BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6524

Length=681
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP03229.1|  unnamed protein product                                278   3e-87   Coffea canephora [robusta coffee]
ref|XP_011093662.1|  PREDICTED: mitochondrial-processing peptidas...    275   1e-85   Sesamum indicum [beniseed]
ref|XP_011093661.1|  PREDICTED: mitochondrial-processing peptidas...    272   1e-84   Sesamum indicum [beniseed]
ref|XP_010244405.1|  PREDICTED: mitochondrial-processing peptidas...    271   2e-84   Nelumbo nucifera [Indian lotus]
ref|XP_009602845.1|  PREDICTED: mitochondrial-processing peptidas...    272   4e-84   Nicotiana tomentosiformis
ref|XP_009783210.1|  PREDICTED: mitochondrial-processing peptidas...    268   2e-83   Nicotiana sylvestris
ref|NP_001274924.1|  mitochondrial-processing peptidase subunit a...    267   8e-83   Solanum tuberosum [potatoes]
ref|XP_009597035.1|  PREDICTED: mitochondrial-processing peptidas...    263   3e-81   Nicotiana tomentosiformis
ref|XP_002283310.1|  PREDICTED: mitochondrial-processing peptidas...    262   6e-81   Vitis vinifera
ref|XP_009757181.1|  PREDICTED: mitochondrial-processing peptidas...    261   2e-80   Nicotiana sylvestris
gb|KHF99831.1|  Mitochondrial-processing peptidase subunit alpha        259   1e-79   Gossypium arboreum [tree cotton]
gb|KJB83099.1|  hypothetical protein B456_013G229300                    254   2e-79   Gossypium raimondii
ref|XP_004503508.1|  PREDICTED: mitochondrial-processing peptidas...    257   6e-79   Cicer arietinum [garbanzo]
gb|KJB83096.1|  hypothetical protein B456_013G229300                    256   1e-78   Gossypium raimondii
ref|XP_008447564.1|  PREDICTED: mitochondrial-processing peptidas...    256   1e-78   Cucumis melo [Oriental melon]
gb|EYU30680.1|  hypothetical protein MIMGU_mgv1a004957mg                256   2e-78   Erythranthe guttata [common monkey flower]
gb|KJB83098.1|  hypothetical protein B456_013G229300                    255   2e-78   Gossypium raimondii
ref|XP_010098163.1|  Mitochondrial-processing peptidase subunit a...    256   2e-78   Morus notabilis
gb|KJB83097.1|  hypothetical protein B456_013G229300                    256   2e-78   Gossypium raimondii
gb|EYU27247.1|  hypothetical protein MIMGU_mgv1a004049mg                256   4e-78   Erythranthe guttata [common monkey flower]
ref|XP_004510321.1|  PREDICTED: mitochondrial-processing peptidas...    254   6e-78   Cicer arietinum [garbanzo]
ref|NP_001275168.1|  mitochondrial-processing peptidase subunit a...    254   9e-78   Solanum tuberosum [potatoes]
ref|XP_006353507.1|  PREDICTED: mitochondrial-processing peptidas...    254   9e-78   
gb|KGN58021.1|  hypothetical protein Csa_3G435020                       252   4e-77   Cucumis sativus [cucumbers]
ref|XP_004149179.1|  PREDICTED: mitochondrial-processing peptidas...    252   4e-77   Cucumis sativus [cucumbers]
gb|KDO55880.1|  hypothetical protein CISIN_1g0104471mg                  248   7e-77   Citrus sinensis [apfelsine]
ref|XP_006451350.1|  hypothetical protein CICLE_v10008040mg             248   7e-77   
ref|XP_009415735.1|  PREDICTED: mitochondrial-processing peptidas...    251   7e-77   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG30214.1|  Mitochondrial-processing peptidase subunit alpha        252   8e-77   Gossypium arboreum [tree cotton]
ref|XP_003525296.1|  PREDICTED: mitochondrial-processing peptidas...    251   9e-77   Glycine max [soybeans]
gb|KDO55881.1|  hypothetical protein CISIN_1g0104471mg                  248   9e-77   Citrus sinensis [apfelsine]
ref|XP_004251648.1|  PREDICTED: mitochondrial-processing peptidas...    251   1e-76   Solanum lycopersicum
ref|XP_010545654.1|  PREDICTED: probable mitochondrial-processing...    251   1e-76   Tarenaya hassleriana [spider flower]
ref|XP_006451348.1|  hypothetical protein CICLE_v10008040mg             249   2e-76   
gb|KDO55885.1|  hypothetical protein CISIN_1g0104471mg                  248   2e-76   Citrus sinensis [apfelsine]
gb|ACJ86233.1|  unknown                                                 251   2e-76   Medicago truncatula
ref|XP_003630686.1|  Mitochondrial-processing peptidase subunit a...    251   2e-76   Medicago truncatula
ref|XP_006853743.1|  PREDICTED: mitochondrial-processing peptidas...    249   4e-76   Amborella trichopoda
ref|XP_006451349.1|  hypothetical protein CICLE_v10008040mg             250   5e-76   Citrus clementina [clementine]
ref|XP_006475356.1|  PREDICTED: mitochondrial-processing peptidas...    249   5e-76   Citrus sinensis [apfelsine]
ref|XP_011078227.1|  PREDICTED: mitochondrial-processing peptidas...    249   6e-76   Sesamum indicum [beniseed]
gb|KJB27182.1|  hypothetical protein B456_004G282800                    249   8e-76   Gossypium raimondii
gb|KJB27183.1|  hypothetical protein B456_004G282800                    249   9e-76   Gossypium raimondii
gb|KCW82289.1|  hypothetical protein EUGRSUZ_C03704                     247   2e-75   Eucalyptus grandis [rose gum]
ref|XP_003530483.1|  PREDICTED: mitochondrial-processing peptidas...    248   2e-75   Glycine max [soybeans]
ref|XP_006378186.1|  hypothetical protein POPTR_0010s04610g             247   2e-75   
ref|XP_006583043.1|  PREDICTED: mitochondrial-processing peptidas...    246   2e-75   
ref|XP_008228401.1|  PREDICTED: mitochondrial-processing peptidas...    248   2e-75   Prunus mume [ume]
ref|XP_007215264.1|  hypothetical protein PRUPE_ppa004554mg             247   3e-75   Prunus persica
ref|XP_002283426.1|  PREDICTED: mitochondrial-processing peptidas...    247   4e-75   Vitis vinifera
ref|XP_010049597.1|  PREDICTED: mitochondrial-processing peptidas...    247   5e-75   Eucalyptus grandis [rose gum]
gb|KHN16661.1|  Mitochondrial-processing peptidase subunit alpha        247   6e-75   Glycine soja [wild soybean]
ref|XP_003530042.1|  PREDICTED: mitochondrial-processing peptidas...    246   8e-75   Glycine max [soybeans]
ref|NP_001044193.1|  Os01g0739000                                       246   8e-75   
gb|KHN39262.1|  Mitochondrial-processing peptidase subunit alpha        246   8e-75   Glycine soja [wild soybean]
gb|AFW78810.1|  putative mitochondrial processing peptidase alpha...    236   1e-74   
ref|XP_011012737.1|  PREDICTED: mitochondrial-processing peptidas...    246   1e-74   Populus euphratica
ref|XP_008799765.1|  PREDICTED: mitochondrial-processing peptidas...    246   1e-74   Phoenix dactylifera
ref|XP_010086910.1|  Mitochondrial-processing peptidase subunit a...    246   2e-74   Morus notabilis
ref|XP_010688377.1|  PREDICTED: mitochondrial-processing peptidas...    244   2e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009409367.1|  PREDICTED: mitochondrial-processing peptidas...    245   3e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010688376.1|  PREDICTED: mitochondrial-processing peptidas...    244   4e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002311791.2|  hypothetical protein POPTR_0008s19750g             243   4e-74   
ref|XP_007160267.1|  hypothetical protein PHAVU_002G306900g             244   5e-74   Phaseolus vulgaris [French bean]
ref|XP_003531643.1|  PREDICTED: mitochondrial-processing peptidas...    244   5e-74   Glycine max [soybeans]
ref|XP_007012970.1|  Mitochondrial-processing peptidase subunit a...    241   5e-74   
ref|XP_010062551.1|  PREDICTED: mitochondrial-processing peptidas...    244   6e-74   Eucalyptus grandis [rose gum]
ref|XP_010914811.1|  PREDICTED: mitochondrial-processing peptidas...    244   6e-74   Elaeis guineensis
gb|KDO55879.1|  hypothetical protein CISIN_1g0104471mg                  240   6e-74   Citrus sinensis [apfelsine]
ref|XP_004302845.1|  PREDICTED: mitochondrial-processing peptidas...    243   1e-73   Fragaria vesca subsp. vesca
ref|XP_008380841.1|  PREDICTED: mitochondrial-processing peptidas...    243   1e-73   Malus domestica [apple tree]
ref|XP_011016383.1|  PREDICTED: mitochondrial-processing peptidas...    238   5e-73   Populus euphratica
ref|XP_006644677.1|  PREDICTED: mitochondrial-processing peptidas...    241   6e-73   Oryza brachyantha
ref|XP_008795496.1|  PREDICTED: mitochondrial-processing peptidas...    241   1e-72   Phoenix dactylifera
ref|XP_008795498.1|  PREDICTED: mitochondrial-processing peptidas...    241   1e-72   Phoenix dactylifera
ref|XP_007012969.1|  Insulinase protein isoform 1                       243   1e-72   
ref|XP_008798592.1|  PREDICTED: mitochondrial-processing peptidas...    241   1e-72   
ref|XP_008798591.1|  PREDICTED: mitochondrial-processing peptidas...    240   3e-72   Phoenix dactylifera
ref|XP_008459098.1|  PREDICTED: mitochondrial-processing peptidas...    240   3e-72   Cucumis melo [Oriental melon]
ref|XP_009344488.1|  PREDICTED: mitochondrial-processing peptidas...    239   5e-72   Pyrus x bretschneideri [bai li]
ref|XP_003627059.1|  Mitochondrial-processing peptidase subunit a...    239   6e-72   Medicago truncatula
gb|AFW78811.1|  putative mitochondrial processing peptidase alpha...    238   1e-71   
ref|NP_001146680.1|  uncharacterized protein LOC100280280               238   1e-71   Zea mays [maize]
gb|KGN60560.1|  hypothetical protein Csa_2G000680                       238   1e-71   Cucumis sativus [cucumbers]
ref|XP_004141034.2|  PREDICTED: mitochondrial-processing peptidas...    238   2e-71   Cucumis sativus [cucumbers]
ref|XP_010528943.1|  PREDICTED: probable mitochondrial-processing...    237   2e-71   Tarenaya hassleriana [spider flower]
gb|EAZ13476.1|  hypothetical protein OsJ_03392                          238   3e-71   Oryza sativa Japonica Group [Japonica rice]
gb|KDO51845.1|  hypothetical protein CISIN_1g010650mg                   235   3e-71   Citrus sinensis [apfelsine]
ref|XP_006465713.1|  PREDICTED: mitochondrial-processing peptidas...    237   3e-71   Citrus sinensis [apfelsine]
gb|EEC71449.1|  hypothetical protein OsI_03671                          238   6e-71   Oryza sativa Indica Group [Indian rice]
ref|XP_007204564.1|  hypothetical protein PRUPE_ppa004446mg             236   8e-71   
gb|KDO51843.1|  hypothetical protein CISIN_1g010650mg                   236   1e-70   Citrus sinensis [apfelsine]
gb|KDO51844.1|  hypothetical protein CISIN_1g010650mg                   236   1e-70   Citrus sinensis [apfelsine]
ref|XP_009338746.1|  PREDICTED: mitochondrial-processing peptidas...    235   1e-70   Pyrus x bretschneideri [bai li]
ref|XP_010924455.1|  PREDICTED: mitochondrial-processing peptidas...    235   1e-70   Elaeis guineensis
ref|XP_008354423.1|  PREDICTED: mitochondrial-processing peptidas...    235   2e-70   
ref|XP_008664141.1|  PREDICTED: mitochondrial-processing peptidas...    230   2e-70   
ref|XP_008242460.1|  PREDICTED: mitochondrial-processing peptidas...    235   3e-70   Prunus mume [ume]
ref|XP_007135618.1|  hypothetical protein PHAVU_010G144000g             234   4e-70   Phaseolus vulgaris [French bean]
ref|XP_006426848.1|  hypothetical protein CICLE_v10025419mg             234   6e-70   
ref|XP_006426849.1|  hypothetical protein CICLE_v10025419mg             233   7e-70   Citrus clementina [clementine]
ref|XP_003546593.1|  PREDICTED: mitochondrial-processing peptidas...    233   1e-69   Glycine max [soybeans]
ref|XP_002514191.1|  mitochondrial processing peptidase alpha sub...    232   4e-69   Ricinus communis
ref|XP_004287497.1|  PREDICTED: mitochondrial-processing peptidas...    231   7e-69   Fragaria vesca subsp. vesca
ref|XP_012069060.1|  PREDICTED: mitochondrial-processing peptidas...    229   2e-68   Jatropha curcas
gb|KDP40843.1|  hypothetical protein JCGZ_24842                         229   2e-68   Jatropha curcas
ref|XP_002299745.1|  mitochondrial processing peptidase alpha sub...    229   3e-68   Populus trichocarpa [western balsam poplar]
ref|XP_006299456.1|  hypothetical protein CARUB_v10015621mg             228   6e-68   Capsella rubella
ref|XP_010504362.1|  PREDICTED: probable mitochondrial-processing...    228   6e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010504356.1|  PREDICTED: probable mitochondrial-processing...    228   6e-68   Camelina sativa [gold-of-pleasure]
emb|CDY46536.1|  BnaA08g01750D                                          228   6e-68   Brassica napus [oilseed rape]
ref|XP_009107159.1|  PREDICTED: probable mitochondrial-processing...    228   7e-68   Brassica rapa
gb|ADE77223.1|  unknown                                                 228   1e-67   Picea sitchensis
ref|XP_011000940.1|  PREDICTED: mitochondrial-processing peptidas...    227   2e-67   Populus euphratica
dbj|BAB62405.1|  mitochondrial processing peptidase alpha subunit       227   2e-67   Morus alba
gb|EPS62572.1|  mitochondrial processing peptidase                      226   3e-67   Genlisea aurea
emb|CDM84014.1|  unnamed protein product                                226   5e-67   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010487509.1|  PREDICTED: probable mitochondrial-processing...    226   6e-67   Camelina sativa [gold-of-pleasure]
gb|EMS48740.1|  Mitochondrial-processing peptidase subunit alpha        225   8e-67   Triticum urartu
ref|XP_006595118.1|  PREDICTED: mitochondrial-processing peptidas...    224   8e-67   Glycine max [soybeans]
ref|XP_006392972.1|  hypothetical protein EUTSA_v10011412mg             224   1e-66   
ref|XP_006595117.1|  PREDICTED: mitochondrial-processing peptidas...    224   1e-66   Glycine max [soybeans]
ref|XP_003542085.1|  PREDICTED: mitochondrial-processing peptidas...    224   1e-66   Glycine max [soybeans]
emb|CDY33843.1|  BnaC06g05100D                                          225   1e-66   Brassica napus [oilseed rape]
ref|XP_010535187.1|  PREDICTED: probable mitochondrial-processing...    222   2e-66   Tarenaya hassleriana [spider flower]
gb|KFK35813.1|  hypothetical protein AALP_AA4G040900                    225   2e-66   Arabis alpina [alpine rockcress]
ref|XP_006392973.1|  hypothetical protein EUTSA_v10011412mg             224   3e-66   Eutrema salsugineum [saltwater cress]
emb|CDY53441.1|  BnaC03g78020D                                          224   3e-66   Brassica napus [oilseed rape]
gb|KHN30017.1|  Mitochondrial-processing peptidase subunit alpha        222   3e-66   Glycine soja [wild soybean]
ref|XP_010535186.1|  PREDICTED: probable mitochondrial-processing...    223   5e-66   Tarenaya hassleriana [spider flower]
ref|XP_010465671.1|  PREDICTED: probable mitochondrial-processing...    222   1e-65   Camelina sativa [gold-of-pleasure]
ref|XP_004961441.1|  PREDICTED: mitochondrial-processing peptidas...    222   2e-65   Setaria italica
ref|XP_002894348.1|  hypothetical protein ARALYDRAFT_474319             222   2e-65   
ref|NP_001077701.1|  putative mitochondrial-processing peptidase ...    219   4e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007150592.1|  hypothetical protein PHAVU_005G1652000g            220   5e-65   Phaseolus vulgaris [French bean]
dbj|BAE98617.1|  hypothetical protein                                   220   8e-65   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175610.1|  putative mitochondrial-processing peptidase sub...    220   1e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65922.1|  mitochondrial processing peptidase alpha subunit,...    220   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307303.1|  hypothetical protein CARUB_v10008921mg             219   2e-64   Capsella rubella
ref|XP_009147720.1|  PREDICTED: probable mitochondrial-processing...    218   7e-64   Brassica rapa
ref|XP_009144867.1|  PREDICTED: probable mitochondrial-processing...    217   1e-63   Brassica rapa
emb|CDY22877.1|  BnaA06g02000D                                          217   1e-63   Brassica napus [oilseed rape]
emb|CDY45641.1|  BnaA05g15080D                                          217   1e-63   Brassica napus [oilseed rape]
ref|XP_002515947.1|  mitochondrial processing peptidase alpha sub...    216   2e-63   
gb|AFW58098.1|  hypothetical protein ZEAMMB73_790961                    219   1e-62   
emb|CDX87868.1|  BnaC06g09300D                                          211   2e-61   
gb|KJB68194.1|  hypothetical protein B456_010G231200                    208   6e-61   Gossypium raimondii
ref|XP_010232284.1|  PREDICTED: mitochondrial-processing peptidas...    209   9e-61   
ref|XP_010232283.1|  PREDICTED: mitochondrial-processing peptidas...    209   1e-60   Brachypodium distachyon [annual false brome]
gb|KFK38993.1|  hypothetical protein AALP_AA3G186200                    209   1e-60   Arabis alpina [alpine rockcress]
gb|KJB68192.1|  hypothetical protein B456_010G231200                    209   1e-60   Gossypium raimondii
ref|NP_001150614.1|  mitochondrial-processing peptidase alpha sub...    209   2e-60   
ref|XP_004968500.1|  PREDICTED: mitochondrial-processing peptidas...    209   2e-60   Setaria italica
ref|NP_001241707.1|  putative mitochondrial processing peptidase ...    207   6e-60   Zea mays [maize]
gb|ACG24289.1|  mitochondrial-processing peptidase alpha subunit        207   6e-60   Zea mays [maize]
ref|XP_003564704.1|  PREDICTED: mitochondrial-processing peptidas...    207   7e-60   Brachypodium distachyon [annual false brome]
ref|XP_002883011.1|  mppalpha                                           206   2e-59   
ref|XP_010231138.1|  PREDICTED: mitochondrial-processing peptidas...    206   3e-59   Brachypodium distachyon [annual false brome]
gb|EAY72858.1|  hypothetical protein OsI_00727                          205   7e-59   Oryza sativa Indica Group [Indian rice]
ref|NP_001042272.1|  Os01g0191500                                       203   2e-58   
ref|XP_010500794.1|  PREDICTED: probable mitochondrial-processing...    202   8e-58   Camelina sativa [gold-of-pleasure]
ref|NP_566548.1|  mitochondrial processing peptidase alpha subunit      201   1e-57   Arabidopsis thaliana [mouse-ear cress]
gb|AAK59675.1|  putative mitochondrial processing peptidase alpha...    201   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002457199.1|  hypothetical protein SORBIDRAFT_03g003160          200   3e-57   Sorghum bicolor [broomcorn]
ref|XP_010479701.1|  PREDICTED: probable mitochondrial-processing...    200   3e-57   Camelina sativa [gold-of-pleasure]
emb|CDM81679.1|  unnamed protein product                                200   3e-57   Triticum aestivum [Canadian hard winter wheat]
gb|EEE64417.1|  hypothetical protein OsJ_19261                          200   3e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006643862.1|  PREDICTED: mitochondrial-processing peptidas...    200   4e-57   Oryza brachyantha
ref|NP_001056089.1|  Os05g0524300                                       199   5e-57   
emb|CDY43102.1|  BnaC05g36750D                                          199   8e-57   Brassica napus [oilseed rape]
ref|XP_010462039.1|  PREDICTED: probable mitochondrial-processing...    199   8e-57   Camelina sativa [gold-of-pleasure]
ref|XP_007024340.1|  Mitochondrial-processing peptidase subunit a...    196   3e-56   
ref|XP_007024342.1|  Mitochondrial-processing peptidase subunit a...    195   3e-56   
gb|EMS58411.1|  Mitochondrial-processing peptidase subunit alpha        196   7e-56   Triticum urartu
emb|CDX92075.1|  BnaA05g23320D                                          196   8e-56   
ref|XP_007024339.1|  Mitochondrial-processing peptidase subunit a...    196   9e-56   
ref|XP_007024341.1|  Mitochondrial-processing peptidase subunit a...    194   1e-55   
ref|XP_009146083.1|  PREDICTED: probable mitochondrial-processing...    194   7e-55   Brassica rapa
gb|AAG42149.1|  mitochondrial processing peptidase alpha-chain pr...    194   9e-55   Dactylis glomerata [cocksfoot]
gb|KHG28938.1|  Mitochondrial-processing peptidase subunit alpha        191   3e-54   Gossypium arboreum [tree cotton]
gb|EMT19127.1|  Mitochondrial-processing peptidase subunit alpha        195   5e-54   
ref|XP_001759462.1|  predicted protein                                  191   1e-53   
ref|XP_006406832.1|  hypothetical protein EUTSA_v10020561mg             186   1e-51   Eutrema salsugineum [saltwater cress]
gb|ACN36870.1|  unknown                                                 177   8e-49   Zea mays [maize]
ref|XP_001753960.1|  predicted protein                                  174   8e-48   
ref|XP_001765307.1|  predicted protein                                  175   1e-47   
ref|XP_001777355.1|  predicted protein                                  172   1e-46   
gb|ERN16185.1|  hypothetical protein AMTR_s00030p00236070               172   1e-46   Amborella trichopoda
ref|XP_006854718.2|  PREDICTED: mitochondrial-processing peptidas...    172   2e-46   Amborella trichopoda
ref|XP_008799681.1|  PREDICTED: mitochondrial-processing peptidas...    167   4e-45   Phoenix dactylifera
ref|XP_002987658.1|  hypothetical protein SELMODRAFT_126515             167   8e-45   
ref|XP_002987595.1|  hypothetical protein SELMODRAFT_183257             167   1e-44   Selaginella moellendorffii
ref|XP_009414834.1|  PREDICTED: mitochondrial-processing peptidas...    166   3e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010931091.1|  PREDICTED: mitochondrial-processing peptidas...    162   6e-43   Elaeis guineensis
ref|XP_002992589.1|  hypothetical protein SELMODRAFT_448827             153   1e-39   Selaginella moellendorffii
tpg|DAA55704.1|  TPA: putative mitochondrial processing peptidase...    147   3e-38   
ref|NP_001167727.1|  putative mitochondrial processing peptidase ...    147   1e-37   Zea mays [maize]
gb|ACN28785.1|  unknown                                                 147   1e-37   Zea mays [maize]
dbj|BAJ89700.1|  predicted protein                                      147   1e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002457003.1|  hypothetical protein SORBIDRAFT_03g047030          145   7e-37   
emb|CDJ26330.1|  unnamed protein product                                144   2e-36   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010233616.1|  PREDICTED: ABC transporter D family member 1...    145   1e-35   
ref|XP_005645630.1|  LuxS/MPP-like metallohydrolase                     140   3e-35   Coccomyxa subellipsoidea C-169
gb|EAY77359.1|  hypothetical protein OsI_05342                          139   5e-35   Oryza sativa Indica Group [Indian rice]
gb|KDO55884.1|  hypothetical protein CISIN_1g0104471mg                  137   8e-35   Citrus sinensis [apfelsine]
ref|NP_001045501.1|  Os01g0966300                                       139   9e-35   
gb|AFW83870.1|  putative mitochondrial processing peptidase alpha...    137   1e-34   
ref|NP_001170252.1|  uncharacterized protein LOC100384208               136   2e-34   
gb|AFW83871.1|  putative mitochondrial processing peptidase alpha...    136   4e-34   
gb|EEC79554.1|  hypothetical protein OsI_20678                          138   5e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_008655317.1|  PREDICTED: uncharacterized protein LOC100384...    137   5e-34   Zea mays [maize]
ref|XP_008655316.1|  PREDICTED: uncharacterized protein LOC100384...    137   7e-34   
ref|XP_006645345.1|  PREDICTED: mitochondrial-processing peptidas...    135   2e-33   
ref|XP_011399005.1|  putative mitochondrial-processing peptidase ...    135   3e-33   Auxenochlorella protothecoides
ref|XP_007509007.1|  predicted protein                                  134   8e-33   Bathycoccus prasinos
gb|EMT18398.1|  Mitochondrial-processing peptidase subunit alpha        134   8e-33   
ref|XP_005846410.1|  hypothetical protein CHLNCDRAFT_36005              130   2e-31   Chlorella variabilis
ref|XP_002508413.1|  predicted protein                                  126   4e-30   Micromonas commoda
ref|XP_001697130.1|  mitochondrial processing peptidase alpha sub...    121   3e-28   Chlamydomonas reinhardtii
ref|XP_010481129.1|  PREDICTED: probable mitochondrial-processing...    115   3e-28   
ref|XP_010276189.1|  PREDICTED: mitochondrial-processing peptidas...    114   4e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010269174.1|  PREDICTED: mitochondrial-processing peptidas...    114   7e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010258501.1|  PREDICTED: mitochondrial-processing peptidas...    114   8e-27   
ref|XP_002945711.1|  hypothetical protein VOLCADRAFT_85964              113   8e-26   Volvox carteri f. nagariensis
ref|XP_004971384.1|  PREDICTED: mitochondrial-processing peptidas...    110   2e-24   
ref|XP_010251231.1|  PREDICTED: mitochondrial-processing peptidas...    106   4e-24   
gb|EMT01864.1|  ABC transporter D family member 1                       110   1e-23   
ref|XP_005780606.1|  mitochondrial processing peptidase alpha sub...  98.6    2e-22   Emiliania huxleyi CCMP1516
gb|KDO51228.1|  hypothetical protein CISIN_1g044668mg                   103   2e-22   Citrus sinensis [apfelsine]
emb|CDS13277.1|  hypothetical protein LRAMOSA05455                      101   4e-21   Lichtheimia ramosa
emb|CDH54037.1|  mitochondrial processing alpha subunit                 101   4e-21   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_009820981.1|  hypothetical protein, variant                    99.4    5e-21   Aphanomyces astaci
ref|XP_008862995.1|  hypothetical protein H310_01616                    100   9e-21   Aphanomyces invadans
emb|CEP11004.1|  hypothetical protein                                   100   9e-21   Parasitella parasitica
ref|XP_009820980.1|  hypothetical protein H257_00138                  99.8    2e-20   Aphanomyces astaci
gb|ENH86349.1|  mitochondrial processing peptidase                    99.4    2e-20   
ref|XP_001907997.1|  hypothetical protein                             98.6    4e-20   Podospora anserina S mat+
ref|XP_008475257.1|  PREDICTED: mitochondrial-processing peptidas...  97.8    4e-20   
gb|EMF15932.1|  Peptidase_M16-domain-containing protein               99.0    4e-20   Sphaerulina musiva SO2202
gb|KFB40497.1|  AGAP000935-PA-like protein                            97.8    6e-20   Anopheles sinensis
gb|EMS59373.1|  Mitochondrial-processing peptidase subunit alpha      91.3    6e-20   Triticum urartu
emb|CDP32140.1|  Putative mitochondrial-processing peptidase subu...  98.2    7e-20   Podospora anserina S mat+
ref|XP_009260074.1|  hypothetical protein FPSE_08681                  97.8    1e-19   Fusarium pseudograminearum CS3096
gb|ETM47544.1|  hypothetical protein L914_07753                       97.4    1e-19   Phytophthora parasitica
ref|XP_011318501.1|  peptidase alpha subunit                          97.4    1e-19   Fusarium graminearum PH-1
gb|KDO33365.1|  hypothetical protein SPRG_02172                       96.7    1e-19   Saprolegnia parasitica CBS 223.65
emb|CBJ31604.1|  Mitochondrial Processing Peptidase alpha subunit     97.1    1e-19   Ectocarpus siliculosus
ref|XP_008904779.1|  hypothetical protein PPTG_11254                  97.1    1e-19   Phytophthora parasitica INRA-310
gb|ETL94313.1|  hypothetical protein L917_07681                       97.1    1e-19   Phytophthora parasitica
gb|ETK87731.1|  hypothetical protein L915_07867                       97.1    1e-19   Phytophthora parasitica
gb|ETO76520.1|  hypothetical protein F444_08080                       97.1    1e-19   Phytophthora parasitica P1976
emb|CEJ82693.1|  Putative Mitochondrial-processing peptidase subu...  97.4    1e-19   Torrubiella hemipterigena
ref|XP_007733021.1|  mitochondrial processing peptidase               97.1    2e-19   Capronia epimyces CBS 606.96
ref|XP_008615167.1|  hypothetical protein SDRG_10928                  96.7    2e-19   Saprolegnia diclina VS20
ref|XP_009513783.1|  hypothetical protein PHYSODRAFT_320443           96.7    2e-19   Phytophthora sojae
gb|AAW78940.1|  GekBS094P                                             92.0    2e-19   Gekko japonicus
ref|XP_009658020.1|  mitochondrial-processing peptidase subunit a...  96.3    3e-19   Verticillium dahliae VdLs.17
emb|CCA25279.1|  conserved hypothetical protein                       96.3    4e-19   Albugo laibachii Nc14
gb|EPB89014.1|  hypothetical protein HMPREF1544_04137                 95.9    4e-19   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_011497090.1|  PREDICTED: mitochondrial-processing peptidas...  95.1    4e-19   Ceratosolen solmsi marchali
ref|XP_003044855.1|  predicted protein                                95.9    4e-19   [Nectria] haematococca mpVI 77-13-4
emb|CEG00820.1|  Metalloenzyme, LuxS/M16 peptidase-like               94.7    4e-19   Ostreococcus tauri
ref|XP_001176813.1|  PREDICTED: mitochondrial-processing peptidas...  95.1    4e-19   Strongylocentrotus purpuratus [purple urchin]
ref|XP_011497091.1|  PREDICTED: mitochondrial-processing peptidas...  94.7    6e-19   Ceratosolen solmsi marchali
ref|NP_001279114.1|  peptidase (mitochondrial processing) beta        94.7    7e-19   Callorhinchus milii [Australian ghost shark]
ref|XP_006014114.1|  PREDICTED: mitochondrial-processing peptidas...  92.4    7e-19   
ref|NP_001088918.1|  uncharacterized protein LOC496289                94.7    8e-19   Xenopus laevis [clawed frog]
dbj|GAN06395.1|  mitochondrial processing peptidase                   95.1    8e-19   Mucor ambiguus
emb|CEG71991.1|  Putative Mitochondrial processing peptidase alph...  95.1    8e-19   Rhizopus microsporus
emb|CEI99504.1|  Putative Mitochondrial processing peptidase alph...  95.1    8e-19   Rhizopus microsporus
ref|XP_002895747.1|  conserved hypothetical protein                   94.7    8e-19   Phytophthora infestans T30-4
emb|CEG81561.1|  Putative Mitochondrial processing peptidase alph...  95.1    8e-19   Rhizopus microsporus
ref|XP_007728311.1|  mitochondrial processing peptidase               95.1    9e-19   Capronia coronata CBS 617.96
gb|EDL99415.1|  peptidase (mitochondrial processing) beta, isofor...  90.9    9e-19   Rattus norvegicus [brown rat]
gb|EPS25831.1|  hypothetical protein PDE_00767                        95.1    9e-19   Penicillium oxalicum 114-2
ref|XP_006670223.1|  mitochondrial processing peptidase alpha sub...  94.7    9e-19   Cordyceps militaris CM01
ref|XP_003385964.1|  PREDICTED: mitochondrial-processing peptidas...  94.4    1e-18   Amphimedon queenslandica
gb|EWG49673.1|  mitochondrial-processing peptidase subunit alpha      94.7    1e-18   Fusarium verticillioides 7600
gb|EGU80463.1|  hypothetical protein FOXB_09020                       94.7    1e-18   Fusarium oxysporum Fo5176
gb|ENH66097.1|  Mitochondrial-processing peptidase subunit alpha      94.7    1e-18   
gb|EDL99418.1|  peptidase (mitochondrial processing) beta, isofor...  91.3    1e-18   
gb|EMT70743.1|  Mitochondrial-processing peptidase subunit alpha      94.7    1e-18   
ref|XP_001631568.1|  predicted protein                                94.0    1e-18   
dbj|GAM19886.1|  hypothetical protein SAMD00019534_030610             94.0    1e-18   
gb|EXK40360.1|  mitochondrial processing peptidase                    94.7    1e-18   
emb|CCT69284.1|  probable mitochondrial processing peptidase alph...  94.7    1e-18   
ref|XP_006808720.1|  PREDICTED: mitochondrial-processing peptidas...  93.2    1e-18   
gb|EPZ35276.1|  Peptidase M16, zinc-binding site domain-containin...  93.6    1e-18   
ref|XP_002741599.1|  PREDICTED: mitochondrial-processing peptidas...  93.6    1e-18   
gb|KJB68193.1|  hypothetical protein B456_010G231200                  92.4    2e-18   
gb|EDL99419.1|  peptidase (mitochondrial processing) beta, isofor...  91.3    2e-18   
ref|XP_001422415.1|  predicted protein                                93.2    2e-18   
ref|XP_005709111.1|  mitochondrial processing peptidase               93.2    2e-18   
ref|XP_005755231.1|  PREDICTED: mitochondrial-processing peptidas...  93.2    2e-18   
ref|XP_004576241.1|  PREDICTED: mitochondrial-processing peptidas...  93.2    2e-18   
ref|XP_003458723.1|  PREDICTED: mitochondrial-processing peptidas...  93.2    2e-18   
ref|XP_005951901.1|  PREDICTED: mitochondrial-processing peptidas...  93.2    2e-18   
ref|NP_001039103.1|  mitochondrial-processing peptidase subunit beta  93.2    2e-18   
gb|KIJ22035.1|  hypothetical protein PAXINDRAFT_124470                93.6    2e-18   
gb|EFQ25154.1|  insulinase                                            94.0    2e-18   
ref|XP_003558505.1|  PREDICTED: probable mitochondrial-processing...  93.6    2e-18   
gb|EDL03196.1|  mCG6419, isoform CRA_c                                90.5    2e-18   
gb|EMS54290.1|  Mitochondrial-processing peptidase subunit alpha      92.0    2e-18   
ref|XP_004354528.1|  mitochondrial processing peptidase beta subunit  92.8    2e-18   
gb|EDL99416.1|  peptidase (mitochondrial processing) beta, isofor...  91.3    3e-18   
gb|KDN71763.1|  putative insulinase                                   93.6    3e-18   
ref|XP_009153644.1|  mitochondrial processing peptidase               93.6    3e-18   
ref|XP_003663130.1|  hypothetical protein MYCTH_2304617               93.6    3e-18   
emb|CCA70151.1|  probable mitochondrial processing peptidase alph...  93.2    3e-18   
ref|XP_008323676.1|  PREDICTED: mitochondrial-processing peptidas...  92.8    3e-18   
gb|KIW21571.1|  hypothetical protein PV08_02151                       93.2    3e-18   
emb|CDQ89021.1|  unnamed protein product                              92.4    3e-18   
emb|CAF93398.1|  unnamed protein product                              92.4    3e-18   
gb|KIH92690.1|  mitochondrial processing peptidase                    93.2    3e-18   
gb|ERT01234.1|  hypothetical protein HMPREF1624_02476                 93.2    3e-18   
ref|NP_001085137.1|  peptidase (mitochondrial processing) beta        92.8    3e-18   
gb|KHN08019.1|  Mitochondrial-processing peptidase subunit alpha      90.1    3e-18   
gb|AAI23110.1|  MGC78954 protein                                      92.8    4e-18   
emb|CCF32823.1|  insulinase                                           93.2    4e-18   
gb|KKA24895.1|  Acetoacetyl-CoA synthase                              94.4    4e-18   
ref|XP_010885582.1|  PREDICTED: mitochondrial-processing peptidas...  92.4    4e-18   
ref|XP_010885583.1|  PREDICTED: mitochondrial-processing peptidas...  92.4    4e-18   
ref|XP_001766086.1|  predicted protein                                92.4    4e-18   
gb|AAV44043.1|  putative mitochondrial processing peptidase alpha...  91.3    4e-18   
ref|XP_008276772.1|  PREDICTED: mitochondrial-processing peptidas...  92.4    4e-18   
ref|XP_003978567.1|  PREDICTED: mitochondrial-processing peptidas...  92.4    4e-18   
ref|XP_002424317.1|  ubiquinol-cytochrome C reductase, core prote...  92.4    4e-18   
ref|XP_008509794.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    4e-18   
ref|XP_004084681.1|  PREDICTED: mitochondrial-processing peptidas...  92.4    4e-18   
gb|EFW19215.1|  mitochondrial-processing peptidase subunit alpha      92.8    5e-18   
gb|EWY91621.1|  mitochondrial processing peptidase                    92.8    5e-18   
ref|XP_002129466.1|  PREDICTED: mitochondrial-processing peptidas...  92.0    5e-18   
ref|XP_003067046.1|  mitochondrial processing peptidase alpha sub...  92.8    5e-18   
ref|XP_001239441.1|  hypothetical protein CIMG_09062                  92.8    5e-18   
ref|XP_007923257.1|  hypothetical protein MYCFIDRAFT_150806           92.8    5e-18   
ref|XP_006633526.1|  PREDICTED: mitochondrial-processing peptidas...  92.0    5e-18   
ref|NP_001012514.1|  mitochondrial-processing peptidase subunit beta  92.0    5e-18   
ref|XP_752553.1|  mitochondrial processing peptidase alpha subunit    92.8    6e-18   
gb|KEY79582.1|  mitochondrial processing peptidase alpha subunit      92.4    6e-18   
ref|XP_004839772.1|  PREDICTED: mitochondrial-processing peptidas...  92.0    6e-18   
gb|KIW59847.1|  hypothetical protein PV05_00113                       92.4    7e-18   
ref|XP_309120.4|  AGAP000935-PA                                       91.7    7e-18   
gb|KIW38859.1|  hypothetical protein PV06_08688                       92.4    7e-18   
ref|XP_004839771.1|  PREDICTED: mitochondrial-processing peptidas...  92.0    7e-18   
ref|XP_002986789.1|  hypothetical protein SELMODRAFT_158279           92.0    7e-18   
ref|XP_004894022.1|  PREDICTED: mitochondrial-processing peptidas...  91.7    8e-18   
emb|CDO73014.1|  hypothetical protein BN946_scf185007.g68             92.0    8e-18   
ref|XP_001264574.1|  mitochondrial processing peptidase alpha sub...  92.4    8e-18   
ref|XP_007215683.1|  hypothetical protein PRUPE_ppa004059mg           92.0    8e-18   
gb|KIV93313.1|  hypothetical protein PV10_04536                       92.0    8e-18   
ref|XP_002969499.1|  hypothetical protein SELMODRAFT_146300           91.7    8e-18   
emb|CDR97226.1|  mitochondrial processing peptidase alpha subunit...  92.0    8e-18   
ref|XP_003771525.1|  PREDICTED: mitochondrial-processing peptidas...  91.7    8e-18   
ref|XP_002468288.1|  hypothetical protein SORBIDRAFT_01g043060        92.0    9e-18   
ref|NP_001149620.1|  LOC100283246                                     92.0    9e-18   
gb|KFB37884.1|  AGAP000935-PA-like protein                            91.7    9e-18   
gb|AFW89241.1|  peptidase beta subunit                                91.7    9e-18   
ref|XP_007504129.1|  PREDICTED: mitochondrial-processing peptidas...  92.0    9e-18   
emb|CCI40388.1|  unnamed protein product                              92.0    9e-18   
ref|XP_007593993.1|  insulinase                                       92.0    9e-18   
gb|EIT83440.1|  processing peptidase, alpha subunit                   92.0    9e-18   
emb|CCI40389.1|  unnamed protein product                              91.7    9e-18   
ref|XP_001269086.1|  mitochondrial processing peptidase alpha sub...  92.0    1e-17   
ref|XP_002407106.1|  processing peptidase beta subunit, putative      91.3    1e-17   
ref|XP_006693136.1|  mitochondrial processing peptidase alpha sub...  92.0    1e-17   
gb|EEE58574.1|  hypothetical protein OsJ_09894                        91.3    1e-17   
gb|ERM99906.1|  hypothetical protein AMTR_s00110p00066820             91.3    1e-17   
ref|XP_001818903.1|  mitochondrial-processing peptidase subunit a...  92.0    1e-17   
ref|XP_010735238.1|  PREDICTED: mitochondrial-processing peptidas...  91.3    1e-17   
gb|EIE79114.1|  hypothetical protein RO3G_03819                       91.7    1e-17   
ref|XP_006140849.1|  PREDICTED: mitochondrial-processing peptidas...  91.3    1e-17   
ref|XP_008032717.1|  LuxS/MPP-like metallohydrolase                   91.7    1e-17   
dbj|BAA03007.1|  mitochondrial processing protease                    91.3    1e-17   
sp|Q03346.3|MPPB_RAT  RecName: Full=Mitochondrial-processing pept...  91.3    1e-17   
gb|EYE95432.1|  mitochondrial processing peptidase alpha subunit      91.7    1e-17   
gb|ETN58152.1|  collagen alpha chain                                  92.8    1e-17   
ref|XP_002380339.1|  mitochondrial processing peptidase alpha sub...  91.7    1e-17   
ref|XP_009217085.1|  mitochondrial-processing peptidase subunit a...  91.7    1e-17   
ref|NP_071790.1|  mitochondrial-processing peptidase subunit beta...  91.3    1e-17   
gb|EPE10983.1|  mitochondrial processing peptidase alpha              91.7    1e-17   
gb|KID97673.1|  Peptidase M16, core                                   91.7    1e-17   
ref|NP_001049357.1|  Os03g0212700                                     91.3    1e-17   
ref|XP_002599710.1|  hypothetical protein BRAFLDRAFT_287788           90.9    1e-17   
emb|CCA16112.1|  mitochondrialprocessing peptidase subunit beta puta  90.9    1e-17   
gb|KID87417.1|  Peptidase M16, core                                   91.3    1e-17   
gb|EAY89022.1|  hypothetical protein OsI_10505                        91.3    1e-17   
ref|XP_010936330.1|  PREDICTED: probable mitochondrial-processing...  91.3    1e-17   
ref|NP_001130423.1|  uncharacterized protein LOC100191520             91.3    1e-17   
gb|KJK79439.1|  hypothetical protein H634G_05030                      91.3    1e-17   
ref|XP_006837053.2|  PREDICTED: probable mitochondrial-processing...  91.3    1e-17   
gb|KJK89443.1|  hypothetical protein H633G_06692                      91.3    1e-17   
ref|XP_005801232.1|  PREDICTED: mitochondrial-processing peptidas...  90.9    1e-17   
ref|XP_005358415.1|  PREDICTED: mitochondrial-processing peptidas...  90.9    1e-17   
gb|KID75063.1|  Peptidase M16, core                                   91.3    2e-17   
ref|XP_007825098.2|  mitochondrial processing peptidase alpha sub...  91.3    2e-17   
gb|EXU97322.1|  peptidase M16 family protein                          91.3    2e-17   
ref|XP_003703722.1|  PREDICTED: mitochondrial-processing peptidas...  90.9    2e-17   
ref|XP_003655441.1|  hypothetical protein THITE_2119130               91.3    2e-17   
ref|XP_008399509.1|  PREDICTED: mitochondrial-processing peptidas...  90.9    2e-17   
ref|XP_006599164.1|  PREDICTED: probable mitochondrial-processing...  90.5    2e-17   
ref|XP_008792725.1|  PREDICTED: probable mitochondrial-processing...  91.3    2e-17   
ref|XP_658708.1|  hypothetical protein AN1104.2                       91.3    2e-17   
emb|CBQ72957.1|  probable mitochondrial processing peptidase alph...  91.7    2e-17   
gb|KID64964.1|  Peptidase M16, core                                   91.3    2e-17   
emb|CAJ83610.1|  peptidase (mitochondrial processing) beta            90.9    2e-17   
ref|XP_007577405.1|  PREDICTED: mitochondrial-processing peptidas...  90.9    2e-17   
ref|XP_005734725.1|  PREDICTED: cytochrome b-c1 complex subunit 2...  90.5    2e-17   
ref|XP_004558361.1|  PREDICTED: cytochrome b-c1 complex subunit 2...  90.5    2e-17   
ref|XP_001210472.1|  mitochondrial processing peptidase alpha sub...  91.3    2e-17   
gb|EME47007.1|  hypothetical protein DOTSEDRAFT_69101                 91.3    2e-17   
gb|KIO08564.1|  hypothetical protein M404DRAFT_134609                 90.9    2e-17   
ref|XP_005734724.1|  PREDICTED: cytochrome b-c1 complex subunit 2...  90.5    2e-17   
ref|XP_006651164.1|  PREDICTED: probable mitochondrial-processing...  90.5    2e-17   
ref|XP_006791525.1|  PREDICTED: cytochrome b-c1 complex subunit 2...  90.5    2e-17   
ref|XP_004652947.1|  PREDICTED: mitochondrial-processing peptidas...  90.5    2e-17   
ref|XP_009408617.1|  PREDICTED: probable mitochondrial-processing...  90.9    2e-17   
ref|XP_007271130.1|  mitochondrial processing peptidase               90.9    2e-17   
ref|XP_010349997.1|  PREDICTED: mitochondrial-processing peptidas...  87.8    2e-17   
ref|XP_004602325.1|  PREDICTED: mitochondrial-processing peptidas...  90.5    2e-17   
ref|XP_006965388.1|  predicted protein                                90.9    2e-17   
ref|XP_001229605.1|  hypothetical protein CHGG_03089                  90.9    2e-17   
ref|XP_008828982.1|  PREDICTED: mitochondrial-processing peptidas...  90.5    2e-17   
gb|EFA82909.1|  mitochondrial processing peptidase beta subunit       90.5    2e-17   
ref|XP_011138830.1|  PREDICTED: mitochondrial-processing peptidas...  90.5    2e-17   
ref|XP_006049911.1|  PREDICTED: mitochondrial-processing peptidas...  90.5    2e-17   
ref|XP_001488876.1|  PREDICTED: mitochondrial-processing peptidas...  90.5    2e-17   
tpg|DAA30658.1|  TPA: mitochondrial-processing peptidase subunit ...  90.5    2e-17   
gb|KIX08739.1|  hypothetical protein Z518_03396                       90.9    2e-17   
ref|XP_004439399.1|  PREDICTED: mitochondrial-processing peptidas...  90.5    2e-17   
dbj|BAE41163.1|  unnamed protein product                              90.1    2e-17   
ref|XP_003130289.1|  PREDICTED: mitochondrial-processing peptidas...  90.5    2e-17   
gb|KDR14885.1|  Mitochondrial-processing peptidase subunit beta       90.5    2e-17   
ref|XP_007233744.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    2e-17   
ref|XP_001650898.1|  AAEL005435-PA                                    90.1    2e-17   
ref|XP_005377286.1|  PREDICTED: mitochondrial-processing peptidas...  90.5    2e-17   
ref|XP_007669158.1|  PREDICTED: mitochondrial-processing peptidas...  90.5    2e-17   
ref|XP_005377285.1|  PREDICTED: mitochondrial-processing peptidas...  90.5    2e-17   
ref|XP_003855277.1|  matrix processing peptidase of mitochondria      90.5    2e-17   
ref|NP_001029785.1|  mitochondrial-processing peptidase subunit b...  90.5    2e-17   
ref|XP_010635334.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    2e-17   
ref|XP_005895313.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    2e-17   
ref|XP_007532743.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    2e-17   
ref|XP_007532744.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    3e-17   
ref|XP_004479042.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    3e-17   
ref|XP_002778427.1|  conserved hypothetical protein                   89.7    3e-17   
ref|XP_001507859.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    3e-17   
ref|XP_004591410.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    3e-17   
ref|NP_082707.1|  mitochondrial-processing peptidase subunit beta...  90.1    3e-17   
ref|XP_007641060.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    3e-17   
ref|XP_008230864.1|  PREDICTED: probable mitochondrial-processing...  90.5    3e-17   
ref|XP_005679165.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    3e-17   
ref|XP_007177379.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    3e-17   
ref|XP_011993295.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    3e-17   
ref|XP_005925440.1|  PREDICTED: cytochrome b-c1 complex subunit 2...  90.1    3e-17   
ref|XP_001134518.1|  mitochondrial processing peptidase beta subunit  90.1    3e-17   
ref|XP_004390779.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    3e-17   
emb|CDJ37319.1|  mitochondrial-processing peptidase alpha subunit...  90.5    3e-17   
ref|XP_006834428.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    3e-17   
ref|XP_008600381.1|  insulinase-like protein                          90.5    3e-17   
ref|XP_002149299.1|  mitochondrial processing peptidase alpha sub...  90.5    3e-17   
ref|XP_005961132.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    3e-17   
gb|EEH21191.2|  hypothetical protein PABG_03422                       90.5    3e-17   
ref|XP_002484862.1|  mitochondrial processing peptidase alpha sub...  90.5    3e-17   
ref|XP_003469905.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    3e-17   
ref|XP_001863592.1|  mitochondrial processing peptidase beta subunit  90.1    3e-17   
ref|XP_004007875.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    3e-17   
ref|XP_005080943.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    3e-17   
ref|XP_008170690.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    3e-17   
gb|KJX92983.1|  mitochondrial-processing peptidase subunit alpha ...  90.5    3e-17   
ref|XP_004639320.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    3e-17   
ref|XP_004677214.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    3e-17   
ref|XP_007942807.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    3e-17   
gb|KGN44047.1|  hypothetical protein Csa_7G135920                     86.3    3e-17   
ref|XP_002789779.1|  mitochondrial-processing peptidase subunit a...  90.5    3e-17   
ref|XP_005863048.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    3e-17   
ref|XP_006137599.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    3e-17   
emb|CDP02290.1|  unnamed protein product                              90.1    3e-17   
ref|XP_003361114.1|  PREDICTED: mitochondrial-processing peptidas...  90.5    3e-17   
ref|XP_003547775.1|  PREDICTED: probable mitochondrial-processing...  90.1    3e-17   
dbj|GAK64491.1|  mtochondrial processing peptidase                    90.5    3e-17   
gb|KDO27764.1|  hypothetical protein SPRG_07363                       89.7    3e-17   
gb|EKV05824.1|  Mitochondrial processing peptidase alpha subunit,...  90.5    4e-17   
ref|XP_001948008.1|  PREDICTED: mitochondrial-processing peptidas...  89.7    4e-17   
ref|XP_007641061.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    4e-17   
ref|XP_002559502.1|  Pc13g10820                                       90.5    4e-17   
emb|CCF52811.1|  probable mitochondrial processing peptidase alph...  90.5    4e-17   
ref|XP_009388910.1|  PREDICTED: probable mitochondrial-processing...  90.1    4e-17   
ref|XP_005319524.1|  PREDICTED: mitochondrial-processing peptidas...  89.7    4e-17   
ref|XP_005101318.1|  PREDICTED: mitochondrial-processing peptidas...  89.7    4e-17   
ref|XP_006774967.1|  PREDICTED: mitochondrial-processing peptidas...  89.4    4e-17   
ref|XP_008684373.1|  PREDICTED: mitochondrial-processing peptidas...  89.7    4e-17   
ref|XP_533104.3|  PREDICTED: mitochondrial-processing peptidase s...  89.7    4e-17   
ref|XP_003982736.1|  PREDICTED: mitochondrial-processing peptidas...  89.7    4e-17   
ref|XP_002928710.1|  PREDICTED: mitochondrial-processing peptidas...  89.7    4e-17   
ref|XP_006925454.1|  PREDICTED: mitochondrial-processing peptidas...  89.7    4e-17   
ref|XP_008608265.1|  mitochondrial processing peptidase               89.4    4e-17   
ref|XP_008060688.1|  PREDICTED: mitochondrial-processing peptidas...  90.1    4e-17   
gb|ETN64350.1|  mitochondrial processing peptidase beta subunit       89.7    4e-17   
ref|XP_008590511.1|  PREDICTED: mitochondrial-processing peptidas...  89.7    4e-17   
gb|AAB84398.1|  mitochondrial processing protease beta precursor      86.3    4e-17   



>emb|CDP03229.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYRT ASR RALKGR  N AL RFASS AVAT SSSGG FSWLTGE+SS+LP LDFPLK 
Sbjct  1    MYRTVASRLRALKGRTGNGALKRFASSAAVATQSSSGGFFSWLTGEKSSSLPSLDFPLKD  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            VT+PPP+PD+VEPG TKITTLPNGL+IASETSA+PAAS+GLYVD GSIYE P S+GA+HL
Sbjct  61   VTIPPPVPDYVEPGKTKITTLPNGLRIASETSANPAASIGLYVDCGSIYEAPTSYGATHL  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NRSHLRVVREVEAIGG+V AAASREQM YTYDALKT++P MVELLV
Sbjct  121  LERMAFKSTKNRSHLRVVREVEAIGGNVTAAASREQMVYTYDALKTHLPEMVELLV  176



>ref|XP_011093662.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Sesamum indicum]
Length=505

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYRTAASR RALKGR   R L R+AS++A+AT SSSGGLF WLTGE+SS+LPPLDFPLK 
Sbjct  1    MYRTAASRVRALKGRTGYRGLARYASTSAIATKSSSGGLFGWLTGEKSSSLPPLDFPLKD  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V LPPPLPD+VEPG TKITTLPNGLK+ASE SA+PAAS+GLYVD GSI+E PAS+GA+HL
Sbjct  61   VVLPPPLPDYVEPGKTKITTLPNGLKVASEPSANPAASIGLYVDCGSIHETPASYGATHL  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NRSHLR+VREVEAIGG+V A+ SRE M+YTYDALK+YVP MVELL+
Sbjct  121  LERMAFKSTTNRSHLRIVREVEAIGGNVTASVSREHMSYTYDALKSYVPQMVELLI  176



>ref|XP_011093661.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Sesamum indicum]
Length=505

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYRTA SR RALKGR   R L R+AS++A+AT SSSG LF WLTGE+SS+LPPLDFPL  
Sbjct  1    MYRTAVSRVRALKGRTGYRGLARYASTSAIATKSSSGSLFGWLTGEKSSSLPPLDFPLND  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V LPPPLPD+VEP  TKITTLPNGLKIASETSA+PAAS+GLYVD GSIYE PAS+GA+HL
Sbjct  61   VVLPPPLPDYVEPAKTKITTLPNGLKIASETSANPAASIGLYVDCGSIYETPASYGATHL  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NRSHLR+VREVEAIGG+V A+ SRE M+YTYDALK+YVP MVELL+
Sbjct  121  LERMAFKSTTNRSHLRIVREVEAIGGNVTASVSREHMSYTYDALKSYVPQMVELLI  176



>ref|XP_010244405.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Nelumbo nucifera]
Length=506

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 149/177 (84%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFass-tavatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYRT ASR R LKG   NR   RFASS       SSSGG FSWLTGERSS+LPPLDFPL 
Sbjct  1    MYRTVASRFRVLKGHGINRGAARFASSGAMATRTSSSGGFFSWLTGERSSSLPPLDFPLP  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GVTLPPPLPD+VEPG TKITTLPNG+KIASETS +P AS+GLYVD GS+YE P SFGA+H
Sbjct  61   GVTLPPPLPDYVEPGKTKITTLPNGVKIASETSMNPTASIGLYVDCGSVYETPISFGATH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKST NRSHLR+VREVEAIGG+V A+ASREQM Y+YDALKTYVP MVELL+
Sbjct  121  LLERMAFKSTANRSHLRIVREVEAIGGNVTASASREQMGYSYDALKTYVPEMVELLI  177



>ref|XP_009602845.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Nicotiana tomentosiformis]
Length=552

 Score =   272 bits (695),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 154/176 (88%), Gaps = 1/176 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYRTA+SR RALK R  +RA  RF+SSTAVAT  S GGLFSW+TG RS +LPPLDFPLK 
Sbjct  49   MYRTASSRFRALKVRGGSRAFVRFSSSTAVATKPS-GGLFSWITGGRSDSLPPLDFPLKD  107

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V LPPPLPD++EPG TKITTL NGLKIASETS+SPAAS+GLYVD GSIYE PAS+GA+HL
Sbjct  108  VQLPPPLPDYIEPGKTKITTLTNGLKIASETSSSPAASIGLYVDCGSIYETPASYGATHL  167

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKSTLNRSHLR+ REVEAIGG+V AAASRE M YTYDALKTYVP MVELLV
Sbjct  168  LERMAFKSTLNRSHLRIAREVEAIGGNVAAAASREHMIYTYDALKTYVPQMVELLV  223



>ref|XP_009783210.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Nicotiana sylvestris]
Length=504

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 152/176 (86%), Gaps = 1/176 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYRTA+SR RALK R  +RA  RF+SSTAV T  S GGLFSW+TG RS +LP LDFPLK 
Sbjct  1    MYRTASSRLRALKVRGGSRAFARFSSSTAVVTKPS-GGLFSWITGGRSDSLPSLDFPLKD  59

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V LPPPLPD++EPG TKITTL NGLKIASETS+SPAAS+GLYVD GSIYE P S+GA+HL
Sbjct  60   VQLPPPLPDYIEPGKTKITTLTNGLKIASETSSSPAASIGLYVDCGSIYETPVSYGATHL  119

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKSTLNRSHLR+VREVEAIGG+V AAASRE M YTYDALKTYVP MVELLV
Sbjct  120  LERMAFKSTLNRSHLRIVREVEAIGGNVAAAASREHMIYTYDALKTYVPQMVELLV  175



>ref|NP_001274924.1| mitochondrial-processing peptidase subunit alpha-like [Solanum 
tuberosum]
 emb|CAA56520.1| mitochondrial processing peptidase [Solanum tuberosum]
Length=504

 Score =   267 bits (683),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 150/176 (85%), Gaps = 1/176 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR  +SR RALK R +NR L RF  STAVAT  S GGLFSWLTG  S +LPPLDFPLK 
Sbjct  1    MYRATSSRLRALKVRGTNRVLARFLCSTAVATKPS-GGLFSWLTGGGSDSLPPLDFPLKD  59

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            + LPPPLPD+VEPG TKITTL NGLKIASE SASPAAS+GLYVD GSIYE PAS+GA+HL
Sbjct  60   IQLPPPLPDYVEPGKTKITTLTNGLKIASEISASPAASIGLYVDCGSIYEAPASYGATHL  119

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKSTLNRSHLR+VREVEAIGG+V AAASRE + YTYDALKTYVP MVELLV
Sbjct  120  LERMAFKSTLNRSHLRIVREVEAIGGNVTAAASREHLIYTYDALKTYVPQMVELLV  175



>ref|XP_009597035.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Nicotiana 
tomentosiformis]
Length=504

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 151/176 (86%), Gaps = 1/176 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR A+SR  +LK R  NR LTRF+SSTAVAT  S GG+FSWLTGE+SS  PPLDFPL  
Sbjct  1    MYRIASSRLSSLKARQVNRVLTRFSSSTAVATKPS-GGIFSWLTGEKSSQQPPLDFPLND  59

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V L PPLPD+VEPG T+ITTL NGLK+ASETSA+PAAS+GLYVD GSIYE PAS+G +HL
Sbjct  60   VKLSPPLPDYVEPGKTQITTLANGLKVASETSANPAASIGLYVDCGSIYETPASYGVTHL  119

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKSTLNRSHLR+VRE+EAIGG+V A+ASRE M YTYDALKTYVP MVE+LV
Sbjct  120  LERMAFKSTLNRSHLRIVREIEAIGGNVTASASREHMIYTYDALKTYVPQMVEMLV  175



>ref|XP_002283310.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Vitis 
vinifera]
 emb|CBI27974.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   262 bits (670),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsss-GGLFSWLTGERSSALPPLDFPLK  330
            MYRTAASR RALKGRA +RAL RFASS+AVAT+SSS GGLFSWL G++S  LPPLDFPL 
Sbjct  1    MYRTAASRVRALKGRAGSRALIRFASSSAVATSSSSSGGLFSWLIGDKSKTLPPLDFPLP  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
             V LPP LPD+VEP   KITT+ NG+KIASETSA+PAAS+GLYVD GSIYE P SFGA+H
Sbjct  61   NVALPPALPDYVEPSKVKITTISNGVKIASETSANPAASIGLYVDCGSIYETPISFGATH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKST+NRS+LRV+REVEAIGG+V A+ASREQM YT+DALKTYVP MVELL+
Sbjct  121  LLERMAFKSTINRSYLRVIREVEAIGGNVTASASREQMGYTFDALKTYVPEMVELLI  177



>ref|XP_009757181.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Nicotiana 
sylvestris]
Length=504

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 149/176 (85%), Gaps = 1/176 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR A+SR  +LK R  NR LTRF+SS AVAT  S GGLFSWLTGE+SS  PPLDFPL  
Sbjct  1    MYRIASSRLSSLKARQVNRVLTRFSSSAAVATKPS-GGLFSWLTGEKSSQQPPLDFPLND  59

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V L  PLPD+VEPG T+ITTL NGLK+ASETS +PAAS+GLYVD GSIYE PAS+GA+HL
Sbjct  60   VKLSTPLPDYVEPGKTQITTLANGLKVASETSVNPAASIGLYVDCGSIYETPASYGATHL  119

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKSTLNRSHLR+VRE+EAIGG+V A+ASRE M YTYDALKTYVP MVE+LV
Sbjct  120  LERMAFKSTLNRSHLRIVREIEAIGGNVTASASREHMIYTYDALKTYVPQMVEMLV  175



>gb|KHF99831.1| Mitochondrial-processing peptidase subunit alpha [Gossypium arboreum]
Length=507

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 150/177 (85%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatns-ssGGLFSWLTGERSSALPPLDFPLK  330
            MYRT+ASR RALKG  S  A  RFASS+ VAT S SSGGL SWLTG +S  +P LDFPL 
Sbjct  1    MYRTSASRLRALKGCTSRIAPARFASSSTVATTSPSSGGLLSWLTGSQSKYVPSLDFPLP  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV LPP LPD+VEPG TKITTLPNGLK+ASETSASPAAS+GLYVD GSIYE PASFG SH
Sbjct  61   GVALPPSLPDYVEPGKTKITTLPNGLKVASETSASPAASIGLYVDCGSIYESPASFGVSH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKST NRSHLR+VREVEAIGG+V AA SREQ+ YT+DALKTYVP MVELL+
Sbjct  121  LLERMAFKSTTNRSHLRIVREVEAIGGNVNAAVSREQIGYTFDALKTYVPEMVELLI  177



>gb|KJB83099.1| hypothetical protein B456_013G229300 [Gossypium raimondii]
Length=366

 Score =   254 bits (650),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 148/177 (84%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFass-tavatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYR AASR RALKG   +R   RF++S  A  T+SSSGGL  W TG +S+++P LDFPL 
Sbjct  1    MYRAAASRLRALKGLTCHRVPARFSTSVAAATTSSSSGGLLGWFTGGQSNSIPSLDFPLP  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV LP  LPD+VEPG TKITTLPNGLK+ASETSA+PAAS+GLYVD GSIYE PASFG SH
Sbjct  61   GVALPSSLPDYVEPGKTKITTLPNGLKVASETSANPAASIGLYVDCGSIYESPASFGVSH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKST NRSHLR+VREVEAIGG+VQAA SREQ+ YT+DALKTYVP MVELL+
Sbjct  121  LLERMAFKSTTNRSHLRIVREVEAIGGNVQAAVSREQIGYTFDALKTYVPEMVELLI  177



>ref|XP_004503508.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Cicer arietinum]
Length=510

 Score =   257 bits (657),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 150/181 (83%), Gaps = 5/181 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRA--LTRFasstavatns---ssGGLFSWLTGERSSALPPLD  318
            MYR AASR RAL+ R+ NR     RFASS++VAT       GGL  W+ G+RS+++PPLD
Sbjct  1    MYRNAASRLRALRARSYNRVPINARFASSSSVATKQPSSGLGGLLGWIIGDRSTSVPPLD  60

Query  319  FPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASF  498
            FPL GVTLPPPLPDHV PG T ITTLPNGLK+ASETSASP AS+GLYVD GSIYE P +F
Sbjct  61   FPLPGVTLPPPLPDHVAPGKTVITTLPNGLKVASETSASPTASIGLYVDCGSIYETPLTF  120

Query  499  GASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
            GA+HLLERMAFK+T NRSH RVVREVEAIGG+VQA+ASREQM YT+DALKTYVP MVELL
Sbjct  121  GATHLLERMAFKTTTNRSHFRVVREVEAIGGNVQASASREQMGYTFDALKTYVPEMVELL  180

Query  679  V  681
            V
Sbjct  181  V  181



>gb|KJB83096.1| hypothetical protein B456_013G229300 [Gossypium raimondii]
Length=490

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 148/177 (84%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFass-tavatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYR AASR RALKG   +R   RF++S  A  T+SSSGGL  W TG +S+++P LDFPL 
Sbjct  1    MYRAAASRLRALKGLTCHRVPARFSTSVAAATTSSSSGGLLGWFTGGQSNSIPSLDFPLP  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV LP  LPD+VEPG TKITTLPNGLK+ASETSA+PAAS+GLYVD GSIYE PASFG SH
Sbjct  61   GVALPSSLPDYVEPGKTKITTLPNGLKVASETSANPAASIGLYVDCGSIYESPASFGVSH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKST NRSHLR+VREVEAIGG+VQAA SREQ+ YT+DALKTYVP MVELL+
Sbjct  121  LLERMAFKSTTNRSHLRIVREVEAIGGNVQAAVSREQIGYTFDALKTYVPEMVELLI  177



>ref|XP_008447564.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Cucumis melo]
Length=505

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 151/176 (86%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            M+R A SR R+LK  A+N   +RFA+STAVAT  +SGG FSWLTGERSS+LPP++ PL G
Sbjct  1    MHRIAGSRLRSLKNHAANLGASRFATSTAVATRPTSGGFFSWLTGERSSSLPPMEIPLSG  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            + LPPPLPDHVEP  TKITTLPNG++IASETS++PAAS+G+Y+D GSIYE P S GASHL
Sbjct  61   INLPPPLPDHVEPSKTKITTLPNGVRIASETSSNPAASIGIYLDCGSIYETPLSSGASHL  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LER+AFKST NRSHLR+VREVEAIGG+  A+ASREQM YT+DALKTYVP MVELLV
Sbjct  121  LERLAFKSTTNRSHLRIVREVEAIGGNTGASASREQMGYTFDALKTYVPEMVELLV  176



>gb|EYU30680.1| hypothetical protein MIMGU_mgv1a004957mg [Erythranthe guttata]
 gb|EYU30681.1| hypothetical protein MIMGU_mgv1a004957mg [Erythranthe guttata]
 gb|EYU30682.1| hypothetical protein MIMGU_mgv1a004957mg [Erythranthe guttata]
Length=503

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            M+RTA SRAR+LKGR   +   R+A+ + V+T  +S G FSWLTGE+SS+L PL  PL+ 
Sbjct  1    MFRTATSRARSLKGRTGYKGCARYATVSPVSTKPASAGFFSWLTGEKSSSLTPLGLPLEN  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            VTLPPPLPD+VEPG T++TTL NGLKIASETSA+PAAS+GLYV+ GSIYE PAS+GA+HL
Sbjct  61   VTLPPPLPDYVEPGKTRVTTLANGLKIASETSANPAASIGLYVNCGSIYETPASYGATHL  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NRSHLRVVREVEAIGG++ A+ SRE M+YTYD LKTYVP MVELLV
Sbjct  121  LERMAFKSTTNRSHLRVVREVEAIGGNITASGSREHMSYTYDGLKTYVPRMVELLV  176



>gb|KJB83098.1| hypothetical protein B456_013G229300 [Gossypium raimondii]
Length=484

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 148/177 (84%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFass-tavatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYR AASR RALKG   +R   RF++S  A  T+SSSGGL  W TG +S+++P LDFPL 
Sbjct  1    MYRAAASRLRALKGLTCHRVPARFSTSVAAATTSSSSGGLLGWFTGGQSNSIPSLDFPLP  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV LP  LPD+VEPG TKITTLPNGLK+ASETSA+PAAS+GLYVD GSIYE PASFG SH
Sbjct  61   GVALPSSLPDYVEPGKTKITTLPNGLKVASETSANPAASIGLYVDCGSIYESPASFGVSH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKST NRSHLR+VREVEAIGG+VQAA SREQ+ YT+DALKTYVP MVELL+
Sbjct  121  LLERMAFKSTTNRSHLRIVREVEAIGGNVQAAVSREQIGYTFDALKTYVPEMVELLI  177



>ref|XP_010098163.1| Mitochondrial-processing peptidase subunit alpha [Morus notabilis]
 gb|EXB74600.1| Mitochondrial-processing peptidase subunit alpha [Morus notabilis]
Length=505

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYRTAA R R+LKGR  N    R+A+++ VAT  +SGG FSWLTGERSS+LPPL+ PL G
Sbjct  1    MYRTAAFRLRSLKGRVGNSGAARYATASGVATRPTSGGFFSWLTGERSSSLPPLEIPLAG  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V L PPLPD+VEP  TKITTLPNG+KIAS+TS SPAAS+GLY++SGSIYE P + GA+HL
Sbjct  61   VNLLPPLPDYVEPSKTKITTLPNGVKIASQTSTSPAASIGLYINSGSIYEGPGTHGATHL  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NRSHLR+VREVEAIGG++ A ASREQM YT+DALKT++P MVELL+
Sbjct  121  LERMAFKSTTNRSHLRIVREVEAIGGNINATASREQMGYTFDALKTHIPQMVELLI  176



>gb|KJB83097.1| hypothetical protein B456_013G229300 [Gossypium raimondii]
Length=505

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 148/177 (84%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFass-tavatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYR AASR RALKG   +R   RF++S  A  T+SSSGGL  W TG +S+++P LDFPL 
Sbjct  1    MYRAAASRLRALKGLTCHRVPARFSTSVAAATTSSSSGGLLGWFTGGQSNSIPSLDFPLP  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV LP  LPD+VEPG TKITTLPNGLK+ASETSA+PAAS+GLYVD GSIYE PASFG SH
Sbjct  61   GVALPSSLPDYVEPGKTKITTLPNGLKVASETSANPAASIGLYVDCGSIYESPASFGVSH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKST NRSHLR+VREVEAIGG+VQAA SREQ+ YT+DALKTYVP MVELL+
Sbjct  121  LLERMAFKSTTNRSHLRIVREVEAIGGNVQAAVSREQIGYTFDALKTYVPEMVELLI  177



>gb|EYU27247.1| hypothetical protein MIMGU_mgv1a004049mg [Erythranthe guttata]
Length=547

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 149/176 (85%), Gaps = 1/176 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYRTA+SR R+LK R   R LTR+AS++ V   S   G F WLTGE+SS+LPPLDFPL+G
Sbjct  44   MYRTASSRLRSLKDRTGYRGLTRYASTSVVTNKSP-AGFFGWLTGEKSSSLPPLDFPLEG  102

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V LP  LPD+VEPG TKITTLPNG++IASET+A PAAS+GL+V+ GSIYE P+S+G +HL
Sbjct  103  VELPASLPDYVEPGKTKITTLPNGVRIASETAAEPAASIGLHVECGSIYESPSSYGVTHL  162

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NRSHLR+VREVEAIGG+V A+ASRE MTYTYDALKTYVP MVELL+
Sbjct  163  LERMAFKSTTNRSHLRIVREVEAIGGNVNASASREHMTYTYDALKTYVPQMVELLI  218



>ref|XP_004510321.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Cicer arietinum]
Length=506

 Score =   254 bits (650),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 148/177 (84%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYR-TAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYR TA+S  R LKGR  N   TR A+S+AVA   SSGGLFSWLTGERSS+LPPLD PL 
Sbjct  1    MYRATASSLKRHLKGRGGNLGATRLATSSAVAAKVSSGGLFSWLTGERSSSLPPLDTPLG  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
             V LP PLPD+VEP  TKITTLPNGLKIASETS +PAAS+GLY+D GSIYE P S GASH
Sbjct  61   SVVLPDPLPDYVEPSKTKITTLPNGLKIASETSQNPAASIGLYLDCGSIYETPLSSGASH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKST+NRSH R+VREVEAIGG++ A+ASREQM YT+DALKTYVP MVELLV
Sbjct  121  LLERMAFKSTVNRSHFRIVREVEAIGGNIGASASREQMGYTFDALKTYVPQMVELLV  177



>ref|NP_001275168.1| mitochondrial-processing peptidase subunit alpha [Solanum tuberosum]
 sp|P29677.1|MPPA_SOLTU RecName: Full=Mitochondrial-processing peptidase subunit alpha; 
AltName: Full=Alpha-MPP; AltName: Full=Ubiquinol-cytochrome-c 
reductase subunit II; Flags: Precursor [Solanum tuberosum]
 emb|CAA46990.1| mitochondrial processing peptidase [Solanum tuberosum]
Length=504

 Score =   254 bits (649),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR A+SR  +LK R  NR LTRF+SS AVAT  S GGLFSW+TG+ SS++ PLDFPL  
Sbjct  1    MYRCASSRLSSLKARQGNRVLTRFSSSAAVATKPS-GGLFSWITGDTSSSVTPLDFPLND  59

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V L PPLPD+VEP  T+ITTL NGLK+ASE S +PAAS+GLYVD GSIYE PAS+GA+HL
Sbjct  60   VKLSPPLPDYVEPAKTQITTLANGLKVASEASVNPAASIGLYVDCGSIYETPASYGATHL  119

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
            LERMAFKSTLNRSHLR+VRE+EAIGG+V A+ASRE M YTYDALKTYVP MVE+L
Sbjct  120  LERMAFKSTLNRSHLRIVREIEAIGGNVTASASREHMIYTYDALKTYVPQMVEML  174



>ref|XP_006353507.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Solanum tuberosum]
Length=504

 Score =   254 bits (649),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR A+SR  +LK R  NR LTRF+SS AVAT  S GGLFSW+TG+ SS++ PLDFPL  
Sbjct  1    MYRCASSRLSSLKARQGNRVLTRFSSSAAVATKPS-GGLFSWITGDTSSSVTPLDFPLND  59

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V L PPLPD+VEP  T+ITTL NGLK+ASE S +PAAS+GLYVD GSIYE PAS+GA+HL
Sbjct  60   VKLSPPLPDYVEPAKTQITTLANGLKVASEASVNPAASIGLYVDCGSIYETPASYGATHL  119

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
            LERMAFKSTLNRSHLR+VRE+EAIGG+V A+ASRE M YTYDALKTYVP MVE+L
Sbjct  120  LERMAFKSTLNRSHLRIVREIEAIGGNVTASASREHMIYTYDALKTYVPQMVEML  174



>gb|KGN58021.1| hypothetical protein Csa_3G435020 [Cucumis sativus]
Length=484

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            M+R A SR R+LK  A+N   +RFA+S+AVA   +SGG FSWLTGERSS+LPP++ PL G
Sbjct  1    MHRIAGSRLRSLKNHAANLGASRFATSSAVAARPTSGGFFSWLTGERSSSLPPMEIPLSG  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            +TLPPPLPD VE   TKITTLPNG++IASETS++PAAS+G+Y+D GSIYE P S GASHL
Sbjct  61   ITLPPPLPDQVETSKTKITTLPNGVRIASETSSNPAASIGIYLDCGSIYETPLSSGASHL  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LER+AFKST NRSHLR+VREVEAIGG+  A+ASREQM YT+DALKTYVP MVELLV
Sbjct  121  LERLAFKSTTNRSHLRIVREVEAIGGNTGASASREQMGYTFDALKTYVPEMVELLV  176



>ref|XP_004149179.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Cucumis 
sativus]
Length=505

 Score =   252 bits (644),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            M+R A SR R+LK  A+N   +RFA+S+AVA   +SGG FSWLTGERSS+LPP++ PL G
Sbjct  1    MHRIAGSRLRSLKNHAANLGASRFATSSAVAARPTSGGFFSWLTGERSSSLPPMEIPLSG  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            +TLPPPLPD VE   TKITTLPNG++IASETS++PAAS+G+Y+D GSIYE P S GASHL
Sbjct  61   ITLPPPLPDQVETSKTKITTLPNGVRIASETSSNPAASIGIYLDCGSIYETPLSSGASHL  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LER+AFKST NRSHLR+VREVEAIGG+  A+ASREQM YT+DALKTYVP MVELLV
Sbjct  121  LERLAFKSTTNRSHLRIVREVEAIGGNTGASASREQMGYTFDALKTYVPEMVELLV  176



>gb|KDO55880.1| hypothetical protein CISIN_1g0104471mg, partial [Citrus sinensis]
Length=389

 Score =   248 bits (634),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 152/179 (85%), Gaps = 3/179 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNR--ALTRFasstavatnsss-GGLFSWLTGERSSALPPLDFP  324
            MYR AASR RALKG    R  + TRFASS+AVA+ SSS GGLFSWLTGERSS+ P LDFP
Sbjct  1    MYRNAASRLRALKGHVRCRVPSATRFASSSAVASTSSSSGGLFSWLTGERSSSSPSLDFP  60

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            L GV+LPP LPD+VEPG TKI+TLPNG+KIASETS SP AS+ LYV  GSIYE P SFG 
Sbjct  61   LPGVSLPPSLPDYVEPGKTKISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGT  120

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +HLLERMAF+ST NRSHLR+VREVEAIGG+VQA+ASREQM Y++DALKTYVP MVELL+
Sbjct  121  THLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEMVELLI  179



>ref|XP_006451350.1| hypothetical protein CICLE_v10008040mg [Citrus clementina]
 gb|ESR64590.1| hypothetical protein CICLE_v10008040mg [Citrus clementina]
 gb|KDO55878.1| hypothetical protein CISIN_1g0104471mg [Citrus sinensis]
Length=395

 Score =   248 bits (634),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 152/179 (85%), Gaps = 3/179 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNR--ALTRFasstavatnsss-GGLFSWLTGERSSALPPLDFP  324
            MYR AASR RALKG    R  + TRFASS+AVA+ SSS GGLFSWLTGERSS+ P LDFP
Sbjct  1    MYRNAASRLRALKGHVRCRVPSATRFASSSAVASTSSSSGGLFSWLTGERSSSSPSLDFP  60

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            L GV+LPP LPD+VEPG TKI+TLPNG+KIASETS SP AS+ LYV  GSIYE P SFG 
Sbjct  61   LPGVSLPPSLPDYVEPGKTKISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGT  120

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +HLLERMAF+ST NRSHLR+VREVEAIGG+VQA+ASREQM Y++DALKTYVP MVELL+
Sbjct  121  THLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEMVELLI  179



>ref|XP_009415735.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Musa acuminata subsp. malaccensis]
Length=500

 Score =   251 bits (642),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 147/176 (84%), Gaps = 5/176 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR A SR RAL+  A  RA TR+AS++    +S  GG FSWLTGE+SS LPPLDFPL G
Sbjct  1    MYRVAVSRLRALEHHA--RA-TRYASTSVAKRSS--GGFFSWLTGEQSSQLPPLDFPLPG  55

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V LPPPLPDHVEPG TKITTLPNG+KIASETS +PA S+GLYVD GS+YE P SFGA+HL
Sbjct  56   VMLPPPLPDHVEPGKTKITTLPNGVKIASETSPNPAFSLGLYVDCGSVYETPLSFGATHL  115

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LE MAFKST NRSHLR+VREVEAIGG+V A+ASREQM YTYDALKTY+P MVE+LV
Sbjct  116  LELMAFKSTTNRSHLRIVREVEAIGGNVMASASREQMGYTYDALKTYMPEMVEVLV  171



>gb|KHG30214.1| Mitochondrial-processing peptidase subunit alpha [Gossypium arboreum]
Length=505

 Score =   252 bits (643),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 147/177 (83%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFass-tavatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYR AAS  RALKGR  +R   RF++S  A  T+SSSGGL  W TG +S+++P LDFPL 
Sbjct  1    MYRAAASGLRALKGRTYHRVPARFSTSVAAATTSSSSGGLLGWFTGGQSNSIPSLDFPLP  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV LP  LPD+VEPG TKITTLPNGLK+ASET A+PAAS+GLYVD GSIYE PASFG SH
Sbjct  61   GVALPSSLPDYVEPGKTKITTLPNGLKVASETLANPAASIGLYVDCGSIYESPASFGVSH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKST NRSHLR+VREVEAIGG+VQAA SREQ+ YT+DALKTYVP MVELL+
Sbjct  121  LLERMAFKSTTNRSHLRIVREVEAIGGNVQAAVSREQIGYTFDALKTYVPEMVELLI  177



>ref|XP_003525296.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform 1 [Glycine max]
 gb|KHM99824.1| Mitochondrial-processing peptidase subunit alpha [Glycine soja]
Length=511

 Score =   251 bits (642),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 149/183 (81%), Gaps = 7/183 (4%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNR-----ALTRFasstavatnsssG--GLFSWLTGERSSALPP  312
            MYR AASR RA+K R+ +      A  RFASS A   +SSSG  GLF WLTG+R+S+LP 
Sbjct  1    MYRNAASRLRAIKARSCSSSSRVPASARFASSVATQQSSSSGLGGLFGWLTGDRTSSLPS  60

Query  313  LDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPA  492
            L FPL GVTLPPPLPD+V PG T ITTLPNGLK+ASETS SP AS+GLYVD GSIYE P 
Sbjct  61   LGFPLPGVTLPPPLPDYVAPGKTIITTLPNGLKVASETSPSPTASIGLYVDCGSIYESPI  120

Query  493  SFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVE  672
            SFGA+HLLERMAFK+T NRSH RVVREVEAIGG+VQA+ASREQM YT+DALKTYVP MVE
Sbjct  121  SFGATHLLERMAFKTTRNRSHFRVVREVEAIGGNVQASASREQMGYTFDALKTYVPEMVE  180

Query  673  LLV  681
            LLV
Sbjct  181  LLV  183



>gb|KDO55881.1| hypothetical protein CISIN_1g0104471mg, partial [Citrus sinensis]
 gb|KDO55882.1| hypothetical protein CISIN_1g0104471mg, partial [Citrus sinensis]
 gb|KDO55883.1| hypothetical protein CISIN_1g0104471mg, partial [Citrus sinensis]
Length=391

 Score =   248 bits (633),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 152/179 (85%), Gaps = 3/179 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNR--ALTRFasstavatnsss-GGLFSWLTGERSSALPPLDFP  324
            MYR AASR RALKG    R  + TRFASS+AVA+ SSS GGLFSWLTGERSS+ P LDFP
Sbjct  1    MYRNAASRLRALKGHVRCRVPSATRFASSSAVASTSSSSGGLFSWLTGERSSSSPSLDFP  60

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            L GV+LPP LPD+VEPG TKI+TLPNG+KIASETS SP AS+ LYV  GSIYE P SFG 
Sbjct  61   LPGVSLPPSLPDYVEPGKTKISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGT  120

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +HLLERMAF+ST NRSHLR+VREVEAIGG+VQA+ASREQM Y++DALKTYVP MVELL+
Sbjct  121  THLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEMVELLI  179



>ref|XP_004251648.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Solanum 
lycopersicum]
Length=504

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 146/176 (83%), Gaps = 1/176 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR  +SR  +LK R  NR LTRF+SS AVAT  S GGLFSW+TG+ SS++ PLDFPL  
Sbjct  1    MYRCVSSRLSSLKARQGNRVLTRFSSSAAVATKPS-GGLFSWITGDTSSSVTPLDFPLND  59

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V L PPLPD+VEP  T+ITTL NG+K+ASE S +PAAS+GLYVD GSIYE P S+GA+HL
Sbjct  60   VKLSPPLPDYVEPAKTRITTLANGVKVASEASVNPAASIGLYVDCGSIYETPVSYGATHL  119

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKSTLNRSHLR+VRE+EAIGG+V A+ASRE M YTYDALKTYVP MVE+LV
Sbjct  120  LERMAFKSTLNRSHLRIVREIEAIGGNVTASASREHMIYTYDALKTYVPQMVEMLV  175



>ref|XP_010545654.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-1 [Tarenaya hassleriana]
Length=502

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 153/177 (86%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRAS-NRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYRTAASRAR+LKG  + N    R+ASS+AV+T+SSSGGLFSWLTGE SS+LPP+D PLK
Sbjct  1    MYRTAASRARSLKGCLTRNVRAARYASSSAVSTSSSSGGLFSWLTGETSSSLPPMDMPLK  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV++PPPL DHVEP   K+TTLPNGLKIASETS +PAAS+GLYVD GSIYE   S GA+H
Sbjct  61   GVSIPPPLADHVEPSKVKVTTLPNGLKIASETSPNPAASIGLYVDCGSIYETTYSHGATH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKSTLNRSHLR+VREVEAIGG+  A+ASREQM YT DALKTYVP MVE+L+
Sbjct  121  LLERMAFKSTLNRSHLRLVREVEAIGGNTTASASREQMGYTIDALKTYVPEMVEVLI  177



>ref|XP_006451348.1| hypothetical protein CICLE_v10008040mg [Citrus clementina]
 gb|ESR64588.1| hypothetical protein CICLE_v10008040mg [Citrus clementina]
Length=449

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 152/179 (85%), Gaps = 3/179 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNR--ALTRFasstavatnsss-GGLFSWLTGERSSALPPLDFP  324
            MYR AASR RALKG    R  + TRFASS+AVA+ SSS GGLFSWLTGERSS+ P LDFP
Sbjct  1    MYRNAASRLRALKGHVRCRVPSATRFASSSAVASTSSSSGGLFSWLTGERSSSSPSLDFP  60

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            L GV+LPP LPD+VEPG TKI+TLPNG+KIASETS SP AS+ LYV  GSIYE P SFG 
Sbjct  61   LPGVSLPPSLPDYVEPGKTKISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGT  120

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +HLLERMAF+ST NRSHLR+VREVEAIGG+VQA+ASREQM Y++DALKTYVP MVELL+
Sbjct  121  THLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEMVELLI  179



>gb|KDO55885.1| hypothetical protein CISIN_1g0104471mg [Citrus sinensis]
Length=400

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 152/179 (85%), Gaps = 3/179 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNR--ALTRFasstavatnsss-GGLFSWLTGERSSALPPLDFP  324
            MYR AASR RALKG    R  + TRFASS+AVA+ SSS GGLFSWLTGERSS+ P LDFP
Sbjct  1    MYRNAASRLRALKGHVRCRVPSATRFASSSAVASTSSSSGGLFSWLTGERSSSSPSLDFP  60

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            L GV+LPP LPD+VEPG TKI+TLPNG+KIASETS SP AS+ LYV  GSIYE P SFG 
Sbjct  61   LPGVSLPPSLPDYVEPGKTKISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGT  120

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +HLLERMAF+ST NRSHLR+VREVEAIGG+VQA+ASREQM Y++DALKTYVP MVELL+
Sbjct  121  THLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEMVELLI  179



>gb|ACJ86233.1| unknown [Medicago truncatula]
 gb|AFK45711.1| unknown [Medicago truncatula]
Length=510

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 149/181 (82%), Gaps = 5/181 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNR--ALTRFasstavatns---ssGGLFSWLTGERSSALPPLD  318
            MYR  +SR RA + R+ NR  A TRFASS++V+      +SGGLF WLTG  + + PPLD
Sbjct  1    MYRNVSSRLRAYRARSCNRVPATTRFASSSSVSPKQSSSASGGLFGWLTGSSTPSAPPLD  60

Query  319  FPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASF  498
            FPL GVTLP PLPDHV PG T ITTLPNG+K+ASETS SPAAS+GLYVD GSIYE P +F
Sbjct  61   FPLPGVTLPAPLPDHVAPGKTIITTLPNGVKVASETSPSPAASIGLYVDCGSIYETPLTF  120

Query  499  GASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
            GA+HLLERMAFK+T+NRSH RVVREVEAIGG+VQA+ASREQM YT+DALKTYVP MVELL
Sbjct  121  GATHLLERMAFKTTVNRSHFRVVREVEAIGGNVQASASREQMGYTFDALKTYVPEMVELL  180

Query  679  V  681
            V
Sbjct  181  V  181



>ref|XP_003630686.1| Mitochondrial-processing peptidase subunit alpha [Medicago truncatula]
 gb|AET05162.1| processing peptidase [Medicago truncatula]
Length=510

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 148/181 (82%), Gaps = 5/181 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNR--ALTRFasstavatns---ssGGLFSWLTGERSSALPPLD  318
            MYR  +SR RA + R+ NR  A TRFASS++V+      + GGLF WLTG  + + PPLD
Sbjct  1    MYRNVSSRLRAYRARSCNRVPATTRFASSSSVSPKQSSSALGGLFGWLTGSSTPSAPPLD  60

Query  319  FPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASF  498
            FPL GVTLP PLPDHV PG T ITTLPNG+K+ASETS SPAAS+GLYVD GSIYE P +F
Sbjct  61   FPLPGVTLPAPLPDHVAPGKTIITTLPNGVKVASETSPSPAASIGLYVDCGSIYETPLTF  120

Query  499  GASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
            GA+HLLERMAFK+T+NRSH RVVREVEAIGG+VQA+ASREQM YT+DALKTYVP MVELL
Sbjct  121  GATHLLERMAFKTTVNRSHFRVVREVEAIGGNVQASASREQMGYTFDALKTYVPEMVELL  180

Query  679  V  681
            V
Sbjct  181  V  181



>ref|XP_006853743.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Amborella 
trichopoda]
 gb|ERN15210.1| hypothetical protein AMTR_s00056p00180950 [Amborella trichopoda]
Length=500

 Score =   249 bits (637),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 147/176 (84%), Gaps = 5/176 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR+AASR R+LKG A+ R      +ST VA  S+SGG FSWLTGE+SS L PLD PL G
Sbjct  1    MYRSAASRLRSLKGLAAAR-----FASTEVAKRSTSGGFFSWLTGEKSSTLAPLDVPLPG  55

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            VTLPPPLPD+VEPG TKITTLPNG KIASE S +PAAS+GLYVD GS+YE P S GA+HL
Sbjct  56   VTLPPPLPDYVEPGKTKITTLPNGAKIASEASTNPAASIGLYVDCGSVYETPYSIGATHL  115

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NRSHLR+VREVEAIGG+V A+ASREQM Y+YDALKTY+P MVE+L+
Sbjct  116  LERMAFKSTTNRSHLRIVREVEAIGGNVTASASREQMGYSYDALKTYLPEMVEVLI  171



>ref|XP_006451349.1| hypothetical protein CICLE_v10008040mg [Citrus clementina]
 gb|ESR64589.1| hypothetical protein CICLE_v10008040mg [Citrus clementina]
Length=512

 Score =   250 bits (638),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 152/179 (85%), Gaps = 3/179 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNR--ALTRFasstavatnsss-GGLFSWLTGERSSALPPLDFP  324
            MYR AASR RALKG    R  + TRFASS+AVA+ SSS GGLFSWLTGERSS+ P LDFP
Sbjct  1    MYRNAASRLRALKGHVRCRVPSATRFASSSAVASTSSSSGGLFSWLTGERSSSSPSLDFP  60

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            L GV+LPP LPD+VEPG TKI+TLPNG+KIASETS SP AS+ LYV  GSIYE P SFG 
Sbjct  61   LPGVSLPPSLPDYVEPGKTKISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGT  120

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +HLLERMAF+ST NRSHLR+VREVEAIGG+VQA+ASREQM Y++DALKTYVP MVELL+
Sbjct  121  THLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEMVELLI  179



>ref|XP_006475356.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Citrus sinensis]
Length=510

 Score =   249 bits (637),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 152/179 (85%), Gaps = 3/179 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNR--ALTRFasstavatnsss-GGLFSWLTGERSSALPPLDFP  324
            MYR AASR RALKG    R  + TRFASS+AVA+ SSS GGLFSWLTGERSS+ P LDFP
Sbjct  1    MYRNAASRLRALKGHVRCRVPSATRFASSSAVASTSSSSGGLFSWLTGERSSSSPSLDFP  60

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            L GV+LPP LPD+VEPG TKI+TLPNG+KIASETS SP AS+ LYV  GSIYE P SFG 
Sbjct  61   LPGVSLPPSLPDYVEPGKTKISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGT  120

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +HLLERMAF+ST NRSHLR+VREVEAIGG+VQA+ASREQM Y++DALKTYVP MVELL+
Sbjct  121  THLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEMVELLI  179



>ref|XP_011078227.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Sesamum indicum]
Length=502

 Score =   249 bits (636),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 149/176 (85%), Gaps = 3/176 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYRTAAS+ RALKG+   R   R+A+++AVA  SSSGG   WLTG++ S+LP L+FPLK 
Sbjct  1    MYRTAASKVRALKGQTGYRGSARYATTSAVAVKSSSGG---WLTGDQCSSLPSLNFPLKD  57

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V LPPPLPDHVEPG T+ITTLPNGLKIASET+A+P AS+GLYVD GSIYE+P S+G ++L
Sbjct  58   VNLPPPLPDHVEPGQTRITTLPNGLKIASETAANPVASIGLYVDCGSIYERPVSYGVTNL  117

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NRSHLR++RE+EAIGG+V A  SRE M+YTY+ALKTYVP MVELL+
Sbjct  118  LERMAFKSTTNRSHLRIIREIEAIGGNVTALGSREHMSYTYNALKTYVPQMVELLI  173



>gb|KJB27182.1| hypothetical protein B456_004G282800 [Gossypium raimondii]
Length=508

 Score =   249 bits (636),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 149/177 (84%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFS-WLTGERSSALPPLDFPLK  330
            MYRTAASR RALKGR S+ A  RFASS+ VAT SSS G    WLTG +S ++P LDFPL 
Sbjct  1    MYRTAASRLRALKGRTSHIAPARFASSSTVATTSSSSGGLLSWLTGSQSKSVPSLDFPLP  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV LPP LPD+VEPG TKITTLPNGLK+ASETSASPAAS+GLYVD GSIYE PASFG SH
Sbjct  61   GVALPPSLPDYVEPGKTKITTLPNGLKVASETSASPAASIGLYVDCGSIYESPASFGVSH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKST NRSHLR+VR VEAIGG+V AA SREQ+ YT+DALKTYVP MVELL+
Sbjct  121  LLERMAFKSTTNRSHLRIVRGVEAIGGNVNAAVSREQIGYTFDALKTYVPEMVELLI  177



>gb|KJB27183.1| hypothetical protein B456_004G282800 [Gossypium raimondii]
Length=507

 Score =   249 bits (636),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 149/177 (84%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFS-WLTGERSSALPPLDFPLK  330
            MYRTAASR RALKGR S+ A  RFASS+ VAT SSS G    WLTG +S ++P LDFPL 
Sbjct  1    MYRTAASRLRALKGRTSHIAPARFASSSTVATTSSSSGGLLSWLTGSQSKSVPSLDFPLP  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV LPP LPD+VEPG TKITTLPNGLK+ASETSASPAAS+GLYVD GSIYE PASFG SH
Sbjct  61   GVALPPSLPDYVEPGKTKITTLPNGLKVASETSASPAASIGLYVDCGSIYESPASFGVSH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKST NRSHLR+VR VEAIGG+V AA SREQ+ YT+DALKTYVP MVELL+
Sbjct  121  LLERMAFKSTTNRSHLRIVRGVEAIGGNVNAAVSREQIGYTFDALKTYVPEMVELLI  177



>gb|KCW82289.1| hypothetical protein EUGRSUZ_C03704 [Eucalyptus grandis]
Length=451

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFassta-vatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYR AASR RALKG A N+ L R AS++     +SSSGG+ SWLTG  SSA  PL++PL 
Sbjct  1    MYRAAASRVRALKGHACNKQLVRSASASTVATKSSSSGGILSWLTGGSSSASVPLEYPLS  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV LPPPLPD+VEP   KI+TLPNG+KIA+ETS +PAAS+GLYVD GSIYE P S G +H
Sbjct  61   GVDLPPPLPDYVEPSKIKISTLPNGVKIATETSTNPAASIGLYVDCGSIYETPISSGVTH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKST NRSHLR+VREVEAIGG+VQA+ASRE M YTYDALKTYVP MVELL+
Sbjct  121  LLERMAFKSTKNRSHLRLVREVEAIGGNVQASASREHMGYTYDALKTYVPEMVELLI  177



>ref|XP_003530483.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Glycine max]
Length=509

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 145/181 (80%), Gaps = 5/181 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNR----ALTRFasstavatnss-sGGLFSWLTGERSSALPPLD  318
            MYR AASR R +  R+ +     A  RF+SS A   +SS  GGLF WLTG+RSS+LP LD
Sbjct  1    MYRNAASRLRVISARSCSSSRIPASARFSSSVATQQSSSGLGGLFGWLTGDRSSSLPSLD  60

Query  319  FPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASF  498
            FPL GVTLPP LPD V PG T ITTLPNGLK+ASETS +P ASVGLYVD GSIYE P SF
Sbjct  61   FPLPGVTLPPSLPDFVAPGKTIITTLPNGLKVASETSPTPTASVGLYVDCGSIYETPISF  120

Query  499  GASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
            GA+HLLERMAFK+T NRSH RVVREVEAIGG+VQA+ASREQM YT+DALKTYVP MVELL
Sbjct  121  GATHLLERMAFKTTRNRSHFRVVREVEAIGGNVQASASREQMGYTFDALKTYVPEMVELL  180

Query  679  V  681
            V
Sbjct  181  V  181



>ref|XP_006378186.1| hypothetical protein POPTR_0010s04610g [Populus trichocarpa]
 gb|ERP55983.1| hypothetical protein POPTR_0010s04610g [Populus trichocarpa]
Length=477

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 149/177 (84%), Gaps = 3/177 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatn-sssGGLFSWLTGERSSALPPLDFPLK  330
            MYR+A SR RA KG    R  TRFASS+A A   SSS G FSWLTGE+S ++PPLDFPL 
Sbjct  1    MYRSAVSRLRAPKG--CRRYPTRFASSSATALQPSSSSGFFSWLTGEKSKSVPPLDFPLV  58

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV LP  LPD+VEPG TKITTL NGL+IASETS +PAAS+GLYVD GSIYE PA+FGA+H
Sbjct  59   GVELPSTLPDYVEPGVTKITTLGNGLRIASETSPNPAASIGLYVDCGSIYESPATFGATH  118

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +LERMAFKST NRSHLRVVREVEAIGGSVQ++ASREQM YTYDALKTY+P MVELL+
Sbjct  119  VLERMAFKSTRNRSHLRVVREVEAIGGSVQSSASREQMGYTYDALKTYLPEMVELLI  175



>ref|XP_006583043.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X2 [Glycine max]
Length=454

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASR-ARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYR AAS   R LKG   N   TRF++S AVA  +SSGGLFSWLTGERSSALPPLD PL 
Sbjct  1    MYRVAASSFRRHLKGHGGNLGSTRFSTSAAVAARTSSGGLFSWLTGERSSALPPLDMPLG  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV LP  LPD+VE   TKITTLPNGLKIASETS +PAAS+GLY+D GSIYE P S G SH
Sbjct  61   GVALPDSLPDYVEQSKTKITTLPNGLKIASETSPNPAASIGLYLDCGSIYETPLSSGVSH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKST NRSH R+VREVEAIGG++ A+ASREQM YT+DALKTY P MVELLV
Sbjct  121  LLERMAFKSTTNRSHFRIVREVEAIGGNIGASASREQMGYTFDALKTYAPQMVELLV  177



>ref|XP_008228401.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Prunus 
mume]
Length=503

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 145/176 (82%), Gaps = 2/176 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MY+ AASR RALKG A N   TRFA+S A    +S GG+FSWLTGE SS LPPL+  L G
Sbjct  1    MYK-AASRLRALKGHAGNLGATRFATSAAAIKPAS-GGIFSWLTGESSSTLPPLETQLPG  58

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V LPPPLPDHV+P  T+ITTL NG+KIASETS SPAAS+GLYVDSGSIYE P S GASHL
Sbjct  59   VNLPPPLPDHVQPSKTQITTLSNGVKIASETSPSPAASIGLYVDSGSIYETPESSGASHL  118

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LER+AFKST NRSHLR+VREVEAIGG + A+ASREQM YT+DA+KTYVP MVELLV
Sbjct  119  LERLAFKSTTNRSHLRIVREVEAIGGHIGASASREQMGYTFDAIKTYVPQMVELLV  174



>ref|XP_007215264.1| hypothetical protein PRUPE_ppa004554mg [Prunus persica]
 gb|EMJ16463.1| hypothetical protein PRUPE_ppa004554mg [Prunus persica]
Length=503

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 145/176 (82%), Gaps = 2/176 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MY+ AASR RALKGRA N   TRFA+S A    +S GG+FSWLTGE SS LPPL+  L G
Sbjct  1    MYK-AASRLRALKGRAGNVGATRFATSAAAIKPAS-GGIFSWLTGESSSTLPPLETQLPG  58

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V LPP LPDHV+P  T+ITTL NG+KIASETS SPAAS+GLYVDSGSIYE P S GASHL
Sbjct  59   VNLPPALPDHVQPSKTQITTLSNGVKIASETSPSPAASIGLYVDSGSIYETPESSGASHL  118

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LER+AFKST NRSHLR+VREVEAIGG + A+ASREQM YT+DA+KTYVP MVELLV
Sbjct  119  LERLAFKSTTNRSHLRIVREVEAIGGHIGASASREQMGYTFDAIKTYVPQMVELLV  174



>ref|XP_002283426.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Vitis 
vinifera]
 emb|CBI36036.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   247 bits (631),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 150/177 (85%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavat-nsssGGLFSWLTGERSSALPPLDFPLK  330
            MYRTAASR RALKGR  N    RFASS+AV   +SSS  LFSWLTGE+SS+L PL+ PL 
Sbjct  1    MYRTAASRLRALKGRGGNWRAARFASSSAVTVRSSSSPSLFSWLTGEKSSSLSPLNLPLA  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV+LPPPLPD+VEP  TKITTL NG+KIASETS +PAAS+G YVD GSIYE P SFGA+H
Sbjct  61   GVSLPPPLPDYVEPSKTKITTLSNGVKIASETSPNPAASIGFYVDCGSIYETPLSFGATH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKST NRSHLRVVREVEAIGG+V A+ASREQM YT+DALKTYVP MVELLV
Sbjct  121  LLERMAFKSTTNRSHLRVVREVEAIGGNVTASASREQMGYTFDALKTYVPEMVELLV  177



>ref|XP_010049597.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Eucalyptus grandis]
 gb|KCW82288.1| hypothetical protein EUGRSUZ_C03704 [Eucalyptus grandis]
Length=506

 Score =   247 bits (631),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFassta-vatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYR AASR RALKG A N+ L R AS++     +SSSGG+ SWLTG  SSA  PL++PL 
Sbjct  1    MYRAAASRVRALKGHACNKQLVRSASASTVATKSSSSGGILSWLTGGSSSASVPLEYPLS  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV LPPPLPD+VEP   KI+TLPNG+KIA+ETS +PAAS+GLYVD GSIYE P S G +H
Sbjct  61   GVDLPPPLPDYVEPSKIKISTLPNGVKIATETSTNPAASIGLYVDCGSIYETPISSGVTH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKST NRSHLR+VREVEAIGG+VQA+ASRE M YTYDALKTYVP MVELL+
Sbjct  121  LLERMAFKSTKNRSHLRLVREVEAIGGNVQASASREHMGYTYDALKTYVPEMVELLI  177



>gb|KHN16661.1| Mitochondrial-processing peptidase subunit alpha [Glycine soja]
Length=509

 Score =   247 bits (630),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 145/181 (80%), Gaps = 5/181 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNR----ALTRFasstavatnss-sGGLFSWLTGERSSALPPLD  318
            MYR AASR R +  R+ +     A  +FASS A   +SS  GGLF WLTG+RSS+LP LD
Sbjct  1    MYRNAASRLRVISARSCSSSRIPASAKFASSVATQQSSSGLGGLFGWLTGDRSSSLPSLD  60

Query  319  FPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASF  498
            FPL GVTLPP LPD V PG T ITTLPNGLK+ASETS +P ASVGLYVD GSIYE P SF
Sbjct  61   FPLPGVTLPPSLPDFVAPGKTIITTLPNGLKVASETSPTPTASVGLYVDCGSIYETPISF  120

Query  499  GASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
            GA+HLLERMAFK+T NRSH RVVREVEAIGG+VQA+ASREQM YT+DALKTYVP MVELL
Sbjct  121  GATHLLERMAFKTTRNRSHFRVVREVEAIGGNVQASASREQMGYTFDALKTYVPEMVELL  180

Query  679  V  681
            V
Sbjct  181  V  181



>ref|XP_003530042.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X1 [Glycine max]
Length=505

 Score =   246 bits (629),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASR-ARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYR AAS   R LKG   N   TRF++S AVA  +SSGGLFSWLTGERSSALPPLD PL 
Sbjct  1    MYRVAASSFRRHLKGHGGNLGSTRFSTSAAVAARTSSGGLFSWLTGERSSALPPLDMPLG  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV LP  LPD+VE   TKITTLPNGLKIASETS +PAAS+GLY+D GSIYE P S G SH
Sbjct  61   GVALPDSLPDYVEQSKTKITTLPNGLKIASETSPNPAASIGLYLDCGSIYETPLSSGVSH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKST NRSH R+VREVEAIGG++ A+ASREQM YT+DALKTY P MVELLV
Sbjct  121  LLERMAFKSTTNRSHFRIVREVEAIGGNIGASASREQMGYTFDALKTYAPQMVELLV  177



>ref|NP_001044193.1| Os01g0739000 [Oryza sativa Japonica Group]
 dbj|BAD86941.1| putative mitochondrial processing peptidase [Oryza sativa Japonica 
Group]
 dbj|BAF06107.1| Os01g0739000 [Oryza sativa Japonica Group]
 dbj|BAG91493.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93650.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGT38448.1| mitochondrial processing peptidase [Oryza sativa Japonica Group]
Length=499

 Score =   246 bits (628),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 143/176 (81%), Gaps = 6/176 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR A S  R+LK      + +RFAS++ V  +S  GGLFSWL GE+SS LPPLD PL G
Sbjct  1    MYRIAGSHLRSLK----RYSYSRFASTSVVKQSS--GGLFSWLLGEKSSQLPPLDVPLPG  54

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            +TLPPPLPD VEP  TK+TTLPNG+KIASETS SPAASVGLY+D GSIYE PAS GASHL
Sbjct  55   ITLPPPLPDFVEPSKTKVTTLPNGIKIASETSVSPAASVGLYIDCGSIYETPASSGASHL  114

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NRSHLR+VREVEAIGG+V A+ASREQM YTYDA K YVP MVE+L+
Sbjct  115  LERMAFKSTTNRSHLRLVREVEAIGGNVSASASREQMCYTYDAFKAYVPEMVEVLI  170



>gb|KHN39262.1| Mitochondrial-processing peptidase subunit alpha [Glycine soja]
Length=505

 Score =   246 bits (629),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASR-ARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYR AAS   R LKG   N   TRF++S AVA  +SSGGLFSWLTGERSSALPPLD PL 
Sbjct  1    MYRVAASSFRRHLKGHGGNLGSTRFSTSAAVAARTSSGGLFSWLTGERSSALPPLDMPLG  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV LP  LPD+VE   TKITTLPNGLKIASETS +PAAS+GLY+D GSIYE P S G SH
Sbjct  61   GVALPDSLPDYVEQSKTKITTLPNGLKIASETSPNPAASIGLYLDCGSIYETPLSSGVSH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKST NRSH R+VREVEAIGG++ A+ASREQM YT+DALKTY P MVELLV
Sbjct  121  LLERMAFKSTTNRSHFRIVREVEAIGGNIGASASREQMGYTFDALKTYAPQMVELLV  177



>gb|AFW78810.1| putative mitochondrial processing peptidase alpha subunit family 
protein [Zea mays]
Length=190

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 140/176 (80%), Gaps = 6/176 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR A S  R+LK   ++R       ++      SSGGLFSWL G +SS LPPLD PL G
Sbjct  1    MYRAAGSHLRSLKHHGASR------LASTSVAKQSSGGLFSWLLGGKSSELPPLDVPLPG  54

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            +++P PLPD VEP  TK+TTLPNG+KIASETS+SPAASVGLY+D GSIYE PAS G SHL
Sbjct  55   ISIPSPLPDFVEPSKTKVTTLPNGVKIASETSSSPAASVGLYIDCGSIYETPASSGVSHL  114

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST+NR+HLR+VREVEAIGG+V A+ASREQM+YTYDALK+Y P MVE+L+
Sbjct  115  LERMAFKSTVNRTHLRLVREVEAIGGNVSASASREQMSYTYDALKSYTPEMVEVLI  170



>ref|XP_011012737.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Populus euphratica]
Length=506

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 148/177 (84%), Gaps = 3/177 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatn-sssGGLFSWLTGERSSALPPLDFPLK  330
            MYR+A SR RA KG    R  TRFASS+A A   SSS G FSWLTGE+S ++PPLDFPL 
Sbjct  1    MYRSAVSRLRAPKG--CRRYPTRFASSSAAALQPSSSSGFFSWLTGEKSKSVPPLDFPLL  58

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV LP  LPD+VEPG TKITTL NGL+IASE S +PAAS+GLYVD GSIYE PA+FGA+H
Sbjct  59   GVELPSTLPDYVEPGVTKITTLGNGLRIASEASPNPAASIGLYVDCGSIYESPATFGATH  118

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +LERMAFKST NRSHLRVVREVEAIGGSVQ++ASREQM YTYDALKTY+P MVELL+
Sbjct  119  VLERMAFKSTRNRSHLRVVREVEAIGGSVQSSASREQMGYTYDALKTYLPEMVELLI  175



>ref|XP_008799765.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Phoenix dactylifera]
Length=507

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 143/179 (80%), Gaps = 6/179 (3%)
 Frame = +1

Query  154  MYRTAASRARALK----GRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDF  321
            MYR   S  RALK    G  S  A TR  S++      SSGG FSWLTGERS+ LPPLDF
Sbjct  1    MYRALGSHLRALKRHVGGTGSIGASTR--SASTSVAKRSSGGFFSWLTGERSNQLPPLDF  58

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
            PL GVTLPPPLPD+VEPG TKITTLPNG+KIASE+S +PAAS+GLYVD GS+YE P S G
Sbjct  59   PLPGVTLPPPLPDYVEPGKTKITTLPNGVKIASESSPNPAASIGLYVDCGSVYETPVSSG  118

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
             +HLLERMAFKST NRSHLR+VREVEAIGG+V A+ASREQM YT+DALKTY+P MVE+L
Sbjct  119  VTHLLERMAFKSTTNRSHLRIVREVEAIGGNVTASASREQMGYTFDALKTYMPEMVEVL  177



>ref|XP_010086910.1| Mitochondrial-processing peptidase subunit alpha [Morus notabilis]
 gb|EXB24701.1| Mitochondrial-processing peptidase subunit alpha [Morus notabilis]
Length=508

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 151/179 (84%), Gaps = 3/179 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsss---GGLFSWLTGERSSALPPLDFP  324
            MYRTAASR RA+KGR  NR L R+ASS+AVATN SS   GGLF WLTG  S +  PL+FP
Sbjct  1    MYRTAASRLRAVKGRNYNRGLARYASSSAVATNQSSSIFGGLFGWLTGGSSRSSTPLEFP  60

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            L GV  P  LPD+V+P +T+IT+LPNGLKIAS+TSA+PAAS+GLY+D GSIYE P SFGA
Sbjct  61   LPGVNPPHALPDYVQPDTTRITSLPNGLKIASQTSATPAASIGLYLDCGSIYETPVSFGA  120

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            SHLLERMAFK+T NRSHLRVVRE+EAIGG VQA+ASREQM YT+DALKT+VP MVELLV
Sbjct  121  SHLLERMAFKTTRNRSHLRVVREIEAIGGHVQASASREQMGYTFDALKTHVPEMVELLV  179



>ref|XP_010688377.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=469

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 149/178 (84%), Gaps = 2/178 (1%)
 Frame = +1

Query  154  MYRTAASRARAL-KGRASNRALTRFasstav-atnsssGGLFSWLTGERSSALPPLDFPL  327
            MYR AASR +AL K R  +R L R+ASS+A     ++S GLFSW+ G +SS++PPLDFPL
Sbjct  1    MYRVAASRTKALNKARGGSRYLARYASSSAAAVQTNTSSGLFSWIFGGKSSSVPPLDFPL  60

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
            +GVT+PP LPD+VEP  T +TTLPNG+KIASE S +P AS+GLYVDSGSIYE P SFGA+
Sbjct  61   EGVTVPPSLPDYVEPAKTIVTTLPNGVKIASEASPNPTASIGLYVDSGSIYETPYSFGAT  120

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            HLLERMAFKST NRSHLR+VREVEA+GG+V A+ASREQM YT+DALKTYVP MVELLV
Sbjct  121  HLLERMAFKSTTNRSHLRIVREVEAVGGNVTASASREQMGYTFDALKTYVPEMVELLV  178



>ref|XP_009409367.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Musa acuminata subsp. malaccensis]
Length=507

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 141/178 (79%), Gaps = 2/178 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFas--stavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYR   SR  +LK R+    +   A+  ++      SSGG FSWLTG  SS LPPLDFPL
Sbjct  1    MYRAVGSRLNSLKRRSDGARIFGIAARYASTNIAQRSSGGFFSWLTGGSSSQLPPLDFPL  60

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
             GV+LPPPLPD VEPG TKITTLPNGLKIASETS SP ASVGLYVD GSIYE P+SFGA+
Sbjct  61   PGVSLPPPLPDFVEPGKTKITTLPNGLKIASETSPSPVASVGLYVDCGSIYETPSSFGAT  120

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            HLLERMAFKST NRSHLR+VRE+EAIGGSV A+ SREQ+ YTYDALKTY+P MVE+L+
Sbjct  121  HLLERMAFKSTKNRSHLRIVREIEAIGGSVTASGSREQIGYTYDALKTYMPEMVEVLI  178



>ref|XP_010688376.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=507

 Score =   244 bits (624),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 149/178 (84%), Gaps = 2/178 (1%)
 Frame = +1

Query  154  MYRTAASRARAL-KGRASNRALTRFasstav-atnsssGGLFSWLTGERSSALPPLDFPL  327
            MYR AASR +AL K R  +R L R+ASS+A     ++S GLFSW+ G +SS++PPLDFPL
Sbjct  1    MYRVAASRTKALNKARGGSRYLARYASSSAAAVQTNTSSGLFSWIFGGKSSSVPPLDFPL  60

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
            +GVT+PP LPD+VEP  T +TTLPNG+KIASE S +P AS+GLYVDSGSIYE P SFGA+
Sbjct  61   EGVTVPPSLPDYVEPAKTIVTTLPNGVKIASEASPNPTASIGLYVDSGSIYETPYSFGAT  120

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            HLLERMAFKST NRSHLR+VREVEA+GG+V A+ASREQM YT+DALKTYVP MVELLV
Sbjct  121  HLLERMAFKSTTNRSHLRIVREVEAVGGNVTASASREQMGYTFDALKTYVPEMVELLV  178



>ref|XP_002311791.2| hypothetical protein POPTR_0008s19750g, partial [Populus trichocarpa]
 gb|EEE89158.2| hypothetical protein POPTR_0008s19750g, partial [Populus trichocarpa]
Length=452

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 147/178 (83%), Gaps = 4/178 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssG--GLFSWLTGERSSALPPLDFPL  327
            MYRTA SR  ALKG    R  TRFASS+A A   SS   GLFSWLTG +S +L PLDFPL
Sbjct  1    MYRTAVSRLSALKG--GRRYPTRFASSSAAAALQSSSSSGLFSWLTGGKSKSLSPLDFPL  58

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
            +GV LP  LPD+VEPG TKITTL NGL+IASETS SP AS+GLYVD GS+YE PA+FGA+
Sbjct  59   QGVELPSTLPDYVEPGVTKITTLGNGLRIASETSPSPVASIGLYVDCGSVYESPATFGAT  118

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            HLLERMAFKST NRSHLRVVREVEAIGG+VQ++ASREQM YTYDALKTY+P MVELL+
Sbjct  119  HLLERMAFKSTRNRSHLRVVREVEAIGGAVQSSASREQMGYTYDALKTYLPEMVELLI  176



>ref|XP_007160267.1| hypothetical protein PHAVU_002G306900g [Phaseolus vulgaris]
 gb|ESW32261.1| hypothetical protein PHAVU_002G306900g [Phaseolus vulgaris]
Length=508

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 146/179 (82%), Gaps = 3/179 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsss---GGLFSWLTGERSSALPPLDFP  324
            MYR  ASR R ++ R+ +R   RFASS++VAT  SS   GGLF WLTG+RSS+  PLDFP
Sbjct  1    MYRNVASRLRIIRARSCSRLPVRFASSSSVATKQSSSGLGGLFGWLTGDRSSSATPLDFP  60

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            L GV   PPLPD+V PG T ITTLPNG+K+ASETSA+P AS+GLYVD GSIYE P S GA
Sbjct  61   LPGVVPSPPLPDYVAPGKTIITTLPNGVKVASETSATPTASIGLYVDCGSIYESPISLGA  120

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +HLLERMAFK+T NRSH RVVREVEAIGG+VQA+ASREQM YT+DALKTYVP MVELLV
Sbjct  121  THLLERMAFKTTRNRSHFRVVREVEAIGGNVQASASREQMGYTFDALKTYVPEMVELLV  179



>ref|XP_003531643.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Glycine max]
 gb|KHN05323.1| Mitochondrial-processing peptidase subunit alpha [Glycine soja]
Length=505

 Score =   244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 142/177 (80%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASR-ARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYR AAS   R LKG   N    RF++S AVA  +SSGGLFSWLTGERSSALPPLD PL 
Sbjct  1    MYRVAASSFRRHLKGHGGNLGSIRFSTSAAVAARTSSGGLFSWLTGERSSALPPLDIPLG  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV LP  LPD VE   TKITTL NGLKIASETS +PAAS+GLY+D GSIYE P S GASH
Sbjct  61   GVALPDSLPDFVEQSKTKITTLSNGLKIASETSPNPAASIGLYLDCGSIYETPFSSGASH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKST NRSH R+VREVEAIGG+V A+ASREQM YT+DALKTYVP MVELLV
Sbjct  121  LLERMAFKSTTNRSHFRIVREVEAIGGNVGASASREQMGYTFDALKTYVPQMVELLV  177



>ref|XP_007012970.1| Mitochondrial-processing peptidase subunit alpha isoform 2 [Theobroma 
cacao]
 gb|EOY30589.1| Mitochondrial-processing peptidase subunit alpha isoform 2 [Theobroma 
cacao]
Length=389

 Score =   241 bits (615),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFS-WLTGERSSALPPLDFPLK  330
            MYRTAASR RALKGR       RFASS+AVAT SSS G F  WLTG +S ++PPLDFPL 
Sbjct  1    MYRTAASRLRALKGRTCCGVPARFASSSAVATTSSSSGGFFSWLTGSQSKSMPPLDFPLP  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV LP PLPD+VEPG T ITTLPNGLKIASETS +PAAS+GLYVD GSIYE P S G SH
Sbjct  61   GVALPAPLPDYVEPGKTTITTLPNGLKIASETSTNPAASIGLYVDCGSIYESPVSLGVSH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKST NRSHLR+VREVEAIGG+V A  SREQ+ YT+DALKTYVP MVELL+
Sbjct  121  LLERMAFKSTTNRSHLRIVREVEAIGGNVHAGVSREQIGYTFDALKTYVPEMVELLI  177



>ref|XP_010062551.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Eucalyptus 
grandis]
 gb|KCW69690.1| hypothetical protein EUGRSUZ_F03085 [Eucalyptus grandis]
Length=505

 Score =   244 bits (623),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYRTAASR R+LKGR  +    R+A+S+AVA++S+S GLFSWLTGE SS LP L+ PL G
Sbjct  1    MYRTAASRLRSLKGRVGSVGTCRYATSSAVASSSTSSGLFSWLTGETSSTLPRLEIPLAG  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            ++ P  LPD+VEP  T+ITTLPNG+KIASETS +PAAS+GLY+DSGS+YE P + GA+HL
Sbjct  61   ISSPDTLPDYVEPSKTRITTLPNGVKIASETSTNPAASIGLYIDSGSVYETPVTCGATHL  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NRSHLRV+REVEA+GG+V A+ASREQM YT+DALKTYVP MVELL+
Sbjct  121  LERMAFKSTRNRSHLRVIREVEAVGGNVAASASREQMGYTFDALKTYVPQMVELLI  176



>ref|XP_010914811.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Elaeis guineensis]
Length=507

 Score =   244 bits (623),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 142/180 (79%), Gaps = 6/180 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNR----ALTRFasstavatnsssGGLFSWLTGERSSALPPLDF  321
            MYR   S  RALK   S      A TR  S++      SSGG FSWLTGERS+ LPPLDF
Sbjct  1    MYRAFGSHLRALKRHVSGTGGIGATTR--SASTSVAKRSSGGFFSWLTGERSNQLPPLDF  58

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
            PL GVTL PPLPD+VEPG TKITTLPNG+KIASE+S +PAAS+GLYVD GS+YE P S G
Sbjct  59   PLPGVTLSPPLPDYVEPGKTKITTLPNGVKIASESSPNPAASIGLYVDCGSVYETPVSSG  118

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            A+HLLERMAFKST NRSHLR+VREVEAIGG+V A+ASREQM YT+DALKTY P MVE+L+
Sbjct  119  ATHLLERMAFKSTTNRSHLRIVREVEAIGGNVTASASREQMGYTFDALKTYTPEMVEVLI  178



>gb|KDO55879.1| hypothetical protein CISIN_1g0104471mg, partial [Citrus sinensis]
Length=370

 Score =   240 bits (613),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 148/175 (85%), Gaps = 3/175 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNR--ALTRFasstavatnsss-GGLFSWLTGERSSALPPLDFP  324
            MYR AASR RALKG    R  + TRFASS+AVA+ SSS GGLFSWLTGERSS+ P LDFP
Sbjct  1    MYRNAASRLRALKGHVRCRVPSATRFASSSAVASTSSSSGGLFSWLTGERSSSSPSLDFP  60

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            L GV+LPP LPD+VEPG TKI+TLPNG+KIASETS SP AS+ LYV  GSIYE P SFG 
Sbjct  61   LPGVSLPPSLPDYVEPGKTKISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGT  120

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMV  669
            +HLLERMAF+ST NRSHLR+VREVEAIGG+VQA+ASREQM Y++DALKTYVP M+
Sbjct  121  THLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEML  175



>ref|XP_004302845.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Fragaria 
vesca subsp. vesca]
Length=503

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 144/176 (82%), Gaps = 3/176 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYRTAASR R+LKGR      TR+AS TA AT  + GG+FSWLTGE+SSALP L+ PL G
Sbjct  1    MYRTAASRVRSLKGRVGT---TRYASVTAAATKPAVGGIFSWLTGEKSSALPRLETPLAG  57

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V LPPPLPD+VEP  TKIT L NG++IASETS SPAAS+G+YV+ GSIYE P + GASHL
Sbjct  58   VNLPPPLPDYVEPSKTKITKLSNGVRIASETSPSPAASIGVYVNCGSIYETPVTSGASHL  117

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LER+AFKST NRS LRVVREVEAIGG + A+ SREQM YT+DALKTYVP MVELLV
Sbjct  118  LERLAFKSTTNRSQLRVVREVEAIGGHIGASCSREQMGYTFDALKTYVPQMVELLV  173



>ref|XP_008380841.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Malus 
domestica]
Length=502

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 148/176 (84%), Gaps = 3/176 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MY+ AASR R+LKGR  N   TRFA+S AV+  SS GGLFSWLTGE SSALPPL+  L G
Sbjct  1    MYK-AASRLRSLKGRG-NLGATRFATSAAVSKPSS-GGLFSWLTGESSSALPPLETQLPG  57

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V LPPP+PD+VEP  T+ITTL NG+KIASETS SPAAS+G+YVDSGSIYE P S GASHL
Sbjct  58   VNLPPPVPDYVEPSKTQITTLSNGVKIASETSTSPAASIGIYVDSGSIYETPVSSGASHL  117

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LER+AFKST NRSHLR+VREVEAIGG + A+ASREQM YT+DA+KTYVP MVELLV
Sbjct  118  LERLAFKSTTNRSHLRIVREVEAIGGHIGASASREQMGYTFDAIKTYVPQMVELLV  173



>ref|XP_011016383.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Populus euphratica]
Length=362

 Score =   238 bits (606),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 146/178 (82%), Gaps = 4/178 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssG--GLFSWLTGERSSALPPLDFPL  327
            MYRTA SR  ALKG    R  TRFASS+A A   SS   GLFSWLTG +S +L PLDFPL
Sbjct  1    MYRTAVSRLSALKG--GRRYPTRFASSSAAAALQSSSSSGLFSWLTGGKSKSLSPLDFPL  58

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
            +GV LP   PD+VEPG TKITTL NGL+IASETS +P AS+GLYVD GS+YE PA+FGA+
Sbjct  59   QGVELPSTSPDYVEPGVTKITTLGNGLRIASETSPNPVASIGLYVDCGSVYESPATFGAT  118

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            HLLERMAFKST NRSHLRVVREVEAIGG+VQ++ASREQM YTYDALKTY+P MVELL+
Sbjct  119  HLLERMAFKSTRNRSHLRVVREVEAIGGAVQSSASREQMGYTYDALKTYLPEMVELLI  176



>ref|XP_006644677.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Oryza brachyantha]
Length=499

 Score =   241 bits (616),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 137/176 (78%), Gaps = 6/176 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR A S  R+LK   S+R       ++      SSGGLF WL G++ S LPPLD PL G
Sbjct  1    MYRIAGSHLRSLKRHGSSR------FASTSIVKQSSGGLFGWLLGDKPSQLPPLDVPLPG  54

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            +TLPPPLPD VEP  TK+TTLPNG+KIASETS SPAASVGLY+D GS+YE PAS GASHL
Sbjct  55   ITLPPPLPDFVEPSKTKVTTLPNGIKIASETSVSPAASVGLYIDCGSMYETPASSGASHL  114

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NRSHLR+VREVEAIGG+V A+ASREQM YTYDA K YVP MVE+L+
Sbjct  115  LERMAFKSTTNRSHLRLVREVEAIGGNVSASASREQMCYTYDAFKAYVPEMVEVLI  170



>ref|XP_008795496.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X1 [Phoenix dactylifera]
Length=505

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR   S  RAL+  A         S++      SSGG FSWLTGE+SS LPPLD PL G
Sbjct  1    MYRALGSHLRALERHAGGGIGATTRSASTSVAKRSSGGFFSWLTGEQSSQLPPLDSPLAG  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            VTLPPPLPD++EP  TKITTLPNG+KIASE+SA+PAAS+GLYVD GS+YE P   GA+HL
Sbjct  61   VTLPPPLPDYIEPEKTKITTLPNGVKIASESSANPAASIGLYVDCGSVYETPVLSGATHL  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NRSHLR+VREVEAIGG+V A+ASREQM YT+DALKTYVP MVE+L+
Sbjct  121  LERMAFKSTTNRSHLRIVREVEAIGGNVTASASREQMGYTFDALKTYVPEMVEVLI  176



>ref|XP_008795498.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X2 [Phoenix dactylifera]
Length=503

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR   S  RAL+  A         S++      SSGG FSWLTGE+SS LPPLD PL G
Sbjct  1    MYRALGSHLRALERHAGGGIGATTRSASTSVAKRSSGGFFSWLTGEQSSQLPPLDSPLAG  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            VTLPPPLPD++EP  TKITTLPNG+KIASE+SA+PAAS+GLYVD GS+YE P   GA+HL
Sbjct  61   VTLPPPLPDYIEPEKTKITTLPNGVKIASESSANPAASIGLYVDCGSVYETPVLSGATHL  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NRSHLR+VREVEAIGG+V A+ASREQM YT+DALKTYVP MVE+L+
Sbjct  121  LERMAFKSTTNRSHLRIVREVEAIGGNVTASASREQMGYTFDALKTYVPEMVEVLI  176



>ref|XP_007012969.1| Insulinase protein isoform 1 [Theobroma cacao]
 gb|EOY30588.1| Insulinase protein isoform 1 [Theobroma cacao]
Length=583

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFS-WLTGERSSALPPLDFPLK  330
            MYRTAASR RALKGR       RFASS+AVAT SSS G F  WLTG +S ++PPLDFPL 
Sbjct  79   MYRTAASRLRALKGRTCCGVPARFASSSAVATTSSSSGGFFSWLTGSQSKSMPPLDFPLP  138

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV LP PLPD+VEPG T ITTLPNGLKIASETS +PAAS+GLYVD GSIYE P S G SH
Sbjct  139  GVALPAPLPDYVEPGKTTITTLPNGLKIASETSTNPAASIGLYVDCGSIYESPVSLGVSH  198

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKST NRSHLR+VREVEAIGG+V A  SREQ+ YT+DALKTYVP MVELL+
Sbjct  199  LLERMAFKSTTNRSHLRIVREVEAIGGNVHAGVSREQIGYTFDALKTYVPEMVELLI  255



>ref|XP_008798592.1| PREDICTED: mitochondrial-processing peptidase subunit alpha isoform 
X2 [Phoenix dactylifera]
Length=505

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR A S  +ALK   +         ++      SSGG FSWLTG +S  LPPLD PL G
Sbjct  1    MYRAAGSHLKALKAGDARIFAAAARFASTSIARRSSGGFFSWLTGGQSGQLPPLDTPLPG  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            VTLPPPLPD+VEPG TKITTLPNG++IASETS SPAASVGLYVD GSIYE  AS GA+H+
Sbjct  61   VTLPPPLPDYVEPGKTKITTLPNGIRIASETSPSPAASVGLYVDCGSIYETFASLGATHV  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFK+T NRSHLR+VRE+EAIGGSV A+ASREQM YTYDALKTY+P MVE+L+
Sbjct  121  LERMAFKTTTNRSHLRIVREIEAIGGSVTASASREQMGYTYDALKTYMPEMVEVLI  176



>ref|XP_008798591.1| PREDICTED: mitochondrial-processing peptidase subunit alpha isoform 
X1 [Phoenix dactylifera]
Length=507

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 144/178 (81%), Gaps = 2/178 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatns--ssGGLFSWLTGERSSALPPLDFPL  327
            MYR A S  +ALK +A +  +   A+  A  + +  SSGG FSWLTG +S  LPPLD PL
Sbjct  1    MYRAAGSHLKALKHQAGDARIFAAAARFASTSIARRSSGGFFSWLTGGQSGQLPPLDTPL  60

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
             GVTLPPPLPD+VEPG TKITTLPNG++IASETS SPAASVGLYVD GSIYE  AS GA+
Sbjct  61   PGVTLPPPLPDYVEPGKTKITTLPNGIRIASETSPSPAASVGLYVDCGSIYETFASLGAT  120

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            H+LERMAFK+T NRSHLR+VRE+EAIGGSV A+ASREQM YTYDALKTY+P MVE+L+
Sbjct  121  HVLERMAFKTTTNRSHLRIVREIEAIGGSVTASASREQMGYTYDALKTYMPEMVEVLI  178



>ref|XP_008459098.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Cucumis melo]
Length=506

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 147/177 (83%), Gaps = 3/177 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFassta-vatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYR AASR  +LKGRA+N  L RFAS++A  +   SSGGLF W  G+RS+ LPPLDFPL 
Sbjct  1    MYRAAASRITSLKGRANN-GLYRFASTSAVASKQKSSGGLFGWFLGDRST-LPPLDFPLS  58

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
             VTLPPPLPD+VEPG TKIT+LPNG+++ASETS  PAAS+GLYVD GS YE P +FG++H
Sbjct  59   DVTLPPPLPDYVEPGKTKITSLPNGVRVASETSPDPAASIGLYVDCGSSYETPETFGSTH  118

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAF +T NRSHLRVVREVEAIGG+V A+A+REQM YT+ ALK+YVP MVELL+
Sbjct  119  LLERMAFHTTRNRSHLRVVREVEAIGGNVLASAAREQMGYTFSALKSYVPEMVELLI  175



>ref|XP_009344488.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Pyrus x bretschneideri]
Length=502

 Score =   239 bits (610),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 147/176 (84%), Gaps = 3/176 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MY+ AASR R+LKGR  N   TRFA+S AV+  SS G LFSWLTGE SSALPPL+  L G
Sbjct  1    MYK-AASRFRSLKGRG-NLGATRFATSAAVSKPSSRG-LFSWLTGESSSALPPLETQLPG  57

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V LPPP+PD+VEP  T+ITTL NG+KIASETS SPAAS+G+YVDSGS+YE P S GASHL
Sbjct  58   VNLPPPVPDYVEPSKTQITTLSNGVKIASETSTSPAASIGIYVDSGSMYETPVSSGASHL  117

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LER+AFKST NRSHLR+VREVEAIGG + A+ASREQM YT+DA+KTYVP MVELLV
Sbjct  118  LERLAFKSTTNRSHLRIVREVEAIGGHIGASASREQMGYTFDAIKTYVPQMVELLV  173



>ref|XP_003627059.1| Mitochondrial-processing peptidase subunit alpha [Medicago truncatula]
 gb|AET01535.1| processing peptidase [Medicago truncatula]
Length=507

 Score =   239 bits (610),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = +1

Query  154  MYR-TAASRARALKGRA-SNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYR TA+S  R LKG    N   TRFA+S+A+A   SSGGLFSWLTGERSS+LPPLD P+
Sbjct  1    MYRATASSLKRHLKGGVLGNLGATRFATSSAIAAKVSSGGLFSWLTGERSSSLPPLDTPI  60

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
                LP  LPD++EP  TKITTL NGLKIASETS++PAAS+GLY+D GSIYE P + GAS
Sbjct  61   SSFVLPDTLPDYIEPSKTKITTLSNGLKIASETSSNPAASIGLYLDCGSIYETPLTSGAS  120

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            HLLERMAFKST+NRSH R+VRE+EAIGG++ A+ASREQM YT+DALKTYVP M+ELLV
Sbjct  121  HLLERMAFKSTVNRSHFRIVREIEAIGGNIGASASREQMGYTFDALKTYVPQMIELLV  178



>gb|AFW78811.1| putative mitochondrial processing peptidase alpha subunit family 
protein [Zea mays]
Length=499

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 140/176 (80%), Gaps = 6/176 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR A S  R+LK   ++R       ++      SSGGLFSWL G +SS LPPLD PL G
Sbjct  1    MYRAAGSHLRSLKHHGASR------LASTSVAKQSSGGLFSWLLGGKSSELPPLDVPLPG  54

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            +++P PLPD VEP  TK+TTLPNG+KIASETS+SPAASVGLY+D GSIYE PAS G SHL
Sbjct  55   ISIPSPLPDFVEPSKTKVTTLPNGVKIASETSSSPAASVGLYIDCGSIYETPASSGVSHL  114

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST+NR+HLR+VREVEAIGG+V A+ASREQM+YTYDALK+Y P MVE+L+
Sbjct  115  LERMAFKSTVNRTHLRLVREVEAIGGNVSASASREQMSYTYDALKSYTPEMVEVLI  170



>ref|NP_001146680.1| uncharacterized protein LOC100280280 [Zea mays]
 gb|ACL54515.1| unknown [Zea mays]
Length=499

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 140/176 (80%), Gaps = 6/176 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR A S  R+LK   ++R       ++      SSGGLFSWL G +SS LPPLD PL G
Sbjct  1    MYRAAGSHLRSLKHHGASR------LASTSVAKQSSGGLFSWLLGGKSSELPPLDVPLPG  54

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            +++P PLPD VEP  TK+TTLPNG+KIASETS+SPAASVGLY+D GSIYE PAS G SHL
Sbjct  55   ISIPSPLPDFVEPSKTKVTTLPNGVKIASETSSSPAASVGLYIDCGSIYETPASSGVSHL  114

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST+NR+HLR+VREVEAIGG+V A+ASREQM+YTYDALK+Y P MVE+L+
Sbjct  115  LERMAFKSTVNRTHLRLVREVEAIGGNVSASASREQMSYTYDALKSYTPEMVEVLI  170



>gb|KGN60560.1| hypothetical protein Csa_2G000680 [Cucumis sativus]
Length=498

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 141/176 (80%), Gaps = 1/176 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR AASR  +LKG A+N      +SS   +   SSGGLF WL G+RS ALPPLDFPL  
Sbjct  1    MYRAAASRITSLKGHANNGVCRFASSSAVASKQKSSGGLFGWLLGDRS-ALPPLDFPLSD  59

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            VTLPPPLPD+VEPG TKIT+LPNG+K+ASETS  P AS+GLYVD GS YE P +FG++HL
Sbjct  60   VTLPPPLPDYVEPGKTKITSLPNGVKVASETSPDPVASIGLYVDCGSSYETPETFGSTHL  119

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFK+T NRSHLRVVREVEAIGG+V A+ +REQM YT +ALK+YVP +VELLV
Sbjct  120  LERMAFKTTSNRSHLRVVREVEAIGGNVLASDAREQMGYTLNALKSYVPEIVELLV  175



>ref|XP_004141034.2| PREDICTED: mitochondrial-processing peptidase subunit alpha [Cucumis 
sativus]
Length=505

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 141/176 (80%), Gaps = 1/176 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR AASR  +LKG A+N      +SS   +   SSGGLF WL G+RS ALPPLDFPL  
Sbjct  1    MYRAAASRITSLKGHANNGVCRFASSSAVASKQKSSGGLFGWLLGDRS-ALPPLDFPLSD  59

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            VTLPPPLPD+VEPG TKIT+LPNG+K+ASETS  P AS+GLYVD GS YE P +FG++HL
Sbjct  60   VTLPPPLPDYVEPGKTKITSLPNGVKVASETSPDPVASIGLYVDCGSSYETPETFGSTHL  119

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFK+T NRSHLRVVREVEAIGG+V A+ +REQM YT +ALK+YVP +VELLV
Sbjct  120  LERMAFKTTSNRSHLRVVREVEAIGGNVLASDAREQMGYTLNALKSYVPEIVELLV  175



>ref|XP_010528943.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-1 [Tarenaya hassleriana]
Length=502

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 149/177 (84%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRAS-NRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYR+AA RA++LKG  + N    R+ASS+AV+T+SSSGGLFSWLTGE SS LP +  PLK
Sbjct  1    MYRSAALRAKSLKGGVTRNLRAARYASSSAVSTSSSSGGLFSWLTGETSSMLPSMYIPLK  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV+LPPPL DHVEP   ++TTLPNGLK+ASE S +PAAS+GLYV+ GSIYE P S GA+H
Sbjct  61   GVSLPPPLADHVEPSKLEVTTLPNGLKVASEVSPNPAASIGLYVNCGSIYETPYSHGATH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKSTLNRSHLR+VREVEAIGG+  A+ASREQM YT DALKTYVP MVE+LV
Sbjct  121  LLERMAFKSTLNRSHLRLVREVEAIGGNTSASASREQMGYTIDALKTYVPEMVEVLV  177



>gb|EAZ13476.1| hypothetical protein OsJ_03392 [Oryza sativa Japonica Group]
Length=535

 Score =   238 bits (607),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +1

Query  262  GGLFSWLTGERSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPA  441
            GGLFSWL GE+SS LPPLD PL G+TLPPPLPD VEP  TK+TTLPNG+KIASETS SPA
Sbjct  83   GGLFSWLLGEKSSQLPPLDVPLPGITLPPPLPDFVEPSKTKVTTLPNGIKIASETSVSPA  142

Query  442  ASVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQ  621
            ASVGLY+D GSIYE PAS GASHLLERMAFKST NRSHLR+VREVEAIGG+V A+ASREQ
Sbjct  143  ASVGLYIDCGSIYETPASSGASHLLERMAFKSTTNRSHLRLVREVEAIGGNVSASASREQ  202

Query  622  MTYTYDALKTYVPHMVELLV  681
            M YTYDA K YVP MVE+L+
Sbjct  203  MCYTYDAFKAYVPEMVEVLI  222



>gb|KDO51845.1| hypothetical protein CISIN_1g010650mg [Citrus sinensis]
Length=436

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR   SR  +LKGR  N    R+A+S A A   SS G FSWLTGE+SS+LP LD PL+G
Sbjct  1    MYRATVSRLGSLKGRLGNFQAMRYATSGAAAVRPSSPGFFSWLTGEQSSSLPSLDTPLEG  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+ PP LPD VEPG  K+TTL NG++IASETS SPAAS+GLY+D GS+YE P+S GAS+L
Sbjct  61   VSFPPSLPDFVEPGKVKVTTLENGIRIASETSVSPAASIGLYLDFGSVYETPSSCGASNL  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LE+MAFKST NRSHLR+VREVEAIGGS+ A+ASREQM Y++DALKTYVP MVELLV
Sbjct  121  LEKMAFKSTKNRSHLRIVREVEAIGGSILASASREQMGYSFDALKTYVPEMVELLV  176



>ref|XP_006465713.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Citrus sinensis]
Length=505

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR   SR  +LKGR  N    R+A+S A A   SS G FSWLTGE+SS+LP LD PL+G
Sbjct  1    MYRATVSRLGSLKGRLGNFQAMRYATSGAAAVRPSSPGFFSWLTGEQSSSLPSLDTPLEG  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+ PP LPD VEPG  K+TTL NG++IASETS SPAAS+GLY+D GS+YE P+S GAS+L
Sbjct  61   VSFPPSLPDFVEPGKVKVTTLENGIRIASETSVSPAASIGLYLDCGSVYETPSSCGASNL  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LE+MAFKST NRSHLR+VREVEAIGGS+ A+ASREQM Y++DALKTYVP MVELLV
Sbjct  121  LEKMAFKSTKNRSHLRIVREVEAIGGSILASASREQMGYSFDALKTYVPEMVELLV  176



>gb|EEC71449.1| hypothetical protein OsI_03671 [Oryza sativa Indica Group]
Length=563

 Score =   238 bits (607),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +1

Query  262  GGLFSWLTGERSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPA  441
            GGLFSWL GE+SS LPPLD PL G+TLPPPLPD VEP  TK+TTLPNG+KIASETS SPA
Sbjct  83   GGLFSWLLGEKSSQLPPLDVPLPGITLPPPLPDFVEPSKTKVTTLPNGIKIASETSVSPA  142

Query  442  ASVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQ  621
            ASVGLY+D GSIYE PAS GASHLLERMAFKST NRSHLR+VREVEAIGG+V A+ASREQ
Sbjct  143  ASVGLYIDCGSIYETPASSGASHLLERMAFKSTTNRSHLRLVREVEAIGGNVSASASREQ  202

Query  622  MTYTYDALKTYVPHMVELLV  681
            M YTYDA K YVP MVE+L+
Sbjct  203  MCYTYDAFKAYVPEMVEVLI  222



>ref|XP_007204564.1| hypothetical protein PRUPE_ppa004446mg [Prunus persica]
 gb|EMJ05763.1| hypothetical protein PRUPE_ppa004446mg [Prunus persica]
Length=509

 Score =   236 bits (602),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 145/182 (80%), Gaps = 6/182 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRAS--NRALTRFasstavat----nsssGGLFSWLTGERSSALPPL  315
            M++TAASR RALKGR S  NR + RF+S   VAT    +S  G LF WLTG +S ++PPL
Sbjct  1    MFKTAASRLRALKGRTSTFNRGVARFSSLNDVATKPPSSSPFGVLFGWLTGGKSRSMPPL  60

Query  316  DFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPAS  495
            DFPL G+ LPP LPD+V+P   KITTLPNG+KIAS  S  PAASVGLYV+ GS+YE P S
Sbjct  61   DFPLSGIKLPPALPDYVQPVEPKITTLPNGVKIASLKSEKPAASVGLYVNCGSVYETPES  120

Query  496  FGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVEL  675
             GA+HLLE MAFKST NRSHLR+VREVEAIGG+VQA+ASREQM YT++ALKTYVP MVEL
Sbjct  121  SGATHLLEHMAFKSTRNRSHLRIVREVEAIGGNVQASASREQMAYTFNALKTYVPEMVEL  180

Query  676  LV  681
            L+
Sbjct  181  LI  182



>gb|KDO51843.1| hypothetical protein CISIN_1g010650mg [Citrus sinensis]
Length=503

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR   SR  +LKGR  N    R+A+S A A   SS G FSWLTGE+SS+LP LD PL+G
Sbjct  1    MYRATVSRLGSLKGRLGNFQAMRYATSGAAAVRPSSPGFFSWLTGEQSSSLPSLDTPLEG  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+ PP LPD VEPG  K+TTL NG++IASETS SPAAS+GLY+D GS+YE P+S GAS+L
Sbjct  61   VSFPPSLPDFVEPGKVKVTTLENGIRIASETSVSPAASIGLYLDFGSVYETPSSCGASNL  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LE+MAFKST NRSHLR+VREVEAIGGS+ A+ASREQM Y++DALKTYVP MVELLV
Sbjct  121  LEKMAFKSTKNRSHLRIVREVEAIGGSILASASREQMGYSFDALKTYVPEMVELLV  176



>gb|KDO51844.1| hypothetical protein CISIN_1g010650mg [Citrus sinensis]
Length=505

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR   SR  +LKGR  N    R+A+S A A   SS G FSWLTGE+SS+LP LD PL+G
Sbjct  1    MYRATVSRLGSLKGRLGNFQAMRYATSGAAAVRPSSPGFFSWLTGEQSSSLPSLDTPLEG  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+ PP LPD VEPG  K+TTL NG++IASETS SPAAS+GLY+D GS+YE P+S GAS+L
Sbjct  61   VSFPPSLPDFVEPGKVKVTTLENGIRIASETSVSPAASIGLYLDFGSVYETPSSCGASNL  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LE+MAFKST NRSHLR+VREVEAIGGS+ A+ASREQM Y++DALKTYVP MVELLV
Sbjct  121  LEKMAFKSTKNRSHLRIVREVEAIGGSILASASREQMGYSFDALKTYVPEMVELLV  176



>ref|XP_009338746.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Pyrus x bretschneideri]
Length=502

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 147/176 (84%), Gaps = 3/176 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MY+ AASR  +LKGR +  A TRFA+S AV+  SS GGLFSWLTGE SSALPPL+  L G
Sbjct  1    MYK-AASRLGSLKGRGTLGA-TRFATSAAVSKPSS-GGLFSWLTGESSSALPPLETQLPG  57

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V LPPP+PD+VEP  T+ITTL NG+KIASETS S AAS+G+YVDSGSIYE P S GASHL
Sbjct  58   VNLPPPVPDYVEPSKTQITTLSNGVKIASETSTSAAASIGIYVDSGSIYETPVSSGASHL  117

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LER+AFKST NRSHLR+VREVEAIGG + A+ASREQM YT+DA+KTYVP MVELLV
Sbjct  118  LERLAFKSTTNRSHLRIVREVEAIGGHIGASASREQMGYTFDAIKTYVPQMVELLV  173



>ref|XP_010924455.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Elaeis guineensis]
Length=507

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 141/180 (78%), Gaps = 6/180 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNR----ALTRFasstavatnsssGGLFSWLTGERSSALPPLDF  321
            MYR   S  RALK  A       A TR AS++    +S   G FSWLTGERSS LPPLD 
Sbjct  1    MYRALGSHLRALKRHADATGGIGATTRSASTSVAKRSSV--GFFSWLTGERSSQLPPLDS  58

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
             L GVTLPPPLPD+VEPG TKITTLPNG+KIASE+S +P AS+GLYVD GS+YE P + G
Sbjct  59   LLAGVTLPPPLPDYVEPGKTKITTLPNGVKIASESSPNPVASIGLYVDCGSVYETPITSG  118

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            A+HLLERMAFKST NRSHLR+VREVEAIGG+V A+ASREQM YT+DALKTY+P MVE+L+
Sbjct  119  ATHLLERMAFKSTTNRSHLRIVREVEAIGGNVMASASREQMGYTFDALKTYMPEMVEVLI  178



>ref|XP_008354423.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Malus domestica]
Length=514

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 142/183 (78%), Gaps = 7/183 (4%)
 Frame = +1

Query  154  MYRTAASRARALKGRAS--NRALTRFasstavatnsss-----GGLFSWLTGERSSALPP  312
            M++TAASR RALKGR S  +R + RF+S   VAT  SS     GGLF WL G  S ++PP
Sbjct  1    MFKTAASRLRALKGRTSTFHRGVARFSSLNDVATKPSSSSSPFGGLFGWLIGGNSRSMPP  60

Query  313  LDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPA  492
            LDFPL G+ LPP LPDHV+P   KITTLPNG+KIAS  S  PAASVGLY++ GS+YE   
Sbjct  61   LDFPLSGINLPPALPDHVQPADVKITTLPNGIKIASLKSEKPAASVGLYINCGSVYETLE  120

Query  493  SFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVE  672
            S GASHLLERMAFKST NRSHLR+VREVEAIGG+VQA+ASREQM YT++ LKT VP MVE
Sbjct  121  SSGASHLLERMAFKSTRNRSHLRIVREVEAIGGNVQASASREQMAYTFNGLKTNVPEMVE  180

Query  673  LLV  681
            LL+
Sbjct  181  LLI  183



>ref|XP_008664141.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Zea mays]
Length=334

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 138/176 (78%), Gaps = 6/176 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR A S  R+LK   ++R       ++      SSGGL SWL G +SS LPPLD PL G
Sbjct  1    MYRAAGSHLRSLKHHGASR------LASTSVAKQSSGGLCSWLLGGKSSELPPLDVPLPG  54

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            +++P PLPD VEP  TK+TTLPNG+KIASETS+SPAASVGLY+D GSI E PAS G SHL
Sbjct  55   ISIPSPLPDFVEPSKTKVTTLPNGVKIASETSSSPAASVGLYIDCGSICETPASSGVSHL  114

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST+NR+HL++VREVEAIGG+V A+ASREQM+YTYDALK+Y P MVE+L+
Sbjct  115  LERMAFKSTVNRTHLQLVREVEAIGGNVSASASREQMSYTYDALKSYTPEMVEVLI  170



>ref|XP_008242460.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Prunus mume]
Length=510

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 142/182 (78%), Gaps = 6/182 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRAS--NRALTRFasstavatnsss----GGLFSWLTGERSSALPPL  315
            M++TAASR RALKGR S  N  + RF+S    AT   S    G LF WLTG RS ++PPL
Sbjct  1    MFKTAASRLRALKGRTSTFNSGVARFSSLNDAATKLPSSSPFGVLFGWLTGGRSRSMPPL  60

Query  316  DFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPAS  495
            DFPL G+ LPP LPD+V+P   KITTLPNG+KIAS  S  PAASVGLYV+ GS+YE P S
Sbjct  61   DFPLSGIKLPPALPDYVQPVEPKITTLPNGVKIASLKSEKPAASVGLYVNCGSVYETPES  120

Query  496  FGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVEL  675
             GA+HLLE MAFKST NRSHLR+VREVEAIGG+VQA+ASREQM YT++ALKTYVP MVEL
Sbjct  121  SGATHLLEHMAFKSTRNRSHLRIVREVEAIGGNVQASASREQMAYTFNALKTYVPEMVEL  180

Query  676  LV  681
            L+
Sbjct  181  LI  182



>ref|XP_007135618.1| hypothetical protein PHAVU_010G144000g [Phaseolus vulgaris]
 gb|ESW07612.1| hypothetical protein PHAVU_010G144000g [Phaseolus vulgaris]
Length=507

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 140/178 (79%), Gaps = 2/178 (1%)
 Frame = +1

Query  154  MYRTAASR-ARALKGRASNRALTRFasstavatn-sssGGLFSWLTGERSSALPPLDFPL  327
            MYR AAS   R LKG A     TR +S++A     +S GG FSWLTGERSS LP LD PL
Sbjct  1    MYRAAASSFRRHLKGDACKLGSTRSSSTSAAVAARTSQGGFFSWLTGERSSVLPSLDIPL  60

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
             GV LP PLPD VE   TKITTL NGLKIASETS +PAAS+GLY+DSGSIYEKP S GAS
Sbjct  61   SGVALPDPLPDSVEQSKTKITTLSNGLKIASETSPNPAASIGLYIDSGSIYEKPFSSGAS  120

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            HLLERMAFKST NRSH R+VREVEAIGG++ A+ASREQM YT+DALKTYVP MVELLV
Sbjct  121  HLLERMAFKSTTNRSHFRIVREVEAIGGNIGASASREQMGYTFDALKTYVPQMVELLV  178



>ref|XP_006426848.1| hypothetical protein CICLE_v10025419mg [Citrus clementina]
 gb|ESR40088.1| hypothetical protein CICLE_v10025419mg [Citrus clementina]
Length=503

 Score =   234 bits (596),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR   SR  +LKGR  N    R+A+S A A   SS G FSWLTGE+SS+LP LD PL+G
Sbjct  1    MYRATVSRLGSLKGRLGNFQAMRYATSGAAAVRPSSPGFFSWLTGEQSSSLPSLDTPLEG  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+ PP LPD VEPG  K+ TL NG++IASETS SPAAS+GLY+D GS+YE P+S GAS+L
Sbjct  61   VSFPPSLPDFVEPGKVKVMTLENGIRIASETSVSPAASIGLYLDFGSVYETPSSCGASNL  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LE+MAFKST NRSHLR+VREVEAIGGS+ A+ASREQM Y++DALKTYVP MVELLV
Sbjct  121  LEKMAFKSTKNRSHLRIVREVEAIGGSILASASREQMGYSFDALKTYVPEMVELLV  176



>ref|XP_006426849.1| hypothetical protein CICLE_v10025419mg [Citrus clementina]
 gb|ESR40089.1| hypothetical protein CICLE_v10025419mg [Citrus clementina]
Length=505

 Score =   233 bits (595),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR   SR  +LKGR  N    R+A+S A A   SS G FSWLTGE+SS+LP LD PL+G
Sbjct  1    MYRATVSRLGSLKGRLGNFQAMRYATSGAAAVRPSSPGFFSWLTGEQSSSLPSLDTPLEG  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+ PP LPD VEPG  K+ TL NG++IASETS SPAAS+GLY+D GS+YE P+S GAS+L
Sbjct  61   VSFPPSLPDFVEPGKVKVMTLENGIRIASETSVSPAASIGLYLDFGSVYETPSSCGASNL  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LE+MAFKST NRSHLR+VREVEAIGGS+ A+ASREQM Y++DALKTYVP MVELLV
Sbjct  121  LEKMAFKSTKNRSHLRIVREVEAIGGSILASASREQMGYSFDALKTYVPEMVELLV  176



>ref|XP_003546593.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Glycine max]
 gb|KHN32658.1| Mitochondrial-processing peptidase subunit alpha [Glycine soja]
Length=491

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 133/176 (76%), Gaps = 14/176 (8%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR  ASR    KG       +R              GLF+WLTGE S+ LPPLD PL+G
Sbjct  1    MYRAVASRLTLPKGNGRTLGASR--------------GLFNWLTGESSNPLPPLDTPLRG  46

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+LPP LPD+VEP  TKITTLPNGLKIASETS +PAAS+GLYVD GS+YE P S GASHL
Sbjct  47   VSLPPSLPDYVEPSKTKITTLPNGLKIASETSPNPAASIGLYVDCGSLYETPLSSGASHL  106

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LE+M+FKST NRSH RVVREVEA+GG+V A+ASREQM YT+DALKTYVP M+ELLV
Sbjct  107  LEKMSFKSTANRSHFRVVREVEAVGGNVGASASREQMGYTFDALKTYVPQMIELLV  162



>ref|XP_002514191.1| mitochondrial processing peptidase alpha subunit, putative [Ricinus 
communis]
 gb|EEF48145.1| mitochondrial processing peptidase alpha subunit, putative [Ricinus 
communis]
Length=507

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 143/177 (81%), Gaps = 2/177 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRA-LTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYRTAASR RALK R   R      +SS A   +S S G+FSWL G++S +LP L+FPL 
Sbjct  1    MYRTAASRLRALKDRTVCRLPARFASSSAAAVQSSPSVGIFSWLFGDKSKSLP-LEFPLP  59

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV LPP LPD+V PG TKITTL NG+KIAS+TS +PAAS+GLYV+ GSIYE PA+FG +H
Sbjct  60   GVELPPSLPDYVAPGETKITTLSNGMKIASQTSPNPAASIGLYVNCGSIYESPATFGTTH  119

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLE+MAFKST NRSHLRVVREVEAIGG VQA+ASREQM YT+DAL+TYVP MVELL+
Sbjct  120  LLEQMAFKSTRNRSHLRVVREVEAIGGVVQASASREQMGYTFDALRTYVPEMVELLI  176



>ref|XP_004287497.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Fragaria vesca subsp. vesca]
Length=524

 Score =   231 bits (590),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 140/185 (76%), Gaps = 9/185 (5%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsss---------GGLFSWLTGERSSAL  306
            M++TA SR RALKGR   R L RF++   V++ ++          GG F WLTG RS ++
Sbjct  1    MFKTATSRLRALKGRTGIRGLARFSTLGEVSSPAAVAARPSWSPLGGFFGWLTGGRSRSM  60

Query  307  PPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEK  486
            PPLDFPL+GV  PP LPD+V+P   KITTLPNG+K+AS  S  P AS+GLY++ GS+YE 
Sbjct  61   PPLDFPLQGVKFPPALPDYVQPEKPKITTLPNGVKVASMKSEIPTASIGLYINCGSVYET  120

Query  487  PASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHM  666
            P S G SHLLERMAFKST NRSHLR+VREVEAIGG+VQA+ASREQM+YT  +LKTYVP M
Sbjct  121  PESSGGSHLLERMAFKSTSNRSHLRIVREVEAIGGTVQASASREQMSYTISSLKTYVPEM  180

Query  667  VELLV  681
            VELL+
Sbjct  181  VELLL  185



>ref|XP_012069060.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Jatropha curcas]
Length=503

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 141/176 (80%), Gaps = 1/176 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR AASR RALK    N    R+A+S++VAT +SSGG FSWLTG +  +LPP+DFPL  
Sbjct  1    MYR-AASRLRALKSNVGNLGAVRYAASSSVATKTSSGGFFSWLTGGQGGSLPPMDFPLPD  59

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+LPPPLPD+VEP   K  TL NG++I SE   +PAAS+G+Y+D GSIYE P S GA+HL
Sbjct  60   VSLPPPLPDYVEPSKVKSKTLENGVRIVSEALQNPAASIGVYIDCGSIYETPLSCGATHL  119

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NRSHLRVVREVEAIGG+V A+ASREQM YT+DA+KT+VP MVELLV
Sbjct  120  LERMAFKSTKNRSHLRVVREVEAIGGNVAASASREQMAYTFDAIKTHVPEMVELLV  175



>gb|KDP40843.1| hypothetical protein JCGZ_24842 [Jatropha curcas]
Length=503

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 141/176 (80%), Gaps = 1/176 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR AASR RALK    N    R+A+S++VAT +SSGG FSWLTG +  +LPP+DFPL  
Sbjct  1    MYR-AASRLRALKSNVGNLGAVRYAASSSVATKTSSGGFFSWLTGGQGGSLPPMDFPLPD  59

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+LPPPLPD+VEP   K  TL NG++I SE   +PAAS+G+Y+D GSIYE P S GA+HL
Sbjct  60   VSLPPPLPDYVEPSKVKSKTLENGVRIVSEALQNPAASIGVYIDCGSIYETPLSCGATHL  119

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NRSHLRVVREVEAIGG+V A+ASREQM YT+DA+KT+VP MVELLV
Sbjct  120  LERMAFKSTKNRSHLRVVREVEAIGGNVAASASREQMAYTFDAIKTHVPEMVELLV  175



>ref|XP_002299745.1| mitochondrial processing peptidase alpha subunit 2 family protein 
[Populus trichocarpa]
 gb|EEE84550.1| mitochondrial processing peptidase alpha subunit 2 family protein 
[Populus trichocarpa]
Length=507

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            M+R+A SR RALKG A N   TR+A+STAVA+  SS G FSWLTGE++S+ PPL+ PL G
Sbjct  1    MHRSAISRLRALKGCAGNLGTTRYATSTAVASRPSSPGFFSWLTGEQASSFPPLEVPLAG  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V  PP LPD+V+PG  +   L NGL I SE S++PAASVGLY+D GS+YE P S GA+HL
Sbjct  61   VAFPPSLPDYVQPGKVESKVLENGLMIVSEASSNPAASVGLYLDCGSVYETPISCGATHL  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NRSHLR+VREVEAIGG+V A+ASREQM YT+DALKTY P M+ELL+
Sbjct  121  LERMAFKSTRNRSHLRIVREVEAIGGNVAASASREQMGYTFDALKTYAPEMIELLI  176



>ref|XP_006299456.1| hypothetical protein CARUB_v10015621mg [Capsella rubella]
 gb|EOA32354.1| hypothetical protein CARUB_v10015621mg [Capsella rubella]
Length=501

 Score =   228 bits (582),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRAS-NRALTRFasstavatnsssG-GLFSWLTGERSSALPPLDFPL  327
            MYRTAASRA++LKG  + N   +R+ASS+AVAT SSS  GLFSWLTG  S +LPP+D PL
Sbjct  1    MYRTAASRAKSLKGILTRNLPASRYASSSAVATGSSSSPGLFSWLTGGSSGSLPPMDIPL  60

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
             GV+LPPPL DHV P   KITTL NGLKIA+E S++PAAS+GLYVD GSIYE P   GA+
Sbjct  61   AGVSLPPPLADHVAPEKLKITTLSNGLKIATEMSSNPAASIGLYVDCGSIYEMPYCRGAT  120

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            HLLERMAFKSTLNRSH R+VRE+EA+GG+  A+ASREQM YT DALKTYVP MVE+L+
Sbjct  121  HLLERMAFKSTLNRSHFRLVREIEAMGGNTSASASREQMGYTIDALKTYVPEMVEVLI  178



>ref|XP_010504362.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-2 isoform X2 [Camelina sativa]
Length=501

 Score =   228 bits (582),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 143/178 (80%), Gaps = 2/178 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASN--RALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYRTAASRA+ALKG  ++  RA    +SS   A++SS+ G FSWLTG  SS+LPP+D PL
Sbjct  1    MYRTAASRAKALKGILNHNLRASRYASSSAVAASSSSTSGFFSWLTGGSSSSLPPMDIPL  60

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
             GV+LPPPL DHV P   K TTL NGLKIA+E S++PAAS+GLYVD GSIYE P S GA+
Sbjct  61   AGVSLPPPLADHVAPEKLKTTTLSNGLKIATEMSSNPAASIGLYVDCGSIYETPYSRGAT  120

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            HLLERMAFKSTLNRSH R+VRE+EA+GG+  A+ASREQM YT DALKTYVP MVE+L+
Sbjct  121  HLLERMAFKSTLNRSHFRLVREIEAMGGNTSASASREQMGYTIDALKTYVPEMVEVLI  178



>ref|XP_010504356.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-2 isoform X1 [Camelina sativa]
Length=502

 Score =   228 bits (582),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 143/178 (80%), Gaps = 2/178 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASN--RALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYRTAASRA+ALKG  ++  RA    +SS   A++SS+ G FSWLTG  SS+LPP+D PL
Sbjct  1    MYRTAASRAKALKGILNHNLRASRYASSSAVAASSSSTSGFFSWLTGGSSSSLPPMDIPL  60

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
             GV+LPPPL DHV P   K TTL NGLKIA+E S++PAAS+GLYVD GSIYE P S GA+
Sbjct  61   AGVSLPPPLADHVAPEKLKTTTLSNGLKIATEMSSNPAASIGLYVDCGSIYETPYSRGAT  120

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            HLLERMAFKSTLNRSH R+VRE+EA+GG+  A+ASREQM YT DALKTYVP MVE+L+
Sbjct  121  HLLERMAFKSTLNRSHFRLVREIEAMGGNTSASASREQMGYTIDALKTYVPEMVEVLI  178



>emb|CDY46536.1| BnaA08g01750D [Brassica napus]
Length=502

 Score =   228 bits (582),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 144/178 (81%), Gaps = 3/178 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRAL--TRFasstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYRTAASRARALKG  S R L   R+ASS+AVAT+SSS G   WLTG  S +L  LD PL
Sbjct  1    MYRTAASRARALKGSLS-RGLGPARYASSSAVATSSSSQGFLGWLTGGSSGSLTSLDMPL  59

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
            +GV+LPPPL D VEP   KITTLPNGLKIASE S +PAAS+GLYVD GSIYE P   GA+
Sbjct  60   QGVSLPPPLADRVEPSKLKITTLPNGLKIASEMSTNPAASIGLYVDCGSIYEAPYFHGAT  119

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            HLLERMAFKST NRSHLR+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE+L+
Sbjct  120  HLLERMAFKSTTNRSHLRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLI  177



>ref|XP_009107159.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-1 [Brassica rapa]
Length=502

 Score =   228 bits (581),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 144/178 (81%), Gaps = 3/178 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRAL--TRFasstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYRTAASRARALKG  S R L   R+ASS+AVAT+SSS G   WLTG  S +L  LD PL
Sbjct  1    MYRTAASRARALKGSLS-RGLGPARYASSSAVATSSSSQGFLGWLTGGSSGSLTSLDMPL  59

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
            +GV+LPPPL D VEP   KITTLPNGLKIASE S +PAASVGLYVD GSIYE P   GA+
Sbjct  60   QGVSLPPPLADRVEPSKLKITTLPNGLKIASEMSPNPAASVGLYVDCGSIYEAPYFHGAT  119

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            HLLERMAFKST NRSHLR+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE+L+
Sbjct  120  HLLERMAFKSTTNRSHLRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLI  177



>gb|ADE77223.1| unknown [Picea sitchensis]
Length=510

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 140/181 (77%), Gaps = 5/181 (3%)
 Frame = +1

Query  154  MYRTAASRAR-----ALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLD  318
            M R+ ASR R      + GR +    T   S T +A  SSSGGLFSW+TG +S +LP LD
Sbjct  1    MLRSGASRVRNNLKIGIHGRQAFATSTPGVSRTEIAQQSSSGGLFSWITGNKSKSLPSLD  60

Query  319  FPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASF  498
            FPL GV LPP LPD+VEP  T +TTLPNGLK+ASE S+SP AS+GLYVD GS+YE P S 
Sbjct  61   FPLPGVNLPPTLPDYVEPTKTIVTTLPNGLKVASEDSSSPTASIGLYVDCGSVYETPLSS  120

Query  499  GASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
            GA+HLLERMAFK+T NRSHLR+VREVEAIGG+V A+ASREQM YT+DALKTY+P MVELL
Sbjct  121  GATHLLERMAFKTTRNRSHLRMVREVEAIGGNVTASASREQMGYTFDALKTYLPEMVELL  180

Query  679  V  681
            V
Sbjct  181  V  181



>ref|XP_011000940.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Populus euphratica]
Length=507

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            M+R+A SR RALKG A N   TR+A+STAVA+  SS G FSWLTGE++S+ PPL+ PL G
Sbjct  1    MHRSAISRLRALKGCAGNLGTTRYATSTAVASRPSSPGFFSWLTGEQASSFPPLEVPLAG  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V  PP LPD+V+PG  +   L NGL I SE S++PAAS+GLY+D GS+YE P S G +HL
Sbjct  61   VAFPPSLPDYVQPGKVESKVLENGLMIVSEASSNPAASIGLYLDCGSVYETPISCGTTHL  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NRSHLR+VREVEAIGG+V A+ASREQM YT+DALKTY P M+ELL+
Sbjct  121  LERMAFKSTRNRSHLRIVREVEAIGGNVAASASREQMGYTFDALKTYAPEMIELLI  176



>dbj|BAB62405.1| mitochondrial processing peptidase alpha subunit [Morus alba]
Length=506

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 136/181 (75%), Gaps = 12/181 (7%)
 Frame = +1

Query  154  MYRTAASRARALKGRA---SNRALTRFasstavatnsssGGLFSWLTGERSSA--LPPLD  318
            MYR  ASR RALK R     NR L+        A  ++SGG  SWL+G    +  LP L 
Sbjct  1    MYRATASRLRALKARNFKLGNRFLS-------SAAVATSGGNISWLSGGGGYSSSLPSLM  53

Query  319  FPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASF  498
             PL  V LPPPLPDHVEP  TKITTL NGLKIAS+TS +PAAS+GLYVD GSIYE P SF
Sbjct  54   IPLADVKLPPPLPDHVEPAKTKITTLANGLKIASQTSVTPAASIGLYVDCGSIYETPVSF  113

Query  499  GASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
            GASHLLERMAFK+T NRSHLRVVRE+EAIGG VQA+ASREQM YT+DALKT+VP MVELL
Sbjct  114  GASHLLERMAFKTTRNRSHLRVVREIEAIGGHVQASASREQMGYTFDALKTHVPEMVELL  173

Query  679  V  681
            V
Sbjct  174  V  174



>gb|EPS62572.1| mitochondrial processing peptidase, partial [Genlisea aurea]
Length=487

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +1

Query  265  GLFSWLTGERSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAA  444
            GLF WLTGE+SS LPPLDFPL+ V LPP LPDHVE G+TKITTL NGL+IASE S +PAA
Sbjct  23   GLFGWLTGEKSSTLPPLDFPLRDVVLPPSLPDHVETGTTKITTLSNGLRIASEASQNPAA  82

Query  445  SVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQM  624
            S+GLYVD GSIYE P S+G +HLLERMAFKST+NRSHLR+VREVEA+GG+V  + +RE +
Sbjct  83   SIGLYVDCGSIYETPYSYGVTHLLERMAFKSTINRSHLRIVREVEAVGGNVTGSITREHI  142

Query  625  TYTYDALKTYVPHMVELLV  681
            +YTYD LKTYVP MVELLV
Sbjct  143  SYTYDGLKTYVPQMVELLV  161



>emb|CDM84014.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 131/176 (74%), Gaps = 6/176 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR A S  RALK   S+R       ++      SSGGLF WL G + +  P LD PL G
Sbjct  1    MYRVAGSHLRALKQHGSSR------FASTSVVKQSSGGLFGWLLGSKPTQFPALDVPLPG  54

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            VT+PPPLPD VEP   K+TTLPNG+KIASETS SPAA+VGLY+D GS+YE P S GASHL
Sbjct  55   VTIPPPLPDFVEPAKAKVTTLPNGIKIASETSTSPAATVGLYIDCGSMYETPGSSGASHL  114

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERM+FKST NRSHLR+VREVE+IGG+V A A+REQM YTYDA + YVP MVE+L+
Sbjct  115  LERMSFKSTTNRSHLRLVREVESIGGNVSAIATREQMCYTYDAFRAYVPDMVEVLI  170



>ref|XP_010487509.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-2 [Camelina sativa]
Length=501

 Score =   226 bits (575),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 142/178 (80%), Gaps = 2/178 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASN--RALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYRT ASRA+ALKG  ++  RA    +SS   A++SS+ G FSWLTG  SS+LPP+D PL
Sbjct  1    MYRTTASRAKALKGILNHNLRASRYASSSAVAASSSSTPGFFSWLTGGSSSSLPPMDIPL  60

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
             GV+LPPPL DHV P   K TTL NGLKIA+E S++PAAS+GLYVD GSIYE P S GA+
Sbjct  61   AGVSLPPPLADHVAPEKLKTTTLSNGLKIATEMSSNPAASIGLYVDCGSIYETPYSRGAT  120

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            HLLERMAFKSTLNRSH R+VRE+EA+GG+  A+ASREQM YT DALKTYVP MVE+L+
Sbjct  121  HLLERMAFKSTLNRSHFRLVREIEAMGGNTSASASREQMGYTIDALKTYVPEMVEVLI  178



>gb|EMS48740.1| Mitochondrial-processing peptidase subunit alpha [Triticum urartu]
Length=498

 Score =   225 bits (574),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 130/176 (74%), Gaps = 6/176 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR A S  R LK   S+R       ++      SSGGLF WL G + +  P LD PL G
Sbjct  1    MYRVAGSHLRVLKQHGSSR------FASTSVVKQSSGGLFGWLLGSKPTQFPTLDVPLPG  54

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            VT+PPPLPD VEP   K+TTLPNGLKIASETS SPAA+VGLY+D GS+YE P S GASHL
Sbjct  55   VTIPPPLPDFVEPAKAKVTTLPNGLKIASETSTSPAATVGLYIDCGSMYETPGSSGASHL  114

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERM+FKST NRSHLR+VREVE+IGG+V A A+REQM YTYDA + YVP MVE+L+
Sbjct  115  LERMSFKSTTNRSHLRLVREVESIGGNVSAIATREQMCYTYDAFRAYVPDMVEVLI  170



>ref|XP_006595118.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X3 [Glycine max]
Length=443

 Score =   224 bits (570),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 131/176 (74%), Gaps = 14/176 (8%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR  +SR    KG       +R              GLF WLTGE S+ LPPLD PL+G
Sbjct  1    MYRAVSSRLTLPKGNGRTLGASR--------------GLFRWLTGESSNPLPPLDTPLRG  46

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+LPP LPD VEP +TKITTLPNGLKIASETS +PAAS+GLY+D GS+YE P S GAS L
Sbjct  47   VSLPPSLPDFVEPSNTKITTLPNGLKIASETSPNPAASIGLYLDCGSLYETPLSSGASLL  106

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LE+M+FKST NRSH RVVREVEAIGG+V A+ASREQM YT+DALKTYVP M+ELL+
Sbjct  107  LEKMSFKSTANRSHFRVVREVEAIGGNVGASASREQMGYTFDALKTYVPQMIELLI  162



>ref|XP_006392972.1| hypothetical protein EUTSA_v10011412mg [Eutrema salsugineum]
 gb|ESQ30258.1| hypothetical protein EUTSA_v10011412mg [Eutrema salsugineum]
Length=466

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 146/178 (82%), Gaps = 3/178 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRAL--TRFasstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYRTAASRARALKG  S R+L   R+ASS+AVAT+SS  G  SWLTG  S ++  LD PL
Sbjct  1    MYRTAASRARALKGSLS-RSLRPARYASSSAVATSSSPSGFLSWLTGSSSGSITSLDMPL  59

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
            +GV+LPPPLPD VEP   KITTLPNG KIASE S +PAAS+GLYVD GSIYE P   GA+
Sbjct  60   QGVSLPPPLPDLVEPSKIKITTLPNGFKIASEMSPNPAASIGLYVDCGSIYEAPYFHGAT  119

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            HLLERMAFKSTLNRSHLR+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE+L+
Sbjct  120  HLLERMAFKSTLNRSHLRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLI  177



>ref|XP_006595117.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X2 [Glycine max]
Length=470

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 131/176 (74%), Gaps = 14/176 (8%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR  +SR    KG       +R              GLF WLTGE S+ LPPLD PL+G
Sbjct  1    MYRAVSSRLTLPKGNGRTLGASR--------------GLFRWLTGESSNPLPPLDTPLRG  46

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+LPP LPD VEP +TKITTLPNGLKIASETS +PAAS+GLY+D GS+YE P S GAS L
Sbjct  47   VSLPPSLPDFVEPSNTKITTLPNGLKIASETSPNPAASIGLYLDCGSLYETPLSSGASLL  106

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LE+M+FKST NRSH RVVREVEAIGG+V A+ASREQM YT+DALKTYVP M+ELL+
Sbjct  107  LEKMSFKSTANRSHFRVVREVEAIGGNVGASASREQMGYTFDALKTYVPQMIELLI  162



>ref|XP_003542085.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X1 [Glycine max]
Length=491

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 131/176 (74%), Gaps = 14/176 (8%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR  +SR    KG       +R              GLF WLTGE S+ LPPLD PL+G
Sbjct  1    MYRAVSSRLTLPKGNGRTLGASR--------------GLFRWLTGESSNPLPPLDTPLRG  46

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+LPP LPD VEP +TKITTLPNGLKIASETS +PAAS+GLY+D GS+YE P S GAS L
Sbjct  47   VSLPPSLPDFVEPSNTKITTLPNGLKIASETSPNPAASIGLYLDCGSLYETPLSSGASLL  106

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LE+M+FKST NRSH RVVREVEAIGG+V A+ASREQM YT+DALKTYVP M+ELL+
Sbjct  107  LEKMSFKSTANRSHFRVVREVEAIGGNVGASASREQMGYTFDALKTYVPQMIELLI  162



>emb|CDY33843.1| BnaC06g05100D [Brassica napus]
Length=502

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 146/178 (82%), Gaps = 3/178 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALT--RFasstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYRTAASRA+ALKG  S R L   R+ASS AVAT+SSS G F WLTG  SS+L  LD PL
Sbjct  1    MYRTAASRAKALKGSLS-RGLAPARYASSNAVATSSSSTGFFGWLTGGSSSSLASLDMPL  59

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
            +GV+LPPPL DHVEP   KITTLPNGLKIASE S +PAAS+GLYVD GSIYE P   GA+
Sbjct  60   QGVSLPPPLADHVEPSKLKITTLPNGLKIASEMSPNPAASIGLYVDCGSIYEAPYFHGAT  119

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            HLLERMAFKST NRSHLR+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE+L+
Sbjct  120  HLLERMAFKSTTNRSHLRLVREIEAIGGNTSASASREQMSYTIDALKTYVPGMVEVLI  177



>ref|XP_010535187.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-2 isoform X2 [Tarenaya hassleriana]
Length=409

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRAS-NRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYRTAA R+R LKG    N    R+ASS+AVAT+SSSGG FSWLTGE S +LP +D PLK
Sbjct  1    MYRTAALRSRVLKGCLHRNLRAARYASSSAVATSSSSGGFFSWLTGETSRSLPSMDMPLK  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV++PPPL DHVEP   K+TTLPNGLK+ASE S +PAA +GLYVD GSIYE P S GA+H
Sbjct  61   GVSIPPPLADHVEPSKIKVTTLPNGLKLASEASPNPAAFIGLYVDCGSIYETPYSHGATH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKSTLNRSHLR+VREVEAIGG   A+ASREQM +T DALKTYVP MVE+L+
Sbjct  121  LLERMAFKSTLNRSHLRLVREVEAIGGHTCASASREQMGFTIDALKTYVPEMVEVLI  177



>gb|KFK35813.1| hypothetical protein AALP_AA4G040900 [Arabis alpina]
Length=513

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 144/183 (79%), Gaps = 8/183 (4%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRAL----TRFasstavatnsss---GGLFSWLTGERSSALPP  312
            MYRTA SRARALKG  S R L     R+ASS+AVAT+SSS   GG  SWLTG  S  L  
Sbjct  1    MYRTAISRARALKGSLS-RGLRPVAARYASSSAVATSSSSSSSGGFLSWLTGGSSGMLTS  59

Query  313  LDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPA  492
            LD PL+GV+LPPPL DHVEP    ITTLPNG KIASE S +PAAS+GLYVD GSIYE P 
Sbjct  60   LDMPLQGVSLPPPLADHVEPSKHIITTLPNGFKIASEMSPNPAASIGLYVDCGSIYEAPY  119

Query  493  SFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVE  672
              GA+HLLERMAFKSTLNRSHLR+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE
Sbjct  120  FHGATHLLERMAFKSTLNRSHLRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVE  179

Query  673  LLV  681
            +L+
Sbjct  180  VLI  182



>ref|XP_006392973.1| hypothetical protein EUTSA_v10011412mg [Eutrema salsugineum]
 gb|ESQ30259.1| hypothetical protein EUTSA_v10011412mg [Eutrema salsugineum]
Length=502

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 146/178 (82%), Gaps = 3/178 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRAL--TRFasstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYRTAASRARALKG  S R+L   R+ASS+AVAT+SS  G  SWLTG  S ++  LD PL
Sbjct  1    MYRTAASRARALKGSLS-RSLRPARYASSSAVATSSSPSGFLSWLTGSSSGSITSLDMPL  59

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
            +GV+LPPPLPD VEP   KITTLPNG KIASE S +PAAS+GLYVD GSIYE P   GA+
Sbjct  60   QGVSLPPPLPDLVEPSKIKITTLPNGFKIASEMSPNPAASIGLYVDCGSIYEAPYFHGAT  119

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            HLLERMAFKSTLNRSHLR+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE+L+
Sbjct  120  HLLERMAFKSTLNRSHLRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLI  177



>emb|CDY53441.1| BnaC03g78020D [Brassica napus]
Length=502

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 143/178 (80%), Gaps = 3/178 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRAL--TRFasstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYRTAASRARALKG  S R L   R+AS++AVAT++SS G   WLTG  S +L  LD PL
Sbjct  1    MYRTAASRARALKGSLS-RGLGPARYASASAVATSASSPGFLGWLTGGSSGSLTSLDMPL  59

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
            +GV+LPP L D VEP   KITTLPNGLKIASE S +PAAS+GLYVD GSIYE P   GA+
Sbjct  60   QGVSLPPSLADRVEPSKLKITTLPNGLKIASEMSPNPAASIGLYVDCGSIYEAPYFHGAT  119

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            HLLERMAFKST NRSHLR+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE+L+
Sbjct  120  HLLERMAFKSTTNRSHLRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLI  177



>gb|KHN30017.1| Mitochondrial-processing peptidase subunit alpha [Glycine soja]
Length=425

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 131/176 (74%), Gaps = 14/176 (8%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR  +SR    KG       +R              GLF WLTGE S+ LPPLD PL+G
Sbjct  1    MYRAVSSRLTLPKGNGRTLGTSR--------------GLFRWLTGESSNPLPPLDTPLRG  46

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+LPP LPD VEP +TKITTLPNGLKIASETS +PAAS+GLY+D GS+YE P S GAS L
Sbjct  47   VSLPPSLPDFVEPSNTKITTLPNGLKIASETSPNPAASIGLYLDCGSLYETPLSSGASLL  106

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LE+M+FKST NRSH RVVREVEAIGG+V A+ASREQM YT++ALKTYVP M+ELL+
Sbjct  107  LEKMSFKSTANRSHFRVVREVEAIGGNVGASASREQMGYTFNALKTYVPQMIELLI  162



>ref|XP_010535186.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-2 isoform X1 [Tarenaya hassleriana]
Length=502

 Score =   223 bits (569),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRAS-NRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYRTAA R+R LKG    N    R+ASS+AVAT+SSSGG FSWLTGE S +LP +D PLK
Sbjct  1    MYRTAALRSRVLKGCLHRNLRAARYASSSAVATSSSSGGFFSWLTGETSRSLPSMDMPLK  60

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV++PPPL DHVEP   K+TTLPNGLK+ASE S +PAA +GLYVD GSIYE P S GA+H
Sbjct  61   GVSIPPPLADHVEPSKIKVTTLPNGLKLASEASPNPAAFIGLYVDCGSIYETPYSHGATH  120

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKSTLNRSHLR+VREVEAIGG   A+ASREQM +T DALKTYVP MVE+L+
Sbjct  121  LLERMAFKSTLNRSHLRLVREVEAIGGHTCASASREQMGFTIDALKTYVPEMVEVLI  177



>ref|XP_010465671.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-2 [Camelina sativa]
Length=501

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 138/178 (78%), Gaps = 2/178 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASN--RALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYR AASR +ALKG  ++  RA    +SS   A++S   G FSWLTG  SS+LPP+D PL
Sbjct  1    MYRMAASRTKALKGILNHNLRASRYASSSAVAASSSLKPGFFSWLTGGSSSSLPPMDIPL  60

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
             GV+LPPPL DHV P   K TTL NGLKIA+E S++PAAS+GLYVD GSIYE P S G +
Sbjct  61   AGVSLPPPLADHVAPEKLKTTTLSNGLKIATEMSSNPAASIGLYVDCGSIYETPYSRGVT  120

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            HLLERMAFKSTLNRSH R+VRE+EA+GG+  A+ASREQM YT DALKTYVP MVE+L+
Sbjct  121  HLLERMAFKSTLNRSHFRLVREIEAMGGNTSASASREQMGYTIDALKTYVPEMVEVLI  178



>ref|XP_004961441.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Setaria italica]
Length=499

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 137/176 (78%), Gaps = 6/176 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR A S  R+LK   + R       ++      S GGLF WL G +SS LPPLD PL G
Sbjct  1    MYRAAGSHLRSLKHHGATR------LASTSVVKQSQGGLFGWLLGGKSSQLPPLDVPLPG  54

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            +T+PPPLPD VEP  TKITTLPNG+KIASETSASPA SVGLY+D GSIYE PAS G SHL
Sbjct  55   ITIPPPLPDFVEPSKTKITTLPNGVKIASETSASPAVSVGLYIDCGSIYETPASSGVSHL  114

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST+NRSHLR+VREVEAIGG+V A+ASREQM+YTYDALK+Y P MVE+L+
Sbjct  115  LERMAFKSTVNRSHLRLVREVEAIGGNVSASASREQMSYTYDALKSYTPEMVEVLI  170



>ref|XP_002894348.1| hypothetical protein ARALYDRAFT_474319 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70607.1| hypothetical protein ARALYDRAFT_474319 [Arabidopsis lyrata subsp. 
lyrata]
Length=503

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 145/179 (81%), Gaps = 4/179 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRAL--TRFasstavatnsssG-GLFSWLTGERSSALPPLDFP  324
            MYRTAASRARALKG  + R+L   R+ASS+AVA  SSS  G  SWL+G   ++L  LD P
Sbjct  1    MYRTAASRARALKGVLT-RSLRPARYASSSAVAATSSSTPGYLSWLSGGSGASLTSLDMP  59

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            L+GV+LPPPL D VEP   KITTLPNGLKIASETS +PAAS+GLYVD GSIYE P   GA
Sbjct  60   LQGVSLPPPLADKVEPSKLKITTLPNGLKIASETSPNPAASIGLYVDCGSIYEAPYFHGA  119

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +HLLERMAFKSTLNR+H R+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE+L+
Sbjct  120  THLLERMAFKSTLNRTHFRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLI  178



>ref|NP_001077701.1| putative mitochondrial-processing peptidase subunit alpha-1 [Arabidopsis 
thaliana]
 gb|AEE32743.1| putative mitochondrial-processing peptidase subunit alpha-1 [Arabidopsis 
thaliana]
Length=451

 Score =   219 bits (559),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 144/179 (80%), Gaps = 4/179 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRAL--TRFasstavatnsssG-GLFSWLTGERSSALPPLDFP  324
            MYRTAASRARALKG  + R+L   R+ASS+AVA  SSS     SWL+G   +AL  LD P
Sbjct  1    MYRTAASRARALKGVLT-RSLRPARYASSSAVAETSSSTPAYLSWLSGGSRAALTSLDMP  59

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            L+GV+LPPPL D VEP   +ITTLPNGLKIASET+ +PAAS+GLYVD GSIYE P   GA
Sbjct  60   LQGVSLPPPLADKVEPSKLQITTLPNGLKIASETTPNPAASIGLYVDCGSIYEAPYFHGA  119

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +HLLERMAFKSTLNR+H R+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE+L+
Sbjct  120  THLLERMAFKSTLNRTHFRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLI  178



>ref|XP_007150592.1| hypothetical protein PHAVU_005G1652000g, partial [Phaseolus vulgaris]
 gb|ESW22586.1| hypothetical protein PHAVU_005G1652000g, partial [Phaseolus vulgaris]
Length=482

 Score =   220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +1

Query  265  GLFSWLTGERSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAA  444
            GLFSWLTGE SS+LPPLD PL+G   PP LPD+VEPG TKITTL NGLKIASETS +PAA
Sbjct  15   GLFSWLTGESSSSLPPLDTPLRGFAPPPSLPDYVEPGKTKITTLSNGLKIASETSPNPAA  74

Query  445  SVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQM  624
            S+GLYVD GS+YE P   GASHLLE+MAFKST NRSH RVVREVEA+GG+V A+ASR+Q+
Sbjct  75   SIGLYVDCGSLYETPLLSGASHLLEKMAFKSTTNRSHFRVVREVEAVGGNVGASASRDQI  134

Query  625  TYTYDALKTYVPHMVELLV  681
             YT+DALKTYVP M+ELLV
Sbjct  135  GYTFDALKTYVPQMIELLV  153



>dbj|BAE98617.1| hypothetical protein [Arabidopsis thaliana]
Length=494

 Score =   220 bits (560),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 144/179 (80%), Gaps = 4/179 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRAL--TRFasstavatnsssG-GLFSWLTGERSSALPPLDFP  324
            MYRTAASRARALKG  + R+L   R+ASS+AVA  SSS     SWL+G   +AL  LD P
Sbjct  1    MYRTAASRARALKGVLT-RSLRPARYASSSAVAETSSSTPAYLSWLSGGSRAALTSLDMP  59

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            L+GV+LPPPL D VEP   +ITTLPNGLKIASET+ +PAAS+GLYVD GSIYE P   GA
Sbjct  60   LQGVSLPPPLADKVEPSKLQITTLPNGLKIASETTPNPAASIGLYVDCGSIYEAPYFHGA  119

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +HLLERMAFKSTLNR+H R+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE+L+
Sbjct  120  THLLERMAFKSTLNRTHFRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLI  178



>ref|NP_175610.1| putative mitochondrial-processing peptidase subunit alpha-1 [Arabidopsis 
thaliana]
 sp|Q9ZU25.1|MPPA1_ARATH RecName: Full=Probable mitochondrial-processing peptidase subunit 
alpha-1; AltName: Full=Alpha-MPP 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD12673.1| Strong similarity to gi|2062155 T02O04.2 mitochondrial processing 
peptidase alpha subunit precusor isolog from Arabidopsis 
thaliana BAC gb|AC001645. ESTs gb|Z18504 and gb|AA395715 come 
from this gene [Arabidopsis thaliana]
 gb|AAL38862.1| putative mitochondrial processing peptidase alpha subunit [Arabidopsis 
thaliana]
 gb|AAM14194.1| putative mitochondrial processing peptidase alpha subunit [Arabidopsis 
thaliana]
 gb|AEE32742.1| putative mitochondrial-processing peptidase subunit alpha-1 [Arabidopsis 
thaliana]
Length=503

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 144/179 (80%), Gaps = 4/179 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRAL--TRFasstavatnsssG-GLFSWLTGERSSALPPLDFP  324
            MYRTAASRARALKG  + R+L   R+ASS+AVA  SSS     SWL+G   +AL  LD P
Sbjct  1    MYRTAASRARALKGVLT-RSLRPARYASSSAVAETSSSTPAYLSWLSGGSRAALTSLDMP  59

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            L+GV+LPPPL D VEP   +ITTLPNGLKIASET+ +PAAS+GLYVD GSIYE P   GA
Sbjct  60   LQGVSLPPPLADKVEPSKLQITTLPNGLKIASETTPNPAASIGLYVDCGSIYEAPYFHGA  119

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +HLLERMAFKSTLNR+H R+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE+L+
Sbjct  120  THLLERMAFKSTLNRTHFRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLI  178



>gb|AAM65922.1| mitochondrial processing peptidase alpha subunit, putative [Arabidopsis 
thaliana]
Length=503

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 144/179 (80%), Gaps = 4/179 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRAL--TRFasstavatnsssG-GLFSWLTGERSSALPPLDFP  324
            MYRTAASRARALKG  + R+L   R+ASS+AVA  SSS     SWL+G   +AL  LD P
Sbjct  1    MYRTAASRARALKGVLT-RSLRPARYASSSAVAETSSSTPAYLSWLSGGSRAALTSLDMP  59

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            L+GV+LPPPL D VEP   +ITTLPNGLKIASET+ +PAAS+GLYVD GSIYE P   GA
Sbjct  60   LQGVSLPPPLADKVEPSKLQITTLPNGLKIASETTPNPAASIGLYVDCGSIYEAPYFHGA  119

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +HLLERMAFKSTLNR+H R+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE+L+
Sbjct  120  THLLERMAFKSTLNRTHFRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLI  178



>ref|XP_006307303.1| hypothetical protein CARUB_v10008921mg [Capsella rubella]
 gb|EOA40201.1| hypothetical protein CARUB_v10008921mg [Capsella rubella]
Length=503

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 142/179 (79%), Gaps = 4/179 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRAL--TRFasstavatnsssG-GLFSWLTGERSSALPPLDFP  324
            MYRTAASRA+ALKG  + R+L   R+ASS+A A  +SS  G  SWL G  SS L  LD P
Sbjct  1    MYRTAASRAKALKGVLT-RSLRPARYASSSAAAATTSSTPGYLSWLGGGSSSTLTSLDMP  59

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            L+GV+LPPPL D VEP   K+TTLPNGLKIASE S +PAAS+GLYVD GSIYE P   GA
Sbjct  60   LQGVSLPPPLADKVEPSKLKVTTLPNGLKIASEMSPNPAASIGLYVDCGSIYEAPYFHGA  119

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +HLLERMAFKSTLNR+H R+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE+L+
Sbjct  120  THLLERMAFKSTLNRTHFRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLI  178



>ref|XP_009147720.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-1 [Brassica rapa]
Length=506

 Score =   218 bits (555),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 142/181 (78%), Gaps = 5/181 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASN-----RALTRFasstavatnsssGGLFSWLTGERSSALPPLD  318
            MYRTAASRA+ALKG  S      R  +  A +T+ +++SSS G F WLTG  SS+L  LD
Sbjct  1    MYRTAASRAKALKGSLSRGLAPARYASSSAVATSSSSSSSSSGFFGWLTGGSSSSLNSLD  60

Query  319  FPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASF  498
             PL+GV+LPPPL DHVEP   KITTLPNGLKIASE S +P AS+GLYVD GSIYE P   
Sbjct  61   MPLQGVSLPPPLADHVEPSKLKITTLPNGLKIASEMSPNPVASIGLYVDCGSIYEAPYFH  120

Query  499  GASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
            GA+HLLERMAFKST NRSHLR+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE+L
Sbjct  121  GATHLLERMAFKSTTNRSHLRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVL  180

Query  679  V  681
            +
Sbjct  181  I  181



>ref|XP_009144867.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-1 [Brassica rapa]
Length=504

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 148/180 (82%), Gaps = 5/180 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRAL--TRFasstavatnsssG--GLFSWLTGERSSALPPLDF  321
            MYRTAASRARALKG  S R+L   R+ASS+AVAT+SSS   G FSWLTG  SS+L  LD 
Sbjct  1    MYRTAASRARALKGSLS-RSLRPARYASSSAVATSSSSSSPGFFSWLTGGSSSSLNSLDM  59

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
            PL+GV+LPPPL D VEP   KITTLPNGLKIASE S +PAAS+GLYVD GSIYE P   G
Sbjct  60   PLQGVSLPPPLADLVEPSKLKITTLPNGLKIASEMSPNPAASIGLYVDCGSIYEAPYFHG  119

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            A+HLLERMAFKST NRSHLR+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE+L+
Sbjct  120  ATHLLERMAFKSTRNRSHLRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLI  179



>emb|CDY22877.1| BnaA06g02000D [Brassica napus]
Length=504

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 146/180 (81%), Gaps = 5/180 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALT--RFasstavatnsssG--GLFSWLTGERSSALPPLDF  321
            MYRTAASRA+ALKG  S R L   R+ASS+AVAT+SSS   G F WLTG  SS+L  LD 
Sbjct  1    MYRTAASRAKALKGSLS-RGLAPARYASSSAVATSSSSSSSGFFGWLTGGSSSSLASLDM  59

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
            PL+GV+LPPPL DHVEP   KITTLPNGLKIASE S +P AS+GLYVD GSIYE P   G
Sbjct  60   PLQGVSLPPPLADHVEPSKLKITTLPNGLKIASEMSPNPVASIGLYVDCGSIYEAPYFHG  119

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            A+HLLERMAFKST NRSHLR+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE+L+
Sbjct  120  ATHLLERMAFKSTTNRSHLRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLI  179



>emb|CDY45641.1| BnaA05g15080D [Brassica napus]
Length=504

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 148/180 (82%), Gaps = 5/180 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRAL--TRFasstavatnsssG--GLFSWLTGERSSALPPLDF  321
            MYRTAASRARALKG  S R+L   R+ASS+AVAT+SSS   G FSWLTG  SS+L  LD 
Sbjct  1    MYRTAASRARALKGSLS-RSLRPARYASSSAVATSSSSSSPGFFSWLTGGSSSSLNSLDM  59

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
            PL+GV+LPPPL D VEP   KITTLPNGLKIASE S +PAAS+GLYVD GSIYE P   G
Sbjct  60   PLQGVSLPPPLADLVEPSKLKITTLPNGLKIASEMSPNPAASIGLYVDCGSIYEAPYFHG  119

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            A+HLLERMAFKST NRSHLR+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE+L+
Sbjct  120  ATHLLERMAFKSTRNRSHLRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLI  179



>ref|XP_002515947.1| mitochondrial processing peptidase alpha subunit, putative [Ricinus 
communis]
 gb|EEF46367.1| mitochondrial processing peptidase alpha subunit, putative [Ricinus 
communis]
Length=492

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYRTAASR RALK    N   TR+A+S+AV   +SS G FSWLTGE+SS+LPPL  PL  
Sbjct  1    MYRTAASRLRALKSHVGNLGATRYATSSAVTARTSSPGFFSWLTGEKSSSLPPLSSPLAD  60

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+LPPPLPD+VEP   K  TL NG++I SE + SPAAS+GLY+D GSIYE P S GA+HL
Sbjct  61   VSLPPPLPDYVEPSKVKSKTLENGVRIVSEATPSPAASIGLYIDCGSIYETPMSCGATHL  120

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NRSHLR+VREVEAIGG++ A+ASREQM YT+DAL+T++P MVELLV
Sbjct  121  LERMAFKSTRNRSHLRIVREVEAIGGNIGASASREQMAYTFDALRTHIPEMVELLV  176



>gb|AFW58098.1| hypothetical protein ZEAMMB73_790961 [Zea mays]
Length=834

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  262  GGLFSWLTGERSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPA  441
            GGL SWL G +SS LPPLD PL G+++P PLPD VEP  TK+TTLPNG+KIASETS+SPA
Sbjct  490  GGLCSWLLGGKSSELPPLDVPLPGISIPSPLPDFVEPSKTKVTTLPNGVKIASETSSSPA  549

Query  442  ASVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQ  621
            ASVGLY+D GSI E PAS G SHLLERMAFKST+NR+HL++VREVEAIGG+V A+ASREQ
Sbjct  550  ASVGLYIDCGSICETPASSGVSHLLERMAFKSTVNRTHLQLVREVEAIGGNVSASASREQ  609

Query  622  MTYTYDALKTYVPHMVELLV  681
            M+YTYDALK+Y P MVE+L+
Sbjct  610  MSYTYDALKSYTPEMVEVLI  629



>emb|CDX87868.1| BnaC06g09300D [Brassica napus]
Length=504

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 147/180 (82%), Gaps = 5/180 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRAL--TRFasstavatnsssG--GLFSWLTGERSSALPPLDF  321
            MYRTAASRARALKG  S R+L   R+ASS+AVAT+SSS   G FSWLTG  SS+L  LD 
Sbjct  1    MYRTAASRARALKGSLS-RSLRPARYASSSAVATSSSSSSPGFFSWLTGGSSSSLTSLDM  59

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
            PL+GV+LPPPL D VEP   KITTLPNGLKIASE S +P AS+GLYVD GSIYE P   G
Sbjct  60   PLQGVSLPPPLADLVEPSKLKITTLPNGLKIASEMSPNPTASIGLYVDCGSIYEAPYFHG  119

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            A+HLLERMAFKST NRSHLR+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE+L+
Sbjct  120  ATHLLERMAFKSTRNRSHLRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLI  179



>gb|KJB68194.1| hypothetical protein B456_010G231200 [Gossypium raimondii]
Length=430

 Score =   208 bits (530),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 127/176 (72%), Gaps = 21/176 (12%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR A SR RALKGR+ N A  R+A+                     SSA+ PLD PL  
Sbjct  1    MYRVALSRFRALKGRSGNLAAARYAT---------------------SSAVAPLDTPLDS  39

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+LPPPLPD+V P  TKI TL NG++IASE   +PAAS+GL+++ GSIYE P S GASHL
Sbjct  40   VSLPPPLPDYVAPSETKIKTLSNGVRIASEQLPTPAASIGLFINCGSIYETPISSGASHL  99

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NRSHLRVVREVEAIGG+  A+A+RE MTYT+DALKTYVP MVELL+
Sbjct  100  LERMAFKSTTNRSHLRVVREVEAIGGNTLASATRECMTYTFDALKTYVPEMVELLI  155



>ref|XP_010232284.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X2 [Brachypodium distachyon]
Length=477

 Score =   209 bits (532),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  RSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSG  471
            +S+ +PPLD PL G+T PPPLPD +EP  T +TTLPNG+KIASETS SPAASVGLYVD G
Sbjct  40   KSTQIPPLDIPLPGITFPPPLPDFIEPAKTIVTTLPNGIKIASETSMSPAASVGLYVDCG  99

Query  472  SIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKT  651
            SIYE P S GASHLLERMAFKST NRSHLR+VREVE+IGG++ A+ASREQM YTYDA K 
Sbjct  100  SIYETPNSSGASHLLERMAFKSTTNRSHLRLVREVESIGGNISASASREQMCYTYDAFKA  159

Query  652  YVPHMVELLV  681
            YVP MVE+L+
Sbjct  160  YVPDMVEVLI  169



>ref|XP_010232283.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X1 [Brachypodium distachyon]
Length=498

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  RSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSG  471
            +S+ +PPLD PL G+T PPPLPD +EP  T +TTLPNG+KIASETS SPAASVGLYVD G
Sbjct  40   KSTQIPPLDIPLPGITFPPPLPDFIEPAKTIVTTLPNGIKIASETSMSPAASVGLYVDCG  99

Query  472  SIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKT  651
            SIYE P S GASHLLERMAFKST NRSHLR+VREVE+IGG++ A+ASREQM YTYDA K 
Sbjct  100  SIYETPNSSGASHLLERMAFKSTTNRSHLRLVREVESIGGNISASASREQMCYTYDAFKA  159

Query  652  YVPHMVELLV  681
            YVP MVE+L+
Sbjct  160  YVPDMVEVLI  169



>gb|KFK38993.1| hypothetical protein AALP_AA3G186200 [Arabis alpina]
Length=503

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 137/178 (77%), Gaps = 2/178 (1%)
 Frame = +1

Query  154  MYRTAASRARALKGRASN--RALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYRTAASRA+ALKG  S   R+    +SS    ++S++ G  SWLTG  SS+LP +  PL
Sbjct  1    MYRTAASRAKALKGCLSRYLRSPRYASSSAVATSSSTTPGFASWLTGGSSSSLPSMAIPL  60

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
             GV LPP L D+VEP   K TTLPNGL+IASE S +P AS+GLYVD GS++E P   GA+
Sbjct  61   TGVILPPSLADYVEPSKLKTTTLPNGLRIASEMSPNPTASIGLYVDCGSMHETPYFRGAT  120

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            HLLERMAFKSTLNRSHLR+VRE+EA+GG+  A+ASREQM+YT DAL+TYVP MVE+L+
Sbjct  121  HLLERMAFKSTLNRSHLRLVREIEAMGGNTSASASREQMSYTIDALRTYVPEMVEVLI  178



>gb|KJB68192.1| hypothetical protein B456_010G231200 [Gossypium raimondii]
 gb|KJB68195.1| hypothetical protein B456_010G231200 [Gossypium raimondii]
Length=484

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 127/176 (72%), Gaps = 21/176 (12%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYR A SR RALKGR+ N A  R+A+                     SSA+ PLD PL  
Sbjct  1    MYRVALSRFRALKGRSGNLAAARYAT---------------------SSAVAPLDTPLDS  39

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+LPPPLPD+V P  TKI TL NG++IASE   +PAAS+GL+++ GSIYE P S GASHL
Sbjct  40   VSLPPPLPDYVAPSETKIKTLSNGVRIASEQLPTPAASIGLFINCGSIYETPISSGASHL  99

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NRSHLRVVREVEAIGG+  A+A+RE MTYT+DALKTYVP MVELL+
Sbjct  100  LERMAFKSTTNRSHLRVVREVEAIGGNTLASATRECMTYTFDALKTYVPEMVELLI  155



>ref|NP_001150614.1| mitochondrial-processing peptidase alpha subunit [Zea mays]
 gb|ACG39762.1| mitochondrial-processing peptidase alpha subunit [Zea mays]
Length=505

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 132/178 (74%), Gaps = 3/178 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTR--FasstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYR A+    ALK   +N  +       ++      SSGGL++WLTG RS+ +PP DF L
Sbjct  1    MYRVASGLG-ALKRHGANAQMMNAAIRCASTSVAQRSSGGLWTWLTGARSNEIPPPDFTL  59

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
             GVT+PPPLPDHVE G T++TTLPNG+KIASETSA  + SVG+YVD GS+YE P + GAS
Sbjct  60   PGVTIPPPLPDHVEAGKTRVTTLPNGVKIASETSAGSSCSVGVYVDCGSVYEAPETTGAS  119

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
             LL+ MAF +T NRS LRVVRE+EAIGGS +A+ASRE M+YTY ALKTY+P MVE+L+
Sbjct  120  QLLKTMAFTTTANRSELRVVREIEAIGGSAKASASREMMSYTYGALKTYMPEMVEVLI  177



>ref|XP_004968500.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Setaria italica]
Length=505

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 136/178 (76%), Gaps = 3/178 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFa--sstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYR A S  RALK   ++  +   A  S++     SSSGG ++WLTG RS+ALPP DF L
Sbjct  1    MYR-AVSGLRALKRHRADAQMMNIAIRSASTSVAQSSSGGFWTWLTGARSNALPPPDFEL  59

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
             GVT+PPPLP+ VEPG TKITTL NG+KIASETSA P+ SVG+YVD GS+YE P + GAS
Sbjct  60   PGVTIPPPLPNLVEPGKTKITTLSNGVKIASETSAGPSCSVGVYVDCGSVYEAPETTGAS  119

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
             LL+ +AF +T NRS LRVVRE+EAIGGS +A+ASRE M+YTY ALKTY+P MVE+L+
Sbjct  120  QLLKTLAFSTTTNRSELRVVREIEAIGGSAKASASREMMSYTYGALKTYMPEMVEVLI  177



>ref|NP_001241707.1| putative mitochondrial processing peptidase alpha subunit family 
protein [Zea mays]
 gb|ACF85240.1| unknown [Zea mays]
 tpg|DAA53038.1| TPA: putative mitochondrial processing peptidase alpha subunit 
family protein [Zea mays]
Length=505

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 131/178 (74%), Gaps = 3/178 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTR--FasstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYR A+    ALK   +N  +       ++      SSGG ++WLTG RS+ +PP DF L
Sbjct  1    MYRVASGLG-ALKRHGANAQMMNAAIRCASTSVAQRSSGGFWTWLTGARSNEIPPPDFTL  59

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
             GVT+PPPLPDHVE G T++TTLPNG+KIASETSA  + SVG+YVD GS+YE P + GAS
Sbjct  60   PGVTIPPPLPDHVEAGKTRVTTLPNGVKIASETSAGSSCSVGVYVDCGSVYEAPETTGAS  119

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
             LL+ MAF +T NRS LRVVRE+EAIGGS +A+ASRE M+YTY ALKTY+P MVE+L+
Sbjct  120  QLLKTMAFTTTANRSELRVVREIEAIGGSAKASASREMMSYTYGALKTYMPEMVEVLI  177



>gb|ACG24289.1| mitochondrial-processing peptidase alpha subunit [Zea mays]
Length=505

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 131/178 (74%), Gaps = 3/178 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTR--FasstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYR A+    ALK   +N  +       ++      SSGG ++WLTG RS+ +PP DF L
Sbjct  1    MYRVASGLG-ALKRHGANAQMMNAAIRCASTSVAQRSSGGFWTWLTGARSNEIPPPDFTL  59

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
             GVT+PPPLPDHVE G T++TTLPNG+KIASETSA  + SVG+YVD GS+YE P + GAS
Sbjct  60   PGVTIPPPLPDHVEAGKTRVTTLPNGVKIASETSAGSSCSVGVYVDCGSVYEAPETTGAS  119

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
             LL+ MAF +T NRS LRVVRE+EAIGGS +A+ASRE M+YTY ALKTY+P MVE+L+
Sbjct  120  QLLKTMAFTTTANRSELRVVREIEAIGGSAKASASREMMSYTYGALKTYMPEMVEVLI  177



>ref|XP_003564704.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Brachypodium distachyon]
Length=505

 Score =   207 bits (527),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 135/178 (76%), Gaps = 3/178 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFa--sstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYR AAS   ALK   ++  +   A  S++      SSGG ++WLTG RS+ALPP DFPL
Sbjct  1    MYR-AASGLGALKRHGADAQMLNLAIRSASTSVAQRSSGGFWTWLTGARSNALPPPDFPL  59

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
             GVT+PPPLPDHVEPG T++TTLPNG+KIASETS     SVG+YV+ GS+YE P + GA+
Sbjct  60   PGVTIPPPLPDHVEPGKTRVTTLPNGVKIASETSPGSTCSVGVYVNCGSVYEAPETLGAT  119

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
             LL+++AF +T NRSHLRVVRE++A+GG   A+A+RE M+Y+Y ALKTY+P MVE+LV
Sbjct  120  QLLKKLAFTTTTNRSHLRVVREIDAVGGKASASANREMMSYSYAALKTYMPEMVEVLV  177



>ref|XP_002883011.1| mppalpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59270.1| mppalpha [Arabidopsis lyrata subsp. lyrata]
Length=514

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 140/179 (78%), Gaps = 4/179 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRAL--TRFasstavatnsssGGLFSWLTGERSS-ALPPLDFP  324
            MYRTAASRA+ALKG   NR L  +R+ASS+AVAT+SSS    S       S ALP +D P
Sbjct  1    MYRTAASRAKALKG-ILNRNLRASRYASSSAVATSSSSASGSSSWLSGGYSSALPSMDIP  59

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            L GV+LPP L DHVEP   KITTLPNGLKIASE S +PAAS+GLYVD GSIYE P   GA
Sbjct  60   LTGVSLPPSLADHVEPSKLKITTLPNGLKIASEMSLNPAASIGLYVDCGSIYETPQFRGA  119

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +HLLERMAFKSTLNRSH R+VRE+EA+GG+  A+ASREQM YT DALKTYVP MVE+L+
Sbjct  120  THLLERMAFKSTLNRSHFRLVREIEAMGGNTSASASREQMGYTIDALKTYVPEMVEVLI  178



>ref|XP_010231138.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Brachypodium distachyon]
Length=498

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  RSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSG  471
             SS LPPLD PL G+T+PPPLPD VE   TKITTLPNG+KIASETS   AASVGLY+D G
Sbjct  41   NSSQLPPLDVPLSGITIPPPLPDFVELSKTKITTLPNGIKIASETSPGSAASVGLYIDCG  100

Query  472  SIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKT  651
            S+YE  AS GASHLLERMAF+ST NRSHLR+VREVEAIGG+V A+ASREQM+YTYDALKT
Sbjct  101  SVYETAASSGASHLLERMAFRSTTNRSHLRLVREVEAIGGNVSASASREQMSYTYDALKT  160

Query  652  YVPHMVELLV  681
            Y P MVE+L+
Sbjct  161  YAPEMVEVLL  170



>gb|EAY72858.1| hypothetical protein OsI_00727 [Oryza sativa Indica Group]
Length=505

 Score =   205 bits (521),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 135/180 (75%), Gaps = 7/180 (4%)
 Frame = +1

Query  154  MYRTA----ASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDF  321
            MYR A    A +   L G+  N A+     ++      SSGG ++WLTG RS+ALPP DF
Sbjct  1    MYRAASGLGAIKRHGLDGQMLNVAI---RCASTSVAQRSSGGFWTWLTGARSNALPPPDF  57

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
             L GVT+PPPLPD VEPG TKITTL NG+KIASET+  P+ SVG+YV+ GS++E P + G
Sbjct  58   TLPGVTIPPPLPDLVEPGKTKITTLANGVKIASETTPGPSCSVGVYVNCGSVHEAPETLG  117

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            A+ LL++MAF +T NRSHLRVVRE+EA+GG+V+A+A+RE M+Y+Y ALKTY+P MVE+L+
Sbjct  118  ATQLLKKMAFTTTTNRSHLRVVREIEAVGGNVKASANREMMSYSYAALKTYMPEMVEVLI  177



>ref|NP_001042272.1| Os01g0191500 [Oryza sativa Japonica Group]
 dbj|BAD72225.1| putative mitochondrial processing peptidase [Oryza sativa Japonica 
Group]
 dbj|BAF04186.1| Os01g0191500 [Oryza sativa Japonica Group]
 gb|EAZ10865.1| hypothetical protein OsJ_00704 [Oryza sativa Japonica Group]
 dbj|BAG92759.1| unnamed protein product [Oryza sativa Japonica Group]
Length=505

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 135/180 (75%), Gaps = 7/180 (4%)
 Frame = +1

Query  154  MYRTA----ASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDF  321
            MYR A    A +   L G+  N A+     ++      SSGG ++WLTG RS+ALPP DF
Sbjct  1    MYRAASGLGAIKRHGLDGQMLNVAI---RCASTSVAQRSSGGFWTWLTGARSNALPPPDF  57

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
             L GVT+PPPLPD VEPG TKITTL NG+KIASET+  P+ SVG+YV+ GS++E P + G
Sbjct  58   TLPGVTIPPPLPDLVEPGKTKITTLANGVKIASETTPGPSCSVGVYVNCGSVHEAPETLG  117

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            A+ LL++MA+ +T NRSHLRVVRE+EA+GG+V+A+A+RE M+Y+Y ALKTY+P MVE+L+
Sbjct  118  ATQLLKKMAYTTTTNRSHLRVVREIEAVGGNVKASANREMMSYSYAALKTYMPEMVEVLI  177



>ref|XP_010500794.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-1 [Camelina sativa]
Length=503

 Score =   202 bits (513),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 143/179 (80%), Gaps = 4/179 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRAL--TRFasstavatnsssG-GLFSWLTGERSSALPPLDFP  324
            MYRTAASRA+ALKG  + R+L   R+ASS+A A  SSS  G  SWL G  SS+L  LD P
Sbjct  1    MYRTAASRAKALKGVLT-RSLRPARYASSSAAAATSSSTPGYLSWLGGGSSSSLTSLDMP  59

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            L+GV+LPPPL D VEP   KITTLPNGLKIASE S SPAAS+GLYVD GSIYE P   GA
Sbjct  60   LQGVSLPPPLADKVEPSKLKITTLPNGLKIASEMSPSPAASIGLYVDCGSIYEAPYFHGA  119

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +HLLERMAFKSTLNR+H R+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE+L+
Sbjct  120  THLLERMAFKSTLNRTHFRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLI  178



>ref|NP_566548.1| mitochondrial processing peptidase alpha subunit [Arabidopsis 
thaliana]
 sp|O04308.1|MPPA2_ARATH RecName: Full=Probable mitochondrial-processing peptidase subunit 
alpha-2; AltName: Full=Alpha-MPP 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAB63629.1| mitochondrial processing peptidase alpha subunit precusor isolog 
[Arabidopsis thaliana]
 dbj|BAB01147.1| mitochondrial processing peptidase alpha subunit [Arabidopsis 
thaliana]
 gb|AAN13101.1| putative mitochondrial processing peptidase alpha subunit [Arabidopsis 
thaliana]
 gb|AEE75825.1| mitochondrial processing peptidase alpha subunit [Arabidopsis 
thaliana]
Length=499

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 143/177 (81%), Gaps = 4/177 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRAS-NRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYRTAASRA+ALKG  + N   +R+ASS+AVAT+SSS    SWL+G  SS+LP ++ PL 
Sbjct  1    MYRTAASRAKALKGILNHNFRASRYASSSAVATSSSSS---SWLSGGYSSSLPSMNIPLA  57

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV+LPPPL DHVEP   K TTLPNGL IA+E S +PAAS+GLYVD GSIYE P   GA+H
Sbjct  58   GVSLPPPLSDHVEPSKLKTTTLPNGLTIATEMSPNPAASIGLYVDCGSIYETPQFRGATH  117

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKSTLNRSH R+VRE+EAIGG+  A+ASREQM YT DALKTYVP MVE+L+
Sbjct  118  LLERMAFKSTLNRSHFRLVREIEAIGGNTSASASREQMGYTIDALKTYVPEMVEVLI  174



>gb|AAK59675.1| putative mitochondrial processing peptidase alpha subunit [Arabidopsis 
thaliana]
Length=499

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 143/177 (81%), Gaps = 4/177 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRAS-NRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLK  330
            MYRTAASRA+ALKG  + N   +R+ASS+AVAT+SSS    SWL+G  SS+LP ++ PL 
Sbjct  1    MYRTAASRAKALKGILNHNFRASRYASSSAVATSSSSS---SWLSGGYSSSLPSMNIPLA  57

Query  331  GVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASH  510
            GV+LPPPL DHVEP   K TTLPNGL IA+E S +PAAS+GLYVD GSIYE P   GA+H
Sbjct  58   GVSLPPPLSDHVEPSKLKTTTLPNGLTIATEMSPNPAASIGLYVDCGSIYETPQFRGATH  117

Query  511  LLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LLERMAFKSTLNRSH R+VRE+EAIGG+  A+ASREQM YT DALKTYVP MVE+L+
Sbjct  118  LLERMAFKSTLNRSHFRLVREIEAIGGNTSASASREQMGYTIDALKTYVPEMVEVLI  174



>ref|XP_002457199.1| hypothetical protein SORBIDRAFT_03g003160 [Sorghum bicolor]
 gb|EES02319.1| hypothetical protein SORBIDRAFT_03g003160 [Sorghum bicolor]
Length=505

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = +1

Query  262  GGLFSWLTGERSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPA  441
            GG ++WLTG RS+ +PP DF L GVT+PPPLPDHVE G T +TTLPNG+KIASETSA  +
Sbjct  38   GGFWTWLTGARSNEIPPPDFALPGVTIPPPLPDHVEAGKTIVTTLPNGVKIASETSAGSS  97

Query  442  ASVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQ  621
             SVG+YVD GS+YE P + GAS L++ MAF +T NRS LRVVRE++AIGG+ +A+ASRE 
Sbjct  98   CSVGVYVDCGSVYEAPETTGASQLVKTMAFATTANRSELRVVREIDAIGGTAKASASREM  157

Query  622  MTYTYDALKTYVPHMVELLV  681
            M+YTY ALKTY+P MVE+L+
Sbjct  158  MSYTYRALKTYMPEMVEVLI  177



>ref|XP_010479701.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-1 [Camelina sativa]
Length=503

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 142/179 (79%), Gaps = 4/179 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRAL--TRFasstavatnsssG-GLFSWLTGERSSALPPLDFP  324
            MYRTAASRA+ALKG  + R+L   R+ASS+A A  SSS  G  SWL G  S +L  LD P
Sbjct  1    MYRTAASRAKALKGVLT-RSLRPARYASSSAAAATSSSTPGYLSWLGGGSSGSLTSLDMP  59

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            L+GV+LPPPL D VEP   KITTLPNGLKIASE S +PAAS+GLYVD GSIYE P   GA
Sbjct  60   LQGVSLPPPLADKVEPSKLKITTLPNGLKIASEMSPNPAASIGLYVDCGSIYEAPYFHGA  119

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +HLLERMAFKSTLNR+H R+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE+L+
Sbjct  120  THLLERMAFKSTLNRTHFRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLI  178



>emb|CDM81679.1| unnamed protein product [Triticum aestivum]
Length=505

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 131/178 (74%), Gaps = 3/178 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFa--sstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYR AAS   ALK   ++  L   A  S++      SSGG   WLTG RS+ALPP DF L
Sbjct  1    MYR-AASGLGALKQHGADTQLLNIAVRSASTSIAQRSSGGFLGWLTGARSNALPPPDFAL  59

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
             GVT+PPPL DHVEPG TKITTL NG+KIASETS   A SVG+YV+ GS+YE P + GA+
Sbjct  60   PGVTIPPPLADHVEPGKTKITTLSNGVKIASETSPGSACSVGVYVNCGSVYETPETLGAT  119

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
             LL+++AF +T NRS LRVVRE+ AIGGS +A+A+RE M+Y+Y ALKTY+P MVE+LV
Sbjct  120  QLLKKLAFTTTRNRSQLRVVREIGAIGGSAKASANRELMSYSYGALKTYMPEMVEVLV  177



>gb|EEE64417.1| hypothetical protein OsJ_19261 [Oryza sativa Japonica Group]
Length=495

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  RSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSG  471
             SS LPPLD PL GV + PPLPD VEP  TKITTLPNG+KIASETS  PA SVGLY+D G
Sbjct  37   NSSQLPPLDVPLPGVIISPPLPDFVEPSKTKITTLPNGIKIASETSPIPAVSVGLYIDCG  96

Query  472  SIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKT  651
            S+YE  +S G SHLLERMAFKST NRSHLR+VREVEAIGG+V A+ASREQM+YTYDALK 
Sbjct  97   SVYETSSSSGTSHLLERMAFKSTTNRSHLRLVREVEAIGGNVFASASREQMSYTYDALKC  156

Query  652  YVPHMVELLV  681
            Y P MVE+L+
Sbjct  157  YAPEMVEVLI  166



>ref|XP_006643862.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Oryza brachyantha]
Length=505

 Score =   200 bits (508),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 132/180 (73%), Gaps = 7/180 (4%)
 Frame = +1

Query  154  MYRTA----ASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDF  321
            MYR A    A +   L G+  N A+    S++      SSGG +SWLTG RS+ALPP DF
Sbjct  1    MYRAASGLGALKRHGLDGQMLNIAI---RSASTSVAQRSSGGFWSWLTGARSNALPPPDF  57

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
             L GVT+PPPLPD VEP  T+ITTL NG+KIASET+A P+ SVG+YV+ GS++E P + G
Sbjct  58   TLPGVTIPPPLPDFVEPAKTRITTLSNGVKIASETTAGPSCSVGVYVNCGSVHETPETLG  117

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
             + LL++MAF +T NRSHLRVVRE+EA+GGSV+A+A+RE  +Y Y  LKTY+P MVE+L+
Sbjct  118  VTQLLKKMAFTTTTNRSHLRVVREIEAVGGSVKASANREMTSYNYATLKTYMPEMVEVLI  177



>ref|NP_001056089.1| Os05g0524300 [Oryza sativa Japonica Group]
 dbj|BAF18003.1| Os05g0524300, partial [Oryza sativa Japonica Group]
Length=494

 Score =   199 bits (507),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  RSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSG  471
             SS LPPLD PL GV + PPLPD VEP  TKITTLPNG+KIASETS  PA SVGLY+D G
Sbjct  36   NSSQLPPLDVPLPGVIISPPLPDFVEPSKTKITTLPNGIKIASETSPIPAVSVGLYIDCG  95

Query  472  SIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKT  651
            S+YE  +S G SHLLERMAFKST NRSHLR+VREVEAIGG+V A+ASREQM+YTYDALK 
Sbjct  96   SVYETSSSSGTSHLLERMAFKSTTNRSHLRLVREVEAIGGNVFASASREQMSYTYDALKC  155

Query  652  YVPHMVELLV  681
            Y P MVE+L+
Sbjct  156  YAPEMVEVLI  165



>emb|CDY43102.1| BnaC05g36750D [Brassica napus]
Length=494

 Score =   199 bits (506),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 132/176 (75%), Gaps = 7/176 (4%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYRTAA RA+AL G  S R+      +++ A  +++  +FS       S+LP L+ PL G
Sbjct  1    MYRTAALRAKALTGCLS-RSFRASRYASSTAAAATASPVFS------GSSLPSLNIPLDG  53

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            ++LPP LPD+V P   + TTLPNGLKIASE S +PAASVGLYVD GSIYE P S GA+HL
Sbjct  54   ISLPPSLPDNVGPSKVQTTTLPNGLKIASEMSPNPAASVGLYVDCGSIYETPLSRGATHL  113

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKSTLNRSH+R+VRE+E++G S  A+ASREQM YT DALKTYVP MVE+LV
Sbjct  114  LERMAFKSTLNRSHVRLVREIESMGASTSASASREQMGYTIDALKTYVPQMVEVLV  169



>ref|XP_010462039.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-1 isoform X1 [Camelina sativa]
 ref|XP_010462040.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-1 isoform X2 [Camelina sativa]
Length=503

 Score =   199 bits (506),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 143/179 (80%), Gaps = 4/179 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRAL--TRFasstavatnsssG-GLFSWLTGERSSALPPLDFP  324
            MYRTAASRA+ALKG  + R+L   R+ASS+A A  SSS  G  SWL G  SS+L  LD P
Sbjct  1    MYRTAASRAKALKGVLT-RSLRPARYASSSAAAATSSSTPGYLSWLGGGSSSSLTSLDMP  59

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            L+GV+LPPPL D VEP   +ITTLPNGLKIASE S +PAAS+GLYVD GSIYE P   GA
Sbjct  60   LQGVSLPPPLADKVEPSKLQITTLPNGLKIASEMSPNPAASIGLYVDCGSIYEAPYFHGA  119

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +HLLERMAFKSTLNR+H R+VRE+EAIGG+  A+ASREQM+YT DALKTYVP MVE+L+
Sbjct  120  THLLERMAFKSTLNRTHFRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLI  178



>ref|XP_007024340.1| Mitochondrial-processing peptidase subunit alpha isoform 2 [Theobroma 
cacao]
 gb|EOY26962.1| Mitochondrial-processing peptidase subunit alpha isoform 2 [Theobroma 
cacao]
Length=414

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 124/176 (70%), Gaps = 21/176 (12%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYRTA SR RA+KGR  N A   +A+                     SSA+  L+ PL+G
Sbjct  1    MYRTALSRFRAVKGRTGNLAAAHYAT---------------------SSAVASLETPLEG  39

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+LPP LPD+V    TK+ TL NG+KIASE   +PAAS+GL+++SGSIYE P S GASHL
Sbjct  40   VSLPPALPDYVASSETKVKTLSNGVKIASEKLLTPAASIGLFINSGSIYETPISSGASHL  99

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NR+HLR+VREVEAIGG+   +ASRE M YT+DALK+YVP MVELL+
Sbjct  100  LERMAFKSTTNRTHLRIVREVEAIGGNTSTSASRECMAYTFDALKSYVPEMVELLI  155



>ref|XP_007024342.1| Mitochondrial-processing peptidase subunit alpha, putative isoform 
4 [Theobroma cacao]
 gb|EOY26964.1| Mitochondrial-processing peptidase subunit alpha, putative isoform 
4 [Theobroma cacao]
Length=402

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 124/176 (70%), Gaps = 21/176 (12%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYRTA SR RA+KGR  N A   +A+                     SSA+  L+ PL+G
Sbjct  1    MYRTALSRFRAVKGRTGNLAAAHYAT---------------------SSAVASLETPLEG  39

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+LPP LPD+V    TK+ TL NG+KIASE   +PAAS+GL+++SGSIYE P S GASHL
Sbjct  40   VSLPPALPDYVASSETKVKTLSNGVKIASEKLLTPAASIGLFINSGSIYETPISSGASHL  99

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NR+HLR+VREVEAIGG+   +ASRE M YT+DALK+YVP MVELL+
Sbjct  100  LERMAFKSTTNRTHLRIVREVEAIGGNTSTSASRECMAYTFDALKSYVPEMVELLI  155



>gb|EMS58411.1| Mitochondrial-processing peptidase subunit alpha [Triticum urartu]
Length=470

 Score =   196 bits (498),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = +1

Query  262  GGLFSWLTGERSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPA  441
            GG   WLTG RS+ALPP DF L GVT+PPPL DHVEPG TKITTL NG+KIASETS   A
Sbjct  61   GGFLGWLTGARSNALPPPDFALPGVTIPPPLADHVEPGKTKITTLSNGVKIASETSPGSA  120

Query  442  ASVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQ  621
             SVG+YV  GS+YE P + GA+ LL+++AF +T NRS LRVVRE+ AIGGS +A+A+RE 
Sbjct  121  CSVGVYVHCGSVYETPETLGATQLLKKLAFTTTRNRSQLRVVREIGAIGGSAKASANREL  180

Query  622  MTYTYDALKTYVPHMVELLV  681
            M+Y+Y ALKTY+P MVE+LV
Sbjct  181  MSYSYGALKTYMPEMVEVLV  200



>emb|CDX92075.1| BnaA05g23320D [Brassica napus]
Length=495

 Score =   196 bits (499),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 129/176 (73%), Gaps = 6/176 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYRTAA RA+AL G  S        +S+  A  +++  +FS       S+LP L  PL G
Sbjct  1    MYRTAALRAKALTGCLSRSFRASRYASSTAAAAATASPVFS------GSSLPSLSIPLDG  54

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+LPP LPD+V P   + TTLPNGLKIASE S +PAASVGLYVD GSIYE P S GA+HL
Sbjct  55   VSLPPSLPDNVGPSKLQTTTLPNGLKIASEMSPNPAASVGLYVDCGSIYETPFSRGATHL  114

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKSTLNRSH+R+VRE+E++G S  A+ASREQM YT DALKTYVP MVE+LV
Sbjct  115  LERMAFKSTLNRSHVRLVREIESMGASTSASASREQMGYTIDALKTYVPQMVEVLV  170



>ref|XP_007024339.1| Mitochondrial-processing peptidase subunit alpha isoform 1 [Theobroma 
cacao]
 gb|EOY26961.1| Mitochondrial-processing peptidase subunit alpha isoform 1 [Theobroma 
cacao]
Length=486

 Score =   196 bits (498),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 124/176 (70%), Gaps = 21/176 (12%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYRTA SR RA+KGR  N A   +A+                     SSA+  L+ PL+G
Sbjct  1    MYRTALSRFRAVKGRTGNLAAAHYAT---------------------SSAVASLETPLEG  39

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+LPP LPD+V    TK+ TL NG+KIASE   +PAAS+GL+++SGSIYE P S GASHL
Sbjct  40   VSLPPALPDYVASSETKVKTLSNGVKIASEKLLTPAASIGLFINSGSIYETPISSGASHL  99

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NR+HLR+VREVEAIGG+   +ASRE M YT+DALK+YVP MVELL+
Sbjct  100  LERMAFKSTTNRTHLRIVREVEAIGGNTSTSASRECMAYTFDALKSYVPEMVELLI  155



>ref|XP_007024341.1| Mitochondrial-processing peptidase subunit alpha, putative isoform 
3 [Theobroma cacao]
 gb|EOY26963.1| Mitochondrial-processing peptidase subunit alpha, putative isoform 
3 [Theobroma cacao]
Length=432

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 124/176 (70%), Gaps = 21/176 (12%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYRTA SR RA+KGR  N A   +A+                     SSA+  L+ PL+G
Sbjct  1    MYRTALSRFRAVKGRTGNLAAAHYAT---------------------SSAVASLETPLEG  39

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+LPP LPD+V    TK+ TL NG+KIASE   +PAAS+GL+++SGSIYE P S GASHL
Sbjct  40   VSLPPALPDYVASSETKVKTLSNGVKIASEKLLTPAASIGLFINSGSIYETPISSGASHL  99

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKST NR+HLR+VREVEAIGG+   +ASRE M YT+DALK+YVP MVELL+
Sbjct  100  LERMAFKSTTNRTHLRIVREVEAIGGNTSTSASRECMAYTFDALKSYVPEMVELLI  155



>ref|XP_009146083.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-2 [Brassica rapa]
Length=495

 Score =   194 bits (493),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 128/176 (73%), Gaps = 6/176 (3%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPLKG  333
            MYRTAA RA+AL G  S        +S+  A  +++  +FS       S+LP L  PL G
Sbjct  1    MYRTAALRAKALTGCLSRSFRASRYASSTAAAAATASPVFS------GSSLPSLSIPLDG  54

Query  334  VTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHL  513
            V+LPP LPD+V P   + TTLPNGL IASE S +PAASVGLYVD GSIYE P S GA+HL
Sbjct  55   VSLPPSLPDNVGPSKLQTTTLPNGLIIASEMSPNPAASVGLYVDCGSIYETPYSRGATHL  114

Query  514  LERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            LERMAFKSTLNRSH+R+VRE+E++G S  A+ASREQM YT DALKTYVP MVE+LV
Sbjct  115  LERMAFKSTLNRSHIRLVREIESMGASTSASASREQMGYTIDALKTYVPQMVEVLV  170



>gb|AAG42149.1| mitochondrial processing peptidase alpha-chain precursor [Dactylis 
glomerata]
Length=505

 Score =   194 bits (492),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 129/178 (72%), Gaps = 3/178 (2%)
 Frame = +1

Query  154  MYRTAASRARALKGRASNRALTRFa--sstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYR AAS   ALK   ++  +   A  S++      SSGG  SWLTG RSSALPP DF L
Sbjct  1    MYR-AASGLGALKKHGADTQMLNMAIRSASTSVAQRSSGGFLSWLTGARSSALPPPDFAL  59

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
             GVT+P PLPDHVEP  TKITTL NG+KIASETS   + SVG+YV+ GS+YE P + GA+
Sbjct  60   AGVTIPDPLPDHVEPAKTKITTLSNGVKIASETSPGSSCSVGVYVNCGSVYEAPETLGAT  119

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
             LL ++AF +T NRS LRVVRE+ AIGG+ +A+++RE  +Y+Y ALKTY+P MVE+LV
Sbjct  120  QLLNKLAFTTTRNRSQLRVVREIGAIGGNAKASSTRELTSYSYGALKTYMPEMVEVLV  177



>gb|KHG28938.1| Mitochondrial-processing peptidase subunit alpha [Gossypium arboreum]
Length=426

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  295  SSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGS  474
            SSA+ PLD PL  V+LPPPLPD+V P  TKI TL NG++IASE   +PAAS+GL+++ GS
Sbjct  21   SSAVAPLDTPLDSVSLPPPLPDYVAPSETKIKTLSNGVRIASEQLPTPAASIGLFINCGS  80

Query  475  IYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTY  654
            IYE P S GASHLLERMAFKST NRSHLRVVREVEAIGG+  A+A+RE MTYT+DALKTY
Sbjct  81   IYETPISSGASHLLERMAFKSTTNRSHLRVVREVEAIGGNTLASATRECMTYTFDALKTY  140

Query  655  VPHMVELLV  681
            VP MVELL+
Sbjct  141  VPEMVELLI  149



>gb|EMT19127.1| Mitochondrial-processing peptidase subunit alpha [Aegilops tauschii]
Length=702

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = +1

Query  262  GGLFSWLTGERSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPA  441
            GG   WLTG RS+ALPP DF L GVT+PPPL DHVEPG TKITTL NG+KIASETS   A
Sbjct  54   GGFLGWLTGARSNALPPPDFALPGVTIPPPLADHVEPGKTKITTLSNGVKIASETSPGSA  113

Query  442  ASVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQ  621
             SVG+YV  GS+YE P + GA+ LL+++AF +T NRS LRVVRE+ AIGGS +A+A+RE 
Sbjct  114  CSVGVYVHCGSVYETPETLGATQLLKKLAFTTTRNRSQLRVVREIGAIGGSAKASANREL  173

Query  622  MTYTYDALKTYVPHMVELLV  681
            M+Y+Y ALKTY+P MVE+LV
Sbjct  174  MSYSYGALKTYMPEMVEVLV  193



>ref|XP_001759462.1| predicted protein [Physcomitrella patens]
 gb|EDQ75764.1| predicted protein [Physcomitrella patens]
Length=513

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 125/168 (74%), Gaps = 5/168 (3%)
 Frame = +1

Query  181  RALKGRASNRALTRFasstavatnsssGGLFSWLTGERSSA-LPPLDFPLKGVTLPPPLP  357
            R L+  A+N+A+ R    T     SSSGG+ SWL GER++A +P L  PL+GV +PP LP
Sbjct  22   RLLRTNAANQAVPR----TESTQASSSGGVLSWLLGERATAPVPALFEPLQGVHMPPALP  77

Query  358  DHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHLLERMAFKS  537
            D V+P  TK+TTL NG+KIASE  A P +++G+++DSGS  E P   GASHLLERMAFKS
Sbjct  78   DDVKPNETKVTTLANGVKIASEMIAGPTSTIGIFIDSGSKNETPYCTGASHLLERMAFKS  137

Query  538  TLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            T NRSH R+VREVEAIGG+V A ASREQM YT D +KT++P MVELLV
Sbjct  138  TANRSHFRLVREVEAIGGNVMANASREQMCYTGDTIKTFMPEMVELLV  185



>ref|XP_006406832.1| hypothetical protein EUTSA_v10020561mg [Eutrema salsugineum]
 gb|ESQ48285.1| hypothetical protein EUTSA_v10020561mg [Eutrema salsugineum]
Length=503

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 134/178 (75%), Gaps = 2/178 (1%)
 Frame = +1

Query  154  MYRTAASRARALKG--RASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYRTAA+R++ALKG    + RA    +SS    ++SS  GL SWLTG  SS+LP L+ PL
Sbjct  1    MYRTAATRSKALKGIYNRNYRASRYASSSAVATSSSSKPGLASWLTGGSSSSLPSLNIPL  60

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
              V+LPP L D+VEP   K TTLPNGL IASE S +PAASVGLYVD GSIYE P   GA+
Sbjct  61   ADVSLPPSLADNVEPSKLKTTTLPNGLTIASEMSPNPAASVGLYVDCGSIYETPNFRGAT  120

Query  508  HLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            HLLERMAFKSTLNRSHLR+VRE+EAI     A+ASREQM YT DALKTYVP MVE+LV
Sbjct  121  HLLERMAFKSTLNRSHLRLVREIEAIAAITSASASREQMGYTIDALKTYVPEMVEVLV  178



>gb|ACN36870.1| unknown [Zea mays]
 gb|AFW78812.1| putative mitochondrial processing peptidase alpha subunit family 
protein [Zea mays]
Length=464

 Score =   177 bits (449),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  367  EPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHLLERMAFKSTLN  546
            EP  TK+TTLPNG+KIASETS+SPAASVGLY+D GSIYE PAS G SHLLERMAFKST+N
Sbjct  31   EPSKTKVTTLPNGVKIASETSSSPAASVGLYIDCGSIYETPASSGVSHLLERMAFKSTVN  90

Query  547  RSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            R+HLR+VREVEAIGG+V A+ASREQM+YTYDALK+Y P MVE+L+
Sbjct  91   RTHLRLVREVEAIGGNVSASASREQMSYTYDALKSYTPEMVEVLI  135



>ref|XP_001753960.1| predicted protein [Physcomitrella patens]
 gb|EDQ81282.1| predicted protein [Physcomitrella patens]
Length=474

 Score =   174 bits (442),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 105/139 (76%), Gaps = 0/139 (0%)
 Frame = +1

Query  265  GLFSWLTGERSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAA  444
            G+ +WL G+  S  P L  P+  V LPP L   ++PG TK+T L NG++IASE S SP +
Sbjct  9    GILTWLAGDEPSNAPALHEPMPRVHLPPQLCTEMKPGGTKMTKLKNGVRIASENSHSPIS  68

Query  445  SVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQM  624
            +VG+Y+DSGS++E P   G SHLLERMAFKST NRSH R+VR+VEAIGG V A ASREQM
Sbjct  69   TVGVYIDSGSVHESPNVAGVSHLLERMAFKSTSNRSHFRLVRDVEAIGGHVMANASREQM  128

Query  625  TYTYDALKTYVPHMVELLV  681
            + T D++KTY+PHMVELLV
Sbjct  129  SCTADSIKTYMPHMVELLV  147



>ref|XP_001765307.1| predicted protein [Physcomitrella patens]
 gb|EDQ70035.1| predicted protein [Physcomitrella patens]
Length=513

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 121/168 (72%), Gaps = 5/168 (3%)
 Frame = +1

Query  181  RALKGRASNRALTRFasstavatnsssGGLFSWLTGER-SSALPPLDFPLKGVTLPPPLP  357
            R L+  A N A+ R    T  A  SSSGGL S L GER ++ +P L  PL+GV LPP LP
Sbjct  22   RQLRTSAVNHAVPR----TESAQASSSGGLLSKLLGERPTTPVPALYEPLQGVHLPPALP  77

Query  358  DHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHLLERMAFKS  537
            + V+P  T +TTL NG++IAS+  A P +++G+YVDSGS  E P   G+SHLLERMAFKS
Sbjct  78   EDVKPSETNVTTLTNGVRIASQNIAGPTSTIGIYVDSGSKNETPYCTGSSHLLERMAFKS  137

Query  538  TLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            T NRSH R+VREVEAIGG+V A ASRE M YT DA+KT++P MVELLV
Sbjct  138  TANRSHFRLVREVEAIGGNVVANASRELMCYTGDAIKTFMPEMVELLV  185



>ref|XP_001777355.1| predicted protein [Physcomitrella patens]
 gb|EDQ57885.1| predicted protein [Physcomitrella patens]
Length=513

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 108/141 (77%), Gaps = 1/141 (1%)
 Frame = +1

Query  262  GGLFSWLTGERSSA-LPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASP  438
            GG+ SW  GERS+  +P L  PL+GV LPP LP+ ++P  TK+TTL NGL+IASE    P
Sbjct  45   GGVLSWFLGERSTTPVPALYEPLQGVHLPPALPEDIKPSDTKVTTLANGLRIASENVPGP  104

Query  439  AASVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASRE  618
             A+V +++DSGS  E P   GASHLLERMAFKST+NRSH R++REVEAIG ++ + +++E
Sbjct  105  TATVAIHIDSGSKNETPFCTGASHLLERMAFKSTVNRSHFRLIREVEAIGANLMSTSAQE  164

Query  619  QMTYTYDALKTYVPHMVELLV  681
            QM Y+ DA+KT++P MVE+LV
Sbjct  165  QMCYSADAIKTFLPEMVEILV  185



>gb|ERN16185.1| hypothetical protein AMTR_s00030p00236070, partial [Amborella 
trichopoda]
Length=496

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +1

Query  304  LPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYE  483
            +PPL  PL G+ LPP LPDHVE   T+ITTLPNGLKIAS+ S  PA+ +G++VD GSI E
Sbjct  59   IPPLSQPLPGLKLPPCLPDHVEECLTRITTLPNGLKIASQESLGPASCIGIFVDCGSICE  118

Query  484  KPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPH  663
                +G +HLLERMAFKST NR H RVVRE+EA+GG+V A+ASREQM YTYD ++T++P 
Sbjct  119  SEWCYGVTHLLERMAFKSTNNRCHSRVVREIEAVGGNVAASASREQMGYTYDTIRTHLPE  178

Query  664  MVELLV  681
             +ELL+
Sbjct  179  ALELLI  184



>ref|XP_006854718.2| PREDICTED: mitochondrial-processing peptidase subunit alpha [Amborella 
trichopoda]
Length=514

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +1

Query  304  LPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYE  483
            +PPL  PL G+ LPP LPDHVE   T+ITTLPNGLKIAS+ S  PA+ +G++VD GSI E
Sbjct  59   IPPLSQPLPGLKLPPCLPDHVEECLTRITTLPNGLKIASQESLGPASCIGIFVDCGSICE  118

Query  484  KPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPH  663
                +G +HLLERMAFKST NR H RVVRE+EA+GG+V A+ASREQM YTYD ++T++P 
Sbjct  119  SEWCYGVTHLLERMAFKSTNNRCHSRVVREIEAVGGNVAASASREQMGYTYDTIRTHLPE  178

Query  664  MVELLV  681
             +ELL+
Sbjct  179  ALELLI  184



>ref|XP_008799681.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Phoenix dactylifera]
Length=457

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = +1

Query  271  FSWLTGERSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASV  450
             SW  G     LPPL  PL G+ LPP LPD +E   TKITTLPNGLKIASE +  PAA +
Sbjct  46   LSWSEGSYVKHLPPLFHPLAGLKLPPFLPDSLERYPTKITTLPNGLKIASEDAPGPAACL  105

Query  451  GLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTY  630
            G+YVDSGSIYE   S G +HLLER+AFKST NRSH+ +V +VE  GG+V A+ASREQM Y
Sbjct  106  GIYVDSGSIYETEESIGVTHLLERLAFKSTKNRSHMCIVHDVEVTGGNVGASASREQMGY  165

Query  631  TYDALKTYVPHMVELLV  681
            +YD LK Y+   VELL+
Sbjct  166  SYDTLKAYLQGAVELLI  182



>ref|XP_002987658.1| hypothetical protein SELMODRAFT_126515, partial [Selaginella 
moellendorffii]
 gb|EFJ11233.1| hypothetical protein SELMODRAFT_126515, partial [Selaginella 
moellendorffii]
Length=495

 Score =   167 bits (423),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 103/139 (74%), Gaps = 0/139 (0%)
 Frame = +1

Query  265  GLFSWLTGERSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAA  444
            G  SWL  E    LP L   L  V LPP L D VEP  T+I++L NG++IASE  A P A
Sbjct  30   GWLSWLFREPLPTLPALYEALPEVNLPPSLEDTVEPSGTQISSLNNGVRIASEQIAGPTA  89

Query  445  SVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQM  624
            ++G+YVDSGSI+E  ++ GA+HLLERMAFKST NRSH R+ REVEAIGG++ A+A+REQM
Sbjct  90   TLGIYVDSGSIHEDASNSGATHLLERMAFKSTHNRSHFRLTREVEAIGGNIMASATREQM  149

Query  625  TYTYDALKTYVPHMVELLV  681
             YT D +KTY+P MVELLV
Sbjct  150  AYTGDTIKTYMPQMVELLV  168



>ref|XP_002987595.1| hypothetical protein SELMODRAFT_183257 [Selaginella moellendorffii]
 gb|EFJ11431.1| hypothetical protein SELMODRAFT_183257 [Selaginella moellendorffii]
Length=506

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 103/139 (74%), Gaps = 0/139 (0%)
 Frame = +1

Query  265  GLFSWLTGERSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAA  444
            G  SWL  E    LP L   L  V LPP L D VEP  T+I++L NG++IASE  A P A
Sbjct  40   GWLSWLFREPLPTLPALYEALPEVNLPPSLEDTVEPSGTQISSLNNGVRIASEQIAGPTA  99

Query  445  SVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQM  624
            ++G+YVDSGSI+E  ++ GA+HLLERMAFKST NRSH R+ REVEAIGG++ A+A+REQM
Sbjct  100  TLGIYVDSGSIHEDASNSGATHLLERMAFKSTHNRSHFRLTREVEAIGGNIMASATREQM  159

Query  625  TYTYDALKTYVPHMVELLV  681
             YT D +KTY+P MVELLV
Sbjct  160  AYTGDTIKTYMPQMVELLV  178



>ref|XP_009414834.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Musa acuminata subsp. malaccensis]
Length=514

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = +1

Query  295  SSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGS  474
            +  +PPL  PL G+ LP  LPD  E  +TK+TTLPNGL++ASE +  PAA VG+YVDSGS
Sbjct  56   TKCIPPLFHPLPGLNLPICLPDSAEQNATKVTTLPNGLRVASEDALGPAACVGIYVDSGS  115

Query  475  IYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTY  654
            IYE   S G +HLLER+AFKST +RSHL++V EVE+ GG+V A+ASREQM Y+YD LK Y
Sbjct  116  IYETEESIGVTHLLERLAFKSTKHRSHLQIVHEVESTGGNVGASASREQMGYSYDTLKAY  175

Query  655  VPHMVELLV  681
            +P  VELL+
Sbjct  176  LPAAVELLI  184



>ref|XP_010931091.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Elaeis guineensis]
Length=512

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = +1

Query  304  LPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYE  483
             PPL  PL G+ LP  LPD +E   TKITTLPNGLKIASE +  PAA +G+YVDSGSIYE
Sbjct  57   FPPLFHPLCGLKLPHCLPDSMERYPTKITTLPNGLKIASEDAPGPAACLGIYVDSGSIYE  116

Query  484  KPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPH  663
               S G +HLLER+AFKST N SHL +VR+VE  GG+V A+ASREQM Y YD LK Y+P 
Sbjct  117  TEESIGVTHLLERLAFKSTKNHSHLCIVRDVEVTGGNVGASASREQMGYCYDTLKAYLPG  176

Query  664  MVELLV  681
             VELL+
Sbjct  177  AVELLI  182



>ref|XP_002992589.1| hypothetical protein SELMODRAFT_448827 [Selaginella moellendorffii]
 gb|EFJ06291.1| hypothetical protein SELMODRAFT_448827 [Selaginella moellendorffii]
Length=512

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 101/143 (71%), Gaps = 5/143 (3%)
 Frame = +1

Query  265  GLFSWLTGERS----SALPPLDFPLKGVTLPPPLPDHVE-PGSTKITTLPNGLKIASETS  429
            GL SW   ++     S LP L  PL GV LP  L D    P  TKIT L NGL +ASE +
Sbjct  42   GLLSWFQRKKKKGLLSDLPTLYEPLPGVKLPLDLDDGFALPVETKITKLANGLTVASENT  101

Query  430  ASPAASVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAA  609
              P A++G+YVDSGS +E P + G SH+LERMAFKST NR+HLR+VRE EAIGG+V A+A
Sbjct  102  MGPTATIGVYVDSGSSHETPFNSGVSHILERMAFKSTRNRTHLRLVREAEAIGGNVLASA  161

Query  610  SREQMTYTYDALKTYVPHMVELL  678
            SREQM+YT D ++++VP +VELL
Sbjct  162  SREQMSYTGDVIRSFVPEIVELL  184



>tpg|DAA55704.1| TPA: putative mitochondrial processing peptidase alpha subunit 
family protein [Zea mays]
Length=388

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +1

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
            PL G+ LPP LPD++    T+ITTLPNGL++A+E    P+A +G +VDSGSIYE   + G
Sbjct  45   PLPGLDLPPCLPDNLSRSPTRITTLPNGLRVATEDVPGPSACIGFFVDSGSIYESGETTG  104

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
             SHLLERMAFK T +RSHL +V E+E  GG+V A+ASREQM Y+YD LK Y+P  +E+L+
Sbjct  105  VSHLLERMAFKDTKHRSHLNIVSELELAGGNVGASASREQMVYSYDTLKGYMPEALEILI  164



>ref|NP_001167727.1| putative mitochondrial processing peptidase alpha subunit family 
protein [Zea mays]
 gb|ACN25901.1| unknown [Zea mays]
 tpg|DAA55705.1| TPA: putative mitochondrial processing peptidase alpha subunit 
family protein [Zea mays]
Length=488

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +1

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
            PL G+ LPP LPD++    T+ITTLPNGL++A+E    P+A +G +VDSGSIYE   + G
Sbjct  42   PLPGLDLPPCLPDNLSRSPTRITTLPNGLRVATEDVPGPSACIGFFVDSGSIYESGETTG  101

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
             SHLLERMAFK T +RSHL +V E+E  GG+V A+ASREQM Y+YD LK Y+P  +E+L+
Sbjct  102  VSHLLERMAFKDTKHRSHLNIVSELELAGGNVGASASREQMVYSYDTLKGYMPEALEILI  161



>gb|ACN28785.1| unknown [Zea mays]
 tpg|DAA55703.1| TPA: putative mitochondrial processing peptidase alpha subunit 
family protein [Zea mays]
Length=489

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +1

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
            PL G+ LPP LPD++    T+ITTLPNGL++A+E    P+A +G +VDSGSIYE   + G
Sbjct  45   PLPGLDLPPCLPDNLSRSPTRITTLPNGLRVATEDVPGPSACIGFFVDSGSIYESGETTG  104

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
             SHLLERMAFK T +RSHL +V E+E  GG+V A+ASREQM Y+YD LK Y+P  +E+L+
Sbjct  105  VSHLLERMAFKDTKHRSHLNIVSELELAGGNVGASASREQMVYSYDTLKGYMPEALEILI  164



>dbj|BAJ89700.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97207.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=499

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 100/136 (74%), Gaps = 1/136 (1%)
 Frame = +1

Query  277  WLTGERSSALP-PLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVG  453
            WL+G  S+A    L  PL G+ LPP LPD +    T+ITTLPNG+++ASE    P+A VG
Sbjct  34   WLSGAASAARSTSLLRPLPGLDLPPCLPDQLARLPTRITTLPNGVRVASEDVPGPSACVG  93

Query  454  LYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYT  633
            ++V SGS++E P S G +HLLE++A K T +RSH+++V+EVEA GG+V A+ASREQM Y+
Sbjct  94   VFVASGSVHESPESAGVTHLLEKLALKDTAHRSHMQIVQEVEATGGNVGASASREQMVYS  153

Query  634  YDALKTYVPHMVELLV  681
            YD LK Y+P  +E+L+
Sbjct  154  YDTLKAYIPQAIEVLL  169



>ref|XP_002457003.1| hypothetical protein SORBIDRAFT_03g047030 [Sorghum bicolor]
 gb|EES02123.1| hypothetical protein SORBIDRAFT_03g047030 [Sorghum bicolor]
Length=489

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +1

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
            PL G+ LPP LPD++    T++TTLPNGL+IASE    P+A +G +V+SGS+YE   + G
Sbjct  43   PLPGLDLPPCLPDNLSRSPTRVTTLPNGLRIASEDIPGPSACIGFFVNSGSVYESGETTG  102

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
             SH+LERMAFK T +RSHL +V E+E  GG+V A+ASREQM Y+YD LK Y+P  +E+L+
Sbjct  103  VSHMLERMAFKDTKHRSHLNIVHELELAGGNVGASASREQMVYSYDTLKGYMPEALEILI  162



>emb|CDJ26330.1| unnamed protein product [Triticum aestivum]
Length=503

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +1

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
            PL G+ LPP LPD +    T++TTLPNG+++ASE    P A VG++V SGSI+E P S G
Sbjct  54   PLPGLDLPPCLPDQLPRLPTRVTTLPNGVRVASEDVPGPTACVGVFVASGSIHESPESAG  113

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
             +HLLE++AFK T +RSH ++V+EVEA GG++ A+ASREQM Y+YD LK Y+P  VE+L+
Sbjct  114  VTHLLEKLAFKDTAHRSHRQIVQEVEATGGNIGASASREQMVYSYDTLKAYIPQAVEVLL  173



>ref|XP_010233616.1| PREDICTED: ABC transporter D family member 1-like [Brachypodium 
distachyon]
Length=1985

 Score =   145 bits (366),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 100/136 (74%), Gaps = 1/136 (1%)
 Frame = +1

Query  277   WLTGERSSALP-PLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVG  453
             WL+G  ++A    L  PL G+ LPP LPD +    T++TTLPNG+++ASE    P+A VG
Sbjct  1520  WLSGAAAAARSTSLLRPLPGLELPPSLPDQLHRLPTRVTTLPNGVRVASEDIPGPSACVG  1579

Query  454   LYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYT  633
             ++V SGSI+E   + G +HLLE++AFK T +RSHL++V+EVEA GG++ A+ASREQM Y+
Sbjct  1580  VFVASGSIHEAGETTGVTHLLEKLAFKDTAHRSHLQIVQEVEATGGNIGASASREQMVYS  1639

Query  634   YDALKTYVPHMVELLV  681
             YD LK Y+P  VE+L+
Sbjct  1640  YDTLKAYIPQAVEVLL  1655



>ref|XP_005645630.1| LuxS/MPP-like metallohydrolase [Coccomyxa subellipsoidea C-169]
 gb|EIE21086.1| LuxS/MPP-like metallohydrolase [Coccomyxa subellipsoidea C-169]
Length=506

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 96/139 (69%), Gaps = 0/139 (0%)
 Frame = +1

Query  265  GLFSWLTGERSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAA  444
            G  S L G  S    P+  PL GV LP P P   +  +T+ TTLPNG+ IASE +  P A
Sbjct  40   GWLSKLLGGSSRLTVPMTDPLPGVDLPAPSPPPAKAPTTETTTLPNGVTIASEQTLGPTA  99

Query  445  SVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQM  624
            ++GLYV+SGS+YE P+  G SHLLE MAFKST NR+H R+VREVEAIG +V A+ASREQM
Sbjct  100  TLGLYVNSGSVYESPSETGLSHLLEYMAFKSTSNRTHFRLVREVEAIGANVLASASREQM  159

Query  625  TYTYDALKTYVPHMVELLV  681
             Y  D +KT VP  +E+LV
Sbjct  160  AYNIDVVKTNVPDALEILV  178



>gb|EAY77359.1| hypothetical protein OsI_05342 [Oryza sativa Indica Group]
Length=434

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 98/138 (71%), Gaps = 3/138 (2%)
 Frame = +1

Query  277  WLTG---ERSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAAS  447
            WL+G     ++    L  PL G+ +P  LPD +    T++TTLPNG+++ASE    P+A 
Sbjct  27   WLSGGAVASAARTTSLLHPLPGLDVPQCLPDQLGVQPTRVTTLPNGVRVASEDLPGPSAC  86

Query  448  VGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMT  627
            VG++VDSGS+YE   + G SHLLER++FK T +RSHL++V++VEA GG++ A+ASREQ  
Sbjct  87   VGVFVDSGSVYETAETAGVSHLLERLSFKDTAHRSHLQIVQDVEATGGNIGASASREQTV  146

Query  628  YTYDALKTYVPHMVELLV  681
            Y+Y+ LK Y+P  +E+L+
Sbjct  147  YSYETLKAYLPQAIEVLI  164



>gb|KDO55884.1| hypothetical protein CISIN_1g0104471mg, partial [Citrus sinensis]
Length=320

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +1

Query  433  SPAASVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAAS  612
            SP AS+ LYV  GSIYE P SFG +HLLERMAF+ST NRSHLR+VREVEAIGG+VQA+AS
Sbjct  26   SPVASISLYVGCGSIYESPISFGTTHLLERMAFRSTRNRSHLRIVREVEAIGGNVQASAS  85

Query  613  REQMTYTYDALKTYVPHMVELLV  681
            REQM Y++DALKTYVP MVELL+
Sbjct  86   REQMGYSFDALKTYVPEMVELLI  108



>ref|NP_001045501.1| Os01g0966300 [Oryza sativa Japonica Group]
 dbj|BAD88255.1| putative mitochondrial processing peptidase [Oryza sativa Japonica 
Group]
 dbj|BAF07415.1| Os01g0966300 [Oryza sativa Japonica Group]
 gb|EAZ14954.1| hypothetical protein OsJ_04885 [Oryza sativa Japonica Group]
 dbj|BAG93327.1| unnamed protein product [Oryza sativa Japonica Group]
Length=490

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 98/138 (71%), Gaps = 3/138 (2%)
 Frame = +1

Query  277  WLTG---ERSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAAS  447
            WL+G     ++    L  PL G+ +P  LPD +    T++TTLPNG+++ASE    P+A 
Sbjct  27   WLSGGAVASAARTTSLLHPLPGLDVPQCLPDQLGVQPTRVTTLPNGVRVASEDLPGPSAC  86

Query  448  VGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMT  627
            VG++VDSGS+YE   + G SHLLER++FK T +RSHL++V++VEA GG++ A+ASREQ  
Sbjct  87   VGVFVDSGSVYETAETAGVSHLLERLSFKDTAHRSHLQIVQDVEATGGNIGASASREQTV  146

Query  628  YTYDALKTYVPHMVELLV  681
            Y+Y+ LK Y+P  +E+L+
Sbjct  147  YSYETLKAYLPQAIEVLI  164



>gb|AFW83870.1| putative mitochondrial processing peptidase alpha subunit family 
protein [Zea mays]
Length=337

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = +1

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
            PL G+ LPP LPD++    T++TTLPNGL++A+E    P+A +G +V+SGS+YE   + G
Sbjct  50   PLPGLDLPPCLPDNLSRSPTRVTTLPNGLRVATEDIPGPSACIGFFVNSGSVYESGETTG  109

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
             S+LLERM FK T +RSHL +V E+E  G SV  +ASREQM Y+YD LK Y+P  +E+L+
Sbjct  110  VSYLLERMGFKDTKHRSHLSIVSELELAGASVSVSASREQMVYSYDTLKGYMPEALEILI  169



>ref|NP_001170252.1| uncharacterized protein LOC100384208 [Zea mays]
 gb|ACN36385.1| unknown [Zea mays]
Length=347

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = +1

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
            PL G+ LPP LPD++    T++TTLPNGL++A+E    P+A +G +V+SGS+YE   + G
Sbjct  50   PLPGLDLPPCLPDNLSRSPTRVTTLPNGLRVATEDIPGPSACIGFFVNSGSVYESGETTG  109

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
             S+LLERM FK T +RSHL +V E+E  G SV  +ASREQM Y+YD LK Y+P  +E+L+
Sbjct  110  VSYLLERMGFKDTKHRSHLSIVSELELAGASVSVSASREQMVYSYDTLKGYMPEALEILI  169



>gb|AFW83871.1| putative mitochondrial processing peptidase alpha subunit family 
protein isoform 1 [Zea mays]
 gb|AFW83872.1| putative mitochondrial processing peptidase alpha subunit family 
protein isoform 2 [Zea mays]
Length=393

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = +1

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
            PL G+ LPP LPD++    T++TTLPNGL++A+E    P+A +G +V+SGS+YE   + G
Sbjct  50   PLPGLDLPPCLPDNLSRSPTRVTTLPNGLRVATEDIPGPSACIGFFVNSGSVYESGETTG  109

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
             S+LLERM FK T +RSHL +V E+E  G SV  +ASREQM Y+YD LK Y+P  +E+L+
Sbjct  110  VSYLLERMGFKDTKHRSHLSIVSELELAGASVSVSASREQMVYSYDTLKGYMPEALEILI  169



>gb|EEC79554.1| hypothetical protein OsI_20678 [Oryza sativa Indica Group]
Length=592

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 82/129 (64%), Gaps = 25/129 (19%)
 Frame = +1

Query  295  SSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGS  474
            SS LPPLD PL GV + PPLPD VEP  TKITTLP G+KIASETS  PA SV LY+D GS
Sbjct  160  SSQLPPLDVPLPGVIISPPLPDFVEPSKTKITTLPKGIKIASETSPIPAVSVRLYIDCGS  219

Query  475  IYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTY  654
            +YE  +S G SHLLERMAFKST NRSHLR+VRE                          Y
Sbjct  220  VYETSSSSGTSHLLERMAFKSTTNRSHLRLVREC-------------------------Y  254

Query  655  VPHMVELLV  681
             P MVE+L+
Sbjct  255  APEMVEVLI  263



>ref|XP_008655317.1| PREDICTED: uncharacterized protein LOC100384208 isoform X2 [Zea 
mays]
Length=441

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = +1

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
            PL G+ LPP LPD++    T++TTLPNGL++A+E    P+A +G +V+SGS+YE   + G
Sbjct  50   PLPGLDLPPCLPDNLSRSPTRVTTLPNGLRVATEDIPGPSACIGFFVNSGSVYESGETTG  109

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
             S+LLERM FK T +RSHL +V E+E  G SV  +ASREQM Y+YD LK Y+P  +E+L+
Sbjct  110  VSYLLERMGFKDTKHRSHLSIVSELELAGASVSVSASREQMVYSYDTLKGYMPEALEILI  169



>ref|XP_008655316.1| PREDICTED: uncharacterized protein LOC100384208 isoform X1 [Zea 
mays]
Length=496

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = +1

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
            PL G+ LPP LPD++    T++TTLPNGL++A+E    P+A +G +V+SGS+YE   + G
Sbjct  50   PLPGLDLPPCLPDNLSRSPTRVTTLPNGLRVATEDIPGPSACIGFFVNSGSVYESGETTG  109

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
             S+LLERM FK T +RSHL +V E+E  G SV  +ASREQM Y+YD LK Y+P  +E+L+
Sbjct  110  VSYLLERMGFKDTKHRSHLSIVSELELAGASVSVSASREQMVYSYDTLKGYMPEALEILI  169



>ref|XP_006645345.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Oryza brachyantha]
Length=489

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +1

Query  322  PLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFG  501
            PL G+ +P  LPD +    T++TTLPNG+++ASE    P+  +G++V+SGS+YE   + G
Sbjct  44   PLPGLDVPQCLPDQLVGQPTRVTTLPNGVRVASEDLPGPSGCIGVFVESGSVYETAETAG  103

Query  502  ASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
             SHLLE++AFK T +RSHL++V++VEA GG+V A+ASRE M YTY+ LK Y+P  +E+L+
Sbjct  104  MSHLLEKLAFKGTAHRSHLQIVQDVEATGGNVGASASRELMVYTYETLKAYLPQAIEVLI  163



>ref|XP_011399005.1| putative mitochondrial-processing peptidase subunit alpha-1 [Auxenochlorella 
protothecoides]
 gb|KFM26109.1| putative mitochondrial-processing peptidase subunit alpha-1 [Auxenochlorella 
protothecoides]
Length=476

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 93/138 (67%), Gaps = 0/138 (0%)
 Frame = +1

Query  265  GLFSWLTGERSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAA  444
            G  S L G  +    PL  PL GV LP P P       T ITTL NG+K+ASE +    A
Sbjct  39   GFLSGLFGGSNRVTTPLTDPLPGVQLPTPAPAPSSRPETHITTLSNGVKVASENTPGATA  98

Query  445  SVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQM  624
            ++G+YV+SGS+ E PA+ G SHLLE +AFKST +R+HLR+VR+VEA+G +V A+ASREQM
Sbjct  99   TLGIYVESGSVNETPANSGVSHLLEYLAFKSTAHRTHLRLVRDVEALGANVLASASREQM  158

Query  625  TYTYDALKTYVPHMVELL  678
             YT D  +T VP  +E+L
Sbjct  159  AYTIDLPRTLVPEALEVL  176



>ref|XP_007509007.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20093.1| predicted protein [Bathycoccus prasinos]
Length=504

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 94/140 (67%), Gaps = 4/140 (3%)
 Frame = +1

Query  268  LFSWLTGERSSALPPLDFPLKGVTLP--PPLPDHVEPGSTKITTLPNGLKIASETSASPA  441
            +FS + G  ++  PP+D P+  V +P  P  P   E   T +TTL NG  IASE +    
Sbjct  38   IFSQIFGGSATKQPPMDEPMPNVIIPESPIYPK--EAPKTLVTTLSNGATIASENTPGAT  95

Query  442  ASVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQ  621
             +VGLY++SGS YE+P   GASH+LERMAFK+T NR++ R+ +E E +  S+ AAASREQ
Sbjct  96   MAVGLYLESGSKYEQPYMSGASHMLERMAFKATTNRTNFRITKEAEVMSASLLAAASREQ  155

Query  622  MTYTYDALKTYVPHMVELLV  681
            M+YT DALKT++P  VELL 
Sbjct  156  MSYTVDALKTHLPEAVELLC  175



>gb|EMT18398.1| Mitochondrial-processing peptidase subunit alpha [Aegilops tauschii]
Length=562

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +1

Query  433  SPAASVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAAS  612
            SPAA+VGLY+D GS+YE P S GASHLLERM+FKST NRSHLR+VREVE+IGG+V A A+
Sbjct  15   SPAATVGLYIDCGSMYETPGSSGASHLLERMSFKSTTNRSHLRLVREVESIGGNVSAIAT  74

Query  613  REQMTYTYDALKTYVPHMVELLV  681
            REQM YTYDA + YVP MVE+L+
Sbjct  75   REQMCYTYDAFRAYVPDMVEVLI  97



>ref|XP_005846410.1| hypothetical protein CHLNCDRAFT_36005 [Chlorella variabilis]
 gb|EFN54308.1| hypothetical protein CHLNCDRAFT_36005 [Chlorella variabilis]
Length=499

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 90/137 (66%), Gaps = 0/137 (0%)
 Frame = +1

Query  268  LFSWLTGERSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAAS  447
              + L G  S    PL   L GV +P  +    E  +T++T L NG  IA+E +    A+
Sbjct  37   FLAQLFGSGSRLDVPLTDALPGVEIPEAVAPSKEAPATQLTKLSNGATIATENTPGATAT  96

Query  448  VGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMT  627
            +G+YVD GS+YE PA+ GASHLLE MAFK+T NR+HLR+VREVE+IGG+V A+ASREQM 
Sbjct  97   LGIYVDCGSVYETPANTGASHLLEYMAFKTTKNRTHLRLVREVESIGGNVLASASREQMA  156

Query  628  YTYDALKTYVPHMVELL  678
            Y  D  K  +P  +E+L
Sbjct  157  YNIDTSKATIPEALEVL  173



>ref|XP_002508413.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69671.1| predicted protein [Micromonas sp. RCC299]
Length=464

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 86/131 (66%), Gaps = 0/131 (0%)
 Frame = +1

Query  286  GERSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVD  465
            G    A+PP+D P+ G+ +P P         T ITTL NG KIASE +   + +VG+YV 
Sbjct  8    GSAGPAMPPMDQPVPGLAIPDPPAAPAAAPVTNITTLSNGAKIASEDTPGASIAVGMYVS  67

Query  466  SGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDAL  645
            SGS +E P   GASHLLERMA+++T NR+  RV RE E IG ++ A+ASREQM YT D L
Sbjct  68   SGSKWENPHVSGASHLLERMAWRATANRTAFRVTREAEVIGANLLASASREQMAYTVDCL  127

Query  646  KTYVPHMVELL  678
            +T +P  VELL
Sbjct  128  RTNLPEAVELL  138



>ref|XP_001697130.1| mitochondrial processing peptidase alpha subunit [Chlamydomonas 
reinhardtii]
 gb|EDP00385.1| mitochondrial processing peptidase alpha subunit [Chlamydomonas 
reinhardtii]
Length=507

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 87/138 (63%), Gaps = 0/138 (0%)
 Frame = +1

Query  268  LFSWLTGERSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAAS  447
               WL G  +    PL  PL GV    P    + P  T++T L NG++I SE S  P AS
Sbjct  46   FMGWLKGGAARVTTPLSQPLPGVQPEQPAFRPLAPPPTEVTVLENGVRIISEASPGPTAS  105

Query  448  VGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMT  627
            +G+Y++SGSIYE  ++ G S LLE + FK+T +R+ LR+++EVE  G ++ A ASREQM+
Sbjct  106  LGMYINSGSIYENASNSGCSALLECLGFKATQHRNTLRIMKEVEKFGNTIVANASREQMS  165

Query  628  YTYDALKTYVPHMVELLV  681
            YT D LKT  P  +ELL+
Sbjct  166  YTIDCLKTGFPAALELLL  183



>ref|XP_010481129.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-1 [Camelina sativa]
Length=153

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 92/126 (73%), Gaps = 2/126 (2%)
 Frame = +1

Query  154  MYRTAASRARALKG--RASNRALTRFasstavatnsssGGLFSWLTGERSSALPPLDFPL  327
            MYRTAASRA+ALKG    S R     +SS A AT+SS+ G  SWL G  S +L  LD PL
Sbjct  1    MYRTAASRAKALKGVLTRSLRPARYASSSAAAATSSSTPGYLSWLGGGSSGSLTSLDMPL  60

Query  328  KGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGAS  507
            +GV+LPPPL D VEP   KITTLPNGLKIASE S +PAAS+GLYVD GSIYE P   GA+
Sbjct  61   QGVSLPPPLADKVEPSKLKITTLPNGLKIASEMSPNPAASIGLYVDCGSIYEAPYFHGAT  120

Query  508  HLLERM  525
            HLLERM
Sbjct  121  HLLERM  126



>ref|XP_010276189.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X4 [Nelumbo nucifera]
Length=202

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +1

Query  493  SFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVE  672
            SFGA+HLLERMAFKST NRSHLR+VREVEAIGG+V A+ASREQM Y+YDALKTYVP MVE
Sbjct  9    SFGATHLLERMAFKSTANRSHLRIVREVEAIGGNVTASASREQMGYSYDALKTYVPEMVE  68

Query  673  LLV  681
            LL+
Sbjct  69   LLI  71



>ref|XP_010269174.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X3 [Nelumbo nucifera]
Length=227

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +1

Query  493  SFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVE  672
            SFGA+HLLERMAFKST NRSHLR+VREVEAIGG+V A+ASREQM Y+YDALKTYVP MVE
Sbjct  9    SFGATHLLERMAFKSTANRSHLRIVREVEAIGGNVTASASREQMGYSYDALKTYVPEMVE  68

Query  673  LLV  681
            LL+
Sbjct  69   LLI  71



>ref|XP_010258501.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X2 [Nelumbo nucifera]
Length=238

 Score =   114 bits (284),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +1

Query  493  SFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVE  672
            SFGA+HLLERMAFKST NRSHLR+VREVEAIGG+V A+ASREQM Y+YDALKTYVP MVE
Sbjct  9    SFGATHLLERMAFKSTANRSHLRIVREVEAIGGNVTASASREQMGYSYDALKTYVPEMVE  68

Query  673  LLV  681
            LL+
Sbjct  69   LLI  71



>ref|XP_002945711.1| hypothetical protein VOLCADRAFT_85964 [Volvox carteri f. nagariensis]
 gb|EFJ52706.1| hypothetical protein VOLCADRAFT_85964 [Volvox carteri f. nagariensis]
Length=449

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 84/137 (61%), Gaps = 0/137 (0%)
 Frame = +1

Query  271  FSWLTGERSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASV  450
              WL         PL  PL GV    P    + P  T+IT L NG++I SE S  P AS+
Sbjct  1    MDWLKDGTKRITTPLSHPLPGVQPERPGLPPLTPPPTQITVLDNGVRIISEASPGPTASL  60

Query  451  GLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTY  630
            G+YV+SGSIYE   + G S LLE + FK+TL+R  LR+++EVE  G ++ A ASREQM+Y
Sbjct  61   GMYVNSGSIYETAENSGCSALLECLGFKATLHRPTLRIMKEVEKFGNTIVANASREQMSY  120

Query  631  TYDALKTYVPHMVELLV  681
            T D LKT  P  +ELL+
Sbjct  121  TIDCLKTGFPAALELLL  137



>ref|XP_004971384.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Setaria italica]
Length=495

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = +1

Query  340  LPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHLLE  519
            LPPPL D++    T++TTLP+G+++A+E    P+A +G +V+SGS+YE   + G S++LE
Sbjct  55   LPPPLADNLGRSPTRVTTLPSGIRVATEDVPGPSACIGFFVNSGSVYESGETTGVSYMLE  114

Query  520  RMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELLV  681
            +MAFK T +R H  +V E+E  GG+V A+ SREQM Y+YD LK Y+P  +E+L+
Sbjct  115  KMAFKGTNHRRHRNLVHELELAGGNVGASYSREQMVYSYDTLKGYMPEAIEILI  168



>ref|XP_010251231.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X1 [Nelumbo nucifera]
Length=242

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  493  SFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVE  672
            SFGA+HLLERMAFKST NRSHLR+VREVEAIGG+V A+ASREQM Y+YDALKTYVP M++
Sbjct  9    SFGATHLLERMAFKSTANRSHLRIVREVEAIGGNVTASASREQMGYSYDALKTYVPEMLQ  68



>gb|EMT01864.1| ABC transporter D family member 1 [Aegilops tauschii]
Length=1721

 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +1

Query  436   PAASVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASR  615
             P A VG++V SGSI+E P S GA+HLLE++AFK T +RSH+++V+EVEA GG+V A+ASR
Sbjct  1310  PTACVGVFVASGSIHESPESAGATHLLEKLAFKDTAHRSHMQIVQEVEATGGNVGASASR  1369

Query  616   EQMTYTYDALKTYVPHMVELLV  681
             EQM Y+YD LK Y+P  VE+L+
Sbjct  1370  EQMVYSYDTLKAYIPQAVEVLL  1391



>ref|XP_005780606.1| mitochondrial processing peptidase alpha subunit, partial [Emiliania 
huxleyi CCMP1516]
 gb|EOD28177.1| mitochondrial processing peptidase alpha subunit, partial [Emiliania 
huxleyi CCMP1516]
Length=107

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 67/101 (66%), Gaps = 2/101 (2%)
 Frame = +1

Query  376  STKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSH  555
            ST +TTL NGL++AS     P+ S+GL++D+GS Y+  A  G SH+L+ MAFK++ N SH
Sbjct  6    STPVTTLSNGLRVASADMTMPSTSLGLFIDTGSQYD--AVPGTSHMLQHMAFKTSENFSH  63

Query  556  LRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
            L+VVR  E +G  + A A RE M Y  D LK  VP  VELL
Sbjct  64   LKVVRAAELMGAQLSAVAGRESMVYQVDTLKESVPEAVELL  104



>gb|KDO51228.1| hypothetical protein CISIN_1g044668mg [Citrus sinensis]
Length=353

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 76/141 (54%), Gaps = 45/141 (32%)
 Frame = +1

Query  262  GGLFSWLTGERSSALPPLDFPLKGVTL--PPPLPDHVEPGSTKITTLPNGLKIASETSAS  435
            GG +SWL+GE+S++ P LDFPL G+ L  P  LPD+                        
Sbjct  25   GGFYSWLSGEQSTSSPSLDFPLPGICLSHPSSLPDY------------------------  60

Query  436  PAASVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASR  615
                   YVD GSIYE P SF  + LLERMAF+ST +RS+             +QA+ SR
Sbjct  61   ------FYVDCGSIYESPISFVKTDLLERMAFRSTRDRSN-------------IQASPSR  101

Query  616  EQMTYTYDALKTYVPHMVELL  678
            EQM  ++ AL+TYVP MVELL
Sbjct  102  EQMGCSFAALETYVPEMVELL  122



>emb|CDS13277.1| hypothetical protein LRAMOSA05455 [Absidia idahoensis var. thermophila]
Length=554

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 71/104 (68%), Gaps = 6/104 (6%)
 Frame = +1

Query  337  TLPPPLPDHVE------PGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASF  498
            T P   P HV+      PG  K+TTLPNG+++ASE +     +VG+Y+D+GS YE   + 
Sbjct  38   TNPTEFPTHVQEYSKSSPGLCKVTTLPNGIRVASENTPGHFGAVGVYMDAGSRYETERTR  97

Query  499  GASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTY  630
            G SH+L+R+AFKST NRS  +VV E+E++GG++  ++SRE M Y
Sbjct  98   GVSHILDRLAFKSTSNRSADQVVEELESLGGNIMCSSSRESMMY  141



>emb|CDH54037.1| mitochondrial processing alpha subunit [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=553

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 70/102 (69%), Gaps = 6/102 (6%)
 Frame = +1

Query  343  PPPLPDHVE------PGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            P   P HV+      PG  K+TTLPNG+++ASE +     +VG+Y+D+GS YE   + G 
Sbjct  39   PSEFPTHVQEYSKSSPGLCKVTTLPNGIRVASENTPGHFGAVGVYMDAGSRYETEKTRGV  98

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTY  630
            SH+L+R+AFKST NRS  +VV E+E++GG++  ++SRE M Y
Sbjct  99   SHILDRLAFKSTANRSADQVVEELESLGGNIMCSSSRECMMY  140



>ref|XP_009820981.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV88581.1| hypothetical protein, variant [Aphanomyces astaci]
Length=387

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 78/125 (62%), Gaps = 1/125 (1%)
 Frame = +1

Query  304  LPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYE  483
            LP LD P+ G+ +  P      P  T+ T LPNGL++ S+ +   A++VGL+VD+GS +E
Sbjct  69   LPSLDEPIPGLPVLKPASQLQAP-RTETTVLPNGLRVISQETYGQASTVGLFVDAGSRFE  127

Query  484  KPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPH  663
              ++ G +H++E + FKS+ +RSH  +VRE E IG    A++ REQ+ YT D L+  V  
Sbjct  128  DDSNTGVTHMMEHLGFKSSRSRSHADLVREFEDIGAQTTASSGREQLIYTVDVLRDNVDK  187

Query  664  MVELL  678
             + LL
Sbjct  188  ALALL  192



>ref|XP_008862995.1| hypothetical protein H310_01616 [Aphanomyces invadans]
 gb|ETW09190.1| hypothetical protein H310_01616 [Aphanomyces invadans]
Length=535

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 80/125 (64%), Gaps = 1/125 (1%)
 Frame = +1

Query  304  LPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYE  483
            LP LD P+ G+ +  P    ++   T+ T LPNGL++ S+ +   A++VGL+VD+GS +E
Sbjct  71   LPSLDEPIPGLPVLKP-ASQLQAPRTETTVLPNGLRVISQETYGQASTVGLFVDAGSRFE  129

Query  484  KPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPH  663
              ++ G +H++E + FKS+ +RSH  +VRE E IG    +++ REQ+ YT D L+  V  
Sbjct  130  DDSNTGITHMMEHLGFKSSHSRSHADLVREFEDIGAQTTSSSGREQLIYTVDVLRDNVDR  189

Query  664  MVELL  678
             +ELL
Sbjct  190  ALELL  194



>emb|CEP11004.1| hypothetical protein [Parasitella parasitica]
Length=596

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 74/106 (70%), Gaps = 4/106 (4%)
 Frame = +1

Query  319  FPLKGVTLPPPLPDHVEP--GSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPA  492
            FP K   +     DH +P  G  K+TTLPNG++IASE +    ++VG+YVD+GS YE  A
Sbjct  76   FPAK--EMRTSCRDHSKPSTGLCKVTTLPNGIRIASENTPGHFSAVGVYVDAGSRYETAA  133

Query  493  SFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTY  630
            + G SH+L+R+AFKST NRS  +VV E+E++GG++  ++SRE + Y
Sbjct  134  TRGVSHILDRLAFKSTTNRSADQVVAELESLGGNIMCSSSRESIMY  179



>ref|XP_009820980.1| hypothetical protein H257_00138 [Aphanomyces astaci]
 gb|ETV88580.1| hypothetical protein H257_00138 [Aphanomyces astaci]
Length=533

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 79/125 (63%), Gaps = 1/125 (1%)
 Frame = +1

Query  304  LPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYE  483
            LP LD P+ G+ +  P    ++   T+ T LPNGL++ S+ +   A++VGL+VD+GS +E
Sbjct  69   LPSLDEPIPGLPVLKP-ASQLQAPRTETTVLPNGLRVISQETYGQASTVGLFVDAGSRFE  127

Query  484  KPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPH  663
              ++ G +H++E + FKS+ +RSH  +VRE E IG    A++ REQ+ YT D L+  V  
Sbjct  128  DDSNTGVTHMMEHLGFKSSRSRSHADLVREFEDIGAQTTASSGREQLIYTVDVLRDNVDK  187

Query  664  MVELL  678
             + LL
Sbjct  188  ALALL  192



>gb|ENH86349.1| mitochondrial processing peptidase [Colletotrichum orbiculare 
MAFF 240422]
Length=573

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 77/129 (60%), Gaps = 3/129 (2%)
 Frame = +1

Query  295  SSALPPLDFPLKGVTLPPPLPDHVEPGSTK-ITTLPNGLKIASETSASPAASVGLYVDSG  471
            +SAL P        T+  P+P   EP     ITTLPNGL+IASE      + VG+YVD+G
Sbjct  21   TSALRPTQSRRTHATVIDPIPK--EPTDLDAITTLPNGLRIASEALPGSFSGVGVYVDAG  78

Query  472  SIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKT  651
            S YE     G SH+++R+AFKST +RS   ++ +VEA+GG++Q A+SRE M Y       
Sbjct  79   SRYEDAGLRGVSHIMDRLAFKSTTSRSADSMIEQVEALGGNIQCASSRESMMYQAATFNN  138

Query  652  YVPHMVELL  678
             VP  + LL
Sbjct  139  AVPTTIALL  147



>ref|XP_001907997.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP68670.1| unnamed protein product, partial [Podospora anserina S mat+]
Length=530

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 69/101 (68%), Gaps = 0/101 (0%)
 Frame = +1

Query  376  STKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSH  555
            + KITTLPNG+++ASE      + VG+Y+D+GS YE  +  GASH+++R+AFKST +RS 
Sbjct  5    TDKITTLPNGIRVASEDLPDAFSGVGVYIDAGSRYENDSLRGASHIMDRLAFKSTRSRSA  64

Query  556  LRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
              ++  VE +GG++Q A+SRE M Y      + +P  VELL
Sbjct  65   DEMLETVEQLGGNIQCASSRESMMYQAATFNSAIPTTVELL  105



>ref|XP_008475257.1| PREDICTED: mitochondrial-processing peptidase subunit beta, partial 
[Diaphorina citri]
Length=455

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 66/101 (65%), Gaps = 0/101 (0%)
 Frame = +1

Query  376  STKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSH  555
            ST++T++ NGL++A+E S +P A+VG+++D+GS YE  A+ G +H LE MAFK T  RS 
Sbjct  21   STQVTSIDNGLRVATEDSGAPTATVGIWIDAGSRYETDANNGVAHFLEHMAFKGTSKRSQ  80

Query  556  LRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
              +  EVE IG  + A  SREQ  +    LK  VP  VE+L
Sbjct  81   TDLELEVENIGAHLNAYTSREQTVFYAKCLKQDVPKAVEIL  121



>gb|EMF15932.1| Peptidase_M16-domain-containing protein [Sphaerulina musiva SO2202]
Length=573

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 72/112 (64%), Gaps = 1/112 (1%)
 Frame = +1

Query  346  PPLPDHVEPGS-TKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHLLER  522
            PP P   EP    +ITTLPNG+K+ASE+     + +G+Y+D+GS YE  A  G SH+++R
Sbjct  35   PPSPPSAEPTDLDQITTLPNGVKVASESLPGHFSGIGVYIDAGSRYETEALRGVSHIIDR  94

Query  523  MAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
            +AFKST  R+  ++   +E +GG++Q A+SRE + Y      + VP  VELL
Sbjct  95   LAFKSTTKRTSDQMTEAIEGLGGNIQCASSRESLMYQSATFNSAVPETVELL  146



>gb|KFB40497.1| AGAP000935-PA-like protein [Anopheles sinensis]
Length=475

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 70/129 (54%), Gaps = 10/129 (8%)
 Frame = +1

Query  292  RSSALPPLDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSG  471
            RS   P   F    V +PP          T++TTL NGL+IASE   S  A+VGL++D+G
Sbjct  25   RSKLSPAAQFRRALVNVPP----------TEVTTLENGLRIASEDCGSKTATVGLWIDAG  74

Query  472  SIYEKPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKT  651
            S  E  A+ G +H LE MAFK T NRS   +  EVE +G  + A  SREQ  +    L  
Sbjct  75   SRAENNANNGVAHFLEHMAFKGTANRSQTDIELEVENMGAHLNAYTSREQTVFYAKCLSK  134

Query  652  YVPHMVELL  678
             VP  VELL
Sbjct  135  DVPKAVELL  143



>gb|EMS59373.1| Mitochondrial-processing peptidase subunit alpha [Triticum urartu]
Length=84

 Score = 91.3 bits (225),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  487  PASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHM  666
            P S GA+HLLE++AFK T +RSH+++V+EVEA GG+V A+ASREQM Y+YD LK Y+P  
Sbjct  3    PESTGATHLLEKLAFKDTAHRSHMQIVQEVEATGGNVGASASREQMVYSYDTLKAYIPQA  62

Query  667  VELLV  681
            VE+L+
Sbjct  63   VEVLL  67



>emb|CDP32140.1| Putative mitochondrial-processing peptidase subunit alpha, mitochondrial 
precursor [Podospora anserina S mat+]
Length=586

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 69/101 (68%), Gaps = 0/101 (0%)
 Frame = +1

Query  376  STKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHLLERMAFKSTLNRSH  555
            + KITTLPNG+++ASE      + VG+Y+D+GS YE  +  GASH+++R+AFKST +RS 
Sbjct  61   TDKITTLPNGIRVASEDLPDAFSGVGVYIDAGSRYENDSLRGASHIMDRLAFKSTRSRSA  120

Query  556  LRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
              ++  VE +GG++Q A+SRE M Y      + +P  VELL
Sbjct  121  DEMLETVEQLGGNIQCASSRESMMYQAATFNSAIPTTVELL  161



>ref|XP_009260074.1| hypothetical protein FPSE_08681 [Fusarium pseudograminearum CS3096]
 gb|EKJ71175.1| hypothetical protein FPSE_08681 [Fusarium pseudograminearum CS3096]
Length=565

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 72/118 (61%), Gaps = 7/118 (6%)
 Frame = +1

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            +KG+   P   D       K+TTLPNGL++ASE      A VG+Y++ GS +E  +  G 
Sbjct  38   VKGIEKDPTELD-------KVTTLPNGLRVASEALPGSFAGVGVYIEGGSRFENDSLRGV  90

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
            SH+++R+AFKST  RS   ++ +VEA+GG++Q A+SRE M Y        VP  +ELL
Sbjct  91   SHIMDRLAFKSTSKRSADDMLEQVEALGGNIQCASSRESMMYQAATFNNAVPQTIELL  148



>gb|ETM47544.1| hypothetical protein L914_07753 [Phytophthora parasitica]
Length=531

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = +1

Query  361  HVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHLLERMAFKST  540
             ++P  T+I+ LP+GL++ S+ +   AA++G+++D+GS +E   S G SHLLE + FKST
Sbjct  83   QLKPPQTEISVLPSGLRVISQETYGQAATLGIFIDAGSRFEDDDSIGVSHLLEHLGFKST  142

Query  541  LNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
             +RSH ++V E+E IG    ++  REQ+ YT D L+  V   +ELL
Sbjct  143  TSRSHAQLVHEIEDIGALTTSSCGREQIIYTIDLLRDNVEEGLELL  188



>ref|XP_011318501.1| peptidase alpha subunit [Fusarium graminearum PH-1]
 gb|ESU08016.1| peptidase alpha subunit [Fusarium graminearum PH-1]
 gb|EYB30838.1| hypothetical protein FG05_02563 [Fusarium graminearum]
 emb|CEF74877.1| unnamed protein product [Fusarium graminearum]
Length=565

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 72/118 (61%), Gaps = 7/118 (6%)
 Frame = +1

Query  325  LKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGA  504
            +KG+   P   D       K+TTLPNGL++ASE      A VG+Y++ GS +E  +  G 
Sbjct  38   VKGIEKDPTELD-------KVTTLPNGLRVASEALPGSFAGVGVYIEGGSRFENDSLRGV  90

Query  505  SHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
            SH+++R+AFKST  RS   ++ +VEA+GG++Q A+SRE M Y        VP  +ELL
Sbjct  91   SHIMDRLAFKSTSKRSADDMLEQVEALGGNIQCASSRESMMYQAATFNNAVPQTIELL  148



>gb|KDO33365.1| hypothetical protein SPRG_02172 [Saprolegnia parasitica CBS 223.65]
Length=474

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 74/122 (61%), Gaps = 1/122 (1%)
 Frame = +1

Query  313  LDFPLKGVTLPPPLPDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPA  492
            LD P+ G+ +  P      P  T+ T LPNGL++ S+ +   A ++GL+VD+GS +E   
Sbjct  65   LDEPMHGLPVLKPASQLKAP-QTETTVLPNGLRVISQETYGQATTIGLFVDAGSRHETND  123

Query  493  SFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVE  672
            + G +H++E + FKS+  RSH  +VRE E IG    A++ REQ+ YT D L+  V   +E
Sbjct  124  TTGITHMMEHLGFKSSTTRSHADLVREFETIGAQTTASSGREQIIYTIDVLRDNVDRALE  183

Query  673  LL  678
            LL
Sbjct  184  LL  185



>emb|CBJ31604.1| Mitochondrial Processing Peptidase alpha subunit [Ectocarpus 
siliculosus]
Length=528

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 73/125 (58%), Gaps = 5/125 (4%)
 Frame = +1

Query  310  PLDFPLKGVTLPPPL--PDHVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYE  483
            P+D P  GV   PPL  P  ++   T  TTLPNGL++AS+ +     + G+ V++GS  E
Sbjct  115  PMDRPFPGV---PPLKPPGALKRPETLTTTLPNGLRVASQETYGALCTFGIVVNAGSRLE  171

Query  484  KPASFGASHLLERMAFKSTLNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPH  663
               + G  HLLE MAFKST  RSH +VV E E +GG+     SR+QM Y  D L+  +  
Sbjct  172  TDLNTGTCHLLELMAFKSTATRSHQQVVSEFEEMGGTTSTHGSRDQMLYCVDVLRDNLER  231

Query  664  MVELL  678
             VELL
Sbjct  232  AVELL  236



>ref|XP_008904779.1| hypothetical protein PPTG_11254 [Phytophthora parasitica INRA-310]
 gb|ETI47754.1| hypothetical protein F443_08041 [Phytophthora parasitica P1569]
 gb|ETN09633.1| hypothetical protein PPTG_11254 [Phytophthora parasitica INRA-310]
Length=531

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = +1

Query  361  HVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHLLERMAFKST  540
             ++P  T+I+ LP+GL++ S+ +   AA++G+++D+GS +E   S G SHLLE + FKST
Sbjct  83   QLKPPQTEISVLPSGLRVISQETYGQAATLGIFIDAGSRFEDDDSIGVSHLLEHLGFKST  142

Query  541  LNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
             +RSH ++V E+E IG    ++  REQ+ YT D L+  V   +ELL
Sbjct  143  TSRSHAQLVHEIEDIGALTTSSCGREQIIYTIDLLRDNVEKGLELL  188



>gb|ETL94313.1| hypothetical protein L917_07681 [Phytophthora parasitica]
 gb|ETP45635.1| hypothetical protein F442_07974 [Phytophthora parasitica P10297]
Length=531

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = +1

Query  361  HVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHLLERMAFKST  540
             ++P  T+I+ LP+GL++ S+ +   AA++G+++D+GS +E   S G SHLLE + FKST
Sbjct  83   QLKPPQTEISVLPSGLRVISQETYGQAATLGIFIDAGSRFEDDDSIGVSHLLEHLGFKST  142

Query  541  LNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
             +RSH ++V E+E IG    ++  REQ+ YT D L+  V   +ELL
Sbjct  143  TSRSHAQLVHEIEDIGALTTSSCGREQIIYTIDLLRDNVEKGLELL  188



>gb|ETK87731.1| hypothetical protein L915_07867 [Phytophthora parasitica]
 gb|ETL41171.1| hypothetical protein L916_07792 [Phytophthora parasitica]
 gb|ETP17604.1| hypothetical protein F441_08007 [Phytophthora parasitica CJ01A1]
Length=531

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = +1

Query  361  HVEPGSTKITTLPNGLKIASETSASPAASVGLYVDSGSIYEKPASFGASHLLERMAFKST  540
             ++P  T+I+ LP+GL++ S+ +   AA++G+++D+GS +E   S G SHLLE + FKST
Sbjct  83   QLKPPQTEISVLPSGLRVISQETYGQAATLGIFIDAGSRFEDDDSIGVSHLLEHLGFKST  142

Query  541  LNRSHLRVVREVEAIGGSVQAAASREQMTYTYDALKTYVPHMVELL  678
             +RSH ++V E+E IG    ++  REQ+ YT D L+  V   +ELL
Sbjct  143  TSRSHAQLVHEIEDIGALTTSSCGREQIIYTIDLLRDNVEKGLELL  188



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1161397529311