYGGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIV  94

Query  370  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFE  549
            P+R  ED  RHLK+MGDLGQ+VPM+++ R +  ++  V  ++VV NL GR YET+N++F 
Sbjct  95   PYR-DEDEKRHLKVMGDLGQVVPMEWDLRHDEQIEECVRHSDVVYNLTGRHYETKNFTFN  153

Query  550  EVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLR  705
            +V+   A+++A I+ E  G+ RFI VS L A   SPS   R+KA  E  V R
Sbjct  154  DVHVTGAQRIAQIA-EASGVGRFIHVSHLNADANSPSAFLRSKAEGEAVVKR  204



>ref|XP_007527887.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Erinaceus europaeus]
Length=377

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 1/149 (1%)
 Frame = +1

Query  253  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  432
            G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGDLGQI
Sbjct  44   GKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDLMHLRPMGDLGQI  103

Query  433  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  612
            + +++N R++ S++  V  +NVVINLIG+++ETRN+ FE++   +   +A +SKE  G+ 
Sbjct  104  IFLEWNGRNKDSIRRTVEHSNVVINLIGKDWETRNFDFEDIYVKIPHAIAQVSKE-AGVK  162

Query  613  RFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            + I +S L A   SPS+  R+KA  E  V
Sbjct  163  KLIHISHLNADLKSPSKYLRSKAVGEKEV  191



>gb|KFV92623.1| hypothetical protein N326_00630, partial [Eurypyga helias]
Length=226

 Score =   140 bits (353),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 118/168 (70%), Gaps = 2/168 (1%)
 Frame = +1

Query  208  STLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  384
            S L   + V H ++  G   RSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  
Sbjct  12   SVLHQHRQVHHAVIPHGKSRRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCD  71

Query  385  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  564
            +    +L+ MGDLGQ++ ++++ +D+ S++  V  +NVVINL+G+E+ET+N+SFE+V   
Sbjct  72   QYDLMYLRPMGDLGQLLFLEWDCKDKDSIRRAVEHSNVVINLVGKEWETKNFSFEDVFVN  131

Query  565  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            + + +A I++E  G+  FI VS L AS  SPS+  R+KA  E AV  E
Sbjct  132  IPKSIAQITRE-AGVETFIHVSHLNASMKSPSKYLRSKAVGEKAVREE  178



>ref|XP_005569923.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Macaca fascicularis]
Length=304

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L ++GSQV++P R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRIGSQVIIPHRCDIYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ET+N+ F++V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFDDVYVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E AV
Sbjct  159  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKAV  191



>gb|KIM65954.1| hypothetical protein SCLCIDRAFT_1211966 [Scleroderma citrinum 
Foug A]
Length=356

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 112/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  208  STLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  387
            STL   K V   +  G  G S+VSG VATVFG TGFLGRYLV +LA+MG+QV+VP+R  E
Sbjct  23   STLPGRKPV---ISHGPPGYSAVSGHVATVFGCTGFLGRYLVSKLARMGTQVIVPYR-EE  78

Query  388  DCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYM  567
            D  RHLK MGDLGQIV M+++ R+E  +   +  +++V NL+GR+YET+N+ F +V+   
Sbjct  79   DEKRHLKPMGDLGQIVSMEWDIRNEDQIAECLRHSDIVYNLVGRDYETKNFKFADVHVAG  138

Query  568  AEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            AE++A ++ +  G+ R + VS L AS TSPS+  R KA  E  V
Sbjct  139  AERIAKVAAQ-VGVQRMVHVSHLNASATSPSQFYRTKAEGEERV  181



>ref|XP_006633741.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Lepisosteus oculatus]
Length=380

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 121/168 (72%), Gaps = 3/168 (2%)
 Frame = +1

Query  208  STLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  384
            S +   + + H ++ +G GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  
Sbjct  30   SIVVQQRKIHHAVIPRGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRVGSQIVIPHRCD  89

Query  385  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  564
            +    +L+ MGDLGQI+ ++++ RD+ S++  +A +NVVINL+GRE+ETR++SFE+V+  
Sbjct  90   QYDIMYLRPMGDLGQIIFLEWDARDKESIRRALAHSNVVINLVGREWETRHFSFEDVHVN  149

Query  565  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            + +Q+A  ++E  GI +FI +S L A   SPSR  R KA  E AV+RE
Sbjct  150  IPKQIAKAARE-AGIEKFIHMSHLNADIRSPSRYLRTKAVGE-AVVRE  195



>ref|XP_005897993.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Bos mutus]
Length=380

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ M +N RD+ S++  V  ++VVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ + I +S L A   S S+  R+KA  E  V
Sbjct  159  AGVEKLIHISHLNADIKSSSKYLRSKAVGEKEV  191



>ref|XP_004459092.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Dasypus novemcinctus]
Length=384

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDLMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ +++N R++ S++  V  +NVVINL+GR++ET+N+S+E+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWNARNKDSIRRAVEHSNVVINLVGRDWETKNFSYEDVFVKIPQGIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             GI +FI VS L A   S SR  R KA  E  V
Sbjct  159  VGIEKFIHVSHLNADIKSSSRYLRNKAVGEKEV  191



>ref|XP_006754928.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Myotis davidii]
Length=377

 Score =   144 bits (362),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G  GRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R     + HL+ MGD
Sbjct  40   LIPHGRSGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDYMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ +++N R++ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWNARNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ + I +S L A   S SR  R KA  E  V
Sbjct  159  AGVEKLIHISHLNADIKSTSRYLRNKAVGEKEV  191



>gb|KFV11223.1| hypothetical protein N339_08758, partial [Pterocles gutturalis]
Length=251

 Score =   140 bits (354),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 118/168 (70%), Gaps = 2/168 (1%)
 Frame = +1

Query  208  STLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  384
            S L   + V H ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  
Sbjct  12   SILQQHRQVHHAVIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCD  71

Query  385  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  564
            +    +L+ MGDLGQ++ ++++ +D+ S++  V  +NVVINL+G+E+ET+N+SFE+V   
Sbjct  72   QYDLMYLRPMGDLGQLLFLEWDCKDKDSIRRAVEHSNVVINLVGKEWETKNFSFEDVFVN  131

Query  565  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            + + +A I++E  G+   I +S L AS  SPS+  R+KA  E AV  E
Sbjct  132  IPKSIAQITRE-AGVETLIHISHLNASMKSPSKYLRSKAVGEKAVREE  178



>ref|XP_004692611.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Condylura cristata]
Length=569

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 111/161 (69%), Gaps = 2/161 (1%)
 Frame = +1

Query  220  ASKGVGHLVRK-GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCH  396
            A + + H V   G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R      
Sbjct  32   AQRQIHHAVMPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCEPYDV  91

Query  397  RHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQ  576
             HL+ MGDLGQI+ ++++ R++ S++  V  +NVVINL+GRE+ETRN+ FE+V   + + 
Sbjct  92   MHLRPMGDLGQIIFLEWDARNKDSIRRAVEHSNVVINLVGREWETRNFDFEDVYVKIPQA  151

Query  577  LAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            +A +SKE  GI +FI VS L A   S SR  R KA  E  V
Sbjct  152  IAQVSKE-AGIEKFIHVSHLNADIKSSSRYLRNKAVGEKEV  191



>ref|XP_009092324.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Serinus canaria]
Length=373

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 117/168 (70%), Gaps = 2/168 (1%)
 Frame = +1

Query  208  STLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  384
            S L   + V H ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  
Sbjct  25   SVLQQHRQVHHAVIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVVIPYRCD  84

Query  385  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  564
            +    +L+ MGDLGQ++ ++++ RD+ S++  V  +NVVINLIG+E+ET+N+ FE+    
Sbjct  85   QYDLMYLRPMGDLGQLLFLEWDCRDKDSIRRAVEHSNVVINLIGKEWETKNFRFEDEFVN  144

Query  565  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            + + +A ISKE  G+ +FI +S L AS  SPS+  R KA  E AV  E
Sbjct  145  IPQSIAQISKE-AGVEKFIHISHLNASMKSPSKYLRNKAVGEEAVREE  191



>ref|XP_011909624.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Cercocebus atys]
Length=377

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L ++GSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRIGSQVIIPYRCDIYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVYVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R  A  E AV
Sbjct  159  AGVEKFIHVSHLNANIKSSSRYLRNNAVGEKAV  191



>ref|XP_005426929.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Geospiza fortis]
Length=454

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 117/168 (70%), Gaps = 2/168 (1%)
 Frame = +1

Query  208  STLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  384
            S L   + V H ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  
Sbjct  106  SVLQQHRLVHHAVIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCD  165

Query  385  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  564
            +    +L+ MGDLGQ++ M+++ RD+ S++  V  +NVVINLIG+E+ET+N+ FE+    
Sbjct  166  QYDLMYLRPMGDLGQLLFMEWDCRDKDSIRRAVEHSNVVINLIGKEWETKNFKFEDEFVN  225

Query  565  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            + + +A ISKE  G+ +FI +S L AS  SPS+  R KA  E AV  E
Sbjct  226  IPQSIAQISKE-AGVEKFIHISHLNASMKSPSKYLRNKAVGEEAVREE  272



>ref|XP_007353556.1| NAD(P)-binding protein [Auricularia delicata TFB-10046 SS5]
 gb|EJD38366.1| NAD(P)-binding protein [Auricularia delicata TFB-10046 SS5]
Length=390

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 108/149 (72%), Gaps = 2/149 (1%)
 Frame = +1

Query  253  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  432
            G  GRS+V+G +ATVFG TGFLGRYLV +LAK G+QV+VP+R  ED  RHL++MGDLGQ+
Sbjct  34   GPPGRSAVTGQIATVFGCTGFLGRYLVAKLAKAGTQVVVPYR-DEDKKRHLRVMGDLGQV  92

Query  433  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  612
            VP++++ R+E+ ++  V  +++V NL+GR+YET+N+ +  VN   A+++A +S    G+ 
Sbjct  93   VPLEFDARNEAQIEECVRHSHIVYNLVGRDYETKNFDYNAVNVAAAQRIAEVSA-RVGVP  151

Query  613  RFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            RF+ VS L A+  SPS   R KA  E AV
Sbjct  152  RFVHVSHLNANFDSPSEFYRTKALGEEAV  180



>ref|XP_006739694.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Leptonychotes weddellii]
Length=377

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDPYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ ++++ R++ S++  V  +NVVINL+GRE+ET+N+ FE++   +   +A +SKE 
Sbjct  100  LGQIIFLEWDGRNKDSIRRAVKHSNVVINLVGREWETKNFDFEDIFVKIPRAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ + I VS L A   S SR  R KA  E  V
Sbjct  159  AGVEKLIHVSHLNADIKSSSRYLRNKAVGEKEV  191



>ref|XP_002108719.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV29517.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=358

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 107/157 (68%), Gaps = 1/157 (1%)
 Frame = +1

Query  238  HLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMG  417
             LV+ G GGRSS SGI+ATVFG TGF GRY++ +L ++G+Q++VP+R  E   RH++LMG
Sbjct  35   QLVKSGRGGRSSYSGILATVFGGTGFTGRYVINRLGRVGTQIMVPYRCDEHDIRHIRLMG  94

Query  418  DLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKE  597
            DLGQI+   ++ RD  +V  +V  +NVVINLIG+++ETRNY++E+ N   A  +A   ++
Sbjct  95   DLGQIMFRPFSLRDTDAVSELVKHSNVVINLIGQDWETRNYTYEDANVEGARAIARACRD  154

Query  598  HGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            H G+ R I VS L     S S   R+KA  E AVL E
Sbjct  155  H-GVERLIHVSALNVDKNSKSHWLRSKAAGEEAVLEE  190



>gb|KDQ62587.1| hypothetical protein JAAARDRAFT_30488 [Jaapia argillacea MUCL 
33604]
Length=373

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 108/153 (71%), Gaps = 2/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G  GRS+++G VATVFG TGFLGRYLV +LAK G+QV+VP+R S+D  RHLK MGD
Sbjct  36   IISYGPPGRSALTGHVATVFGCTGFLGRYLVSKLAKAGTQVIVPYRESDDA-RHLKPMGD  94

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ+VPM+++ R+E  +   +  +++V NL+GR+YET+NYSF +VN   A ++A ++ + 
Sbjct  95   LGQVVPMEWDIRNEDQIAECLRHSDIVYNLVGRDYETKNYSFGDVNAAGAGRIAKVAAQ-  153

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
              I RF+ VS L AS  S S+  R KA  E  V
Sbjct  154  CNIPRFVHVSHLNASHESTSKFYRTKAEGEDLV  186



>ref|XP_005492469.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Zonotrichia albicollis]
Length=373

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 115/165 (70%), Gaps = 2/165 (1%)
 Frame = +1

Query  208  STLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  384
            S L   + V H ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  
Sbjct  25   SALQQHRQVHHAVIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCD  84

Query  385  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  564
            +    +L+ MGDLGQ++ M+++ RD+ S++  V  +NVVINLIG+E+ET+N+ FE+    
Sbjct  85   QYDLMYLRPMGDLGQLLFMEWDCRDKESIRRAVEHSNVVINLIGKEWETKNFKFEDEFVN  144

Query  565  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            + + +A ISKE  G+ +FI +S L AS  SPS+  R KA  E  V
Sbjct  145  IPQSIAQISKE-AGVEKFIHISHLNASMKSPSKYLRNKAVGEKTV  188



>dbj|GAC95510.1| hypothetical protein PHSY_003086 [Pseudozyma hubeiensis SY62]
Length=392

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 106/149 (71%), Gaps = 2/149 (1%)
 Frame = +1

Query  259  GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVP  438
            GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV++P+R  ED  RHLK+MGDLGQ+VP
Sbjct  58   GGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIIPYR-DEDEKRHLKVMGDLGQVVP  116

Query  439  MKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRF  618
            M+++ R +  ++  +  ++VV NL GR YET+N++F +V+   A+++A I+ E  G+ RF
Sbjct  117  MEWDLRHDEQIEECLRHSDVVYNLTGRHYETKNFTFNDVHVAGAQRIAQIA-EAAGVGRF  175

Query  619  IQVSCLGASPTSPSRMRRAKATAEXAVLR  705
            I VS L A   SPS   R+KA  E  V R
Sbjct  176  IHVSHLNADAESPSAFLRSKAEGEAVVKR  204



>ref|XP_003410681.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Loxodonta africana]
Length=380

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 109/155 (70%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  HLVRK-GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLM  414
            H++R  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       +L+ M
Sbjct  41   HVLRPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDLMYLRPM  100

Query  415  GDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISK  594
            GDLGQI+ +++N RD+ S++  V  +NVVINL+G+++ETRN+ FE+V   + + +A +SK
Sbjct  101  GDLGQIIFLEWNGRDKDSIRRAVEHSNVVINLVGQDWETRNFDFEDVFVKIPQAIAQVSK  160

Query  595  EHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            E  G+ R I VS L A   S SR  R KA  E  V
Sbjct  161  E-AGVERLIHVSHLNADIKSSSRYLRNKAVGEKEV  194



>ref|XP_001515711.2| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial, partial [Ornithorhynchus anatinus]
Length=405

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = +1

Query  253  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  432
            G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGDLGQ+
Sbjct  72   GQGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVVIPYRCEPYDIMHLRPMGDLGQL  131

Query  433  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  612
            + M++N RD+ S++  +A +NVVINLIGR++ET+N+ F++V   + + +A ++KE  G+ 
Sbjct  132  LFMEWNARDKESIRRALAHSNVVINLIGRDWETKNFDFDDVFVKIPQSIAQLAKE-AGVE  190

Query  613  RFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            +FI VS L A   S SR  R KA  E  V+RE
Sbjct  191  KFIHVSHLNADMKSSSRYLRNKAVGEK-VVRE  221



>ref|XP_008703115.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Ursus maritimus]
Length=410

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQ++VP+R       HL+ MGD
Sbjct  73   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQMIVPYRCDPYDTMHLRPMGD  132

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ ++++ R++ S++  V  +NVVINL+GRE+ET+N+ FE++   + + +A +SKE 
Sbjct  133  LGQIIFLEWDGRNKDSIRRAVKHSNVVINLVGREWETKNFDFEDIFVKIPQAIAQVSKE-  191

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A   S SR  R KA  E  V
Sbjct  192  AGVEKFIHVSHLNADIKSSSRYLRNKAVGEKEV  224



>gb|EHH20407.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Macaca mulatta]
 gb|EHH66007.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Macaca fascicularis]
Length=377

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L ++GSQV++P R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRIGSQVIIPHRCDIYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ET+N+ F++V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFDDVYVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E AV
Sbjct  159  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKAV  191



>ref|XP_010076803.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial, partial [Pterocles gutturalis]
Length=270

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 118/168 (70%), Gaps = 2/168 (1%)
 Frame = +1

Query  208  STLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  384
            S L   + V H ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  
Sbjct  31   SILQQHRQVHHAVIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCD  90

Query  385  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  564
            +    +L+ MGDLGQ++ ++++ +D+ S++  V  +NVVINL+G+E+ET+N+SFE+V   
Sbjct  91   QYDLMYLRPMGDLGQLLFLEWDCKDKDSIRRAVEHSNVVINLVGKEWETKNFSFEDVFVN  150

Query  565  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            + + +A I++E  G+   I +S L AS  SPS+  R+KA  E AV  E
Sbjct  151  IPKSIAQITRE-AGVETLIHISHLNASMKSPSKYLRSKAVGEKAVREE  197



>ref|XP_007965492.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Chlorocebus sabaeus]
Length=377

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       +L+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDIYDTMYLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVYVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R K   E AV
Sbjct  159  AGVEKFIHVSHLNANIKSSSRYLRNKDVGEKAV  191



>ref|XP_005569922.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Macaca fascicularis]
Length=377

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L ++GSQV++P R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRIGSQVIIPHRCDIYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ET+N+ F++V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFDDVYVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E AV
Sbjct  159  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKAV  191



>ref|XP_005877078.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Myotis brandtii]
 ref|XP_006096122.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Myotis lucifugus]
 gb|EPQ14420.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Myotis brandtii]
Length=377

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G  GRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R     + HL+ MGD
Sbjct  40   LIPHGRSGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDYMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ +++N R++ S++  V  +NVVINL+GR++ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWNARNKDSIRRAVEHSNVVINLVGRDWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ + I +S L A   S SR  R KA  E  V
Sbjct  159  AGVEKLIHISHLNADIKSTSRYLRNKAVGEKEV  191



>ref|XP_006957558.1| NAD(P)-binding protein [Wallemia sebi CBS 633.66]
 gb|EIM22301.1| NAD(P)-binding protein [Wallemia sebi CBS 633.66]
Length=378

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 111/167 (66%), Gaps = 2/167 (1%)
 Frame = +1

Query  199  RYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFR  378
            +Y       K    ++R G GGRSS +G VATVFG TGFLGRYLVQ++A+ G+QV+VP+R
Sbjct  23   QYHDLNITPKSKSPVLRLGPGGRSSTTGHVATVFGCTGFLGRYLVQKIARTGAQVVVPYR  82

Query  379  GSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVN  558
              E   RHLK+MGDLGQIVPM+++ R    +   +  ++VV NL+GR++ET+N+S+E+V+
Sbjct  83   -DEMEKRHLKVMGDLGQIVPMEWDARRPDQIAECLRHSDVVYNLVGRDHETKNFSYEDVH  141

Query  559  HYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
              +A  +A+I+ +  GI R I VS   A+  SPS   RAK   E  V
Sbjct  142  TKVASDIASIATQE-GIERLIHVSHFNAAHDSPSAFYRAKQAGEDLV  187



>ref|XP_008703114.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Ursus maritimus]
Length=434

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQ++VP+R       HL+ MGD
Sbjct  97   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQMIVPYRCDPYDTMHLRPMGD  156

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ ++++ R++ S++  V  +NVVINL+GRE+ET+N+ FE++   + + +A +SKE 
Sbjct  157  LGQIIFLEWDGRNKDSIRRAVKHSNVVINLVGREWETKNFDFEDIFVKIPQAIAQVSKE-  215

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A   S SR  R KA  E  V
Sbjct  216  AGVEKFIHVSHLNADIKSSSRYLRNKAVGEKEV  248



>dbj|GAN07940.1| NAD(P)-binding protein [Mucor ambiguus]
Length=379

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 113/163 (69%), Gaps = 3/163 (2%)
 Frame = +1

Query  214  LTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  390
            LT  K  G  +++ G GGRSS +G +ATVFG TGFLGRY+V +LAK G+QV+V +R +++
Sbjct  31   LTLRKKTGEPMIKYGLGGRSSTNGHIATVFGCTGFLGRYVVNKLAKQGTQVVVAYRDADE  90

Query  391  CHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMA  570
              RHLK+ GDLGQI+P++++ R++  +   V  +++V NL+GR+YET+N++F +V H   
Sbjct  91   A-RHLKVTGDLGQIIPLEFDLRNKQQIDECVRHSDIVYNLVGRDYETKNFTFNDV-HVDG  148

Query  571  EQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             +L A S    G+ RF+Q+S L AS  S S+  R+KA  E AV
Sbjct  149  SRLLAESCAENGVARFVQMSALNASEDSSSKFLRSKALGEKAV  191



>emb|CEI86940.1| Putative Genomic scaffold, msy_sf_1 [Rhizopus microsporus]
Length=323

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 112/163 (69%), Gaps = 3/163 (2%)
 Frame = +1

Query  214  LTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  390
            LT  K  G  +VR G GGRSS +G +ATVFG TGFLGRY+V +LA+ G+QV+V +R  ++
Sbjct  31   LTFRKKTGQPMVRYGLGGRSSTNGHIATVFGCTGFLGRYVVNRLAQQGTQVVVAYRDPDE  90

Query  391  CHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMA  570
              RHLK+ GDLGQ++P++++ R++  +   V  +++V NL+GR+YET+N++FE V H   
Sbjct  91   V-RHLKVCGDLGQVIPLEFDLRNKEQLAECVRHSDIVYNLVGRDYETKNFTFEHV-HVDG  148

Query  571  EQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             +  A +    G+ RF+QVS L AS  SPS+  R+KA  E AV
Sbjct  149  ARALAEAAAENGVARFVQVSALNASADSPSKFLRSKALGEKAV  191



>ref|XP_011743816.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Macaca nemestrina]
Length=304

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSS SGIVATVFGATGFLGRY+V  L ++GSQV++P R       HL+ MGD
Sbjct  40   VIPHGKGGRSSFSGIVATVFGATGFLGRYVVNHLGRIGSQVIIPHRCDIYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ET+N+ F++V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFDDVYVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ +FI VS L A+  S SR  R KA  E AV
Sbjct  159  AGVEKFIHVSHLNANIKSSSRYLRNKAVGEKAV  191



>ref|XP_004416912.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Odobenus rosmarus divergens]
Length=377

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDPYDTMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ ++++ R++ S++  V  +NVVINL+GRE+ET+N+ FE++   +   +A  SKE 
Sbjct  100  LGQIIFLEWDGRNKDSIQRAVKHSNVVINLVGREWETKNFDFEDIFVMIPHAIAQASKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ + I VS L A   S SR  R KA  E  V
Sbjct  159  AGVEKLIHVSHLNADIKSSSRYLRNKAVGEKEV  191



>ref|NP_001187320.1| mitochondrial NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 
subunit 9 [Ictalurus punctatus]
 gb|ADO28492.1| mitochondrial NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 
subunit 9 [Ictalurus punctatus]
Length=380

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 110/156 (71%), Gaps = 1/156 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            L+ KG GGRSS SG+ ATVFGATGFLGRY+V +L ++GSQ+++P R  +    +L+ MGD
Sbjct  42   LIPKGKGGRSSFSGVAATVFGATGFLGRYVVNRLGRIGSQIVIPHRCDQYDLMYLRPMGD  101

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ M+++ +D+ S+K  ++ +NVVINL+GRE+ET NY +E+V   + +Q+A  S+E 
Sbjct  102  LGQIIFMEWDVKDKESIKRAISHSNVVINLVGREWETSNYKYEDVFVTIPQQIAKASRE-  160

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
             G+ +FI VS L A   SPS+  R KA  E  V  E
Sbjct  161  AGVSKFIHVSHLNADIRSPSKYLRNKAVGETVVRDE  196



>emb|CEF99374.1| NAD(P)-binding domain [Ostreococcus tauri]
Length=359

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 105/149 (70%), Gaps = 1/149 (1%)
 Frame = +1

Query  253  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  432
            GTGGRSS SGI  TVFG+TGFLGRY+   +AK GS++++P R  E+  +HLK+MGDLGQI
Sbjct  21   GTGGRSSFSGITCTVFGSTGFLGRYVTHHVAKSGSRMILPTRCGENDRQHLKVMGDLGQI  80

Query  433  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  612
            + M Y   DE +++  V ++NVVIN++GRE+ETRN+SFE+V+    ++LA I  +  G+ 
Sbjct  81   LQMDYAISDEGAIRHAVERSNVVINMVGREWETRNFSFEDVHVTFPKKLAEICAD-VGVR  139

Query  613  RFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            R I VS LGA+   PS   R KA  E AV
Sbjct  140  RLIHVSALGAADDHPSAYFRTKAQGEAAV  168



>ref|XP_006923900.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Pteropus alecto]
 gb|ELK02573.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Pteropus alecto]
Length=377

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQ+++P R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQIIIPHRCERYDIMHLRPMGD  99

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQI+ +++N R++ S++  V  +NVVINL+GR++ET+NY FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWNGRNKDSIRRAVEHSNVVINLVGRDWETKNYDFEDVFVKIPQAIAQVSKE-  158

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ + I VS L A   S SR  R KA  E  V
Sbjct  159  AGVEKLIHVSHLNADIKSSSRYLRNKAVGEKEV  191



>ref|XP_004347048.1| Ndufa9 protein [Capsaspora owczarzaki ATCC 30864]
 gb|KJE94781.1| Ndufa9 protein [Capsaspora owczarzaki ATCC 30864]
Length=324

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 110/156 (71%), Gaps = 1/156 (1%)
 Frame = +1

Query  235  GHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLM  414
            G + R GTGGRSSVSG+VATVFG+TGF+GRYLV +L ++GSQ+++P+RG E  +RHLK M
Sbjct  63   GPVSRAGTGGRSSVSGVVATVFGSTGFIGRYLVNRLGRVGSQLILPYRGDEHAYRHLKPM  122

Query  415  GDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISK  594
            GDLGQ     Y+ RD+ +VK +V  +NVV NL+G+E+ TRN+S  +V+   AE +A   +
Sbjct  123  GDLGQFSFPFYHLRDKDTVKRLVEHSNVVFNLVGQEFATRNFSLHDVHVTGAETIARACQ  182

Query  595  EHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVL  702
            E  G+ R I VS L AS  S S   ++KA  E AVL
Sbjct  183  E-AGVGRLIHVSALNASTESRSPFLQSKALGEQAVL  217



>ref|XP_007008648.1| hypothetical protein TREMEDRAFT_72592 [Tremella mesenterica DSM 
1558]
 gb|EIW65481.1| hypothetical protein TREMEDRAFT_72592 [Tremella mesenterica DSM 
1558]
Length=411

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 126/209 (60%), Gaps = 28/209 (13%)
 Frame = +1

Query  106  RLGHQYLKPSHSVSAFK--------SFDLLSDHYGID-TPRYASTLTASKGVGHLVRKG-  255
            RLGH+   P   V +F+        + DL+ +H     TPR             ++++G 
Sbjct  5    RLGHRLRAP---VVSFRRTATPRRGAHDLIVEHSPSSHTPR------------PIIKRGP  49

Query  256  -TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  432
             TGGRSSVSG V TVFG TGFLGRY V ++AK G+QV+VP+R  ED  RHL++MGDLGQI
Sbjct  50   PTGGRSSVSGNVVTVFGCTGFLGRYTVAKIAKQGAQVIVPYR-DEDEKRHLRVMGDLGQI  108

Query  433  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  612
            VPM+++ R+   +   V  ++ V NL GR++ET+N++FE++N   A  +A ++ +   + 
Sbjct  109  VPMEWDARNPDQIYECVKHSDTVYNLAGRDWETKNFTFEDINVKAAGLIARVAAQ-ANVP  167

Query  613  RFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            R I VS L ASP+S S   R K   E AV
Sbjct  168  RLIHVSHLNASPSSTSEFYRTKYAGERAV  196



>gb|KFV38950.1| hypothetical protein N341_11120, partial [Tyto alba]
Length=227

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 116/168 (69%), Gaps = 2/168 (1%)
 Frame = +1

Query  208  STLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  384
            S L     V H ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  
Sbjct  13   SVLQQQHQVHHAVIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCD  72

Query  385  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  564
            +    +L+ MGDLGQ++ ++++ +D+ S++  V  +NVVINL+G+E+ET+N+SFE+    
Sbjct  73   QYDLMYLRPMGDLGQLIFLEWDCKDKDSIRRAVEHSNVVINLVGKEFETKNFSFEDEFVN  132

Query  565  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            + + +A I++E  G+   I +S L AS  SPS+  R+KA  E AV  E
Sbjct  133  IPQSIARITRE-AGVETLIHISHLNASMKSPSKYLRSKAVGEKAVREE  179



>dbj|GAM27735.1| hypothetical protein SAMD00019534_109110, partial [Acytostelium 
subglobosum LB1]
Length=351

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 109/162 (67%), Gaps = 4/162 (2%)
 Frame = +1

Query  214  LTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDC  393
            L   + VG +V      R+  SG+VAT+FG TGF GRY+VQ L K G QV+VP+RG +  
Sbjct  7    LNKQRNVGSIVH---ASRTHSSGLVATIFGVTGFTGRYIVQLLTKSGIQVVVPYRGEDYS  63

Query  394  HRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAE  573
             R LK++G+LGQI+P++Y+ RD  S++  ++ +N+VINL GR YETRN+SFE++N   A 
Sbjct  64   FRDLKVLGELGQIIPVRYDIRDTDSIERAISHSNIVINLAGRNYETRNFSFEDINVDAAT  123

Query  574  QLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
            ++A +SK + GI +++ VS L AS  S S   R KA  E AV
Sbjct  124  RIAKLSK-NIGIEKYVHVSALNASEDSASGFSRTKAIGEKAV  164



>emb|CEJ03407.1| Putative Genomic scaffold, msy_sf_1 [Rhizopus microsporus]
Length=379

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 112/163 (69%), Gaps = 3/163 (2%)
 Frame = +1

Query  214  LTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  390
            LT  K  G  ++R G GGRSS +G +ATVFG TGFLGRY+V +LA+ G+QV+V +R  ++
Sbjct  31   LTFRKKTGQPMIRYGLGGRSSTNGHIATVFGCTGFLGRYVVNRLAQQGTQVVVAYRDPDE  90

Query  391  CHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMA  570
              RHLK+ GDLGQI+P++++ R++  +   V  +++V NL+GR+YET+N++FE V H   
Sbjct  91   V-RHLKVCGDLGQIIPLEFDLRNKEQLAECVRHSDIVYNLVGRDYETKNFTFEHV-HVDG  148

Query  571  EQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             +  A +    G+ RF+QVS L AS  SPS+  R+KA  E AV
Sbjct  149  ARALAEAAAENGVARFVQVSALNASADSPSKFLRSKALGEKAV  191



>ref|XP_009973803.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
1 alpha subcomplex subunit 9, mitochondrial, partial [Tyto 
alba]
Length=232

 Score =   138 bits (347),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 116/168 (69%), Gaps = 2/168 (1%)
 Frame = +1

Query  208  STLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  384
            S L     V H ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  
Sbjct  19   SVLQQQHQVHHAVIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCD  78

Query  385  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  564
            +    +L+ MGDLGQ++ ++++ +D+ S++  V  +NVVINL+G+E+ET+N+SFE+    
Sbjct  79   QYDLMYLRPMGDLGQLIFLEWDCKDKDSIRRAVEHSNVVINLVGKEFETKNFSFEDEFVN  138

Query  565  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
            + + +A I++E  G+   I +S L AS  SPS+  R+KA  E AV  E
Sbjct  139  IPQSIARITRE-AGVETLIHISHLNASMKSPSKYLRSKAVGEKAVREE  185



>ref|XP_009954998.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial, partial [Leptosomus discolor]
Length=360

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 118/169 (70%), Gaps = 2/169 (1%)
 Frame = +1

Query  205  ASTLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  381
            +S L   + V H L+  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R 
Sbjct  10   SSVLQQYRQVHHALIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRC  69

Query  382  SEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNH  561
             +    +L+ MGDLGQ++ ++++ +D+ S++  V  +NVVINL+G+E+ET+N++FE+   
Sbjct  70   DQYDLMYLRPMGDLGQLLFLEWDCKDKDSIRRAVEHSNVVINLVGKEWETKNFNFEDAFV  129

Query  562  YMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRMRRAKATAEXAVLRE  708
             + + +A IS+E  G+   I +S L AS  SPS+  R+KA  E AV  E
Sbjct  130  NIPKSIAQISRE-AGVETLIHISHLNASMKSPSKYLRSKAVGEKAVREE  177



>ref|XP_007304718.1| NADH dehydrogenase [Stereum hirsutum FP-91666 SS1]
 gb|EIM85758.1| NADH dehydrogenase [Stereum hirsutum FP-91666 SS1]
Length=379

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 108/153 (71%), Gaps = 2/153 (1%)
 Frame = +1

Query  241  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  420
            ++  G  GRS+ +G VATVFG TGFLGRYLV +LAK G+QV+VP+R  ED  RHLK+MGD
Sbjct  35   IIAYGPPGRSATTGHVATVFGCTGFLGRYLVSKLAKAGTQVVVPYR-DEDEKRHLKVMGD  93

Query  421  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  600
            LGQIVP++++ R E+ ++  +  +++V NL GREY+T+ +S  +VN   A ++A+++   
Sbjct  94   LGQIVPLEWDIRSENQIEECLRHSDIVYNLTGREYDTKRFSLHDVNSTGAGRIASVAAR-  152

Query  601  GGIMRFIQVSCLGASPTSPSRMRRAKATAEXAV  699
             G+ RF+ VS L AS  SPSR  +AKA  E  V
Sbjct  153  AGVPRFVHVSHLNASRDSPSRFYQAKAEGEELV  185



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1267397107886