BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6473

Length=796
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009623669.1|  PREDICTED: rhodanese-like domain-containing ...    267   7e-83   Nicotiana tomentosiformis
ref|XP_009761641.1|  PREDICTED: rhodanese-like domain-containing ...    266   2e-82   Nicotiana sylvestris
ref|XP_006339688.1|  PREDICTED: rhodanese-like domain-containing ...    255   3e-78   Solanum tuberosum [potatoes]
ref|XP_010326928.1|  PREDICTED: rhodanese-like domain-containing ...    247   5e-75   Solanum lycopersicum
ref|XP_012083235.1|  PREDICTED: rhodanese-like domain-containing ...    242   3e-73   Jatropha curcas
ref|XP_007051588.1|  Thylakoid rhodanese-like, putative isoform 3       239   3e-73   
ref|XP_007051591.1|  Thylakoid rhodanese-like, putative isoform 6       238   9e-73   
ref|XP_009789972.1|  PREDICTED: rhodanese-like domain-containing ...    242   1e-72   Nicotiana sylvestris
ref|XP_010266472.1|  PREDICTED: rhodanese-like domain-containing ...    241   2e-72   Nelumbo nucifera [Indian lotus]
ref|XP_004248078.2|  PREDICTED: rhodanese-like domain-containing ...    241   2e-72   
ref|XP_007051587.1|  Thylakoid rhodanese-like, putative isoform 2       238   2e-72   
ref|XP_007051589.1|  Thylakoid rhodanese-like, putative isoform 4       238   6e-72   
ref|XP_002523373.1|  chitinase, putative                                248   7e-72   
ref|XP_010261520.1|  PREDICTED: rhodanese-like domain-containing ...    238   2e-71   Nelumbo nucifera [Indian lotus]
ref|XP_007051586.1|  Thylakoid rhodanese-like, putative isoform 1       237   2e-71   
gb|KHG13147.1|  hypothetical protein F383_04098                         239   2e-71   Gossypium arboreum [tree cotton]
gb|KHG13146.1|  hypothetical protein F383_04098                         239   2e-71   Gossypium arboreum [tree cotton]
gb|KDO86425.1|  hypothetical protein CISIN_1g013011mg                   232   1e-70   Citrus sinensis [apfelsine]
gb|KJB24584.1|  hypothetical protein B456_004G152500                    234   2e-70   Gossypium raimondii
gb|KJB24583.1|  hypothetical protein B456_004G152500                    234   3e-70   Gossypium raimondii
ref|XP_009601089.1|  PREDICTED: rhodanese-like domain-containing ...    234   6e-70   Nicotiana tomentosiformis
gb|KJB24582.1|  hypothetical protein B456_004G152500                    234   1e-69   Gossypium raimondii
gb|KDO86422.1|  hypothetical protein CISIN_1g013011mg                   230   6e-69   Citrus sinensis [apfelsine]
ref|XP_006491251.1|  PREDICTED: rhodanese-like domain-containing ...    231   8e-69   Citrus sinensis [apfelsine]
ref|XP_008233203.1|  PREDICTED: rhodanese-like domain-containing ...    230   1e-68   Prunus mume [ume]
ref|XP_006444874.1|  hypothetical protein CICLE_v10020161mg             230   1e-68   Citrus clementina [clementine]
gb|KDO86421.1|  hypothetical protein CISIN_1g013011mg                   230   1e-68   Citrus sinensis [apfelsine]
ref|XP_006366560.1|  PREDICTED: rhodanese-like domain-containing ...    230   2e-68   Solanum tuberosum [potatoes]
emb|CDP08699.1|  unnamed protein product                                229   6e-68   Coffea canephora [robusta coffee]
ref|XP_010055036.1|  PREDICTED: rhodanese-like domain-containing ...    228   7e-68   
ref|XP_011468943.1|  PREDICTED: rhodanese-like domain-containing ...    226   3e-67   Fragaria vesca subsp. vesca
ref|XP_002320855.1|  hydroxyproline-rich glycoprotein                   223   4e-66   Populus trichocarpa [western balsam poplar]
ref|XP_002302622.2|  hydroxyproline-rich glycoprotein                   223   7e-66   Populus trichocarpa [western balsam poplar]
ref|XP_010095787.1|  Uncharacterized protein L484_017594                229   3e-65   
ref|XP_011037916.1|  PREDICTED: rhodanese-like domain-containing ...    219   2e-64   Populus euphratica
gb|EYU38901.1|  hypothetical protein MIMGU_mgv1a006323mg                219   2e-64   Erythranthe guttata [common monkey flower]
ref|XP_011023203.1|  PREDICTED: rhodanese-like domain-containing ...    219   3e-64   Populus euphratica
gb|AEQ94146.1|  hydroxyproline rich glycoprotein                        213   3e-63   Elaeis guineensis
ref|XP_010661901.1|  PREDICTED: rhodanese-like domain-containing ...    216   3e-63   Vitis vinifera
ref|XP_011650694.1|  PREDICTED: rhodanese-like domain-containing ...    216   4e-63   Cucumis sativus [cucumbers]
ref|XP_007135235.1|  hypothetical protein PHAVU_010G112100g             214   1e-62   Phaseolus vulgaris [French bean]
ref|XP_007135236.1|  hypothetical protein PHAVU_010G112100g             214   2e-62   Phaseolus vulgaris [French bean]
ref|XP_003528797.1|  PREDICTED: rhodanese-like domain-containing ...    214   3e-62   Glycine max [soybeans]
ref|XP_003548475.1|  PREDICTED: rhodanese-like domain-containing ...    211   2e-61   Glycine max [soybeans]
ref|NP_567209.1|  thylakoid rhodanese-like protein                      211   3e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010915675.1|  PREDICTED: rhodanese-like domain-containing ...    211   3e-61   Elaeis guineensis
ref|XP_006286665.1|  hypothetical protein CARUB_v10002584mg             211   4e-61   Capsella rubella
emb|CAB80914.1|  hypothetical protein                                   211   5e-61   Arabidopsis thaliana [mouse-ear cress]
gb|KHN06295.1|  Hypothetical protein glysoja_021133                     209   1e-60   Glycine soja [wild soybean]
ref|XP_010427922.1|  PREDICTED: rhodanese-like domain-containing ...    210   1e-60   Camelina sativa [gold-of-pleasure]
ref|XP_008783830.1|  PREDICTED: rhodanese-like domain-containing ...    208   3e-60   Phoenix dactylifera
ref|XP_004516405.1|  PREDICTED: rhodanese-like domain-containing ...    209   4e-60   Cicer arietinum [garbanzo]
gb|ACJ86240.1|  unknown                                                 208   5e-60   Medicago truncatula
gb|KEH18685.1|  thylakoid rhodanese-like protein                        208   6e-60   Medicago truncatula
ref|XP_006396307.1|  hypothetical protein EUTSA_v10028649mg             206   2e-59   Eutrema salsugineum [saltwater cress]
ref|XP_009421248.1|  PREDICTED: rhodanese-like domain-containing ...    207   2e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006396308.1|  hypothetical protein EUTSA_v10028649mg             206   3e-59   
ref|XP_010669158.1|  PREDICTED: rhodanese-like domain-containing ...    206   3e-59   Beta vulgaris subsp. vulgaris [field beet]
gb|AAB61039.1|  A_IG002N01.31 gene product                              211   6e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010456200.1|  PREDICTED: rhodanese-like domain-containing ...    206   8e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010422759.1|  PREDICTED: rhodanese-like domain-containing ...    207   1e-58   
gb|KJB49531.1|  hypothetical protein B456_008G124200                    203   2e-58   Gossypium raimondii
gb|KHG21564.1|  hypothetical protein F383_26582                         203   2e-58   Gossypium arboreum [tree cotton]
ref|XP_009111413.1|  PREDICTED: rhodanese-like domain-containing ...    202   6e-58   Brassica rapa
ref|XP_008437912.1|  PREDICTED: rhodanese-like domain-containing ...    202   7e-58   Cucumis melo [Oriental melon]
emb|CDY07169.1|  BnaCnng01840D                                          202   1e-57   
emb|CDX74366.1|  BnaA03g26810D                                          202   1e-57   
ref|XP_009134504.1|  PREDICTED: LOW QUALITY PROTEIN: rhodanese-li...    203   1e-57   Brassica rapa
ref|XP_008350777.1|  PREDICTED: LOW QUALITY PROTEIN: rhodanese-li...    198   9e-57   
emb|CDY48498.1|  BnaA09g00250D                                          198   3e-56   Brassica napus [oilseed rape]
ref|XP_009336810.1|  PREDICTED: rhodanese-like domain-containing ...    197   5e-56   Pyrus x bretschneideri [bai li]
ref|XP_010534211.1|  PREDICTED: rhodanese-like domain-containing ...    196   8e-56   Tarenaya hassleriana [spider flower]
ref|XP_009336808.1|  PREDICTED: rhodanese-like domain-containing ...    196   1e-55   Pyrus x bretschneideri [bai li]
gb|KFK30681.1|  hypothetical protein AALP_AA6G014200                    194   2e-54   Arabis alpina [alpine rockcress]
ref|XP_002875001.1|  hypothetical protein ARALYDRAFT_352729             198   2e-54   
emb|CBI40498.3|  unnamed protein product                                189   2e-53   Vitis vinifera
emb|CDX91872.1|  BnaC03g31740D                                          194   2e-52   
gb|EPS66030.1|  hypothetical protein M569_08743                         186   2e-52   Genlisea aurea
ref|XP_007219299.1|  hypothetical protein PRUPE_ppa018863mg             183   1e-51   
ref|XP_010424692.1|  PREDICTED: rhodanese-like domain-containing ...    169   8e-48   
pdb|1VEE|A  Chain A, Nmr Structure Of The Hypothetical Rhodanese ...    149   3e-41   Arabidopsis thaliana [mouse-ear cress]
gb|ABR16588.1|  unknown                                                 156   2e-40   Picea sitchensis
ref|XP_003637723.1|  hypothetical protein MTR_100s0011                  147   2e-39   
ref|XP_006847355.1|  PREDICTED: rhodanese-like domain-containing ...    153   3e-39   Amborella trichopoda
ref|XP_003572147.1|  PREDICTED: rhodanese-like domain-containing ...    145   1e-36   Brachypodium distachyon [annual false brome]
gb|EMS45759.1|  hypothetical protein TRIUR3_22780                       138   6e-35   Triticum urartu
gb|EMT20251.1|  hypothetical protein F775_01839                         137   7e-35   
gb|EAY85255.1|  hypothetical protein OsI_06628                          140   1e-34   Oryza sativa Indica Group [Indian rice]
ref|NP_001046473.1|  Os02g0257300                                       140   1e-34   
gb|AFW71054.1|  hypothetical protein ZEAMMB73_066102                    137   6e-34   
ref|XP_002451894.1|  hypothetical protein SORBIDRAFT_04g009380          137   1e-33   Sorghum bicolor [broomcorn]
ref|XP_008681054.1|  PREDICTED: uncharacterized protein LOC100192...    137   1e-33   Zea mays [maize]
ref|NP_001131286.1|  uncharacterized protein LOC100192599               137   1e-33   Zea mays [maize]
ref|XP_004951282.1|  PREDICTED: rhodanese-like domain-containing ...    135   3e-33   Setaria italica
emb|CCJ09774.1|  rhodanese homology domain protein                      118   5e-28   Hirudo medicinalis
ref|XP_006648515.1|  PREDICTED: rhodanese-like domain-containing ...    114   9e-26   Oryza brachyantha
ref|XP_002991602.1|  hypothetical protein SELMODRAFT_448468             109   4e-24   Selaginella moellendorffii
ref|XP_002971531.1|  hypothetical protein SELMODRAFT_441569             109   4e-24   Selaginella moellendorffii
ref|XP_002527287.1|  chitinase, putative                                102   1e-21   
ref|XP_002271020.2|  PREDICTED: rhodanese-like domain-containing ...    102   1e-21   
emb|CAN80760.1|  hypothetical protein VITISV_014603                     103   2e-21   Vitis vinifera
ref|XP_007049538.1|  Rhodanese/Cell cycle control phosphatase sup...    101   2e-21   
gb|EYU46074.1|  hypothetical protein MIMGU_mgv1a008760mg                100   4e-21   Erythranthe guttata [common monkey flower]
ref|XP_010678998.1|  PREDICTED: rhodanese-like domain-containing ...  99.0    9e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001764633.1|  predicted protein                                95.1    1e-20   
ref|XP_008458097.1|  PREDICTED: rhodanese-like domain-containing ...  97.8    5e-20   Cucumis melo [Oriental melon]
ref|XP_006418623.1|  hypothetical protein EUTSA_v10002639mg           96.3    7e-20   Eutrema salsugineum [saltwater cress]
ref|XP_010095587.1|  hypothetical protein L484_007426                 97.1    1e-19   
ref|XP_011080557.1|  PREDICTED: rhodanese-like domain-containing ...  96.3    2e-19   Sesamum indicum [beniseed]
ref|XP_012084520.1|  PREDICTED: rhodanese-like domain-containing ...  95.9    2e-19   Jatropha curcas
gb|KDP45207.1|  hypothetical protein JCGZ_15072                       95.9    2e-19   Jatropha curcas
ref|XP_004149316.2|  PREDICTED: rhodanese-like domain-containing ...  95.9    2e-19   Cucumis sativus [cucumbers]
ref|XP_010532931.1|  PREDICTED: rhodanese-like domain-containing ...  95.1    2e-19   Tarenaya hassleriana [spider flower]
ref|XP_009136118.1|  PREDICTED: rhodanese-like domain-containing ...  94.4    4e-19   Brassica rapa
ref|XP_006858740.2|  PREDICTED: rhodanese-like domain-containing ...  94.0    4e-19   Amborella trichopoda
ref|XP_004246985.1|  PREDICTED: rhodanese-like domain-containing ...  94.4    6e-19   Solanum lycopersicum
emb|CDY15093.1|  BnaC03g44540D                                        93.2    8e-19   Brassica napus [oilseed rape]
ref|XP_011024728.1|  PREDICTED: rhodanese-like domain-containing ...  93.6    8e-19   Populus euphratica
ref|XP_011015310.1|  PREDICTED: rhodanese-like domain-containing ...  93.6    9e-19   Populus euphratica
ref|XP_011024729.1|  PREDICTED: rhodanese-like domain-containing ...  93.6    1e-18   Populus euphratica
ref|XP_011015311.1|  PREDICTED: rhodanese-like domain-containing ...  93.6    1e-18   Populus euphratica
emb|CDY52290.1|  BnaA03g57830D                                        92.8    1e-18   Brassica napus [oilseed rape]
ref|XP_001767557.1|  predicted protein                                89.4    1e-18   
gb|KDO43509.1|  hypothetical protein CISIN_1g039798mg                 91.7    2e-18   Citrus sinensis [apfelsine]
ref|XP_002303025.1|  hypothetical protein POPTR_0002s24080g           92.8    2e-18   
ref|XP_006469347.1|  PREDICTED: rhodanese-like domain-containing ...  92.4    2e-18   
ref|XP_006645148.1|  PREDICTED: rhodanese-like domain-containing ...  92.8    2e-18   
ref|XP_006447940.1|  hypothetical protein CICLE_v10016082mg           92.4    2e-18   
ref|XP_004493040.1|  PREDICTED: rhodanese-like domain-containing ...  93.2    2e-18   
ref|XP_002885723.1|  hypothetical protein ARALYDRAFT_480047           91.7    3e-18   Arabidopsis lyrata subsp. lyrata
emb|CDP03990.1|  unnamed protein product                              91.7    3e-18   Coffea canephora [robusta coffee]
gb|EPS68185.1|  hypothetical protein M569_06591                       90.9    4e-18   Genlisea aurea
ref|XP_010488649.1|  PREDICTED: rhodanese-like domain-containing ...  91.3    4e-18   Camelina sativa [gold-of-pleasure]
gb|ABN08992.1|  Rhodanese-like                                        91.7    4e-18   Medicago truncatula
ref|XP_003624244.1|  Hydroxyproline-rich glycoprotein-like protein    91.7    4e-18   Medicago truncatula
ref|XP_010251413.1|  PREDICTED: rhodanese-like domain-containing ...  92.0    6e-18   Nelumbo nucifera [Indian lotus]
ref|XP_003564816.1|  PREDICTED: rhodanese-like domain-containing ...  91.3    6e-18   Brachypodium distachyon [annual false brome]
ref|XP_008235871.1|  PREDICTED: rhodanese-like domain-containing ...  91.3    7e-18   Prunus mume [ume]
ref|XP_009382932.1|  PREDICTED: rhodanese-like domain-containing ...  91.3    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW84330.1|  hypothetical protein ZEAMMB73_537769                  89.7    2e-17   
ref|XP_009586824.1|  PREDICTED: rhodanese-like domain-containing ...  90.1    2e-17   Nicotiana tomentosiformis
ref|XP_004970853.1|  PREDICTED: rhodanese-like domain-containing ...  90.1    2e-17   
ref|XP_007199933.1|  hypothetical protein PRUPE_ppa007412mg           90.1    2e-17   Prunus persica
ref|XP_004970854.1|  PREDICTED: rhodanese-like domain-containing ...  89.7    2e-17   Setaria italica
ref|XP_010468493.1|  PREDICTED: rhodanese-like domain-containing ...  88.6    2e-17   
gb|AFW84331.1|  hypothetical protein ZEAMMB73_537769                  89.7    2e-17   
gb|AAM65517.1|  unknown                                               88.6    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566766.1|  Rhodanese/Cell cycle control phosphatase superf...  88.6    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010514185.1|  PREDICTED: rhodanese-like domain-containing ...  88.2    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009342380.1|  PREDICTED: rhodanese-like domain-containing ...  88.6    5e-17   Pyrus x bretschneideri [bai li]
gb|KHG15131.1|  hypothetical protein F383_06661                       88.2    6e-17   Gossypium arboreum [tree cotton]
ref|XP_008382545.1|  PREDICTED: rhodanese-like domain-containing ...  88.2    8e-17   Malus domestica [apple tree]
gb|EMT02847.1|  hypothetical protein F775_12138                       88.2    1e-16   
ref|XP_004290114.1|  PREDICTED: rhodanese-like domain-containing ...  87.0    2e-16   Fragaria vesca subsp. vesca
ref|XP_006350434.1|  PREDICTED: rhodanese-like domain-containing ...  87.0    2e-16   Solanum tuberosum [potatoes]
ref|XP_006299528.1|  hypothetical protein CARUB_v10015700mg           85.9    2e-16   Capsella rubella
gb|KJB22677.1|  hypothetical protein B456_004G060200                  86.7    3e-16   Gossypium raimondii
gb|KJB22678.1|  hypothetical protein B456_004G060200                  86.3    3e-16   Gossypium raimondii
gb|KJB22675.1|  hypothetical protein B456_004G060200                  86.7    3e-16   Gossypium raimondii
ref|XP_001770053.1|  predicted protein                                87.4    5e-16   
ref|XP_009763928.1|  PREDICTED: rhodanese-like domain-containing ...  85.9    5e-16   Nicotiana sylvestris
dbj|BAK02213.1|  predicted protein                                    85.5    2e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFK33973.1|  unknown                                               82.8    2e-15   Medicago truncatula
gb|KCW48714.1|  hypothetical protein EUGRSUZ_K02359                   82.8    2e-15   Eucalyptus grandis [rose gum]
gb|KCW48713.1|  hypothetical protein EUGRSUZ_K02359                   82.8    5e-15   Eucalyptus grandis [rose gum]
ref|XP_010037088.1|  PREDICTED: rhodanese-like domain-containing ...  83.2    5e-15   
gb|KHN40513.1|  Hypothetical protein glysoja_001011                   80.5    2e-14   Glycine soja [wild soybean]
emb|CDM85401.1|  unnamed protein product                              82.0    3e-14   Triticum aestivum [Canadian hard winter wheat]
gb|EAY76777.1|  hypothetical protein OsI_04733                        80.5    3e-14   Oryza sativa Indica Group [Indian rice]
dbj|BAD82378.1|  rhodanese domain-containing protein-like             80.5    5e-14   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001045047.1|  Os01g0889800                                     80.5    5e-14   
ref|XP_007139685.1|  hypothetical protein PHAVU_008G050400g           79.7    7e-14   Phaseolus vulgaris [French bean]
ref|XP_010908500.1|  PREDICTED: rhodanese-like domain-containing ...  79.0    2e-13   Elaeis guineensis
ref|XP_006587793.1|  PREDICTED: rhodanese-like domain-containing ...  77.8    3e-13   Glycine max [soybeans]
ref|XP_003534488.2|  PREDICTED: rhodanese-like domain-containing ...  77.8    4e-13   Glycine max [soybeans]
gb|KHN22145.1|  Hypothetical protein glysoja_042902                   77.4    4e-13   Glycine soja [wild soybean]
ref|XP_003551701.1|  PREDICTED: rhodanese-like domain-containing ...  77.4    4e-13   Glycine max [soybeans]
dbj|BAB01317.1|  unnamed protein product                              77.0    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008788262.1|  PREDICTED: rhodanese-like domain-containing ...  77.0    9e-13   Phoenix dactylifera
ref|XP_006418621.1|  hypothetical protein EUTSA_v10002639mg           65.9    1e-09   
ref|XP_006418622.1|  hypothetical protein EUTSA_v10002639mg           65.9    2e-09   
emb|CDX71001.1|  BnaC03g10850D                                        63.2    1e-08   
gb|ERN20207.1|  hypothetical protein AMTR_s00066p00130420             63.2    2e-08   Amborella trichopoda
ref|NP_001136579.1|  hypothetical protein                             56.6    3e-06   
ref|XP_008788263.1|  PREDICTED: rhodanese-like domain-containing ...  53.1    2e-05   
gb|KCW48715.1|  hypothetical protein EUGRSUZ_K02359                   53.1    5e-05   Eucalyptus grandis [rose gum]



>ref|XP_009623669.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Nicotiana tomentosiformis]
Length=437

 Score =   267 bits (682),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 202/231 (87%), Gaps = 5/231 (2%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvllssv  288
            MEA++A+RLTPLSVLS+RRNEP+KIP  P S PFK+L S   +E++SRNV+GGLVLLSS 
Sbjct  1    MEAIHAVRLTPLSVLSDRRNEPKKIPSHPISFPFKNLCS---VESLSRNVQGGLVLLSSA  57

Query  289  mssglAKALTYEEALQQ--TSVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvS  462
            +++GLAKALTYEEAL+Q  TS + DFD + V+ETVTTFA DNP+++ GGV  LA+PL++ 
Sbjct  58   LTTGLAKALTYEEALEQSTTSPAADFDATAVVETVTTFASDNPLVIVGGVVALALPLVLF  117

Query  463  QLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNG  642
            Q+L KPK WGVESAKTAYAKL DD +AQLLDIR   EL+EVGSPDIRGLKKKPVTV+Y G
Sbjct  118  QVLEKPKSWGVESAKTAYAKLGDDESAQLLDIRAPAELREVGSPDIRGLKKKPVTVAYKG  177

Query  643  EDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            EDKPGFLKKL+LKFK+PENTTLFILDKFDG+SELVAELVT NGFKAAYA+K
Sbjct  178  EDKPGFLKKLALKFKDPENTTLFILDKFDGNSELVAELVTANGFKAAYAVK  228



>ref|XP_009761641.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Nicotiana sylvestris]
Length=441

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 202/231 (87%), Gaps = 5/231 (2%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvllssv  288
            MEA+NA+R+TPLSVLS+RRNEP+KIP  P S PFK+L S   +E+ISRNV+GGLVLLSS 
Sbjct  1    MEAINAVRVTPLSVLSDRRNEPKKIPSHPISFPFKNLCS---VESISRNVQGGLVLLSSA  57

Query  289  mssglAKALTYEEALQQ--TSVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvS  462
            +++GLAKALTYEEAL+Q  TS + DFD + V+ETVTTFA DNP+++AGGV  LA+P+++ 
Sbjct  58   LTTGLAKALTYEEALEQSTTSPAADFDATAVVETVTTFASDNPLVIAGGVVALALPVVLF  117

Query  463  QLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNG  642
            Q+L KPK WGVESAKTAYAKL DD +AQLLDIR   EL+EVGSPDIRGLKKK VTV+Y G
Sbjct  118  QVLEKPKSWGVESAKTAYAKLGDDESAQLLDIRAPAELREVGSPDIRGLKKKAVTVAYKG  177

Query  643  EDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            EDKPGFLKKL+LKFK+PENTTLFILDKFDG+SELVAELVT NGFKAAYAIK
Sbjct  178  EDKPGFLKKLALKFKDPENTTLFILDKFDGNSELVAELVTANGFKAAYAIK  228



>ref|XP_006339688.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
[Solanum tuberosum]
Length=442

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 173/232 (75%), Positives = 199/232 (86%), Gaps = 6/232 (3%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvllssv  288
            MEA+NA+RLTPLSVLS+RRNE +KIP  P S PFK+L S   +E +SRNV+GGLVL+SSV
Sbjct  1    MEAINAVRLTPLSVLSDRRNEAKKIPSHPISFPFKNLCS---VENLSRNVQGGLVLVSSV  57

Query  289  mssglAKALTYEEALQQ--TSVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvS  462
            +++GLAKALTYEE L+Q  TS   +FD + V+ETVTTFA +NP+I+AGG A LA+P+++ 
Sbjct  58   LNTGLAKALTYEETLEQSATSPGAEFDATAVVETVTTFASENPIIIAGGFAALALPIVLF  117

Query  463  QLLSKP-KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  639
            Q+L KP K WGVESAKTAYAKLADDA AQLLDIR   EL+EVGSPDIRGLKKKPVTV Y 
Sbjct  118  QVLGKPPKSWGVESAKTAYAKLADDAGAQLLDIRAPAELREVGSPDIRGLKKKPVTVVYK  177

Query  640  GEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             EDK GFLKKLSLKFKEPENTTLFILDKFDG+SELVAELVTENGFKAAYAIK
Sbjct  178  SEDKTGFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVTENGFKAAYAIK  229



>ref|XP_010326928.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Solanum lycopersicum]
Length=442

 Score =   247 bits (630),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 167/232 (72%), Positives = 197/232 (85%), Gaps = 6/232 (3%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvllssv  288
            MEA+NA+RLTPLSV S+R+NE +KIP  P S PFK+L S   +E +SRNV+GGLVL+SSV
Sbjct  1    MEAINAVRLTPLSVRSDRKNEAKKIPSHPISFPFKNLCS---VENLSRNVQGGLVLVSSV  57

Query  289  mssglAKALTYEEALQQTSV--STDFDPSGVMETVTTFAGDNpvivaggvailavpllvS  462
            +++GLAKALTYEE ++Q+      +FD + V+ETVTTFA +NP+I+AGG A LA+P+++ 
Sbjct  58   LNTGLAKALTYEETIEQSETIPGAEFDATAVVETVTTFASENPIIIAGGFAALALPIVLF  117

Query  463  QLLSKP-KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  639
            Q+L KP K WGVESAKTAYAKLADDA AQLLDIR   EL+EVG+PDIRGLKKKPVTV Y 
Sbjct  118  QVLGKPPKSWGVESAKTAYAKLADDAGAQLLDIRATAELREVGTPDIRGLKKKPVTVVYK  177

Query  640  GEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             EDK GFLKKLSLKFKEPENTTLFILDKFDG+SELVAELVTENGFKAAYAIK
Sbjct  178  AEDKTGFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVTENGFKAAYAIK  229



>ref|XP_012083235.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Jatropha curcas]
 gb|KDP28507.1| hypothetical protein JCGZ_14278 [Jatropha curcas]
Length=444

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 160/238 (67%), Positives = 186/238 (78%), Gaps = 9/238 (4%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllp-------sslpfkslsssnsMEAISRNvkgg  267
            MEA+NA  LTP+SVL E+R EPRK   LP       SS    S +     E +SR   G 
Sbjct  1    MEALNAANLTPISVLCEKRAEPRKFLCLPTTSPLKFSSSASISTNPPTIQECLSRTFHGS  60

Query  268  lvllssvmssglAKALTYEEALQQT--SVSTDFDPSGVMETVTTFAGDNpvivaggvail  441
            LVLLSSV+S+GLAKALTYEEAL+Q+  S ++DFD SGV+++V +FA +NP I+AG VA+L
Sbjct  61   LVLLSSVLSTGLAKALTYEEALEQSLSSPTSDFDSSGVLDSVISFATENPTIIAGSVAVL  120

Query  442  avpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKP  621
            AVPL+VSQ+L KPK WGVESAK AYA L DDANAQLLDIR   E ++VG+PDIRG KKKP
Sbjct  121  AVPLIVSQILKKPKSWGVESAKKAYAVLGDDANAQLLDIRAPVEFRKVGTPDIRGFKKKP  180

Query  622  VTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            V++ Y GEDKPGFLKKLSLKFKEPENTTLFILDKFDG+SELVAEL   NGFKAAYAIK
Sbjct  181  VSIFYQGEDKPGFLKKLSLKFKEPENTTLFILDKFDGNSELVAELAAVNGFKAAYAIK  238



>ref|XP_007051588.1| Thylakoid rhodanese-like, putative isoform 3 [Theobroma cacao]
 ref|XP_007051590.1| Thylakoid rhodanese-like, putative isoform 3 [Theobroma cacao]
 gb|EOX95745.1| Thylakoid rhodanese-like, putative isoform 3 [Theobroma cacao]
 gb|EOX95747.1| Thylakoid rhodanese-like, putative isoform 3 [Theobroma cacao]
Length=331

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 150/239 (63%), Positives = 186/239 (78%), Gaps = 10/239 (4%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvkgg  267
            MEA+NA  LTPLSVL ERR + RK+  L  + P K  +S+  +       E +SR++  G
Sbjct  1    MEALNAASLTPLSVLCERRAKTRKVSSLSIASPPKVPTSAAFIKTPPSLQECLSRSLHRG  60

Query  268  lvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvai  438
            +VLLSSV++SG AKAL+YEEALQQT   S S   D +GV+++V +F  +NP +VAGG   
Sbjct  61   IVLLSSVLTSGAAKALSYEEALQQTKDFSSSFGLDSNGVVDSVVSFVTENPTVVAGGAVA  120

Query  439  lavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKK  618
            LAVPL++SQLL  PKPWGVESAK+AYAKL DDA AQLLDIR  +E +EVGSPD+RG  KK
Sbjct  121  LAVPLILSQLLKNPKPWGVESAKSAYAKLGDDATAQLLDIRAIKEFREVGSPDVRGFGKK  180

Query  619  PVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            PV++++  EDKPGFLKKLSLKF+EPENTTLF++DKFDG+SELVAELVT NGFKAAYA+K
Sbjct  181  PVSITFKNEDKPGFLKKLSLKFREPENTTLFVIDKFDGNSELVAELVTANGFKAAYAVK  239



>ref|XP_007051591.1| Thylakoid rhodanese-like, putative isoform 6 [Theobroma cacao]
 gb|EOX95748.1| Thylakoid rhodanese-like, putative isoform 6 [Theobroma cacao]
Length=353

 Score =   238 bits (608),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 150/239 (63%), Positives = 186/239 (78%), Gaps = 10/239 (4%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvkgg  267
            MEA+NA  LTPLSVL ERR + RK+  L  + P K  +S+  +       E +SR++  G
Sbjct  1    MEALNAASLTPLSVLCERRAKTRKVSSLSIASPPKVPTSAAFIKTPPSLQECLSRSLHRG  60

Query  268  lvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvai  438
            +VLLSSV++SG AKAL+YEEALQQT   S S   D +GV+++V +F  +NP +VAGG   
Sbjct  61   IVLLSSVLTSGAAKALSYEEALQQTKDFSSSFGLDSNGVVDSVVSFVTENPTVVAGGAVA  120

Query  439  lavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKK  618
            LAVPL++SQLL  PKPWGVESAK+AYAKL DDA AQLLDIR  +E +EVGSPD+RG  KK
Sbjct  121  LAVPLILSQLLKNPKPWGVESAKSAYAKLGDDATAQLLDIRAIKEFREVGSPDVRGFGKK  180

Query  619  PVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            PV++++  EDKPGFLKKLSLKF+EPENTTLF++DKFDG+SELVAELVT NGFKAAYA+K
Sbjct  181  PVSITFKNEDKPGFLKKLSLKFREPENTTLFVIDKFDGNSELVAELVTANGFKAAYAVK  239



>ref|XP_009789972.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Nicotiana sylvestris]
Length=481

 Score =   242 bits (617),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 166/236 (70%), Positives = 194/236 (82%), Gaps = 7/236 (3%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfk-slsssnsMEAISRNvkgglvllss  285
            MEA+NA RLTPLSV S+RRNEP+KIP    S     S +SSNS++ +SR V+GGLV+LSS
Sbjct  1    MEALNAARLTPLSVFSDRRNEPKKIPFKNLSNSANFSTNSSNSLDGLSRKVQGGLVVLSS  60

Query  286  vmssglAKALTYEEALQQ--TSVSTD-FDPSGVMETVTTFAGDNpvivaggvailavpll  456
            V ++ LA ALTYEEALQQ  TS STD FD +  +ETVT F  +NP+++AGG AILA+PL+
Sbjct  61   VFTTSLADALTYEEALQQSTTSTSTDEFDANAFVETVTNFVSENPLVIAGGFAILALPLV  120

Query  457  vSQLLS---KPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVT  627
            +SQ+LS   KPK WGVESAK AYAKL DD +++LLDIR   ELK+VGSPDIRGLKKK V+
Sbjct  121  LSQVLSNNNKPKAWGVESAKKAYAKLGDDESSELLDIRGPVELKQVGSPDIRGLKKKTVS  180

Query  628  VSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            V Y GEDKPGFLKKL+LKFKEPENTTLFILDKFDG+SELVAELVT NGFKAAYAIK
Sbjct  181  VVYKGEDKPGFLKKLALKFKEPENTTLFILDKFDGNSELVAELVTANGFKAAYAIK  236



>ref|XP_010266472.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Nelumbo nucifera]
Length=461

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 158/247 (64%), Positives = 195/247 (79%), Gaps = 13/247 (5%)
 Frame = +1

Query  94   IKIYAMEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISR  252
            I+ YAMEA+NA RLTP+SVLS+RR EPRKI  LPS+ P K    +NS        E + R
Sbjct  2    IENYAMEALNAARLTPVSVLSDRRTEPRKISSLPSTFPLKFSKFANSFVSTTNLPEVLLR  61

Query  253  NvkgglvllssvmssglAKALTYEEALQQTSVST------DFDPSGVMETVTTFAGDNpv  414
            +  G L++LSSV+S+GLA+ALTYEEAL+Q++ ++      DFD  G+++ V +F  +NP 
Sbjct  62   SFNGSLMVLSSVLSAGLARALTYEEALEQSTSTSTSGGGSDFDVGGLLDNVVSFGAENPA  121

Query  415  ivaggvailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSP  594
            I+ GGV I A+PL++SQ++ KPKPWG+ESAK A+AKLADD +AQLLDIR   E +EVGSP
Sbjct  122  IIVGGVTIFALPLVLSQVVKKPKPWGIESAKNAFAKLADDLDAQLLDIRAPVEFREVGSP  181

Query  595  DIRGLKKKPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGF  774
            DIRGLKKK V++ YNGEDK GFLKKLSLKFKEPENTTLFILDKFDG+SELVAELVT NGF
Sbjct  182  DIRGLKKKAVSIVYNGEDKLGFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVTANGF  241

Query  775  KAAYAIK  795
            KAAY+IK
Sbjct  242  KAAYSIK  248



>ref|XP_004248078.2| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Solanum lycopersicum]
Length=486

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 161/239 (67%), Positives = 191/239 (80%), Gaps = 5/239 (2%)
 Frame = +1

Query  94   IKI-YAMEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkggl  270
            IKI  AMEA+NA RLTP+SV S+RRNEP+KIP         + + S S+E ISRNV+GGL
Sbjct  7    IKIPLAMEALNAARLTPVSVFSDRRNEPKKIPSFQFKNFPNAANLSRSVEGISRNVQGGL  66

Query  271  vllssvmssglAKALTYEEALQQ--TSVSTDFDPSGVMETVTTFAGDNpvivaggvaila  444
            VLLSSV ++GLAKALTYEEALQQ  TS S+DFD +  +ET+T F  DNP+++AGG A+L 
Sbjct  67   VLLSSVFNTGLAKALTYEEALQQSTTSTSSDFDANAFVETLTDFVSDNPLVIAGGFAVLG  126

Query  445  vpllvSQLLSK-PKP-WGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKK  618
            +P +VSQ+  K PKP WGVESAK AYAKLADD +++L+DIR   ELK+ GSPDI   KKK
Sbjct  127  LPFIVSQVFGKMPKPSWGVESAKKAYAKLADDVSSELVDIRATAELKQEGSPDIGAFKKK  186

Query  619  PVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            PVT+ Y GEDK GFL KL+LKFKEPENTTLFILDKFDG+SELVAELVT NGFK+AYAIK
Sbjct  187  PVTIVYKGEDKTGFLNKLALKFKEPENTTLFILDKFDGNSELVAELVTANGFKSAYAIK  245



>ref|XP_007051587.1| Thylakoid rhodanese-like, putative isoform 2 [Theobroma cacao]
 gb|EOX95744.1| Thylakoid rhodanese-like, putative isoform 2 [Theobroma cacao]
Length=379

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 150/239 (63%), Positives = 186/239 (78%), Gaps = 10/239 (4%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvkgg  267
            MEA+NA  LTPLSVL ERR + RK+  L  + P K  +S+  +       E +SR++  G
Sbjct  1    MEALNAASLTPLSVLCERRAKTRKVSSLSIASPPKVPTSAAFIKTPPSLQECLSRSLHRG  60

Query  268  lvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvai  438
            +VLLSSV++SG AKAL+YEEALQQT   S S   D +GV+++V +F  +NP +VAGG   
Sbjct  61   IVLLSSVLTSGAAKALSYEEALQQTKDFSSSFGLDSNGVVDSVVSFVTENPTVVAGGAVA  120

Query  439  lavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKK  618
            LAVPL++SQLL  PKPWGVESAK+AYAKL DDA AQLLDIR  +E +EVGSPD+RG  KK
Sbjct  121  LAVPLILSQLLKNPKPWGVESAKSAYAKLGDDATAQLLDIRAIKEFREVGSPDVRGFGKK  180

Query  619  PVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            PV++++  EDKPGFLKKLSLKF+EPENTTLF++DKFDG+SELVAELVT NGFKAAYA+K
Sbjct  181  PVSITFKNEDKPGFLKKLSLKFREPENTTLFVIDKFDGNSELVAELVTANGFKAAYAVK  239



>ref|XP_007051589.1| Thylakoid rhodanese-like, putative isoform 4 [Theobroma cacao]
 gb|EOX95746.1| Thylakoid rhodanese-like, putative isoform 4 [Theobroma cacao]
Length=399

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 150/239 (63%), Positives = 186/239 (78%), Gaps = 10/239 (4%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvkgg  267
            MEA+NA  LTPLSVL ERR + RK+  L  + P K  +S+  +       E +SR++  G
Sbjct  1    MEALNAASLTPLSVLCERRAKTRKVSSLSIASPPKVPTSAAFIKTPPSLQECLSRSLHRG  60

Query  268  lvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvai  438
            +VLLSSV++SG AKAL+YEEALQQT   S S   D +GV+++V +F  +NP +VAGG   
Sbjct  61   IVLLSSVLTSGAAKALSYEEALQQTKDFSSSFGLDSNGVVDSVVSFVTENPTVVAGGAVA  120

Query  439  lavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKK  618
            LAVPL++SQLL  PKPWGVESAK+AYAKL DDA AQLLDIR  +E +EVGSPD+RG  KK
Sbjct  121  LAVPLILSQLLKNPKPWGVESAKSAYAKLGDDATAQLLDIRAIKEFREVGSPDVRGFGKK  180

Query  619  PVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            PV++++  EDKPGFLKKLSLKF+EPENTTLF++DKFDG+SELVAELVT NGFKAAYA+K
Sbjct  181  PVSITFKNEDKPGFLKKLSLKFREPENTTLFVIDKFDGNSELVAELVTANGFKAAYAVK  239



>ref|XP_002523373.1| chitinase, putative [Ricinus communis]
 gb|EEF39089.1| chitinase, putative [Ricinus communis]
Length=938

 Score =   248 bits (633),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 159/241 (66%), Positives = 192/241 (80%), Gaps = 8/241 (3%)
 Frame = +1

Query  97   KIYAMEAVNALRLTPLSVLSERRNEPRKIpl------lpsslpfkslsssnsMEAISRNv  258
            K YAMEA+NA  LTP+SVL E+RNEPRKI          S     S +S +  + +SR+ 
Sbjct  503  KNYAMEALNAAGLTPISVLCEKRNEPRKIWCPPTSPLKFSGSAPLSTTSLSLQDCLSRSY  562

Query  259  kgglvllssvmssglAKALTYEEALQQT--SVSTDFDPSGVMETVTTFAGDNpvivaggv  432
             G LV+LSSV+S+GLAKALTYEEALQQ+  + +++ D SGV++ V +FA +NPV++AGG 
Sbjct  563  SGSLVVLSSVLSTGLAKALTYEEALQQSAGTAASESDASGVLDNVISFATENPVVIAGGA  622

Query  433  ailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLK  612
             +LAVPL++SQ+L KPK WGVESAK AYA L DDANAQLLDIR   EL++VG+PDIRG K
Sbjct  623  VVLAVPLILSQILKKPKSWGVESAKKAYALLGDDANAQLLDIRAPVELRKVGTPDIRGFK  682

Query  613  KKPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAI  792
            KKPV +SYNGEDK GFLK+LSLKFKEPENTTLFILDK+DG+SELVAELVT NGFKAAYAI
Sbjct  683  KKPVPISYNGEDKTGFLKRLSLKFKEPENTTLFILDKYDGNSELVAELVTVNGFKAAYAI  742

Query  793  K  795
            K
Sbjct  743  K  743



>ref|XP_010261520.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Nelumbo nucifera]
Length=450

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 157/242 (65%), Positives = 194/242 (80%), Gaps = 13/242 (5%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvkgg  267
            MEA+NA+ L P+SVLS+RR EPR+I  LPS  PFK   S++S+       + +SR++ GG
Sbjct  1    MEALNAVGLPPVSVLSDRRTEPRRISSLPSISPFKFSKSASSVTSPPNLTDILSRSLNGG  60

Query  268  lvllssvmssglAKALTYEEALQQTSVST------DFDPSGVMETVTTFAGDNpvivagg  429
            LV+L+SV+S  LA+ALTYEEAL+Q+  ++      D D  G++++V +FA +NP I+ GG
Sbjct  61   LVVLTSVLSGELARALTYEEALEQSVSTSTSSSGPDVDAGGLVDSVVSFATENPAIIVGG  120

Query  430  vailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGL  609
              ILA+PL++SQ+L KPKPWGVESAK AYAKLADDA+AQLLDIR A E +EVGSPDIRGL
Sbjct  121  ATILALPLVLSQVLKKPKPWGVESAKNAYAKLADDADAQLLDIREAVEFREVGSPDIRGL  180

Query  610  KKKPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYA  789
            KKK V++ Y GEDKPGFLK+LSLKFKEPENTTLFILDKFDG+SELVAELVT NGFK AYA
Sbjct  181  KKKAVSIVYKGEDKPGFLKRLSLKFKEPENTTLFILDKFDGNSELVAELVTANGFKGAYA  240

Query  790  IK  795
            IK
Sbjct  241  IK  242



>ref|XP_007051586.1| Thylakoid rhodanese-like, putative isoform 1 [Theobroma cacao]
 gb|EOX95743.1| Thylakoid rhodanese-like, putative isoform 1 [Theobroma cacao]
Length=430

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 150/239 (63%), Positives = 186/239 (78%), Gaps = 10/239 (4%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvkgg  267
            MEA+NA  LTPLSVL ERR + RK+  L  + P K  +S+  +       E +SR++  G
Sbjct  1    MEALNAASLTPLSVLCERRAKTRKVSSLSIASPPKVPTSAAFIKTPPSLQECLSRSLHRG  60

Query  268  lvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvai  438
            +VLLSSV++SG AKAL+YEEALQQT   S S   D +GV+++V +F  +NP +VAGG   
Sbjct  61   IVLLSSVLTSGAAKALSYEEALQQTKDFSSSFGLDSNGVVDSVVSFVTENPTVVAGGAVA  120

Query  439  lavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKK  618
            LAVPL++SQLL  PKPWGVESAK+AYAKL DDA AQLLDIR  +E +EVGSPD+RG  KK
Sbjct  121  LAVPLILSQLLKNPKPWGVESAKSAYAKLGDDATAQLLDIRAIKEFREVGSPDVRGFGKK  180

Query  619  PVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            PV++++  EDKPGFLKKLSLKF+EPENTTLF++DKFDG+SELVAELVT NGFKAAYA+K
Sbjct  181  PVSITFKNEDKPGFLKKLSLKFREPENTTLFVIDKFDGNSELVAELVTANGFKAAYAVK  239



>gb|KHG13147.1| hypothetical protein F383_04098 [Gossypium arboreum]
Length=499

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 156/241 (65%), Positives = 190/241 (79%), Gaps = 12/241 (5%)
 Frame = +1

Query  109  MEAVNAL--RLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvk  261
            M  +NA    LTPLSVLSE R E RK PLLP + P K  +S   +       + +SR + 
Sbjct  3    MRTLNAATPSLTPLSVLSETRTEARKAPLLPIASPLKLPNSPAFIKTQPALHQCLSRTLH  62

Query  262  gglvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggv  432
            GGL+LLSS++ +G AKAL+YEEALQQT   S S DFDP+G+++TV +FA +NP +VAGG 
Sbjct  63   GGLLLLSSLLPNGFAKALSYEEALQQTTGSSSSVDFDPNGILDTVVSFATENPTVVAGGT  122

Query  433  ailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLK  612
              LAVPL++SQLL  PKPWGVESA++AYAKL DDA AQLLDIRP +E ++VGSPDI+G +
Sbjct  123  VALAVPLILSQLLKNPKPWGVESARSAYAKLGDDATAQLLDIRPLKESRDVGSPDIKGFR  182

Query  613  KKPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAI  792
            KKPV+++YNGEDKP FL KLSLKFKEPENTTLFI+DKFDG+SELVAELVT NGFKAAYA+
Sbjct  183  KKPVSIAYNGEDKPVFLTKLSLKFKEPENTTLFIMDKFDGNSELVAELVTANGFKAAYAV  242

Query  793  K  795
            K
Sbjct  243  K  243



>gb|KHG13146.1| hypothetical protein F383_04098 [Gossypium arboreum]
Length=509

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 156/241 (65%), Positives = 190/241 (79%), Gaps = 12/241 (5%)
 Frame = +1

Query  109  MEAVNAL--RLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvk  261
            M  +NA    LTPLSVLSE R E RK PLLP + P K  +S   +       + +SR + 
Sbjct  3    MRTLNAATPSLTPLSVLSETRTEARKAPLLPIASPLKLPNSPAFIKTQPALHQCLSRTLH  62

Query  262  gglvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggv  432
            GGL+LLSS++ +G AKAL+YEEALQQT   S S DFDP+G+++TV +FA +NP +VAGG 
Sbjct  63   GGLLLLSSLLPNGFAKALSYEEALQQTTGSSSSVDFDPNGILDTVVSFATENPTVVAGGT  122

Query  433  ailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLK  612
              LAVPL++SQLL  PKPWGVESA++AYAKL DDA AQLLDIRP +E ++VGSPDI+G +
Sbjct  123  VALAVPLILSQLLKNPKPWGVESARSAYAKLGDDATAQLLDIRPLKESRDVGSPDIKGFR  182

Query  613  KKPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAI  792
            KKPV+++YNGEDKP FL KLSLKFKEPENTTLFI+DKFDG+SELVAELVT NGFKAAYA+
Sbjct  183  KKPVSIAYNGEDKPVFLTKLSLKFKEPENTTLFIMDKFDGNSELVAELVTANGFKAAYAV  242

Query  793  K  795
            K
Sbjct  243  K  243



>gb|KDO86425.1| hypothetical protein CISIN_1g013011mg [Citrus sinensis]
Length=330

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 149/238 (63%), Positives = 186/238 (78%), Gaps = 9/238 (4%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpssl-------pfkslsssnsMEAISRNvkgg  267
            MEA+N   L PLSVL +RR+EPRKI  L ++             +  N +E  +++V GG
Sbjct  1    MEALNPAGLIPLSVLCDRRSEPRKIQSLSTASLPKLATSASNKTTQQNFLECFAKSVHGG  60

Query  268  lvllssvmssglAKALTYEEALQQT--SVSTDFDPSGVMETVTTFAGDNpvivaggvail  441
            LVLLSSV+ +GLA+ALTYEEALQQ+  S ++D D SG +++V +F  +NP+ +AGGV IL
Sbjct  61   LVLLSSVLGTGLAQALTYEEALQQSAGSSASDVDASGFIDSVISFGTENPLAIAGGVTIL  120

Query  442  avpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKP  621
            AVPL++SQ+L+KPK WGVESA+ AYAKL DDA+AQLLDIR   E ++VGSPD+RGL K+P
Sbjct  121  AVPLVLSQVLNKPKSWGVESARNAYAKLGDDASAQLLDIRAPVEFRQVGSPDVRGLGKRP  180

Query  622  VTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            V++ Y G+DKPGFLKKLSLKFKEPENTTLFILDKFDG+SELVAELVT NGFK AY IK
Sbjct  181  VSIVYKGDDKPGFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVTINGFKNAYTIK  238



>gb|KJB24584.1| hypothetical protein B456_004G152500 [Gossypium raimondii]
Length=437

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 154/241 (64%), Positives = 188/241 (78%), Gaps = 12/241 (5%)
 Frame = +1

Query  109  MEAVNAL--RLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvk  261
            M  +NA    LTPLSVLSE R E RK PLLP + P K  +S   +       +  SR + 
Sbjct  3    MRTLNAATPSLTPLSVLSETRTETRKAPLLPIASPLKLPNSPAFIKTQPALHQCFSRTLH  62

Query  262  gglvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggv  432
            GGL+LLSS++ +G AKAL+YEEALQQT   S S DFDP+G+++TV +F  ++P +VAGG 
Sbjct  63   GGLLLLSSLLPNGFAKALSYEEALQQTTGFSSSVDFDPNGILDTVVSFVTEHPTVVAGGT  122

Query  433  ailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLK  612
              LAVPL++S+LL  PKPWGVESA++AYAKL DDA AQLLDIRP +E ++VGSPDI+G  
Sbjct  123  VALAVPLILSRLLKNPKPWGVESARSAYAKLGDDATAQLLDIRPLKESRDVGSPDIKGFG  182

Query  613  KKPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAI  792
            KKPV+++YNGEDKPGFL KLSLKFKEPENTTLFI+DKFDG+SELVAELVT NGFKAAYA+
Sbjct  183  KKPVSIAYNGEDKPGFLTKLSLKFKEPENTTLFIIDKFDGNSELVAELVTANGFKAAYAV  242

Query  793  K  795
            K
Sbjct  243  K  243



>gb|KJB24583.1| hypothetical protein B456_004G152500 [Gossypium raimondii]
Length=434

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 154/241 (64%), Positives = 188/241 (78%), Gaps = 12/241 (5%)
 Frame = +1

Query  109  MEAVNAL--RLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvk  261
            M  +NA    LTPLSVLSE R E RK PLLP + P K  +S   +       +  SR + 
Sbjct  3    MRTLNAATPSLTPLSVLSETRTETRKAPLLPIASPLKLPNSPAFIKTQPALHQCFSRTLH  62

Query  262  gglvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggv  432
            GGL+LLSS++ +G AKAL+YEEALQQT   S S DFDP+G+++TV +F  ++P +VAGG 
Sbjct  63   GGLLLLSSLLPNGFAKALSYEEALQQTTGFSSSVDFDPNGILDTVVSFVTEHPTVVAGGT  122

Query  433  ailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLK  612
              LAVPL++S+LL  PKPWGVESA++AYAKL DDA AQLLDIRP +E ++VGSPDI+G  
Sbjct  123  VALAVPLILSRLLKNPKPWGVESARSAYAKLGDDATAQLLDIRPLKESRDVGSPDIKGFG  182

Query  613  KKPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAI  792
            KKPV+++YNGEDKPGFL KLSLKFKEPENTTLFI+DKFDG+SELVAELVT NGFKAAYA+
Sbjct  183  KKPVSIAYNGEDKPGFLTKLSLKFKEPENTTLFIIDKFDGNSELVAELVTANGFKAAYAV  242

Query  793  K  795
            K
Sbjct  243  K  243



>ref|XP_009601089.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Nicotiana tomentosiformis]
Length=481

 Score =   234 bits (598),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 159/236 (67%), Positives = 191/236 (81%), Gaps = 7/236 (3%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfk-slsssnsMEAISRNvkgglvllss  285
            MEA+NA  LTPLSV S+RRNEP+KIP    S     S +SSNS+E +SR V+GGLV+LSS
Sbjct  1    MEALNAASLTPLSVFSDRRNEPKKIPFKNLSNSANFSTNSSNSLEILSRKVQGGLVVLSS  60

Query  286  vmssglAKALTYEEALQQTSVST---DFDPSGVMETVTTFAGDNpvivaggvailavpll  456
            V ++ LA ALTYEEALQQ++ ST   DFD +  +ETVT F  +NP+++AGG AILA+PL+
Sbjct  61   VFTTSLANALTYEEALQQSTTSTSTADFDANAFVETVTNFVSENPLVIAGGFAILALPLV  120

Query  457  vSQLLSKPKP---WGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVT  627
            +SQ+L   KP   WGVESAK AYA+L DD +++LLDIR   EL++VGSPDIRGLKKK V+
Sbjct  121  LSQVLGNNKPNKKWGVESAKKAYAELGDDESSELLDIRGPVELRQVGSPDIRGLKKKAVS  180

Query  628  VSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            V Y GEDKPGFLKKL+L+FKEPENTTLFILDKFDG+SELVAELVT NGFKAAYAIK
Sbjct  181  VVYKGEDKPGFLKKLALRFKEPENTTLFILDKFDGNSELVAELVTANGFKAAYAIK  236



>gb|KJB24582.1| hypothetical protein B456_004G152500 [Gossypium raimondii]
Length=498

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 154/241 (64%), Positives = 188/241 (78%), Gaps = 12/241 (5%)
 Frame = +1

Query  109  MEAVNAL--RLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvk  261
            M  +NA    LTPLSVLSE R E RK PLLP + P K  +S   +       +  SR + 
Sbjct  3    MRTLNAATPSLTPLSVLSETRTETRKAPLLPIASPLKLPNSPAFIKTQPALHQCFSRTLH  62

Query  262  gglvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggv  432
            GGL+LLSS++ +G AKAL+YEEALQQT   S S DFDP+G+++TV +F  ++P +VAGG 
Sbjct  63   GGLLLLSSLLPNGFAKALSYEEALQQTTGFSSSVDFDPNGILDTVVSFVTEHPTVVAGGT  122

Query  433  ailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLK  612
              LAVPL++S+LL  PKPWGVESA++AYAKL DDA AQLLDIRP +E ++VGSPDI+G  
Sbjct  123  VALAVPLILSRLLKNPKPWGVESARSAYAKLGDDATAQLLDIRPLKESRDVGSPDIKGFG  182

Query  613  KKPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAI  792
            KKPV+++YNGEDKPGFL KLSLKFKEPENTTLFI+DKFDG+SELVAELVT NGFKAAYA+
Sbjct  183  KKPVSIAYNGEDKPGFLTKLSLKFKEPENTTLFIIDKFDGNSELVAELVTANGFKAAYAV  242

Query  793  K  795
            K
Sbjct  243  K  243



>gb|KDO86422.1| hypothetical protein CISIN_1g013011mg [Citrus sinensis]
Length=417

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 149/238 (63%), Positives = 186/238 (78%), Gaps = 9/238 (4%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpssl-------pfkslsssnsMEAISRNvkgg  267
            MEA+N   L PLSVL +RR+EPRKI  L ++             +  N +E  +++V GG
Sbjct  1    MEALNPAGLIPLSVLCDRRSEPRKIQSLSTASLPKLATSASNKTTQQNFLECFAKSVHGG  60

Query  268  lvllssvmssglAKALTYEEALQQT--SVSTDFDPSGVMETVTTFAGDNpvivaggvail  441
            LVLLSSV+ +GLA+ALTYEEALQQ+  S ++D D SG +++V +F  +NP+ +AGGV IL
Sbjct  61   LVLLSSVLGTGLAQALTYEEALQQSAGSSASDVDASGFIDSVISFGTENPLAIAGGVTIL  120

Query  442  avpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKP  621
            AVPL++SQ+L+KPK WGVESA+ AYAKL DDA+AQLLDIR   E ++VGSPD+RGL K+P
Sbjct  121  AVPLVLSQVLNKPKSWGVESARNAYAKLGDDASAQLLDIRAPVEFRQVGSPDVRGLGKRP  180

Query  622  VTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            V++ Y G+DKPGFLKKLSLKFKEPENTTLFILDKFDG+SELVAELVT NGFK AY IK
Sbjct  181  VSIVYKGDDKPGFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVTINGFKNAYTIK  238



>ref|XP_006491251.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
isoform X1 [Citrus sinensis]
 gb|KDO86424.1| hypothetical protein CISIN_1g013011mg [Citrus sinensis]
Length=451

 Score =   231 bits (588),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 149/238 (63%), Positives = 186/238 (78%), Gaps = 9/238 (4%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpssl-------pfkslsssnsMEAISRNvkgg  267
            MEA+N   L PLSVL +RR+EPRKI  L ++             +  N +E  +++V GG
Sbjct  1    MEALNPAGLIPLSVLCDRRSEPRKIQSLSTASLPKLATSASNKTTQQNFLECFAKSVHGG  60

Query  268  lvllssvmssglAKALTYEEALQQT--SVSTDFDPSGVMETVTTFAGDNpvivaggvail  441
            LVLLSSV+ +GLA+ALTYEEALQQ+  S ++D D SG +++V +F  +NP+ +AGGV IL
Sbjct  61   LVLLSSVLGTGLAQALTYEEALQQSAGSSASDVDASGFIDSVISFGTENPLAIAGGVTIL  120

Query  442  avpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKP  621
            AVPL++SQ+L+KPK WGVESA+ AYAKL DDA+AQLLDIR   E ++VGSPD+RGL K+P
Sbjct  121  AVPLVLSQVLNKPKSWGVESARNAYAKLGDDASAQLLDIRAPVEFRQVGSPDVRGLGKRP  180

Query  622  VTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            V++ Y G+DKPGFLKKLSLKFKEPENTTLFILDKFDG+SELVAELVT NGFK AY IK
Sbjct  181  VSIVYKGDDKPGFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVTINGFKNAYTIK  238



>ref|XP_008233203.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Prunus mume]
Length=449

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 154/240 (64%), Positives = 186/240 (78%), Gaps = 12/240 (5%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpssl-------pfkslsssnsMEAISRNvkgg  267
            MEA+NA  LTPLSVL +R+ EPRK P LP+            S +   S E+ SR+  GG
Sbjct  1    MEALNAASLTPLSVLGDRKKEPRKFPSLPTISLPKFSNSTSLSTTPQASQESSSRSFHGG  60

Query  268  lvllssvmssglAKALTYEEALQQTSVST----DFDPSGVMETVTTFAGDNpvivaggva  435
            L+LLSSV ++G AKALTYEEAL Q SVST    D + SG+++ VT F  +NP ++AGG A
Sbjct  61   LLLLSSVFNTGFAKALTYEEALGQ-SVSTFTGGDLEASGILDNVTAFVTENPAVIAGGFA  119

Query  436  ilavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKK  615
            ILAVPL++SQ+L  PKPWGV++A++AYAKL DDANAQLLDIR   E+++VG+PD+RGL K
Sbjct  120  ILAVPLVLSQVLKPPKPWGVDTARSAYAKLGDDANAQLLDIRSPAEVRQVGTPDVRGLGK  179

Query  616  KPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            K V + Y GEDKPGFLKKLSLKFKEPENTTLF+LDKFDG+SELVAELVT NGFKAAYAIK
Sbjct  180  KAVPIVYKGEDKPGFLKKLSLKFKEPENTTLFVLDKFDGNSELVAELVTVNGFKAAYAIK  239



>ref|XP_006444874.1| hypothetical protein CICLE_v10020161mg [Citrus clementina]
 ref|XP_006491252.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
isoform X2 [Citrus sinensis]
 gb|ESR58114.1| hypothetical protein CICLE_v10020161mg [Citrus clementina]
 gb|KDO86423.1| hypothetical protein CISIN_1g013011mg [Citrus sinensis]
Length=443

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 149/238 (63%), Positives = 186/238 (78%), Gaps = 9/238 (4%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpssl-------pfkslsssnsMEAISRNvkgg  267
            MEA+N   L PLSVL +RR+EPRKI  L ++             +  N +E  +++V GG
Sbjct  1    MEALNPAGLIPLSVLCDRRSEPRKIQSLSTASLPKLATSASNKTTQQNFLECFAKSVHGG  60

Query  268  lvllssvmssglAKALTYEEALQQT--SVSTDFDPSGVMETVTTFAGDNpvivaggvail  441
            LVLLSSV+ +GLA+ALTYEEALQQ+  S ++D D SG +++V +F  +NP+ +AGGV IL
Sbjct  61   LVLLSSVLGTGLAQALTYEEALQQSAGSSASDVDASGFIDSVISFGTENPLAIAGGVTIL  120

Query  442  avpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKP  621
            AVPL++SQ+L+KPK WGVESA+ AYAKL DDA+AQLLDIR   E ++VGSPD+RGL K+P
Sbjct  121  AVPLVLSQVLNKPKSWGVESARNAYAKLGDDASAQLLDIRAPVEFRQVGSPDVRGLGKRP  180

Query  622  VTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            V++ Y G+DKPGFLKKLSLKFKEPENTTLFILDKFDG+SELVAELVT NGFK AY IK
Sbjct  181  VSIVYKGDDKPGFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVTINGFKNAYTIK  238



>gb|KDO86421.1| hypothetical protein CISIN_1g013011mg [Citrus sinensis]
Length=442

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 149/238 (63%), Positives = 186/238 (78%), Gaps = 9/238 (4%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpssl-------pfkslsssnsMEAISRNvkgg  267
            MEA+N   L PLSVL +RR+EPRKI  L ++             +  N +E  +++V GG
Sbjct  1    MEALNPAGLIPLSVLCDRRSEPRKIQSLSTASLPKLATSASNKTTQQNFLECFAKSVHGG  60

Query  268  lvllssvmssglAKALTYEEALQQT--SVSTDFDPSGVMETVTTFAGDNpvivaggvail  441
            LVLLSSV+ +GLA+ALTYEEALQQ+  S ++D D SG +++V +F  +NP+ +AGGV IL
Sbjct  61   LVLLSSVLGTGLAQALTYEEALQQSAGSSASDVDASGFIDSVISFGTENPLAIAGGVTIL  120

Query  442  avpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKP  621
            AVPL++SQ+L+KPK WGVESA+ AYAKL DDA+AQLLDIR   E ++VGSPD+RGL K+P
Sbjct  121  AVPLVLSQVLNKPKSWGVESARNAYAKLGDDASAQLLDIRAPVEFRQVGSPDVRGLGKRP  180

Query  622  VTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            V++ Y G+DKPGFLKKLSLKFKEPENTTLFILDKFDG+SELVAELVT NGFK AY IK
Sbjct  181  VSIVYKGDDKPGFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVTINGFKNAYTIK  238



>ref|XP_006366560.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
[Solanum tuberosum]
Length=479

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 156/238 (66%), Positives = 188/238 (79%), Gaps = 9/238 (4%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllp----sslpfkslsssnsMEAISRNvkgglvl  276
            MEA+NA RL P+SV S+RRNE +KIP        +    S + S S+E ISRNV+GGLVL
Sbjct  1    MEALNAARLNPVSVFSDRRNESKKIPSFQFKNLQNSSNFSTNLSRSVEGISRNVQGGLVL  60

Query  277  lssvmssglAKALTYEEALQQTSVST---DFDPSGVMETVTTFAGDNpvivaggvailav  447
            LSSV ++GLAKALTYEEALQQ++ ST   DFD +  +ET+T F  DNP+++AGG A+L +
Sbjct  61   LSSVFTTGLAKALTYEEALQQSTTSTSTNDFDANAFVETLTDFVSDNPLVIAGGFAVLGL  120

Query  448  pllvSQLLSK-PKP-WGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKP  621
            P +VSQ+  K PKP WGVESAK AYAKLADDA+++L+DIR   ELK+ G+PDI G KKKP
Sbjct  121  PFIVSQVFGKMPKPSWGVESAKKAYAKLADDASSELVDIRTTVELKQEGNPDISGFKKKP  180

Query  622  VTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            VT+ Y GEDK GFL KL+LKFKEPENTTLFILDKFDG+SELVAELVT NGFK+AYAIK
Sbjct  181  VTIVYKGEDKTGFLNKLALKFKEPENTTLFILDKFDGNSELVAELVTANGFKSAYAIK  238



>emb|CDP08699.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   229 bits (583),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 153/243 (63%), Positives = 186/243 (77%), Gaps = 14/243 (6%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsME--------AISRNvkg  264
            MEA+NA+  TPLSVLSERR EPRK     +    K+  +  +          A+ + +  
Sbjct  1    MEALNAVGWTPLSVLSERRTEPRKYLPFHAVPQIKTRPTLANFRSDPAKVAGALPKTIGA  60

Query  265  glvllssvmssglAKALTYEEALQQT-----SVSTD-FDPSGVMETVTTFAGDNpvivag  426
            G+VLLSSV+ SG A+AL+YEEALQQ+     S+  D FD SGV+++VT F  +NP++V G
Sbjct  61   GIVLLSSVLGSGSAEALSYEEALQQSLGEFPSLDLDAFDVSGVIDSVTNFVAENPLVVGG  120

Query  427  gvailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRG  606
            GVAILAVPLL+S +  K KPWGVESAK AYA+L DDA+AQLLDIRP  EL++VGSPD+RG
Sbjct  121  GVAILAVPLLLSLVFGKSKPWGVESAKAAYARLNDDASAQLLDIRPPVELRQVGSPDVRG  180

Query  607  LKKKPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAY  786
            LKKKPV V+Y G+DK GFLKKLSLKFKEPENTTLFILDKF+G+SELVAELVT NGFKAAY
Sbjct  181  LKKKPVAVAYKGDDKLGFLKKLSLKFKEPENTTLFILDKFNGNSELVAELVTANGFKAAY  240

Query  787  AIK  795
            AI+
Sbjct  241  AIR  243



>ref|XP_010055036.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Eucalyptus grandis]
 gb|KCW71521.1| hypothetical protein EUGRSUZ_E00068 [Eucalyptus grandis]
Length=456

 Score =   228 bits (582),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 150/242 (62%), Positives = 187/242 (77%), Gaps = 13/242 (5%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpssl-------pfkslsssnsMEAISRNvkgg  267
            MEA+NA  LTP+SVL +R+ EPRK+  LPS+           S +S +  E +SR   GG
Sbjct  1    MEALNAAGLTPISVLRDRKREPRKVSSLPSNSPLKLWNSSSSSNASPSFQEPVSRGFHGG  60

Query  268  lvllssvmssglAKALTYEEALQQTSVST------DFDPSGVMETVTTFAGDNpvivagg  429
            LVL SS++S+G+AKALTYEEALQQ+  ++      DFD  GV++ V +FA +NPV++ GG
Sbjct  61   LVLASSLISTGVAKALTYEEALQQSVSASAPEGGLDFDGRGVLDNVISFATENPVVIVGG  120

Query  430  vailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGL  609
              ILA+PL++SQ+L   KP+GV+SA+ AYAKL DDA+AQLLDIR   E ++VGSPD+RGL
Sbjct  121  AVILALPLVLSQILKPSKPFGVDSARNAYAKLGDDASAQLLDIRAPVEFRQVGSPDVRGL  180

Query  610  KKKPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYA  789
             KKPV++ Y G+DKPGFLKKLSLKFKEPENTTLFILDKFDG+SELVAELVT NGFKAAYA
Sbjct  181  GKKPVSIVYKGDDKPGFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVTVNGFKAAYA  240

Query  790  IK  795
            IK
Sbjct  241  IK  242



>ref|XP_011468943.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=444

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 156/237 (66%), Positives = 184/237 (78%), Gaps = 9/237 (4%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpssl-----pfkslsssnsMEAISRNvkgglv  273
            MEA+NA  LTP+SVL +R+ EPRK P LPS          S S+  S E  S++  GGL+
Sbjct  1    MEALNAASLTPISVLGDRKKEPRKFPSLPSISLPKFSSSTSYSTKASQEGSSKSFHGGLL  60

Query  274  llssvmssglAKALTYEEALQQTSVST---DFDPSGVMETVTTFAGDNpvivaggvaila  444
            LLSSV ++G AKALTYEEAL Q SVST   DFD   V++ V +F  DNP ++AGG  +LA
Sbjct  61   LLSSVFNAGFAKALTYEEALGQ-SVSTATGDFDTDKVLDNVISFVNDNPAVIAGGFVVLA  119

Query  445  vpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPV  624
            VPL++SQ+L KPKP+GVESAK+AYAKL +DANA L+DIR   E+++VGSPDIRGL KK V
Sbjct  120  VPLVLSQVLKKPKPFGVESAKSAYAKLGEDANALLVDIRAPGEIRQVGSPDIRGLGKKAV  179

Query  625  TVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             + Y GEDKPGFLKKLSLKFKEPENTTLFILDKFDG+SELVAELVT NGFKAAYAIK
Sbjct  180  PIVYKGEDKPGFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVTVNGFKAAYAIK  236



>ref|XP_002320855.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE99170.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=434

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 152/236 (64%), Positives = 180/236 (76%), Gaps = 7/236 (3%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpssl-------pfkslsssnsMEAISRNvkgg  267
            MEA NA   TPLSVL ERR+E RK   LP+            S S S + E +SR + GG
Sbjct  1    MEAFNAASSTPLSVLCERRSESRKSLSLPTVSPLKISHSFSTSTSRSTTQECLSRTLHGG  60

Query  268  lvllssvmssglAKALTYEEALQQTSVSTDFDPSGVMETVTTFAGDNpvivaggvailav  447
            +VLLSSV+ +GLA+ALTY+EAL+Q++ S   D +GV+++V  F  +NP IVAG V +LAV
Sbjct  61   IVLLSSVLGNGLARALTYQEALEQSARSFSSDANGVLDSVIKFGTENPTIVAGSVTVLAV  120

Query  448  pllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVT  627
            PL++S +L+K K WGVESAK AYA L  DANAQLLDIR   E ++VGSPDIRGL+KKPV 
Sbjct  121  PLVLSLVLNKSKSWGVESAKKAYAALGVDANAQLLDIRAPVEFRQVGSPDIRGLRKKPVP  180

Query  628  VSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            + Y GEDKPGFLKKLSLKFKEPENTTLFILDKFDG+SELVAELVT NGFKAAYAIK
Sbjct  181  IVYEGEDKPGFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVTVNGFKAAYAIK  236



>ref|XP_002302622.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE81895.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=436

 Score =   223 bits (567),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 149/238 (63%), Positives = 178/238 (75%), Gaps = 9/238 (4%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpl-------lpsslpfkslsssnsMEAISRNvkgg  267
            M+A+NA  LTPLSVL ERR E RK            S     S S S + E +SR + GG
Sbjct  1    MKALNAASLTPLSVLCERRAETRKSLSLPTVSPLKLSHSDSLSASRSAAQECLSRTLHGG  60

Query  268  lvllssvmssglAKALTYEEALQQ--TSVSTDFDPSGVMETVTTFAGDNpvivaggvail  441
            +VLLSSV+S+GLA+ALTYEEAL++  +  S+DFD +G+++    F  +NP I+AG V +L
Sbjct  61   VVLLSSVLSTGLARALTYEEALEKPASPFSSDFDVNGILDGFIKFGSENPTIIAGSVTVL  120

Query  442  avpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKP  621
            AVPL++S +L+KPK WGVESAK AYA L DDA AQLLDIR   E ++VGSPDI GL KKP
Sbjct  121  AVPLILSLVLNKPKSWGVESAKNAYAALGDDAKAQLLDIRATVEFRQVGSPDISGLSKKP  180

Query  622  VTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             ++ Y  EDKPGFLKKLSLKFKEPENTTLFILDKFDG+SELVAELVT NGFKAAYAIK
Sbjct  181  ASIVYKSEDKPGFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVTVNGFKAAYAIK  238



>ref|XP_010095787.1| Uncharacterized protein L484_017594 [Morus notabilis]
 gb|EXB62207.1| Uncharacterized protein L484_017594 [Morus notabilis]
Length=881

 Score =   229 bits (583),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 152/239 (64%), Positives = 185/239 (77%), Gaps = 15/239 (6%)
 Frame = +1

Query  91   GIKIYAMEAVNALRLTPLS-VLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgg  267
            G + YAMEA+NA  LTP+S VLS+R+ EPRK           S +    +   SR ++GG
Sbjct  444  GDQNYAMEALNAAGLTPISAVLSDRKQEPRK-----------SSAVYPKLSNSSRKIQGG  492

Query  268  lvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvai  438
            LVLLSSV+++GLAKALTYEEALQQ+   S+    D +GV+ +   FA +NPV++AGG A+
Sbjct  493  LVLLSSVLNTGLAKALTYEEALQQSVGSSLDGGLDVNGVLNSAIGFASENPVVLAGGAAV  552

Query  439  lavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKK  618
            LAVPL+VSQLL  PKPWGVESA+ AYA+L +D++ QLLDIRP+ E ++VGSPDIRGL KK
Sbjct  553  LAVPLIVSQLLKNPKPWGVESARNAYARLGEDSSIQLLDIRPSVEFRQVGSPDIRGLGKK  612

Query  619  PVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            PV++ Y GEDKPGFLKKLS KFK PENTTLFILDKF G+SELVAELVT NGFKAAYAIK
Sbjct  613  PVSIVYKGEDKPGFLKKLSFKFKAPENTTLFILDKFGGNSELVAELVTVNGFKAAYAIK  671



>ref|XP_011037916.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Populus euphratica]
Length=425

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 150/236 (64%), Positives = 177/236 (75%), Gaps = 7/236 (3%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpssl-------pfkslsssnsMEAISRNvkgg  267
            MEA NA    PLSVL ERR+E RK   LP+            S S S + E +SR + GG
Sbjct  1    MEAFNAASWAPLSVLCERRSESRKSLSLPTVSPLQISHSFSTSTSRSTTQECLSRTLHGG  60

Query  268  lvllssvmssglAKALTYEEALQQTSVSTDFDPSGVMETVTTFAGDNpvivaggvailav  447
            +VLLSSV+ +GLA+ALTY+EAL+Q++ S   D +GV+++   F  +NP IVAG V +LAV
Sbjct  61   IVLLSSVLGNGLARALTYQEALEQSTRSFSSDANGVLDSFIKFGTENPTIVAGSVTVLAV  120

Query  448  pllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVT  627
            PL++S +L+K K WGVESAK AYA L  DANAQLLDIR   E ++VGSPDIRGL KKPV 
Sbjct  121  PLVLSLVLNKSKSWGVESAKKAYAALGVDANAQLLDIRAPVEFRQVGSPDIRGLSKKPVP  180

Query  628  VSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            + Y GEDKPGFLKKLSLKFKEPENTTLFILDKFDG+SELVAELVT NGFKAAYAIK
Sbjct  181  IVYKGEDKPGFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVTVNGFKAAYAIK  236



>gb|EYU38901.1| hypothetical protein MIMGU_mgv1a006323mg [Erythranthe guttata]
Length=448

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 153/237 (65%), Positives = 183/237 (77%), Gaps = 9/237 (4%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRK-IpllpsslpfkslsssnsMEAISRNvkgglvllss  285
            MEA+NA+ LTPLSVLS +R EPRK + L   S       S+    ++SR ++G +VLL S
Sbjct  1    MEAINAVGLTPLSVLS-KRTEPRKTLSLPTISQFKNQTLSNFGNSSVSRTIQGSIVLLPS  59

Query  286  vmssglAKALTYEEALQQT-----SVSTDFDPSGVMETVTTFAGDNpvivaggvailavp  450
            V+SS LAKALTYEEALQQ+     S ++DFD +GV++ V  FA +NP+I+ GG+A+LAVP
Sbjct  60   VLSSELAKALTYEEALQQSVTTSTSSTSDFDVAGVLDDVINFATENPIIIGGGLAVLAVP  119

Query  451  llvSQLLS--KPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPV  624
            LLVSQLL   KPK WGVE+AK AYAKLA+DA+AQL+DIR   E+K+ GSPDIR  KKK  
Sbjct  120  LLVSQLLGGGKPKAWGVETAKNAYAKLAEDADAQLVDIRAISEIKQEGSPDIRASKKKAA  179

Query  625  TVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             + Y GEDKPGFL KLSLKFKEPENTTLFILDKFDG+SELVAEL T NGFKAAYAIK
Sbjct  180  AIVYQGEDKPGFLNKLSLKFKEPENTTLFILDKFDGNSELVAELATANGFKAAYAIK  236



>ref|XP_011023203.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Populus euphratica]
Length=436

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 151/238 (63%), Positives = 181/238 (76%), Gaps = 9/238 (4%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslp-------fkslsssnsMEAISRNvkgg  267
            M+A+NA  LTPL VL ERR E RK   LP+  P         S S S + E +SR + GG
Sbjct  1    MKALNASSLTPLPVLCERRAETRKSLSLPTVSPLKFSHYDSLSASRSAAQECLSRTLHGG  60

Query  268  lvllssvmssglAKALTYEEALQQ--TSVSTDFDPSGVMETVTTFAGDNpvivaggvail  441
            +VLLSSV+S+GLA+ALTYEEAL++  +   +DFD +G++++V  F  +NP I+AGGV +L
Sbjct  61   VVLLSSVLSTGLARALTYEEALEKPASPFLSDFDVNGILDSVIKFGSENPTIIAGGVTVL  120

Query  442  avpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKP  621
            AVPL++S LL+KPK WGVESAK AYA L DDA AQLLDIR   E ++VGSPDI GL KKP
Sbjct  121  AVPLILSLLLNKPKSWGVESAKKAYAALGDDAKAQLLDIRATVEFRQVGSPDISGLSKKP  180

Query  622  VTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             ++ Y  EDKPGFLKKLSLKFKEPENTTLFILDKFDG+SELVAELV  NGFKAAYAIK
Sbjct  181  ASIVYKSEDKPGFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVAVNGFKAAYAIK  238



>gb|AEQ94146.1| hydroxyproline rich glycoprotein [Elaeis guineensis]
Length=326

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 142/242 (59%), Positives = 179/242 (74%), Gaps = 12/242 (5%)
 Frame = +1

Query  106  AMEAVNALRLTPLSV-----LSERRNEPRKIpllpsslpfkslss--snsMEAISRNvkg  264
            AME +NA  LTP+S+      SER+ E +K+     + P  S +    +  E +SR   G
Sbjct  1    AMEVLNAAGLTPVSLHRTVGFSERKAESKKLFRFRLTKPSTSDAHPPFSLSELLSRGFAG  60

Query  265  glvllssv-mssglAKALTYEEALQQTS----VSTDFDPSGVMETVTTFAGDNpvivagg  429
            GL  LS+   + GLAKALTYEEAL Q+     VS DFD    ++ +  F  +NP++V GG
Sbjct  61   GLAALSAAPGAGGLAKALTYEEALGQSGSSFGVSADFDIGQFLDGIVKFGTENPLVVGGG  120

Query  430  vailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGL  609
            VA+LAVPL++S++L KPKPWGVESA+TAYAKL+DD +AQLLDIR  R+LKEVG PD+RGL
Sbjct  121  VAVLAVPLVLSRILQKPKPWGVESARTAYAKLSDDVDAQLLDIREGRDLKEVGKPDVRGL  180

Query  610  KKKPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYA  789
            KKK V+++Y G DKPGFLKKL+LKFK+P NTTLF+LDKFDG+S+LVAELVT NGFKAAYA
Sbjct  181  KKKAVSITYRGNDKPGFLKKLALKFKDPGNTTLFVLDKFDGNSKLVAELVTANGFKAAYA  240

Query  790  IK  795
            IK
Sbjct  241  IK  242



>ref|XP_010661901.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Vitis vinifera]
Length=440

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 147/242 (61%), Positives = 173/242 (71%), Gaps = 13/242 (5%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsss-------nsMEAISRNvkgg  267
            MEA+N   LTPLSVL +RR EPRKI  LP+    K  SS+          E  +R+  GG
Sbjct  1    MEALNLAGLTPLSVLRDRRTEPRKISSLPAVSALKISSSATFNTTPPALQECFTRSFHGG  60

Query  268  lvllssvmssglAKALTYEEALQQTSVST------DFDPSGVMETVTTFAGDNpvivagg  429
            LVLLSSV+  G A ALTYEEAL Q+  ++      +FD +G ++ V +F  +NP +VAGG
Sbjct  61   LVLLSSVLGPGAAAALTYEEALDQSVTTSTSGGIIEFDANGFLDRVISFGVENPAVVAGG  120

Query  430  vailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGL  609
              IL VPL++SQLL KPKPWGVESA+ AYAKL DDA AQLLDIR   E ++VGSPDIRGL
Sbjct  121  ALILVVPLVLSQLLKKPKPWGVESARNAYAKLGDDATAQLLDIREPVEFRQVGSPDIRGL  180

Query  610  KKKPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYA  789
            +KKPV +   G DK  FLKKLSLKFKEPENTTL ILDKFDG+SE+VAEL   NGFKAAYA
Sbjct  181  RKKPVAIPCKGGDKQAFLKKLSLKFKEPENTTLLILDKFDGNSEMVAELAAVNGFKAAYA  240

Query  790  IK  795
            IK
Sbjct  241  IK  242



>ref|XP_011650694.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Cucumis sativus]
 gb|KGN56436.1| hypothetical protein Csa_3G119690 [Cucumis sativus]
Length=442

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 144/240 (60%), Positives = 187/240 (78%), Gaps = 11/240 (5%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAIS--------RNvkg  264
            MEA+NA  L+PL+VLS+R+ EP+KI  +PSS  FK  +  +    +S        ++++G
Sbjct  1    MEALNAASLSPLAVLSDRKREPKKIFPIPSSSSFKLPNFGSLNTNLSVPQGFCLSKSLQG  60

Query  265  glvllssvmssglAKALTYEEALQQ---TSVSTDFDPSGVMETVTTFAGDNpvivaggva  435
             L+LLSSV ++G++ ALTYEEALQQ   TS S D D +G+++ +  F  +NP IV GGV+
Sbjct  61   SLLLLSSVFNAGVSGALTYEEALQQSMTTSSSGDLDLNGILDGIVNFGTENPGIVVGGVS  120

Query  436  ilavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKK  615
            ILA+PL+ S    KPKPWGVESAK+AYAKL +D+NAQLLDIR   E+++VG+PD++GL K
Sbjct  121  ILALPLIFSLFQGKPKPWGVESAKSAYAKLGEDSNAQLLDIRSPIEIRKVGAPDLKGLGK  180

Query  616  KPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            KPV+++Y GEDKPGFLKKL LKFKEP+NTTLFILDK+DGSSELVAELVT NGFKAA+AIK
Sbjct  181  KPVSITYKGEDKPGFLKKLGLKFKEPQNTTLFILDKYDGSSELVAELVTVNGFKAAFAIK  240



>ref|XP_007135235.1| hypothetical protein PHAVU_010G112100g [Phaseolus vulgaris]
 gb|ESW07229.1| hypothetical protein PHAVU_010G112100g [Phaseolus vulgaris]
Length=439

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 140/236 (59%), Positives = 174/236 (74%), Gaps = 7/236 (3%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNE----PRKIpllpsslpfkslsssnsMEAISRNvkgglvl  276
            MEA+NA  LTPLSVLS+R+      P       S   F +   +     +S+++  GL L
Sbjct  1    MEALNAAALTPLSVLSDRKTTRKQPPVSACKGSSFSTFTNKKPTLLQSCLSKSLHSGLFL  60

Query  277  lssvmssglAKALTYEEALQQTSV---STDFDPSGVMETVTTFAGDNpvivaggvailav  447
             +S++S   A ALTYEEAL Q+     + DFD +G +E+VT FA +NP IVAGGVAILA+
Sbjct  61   AASLVSVDGASALTYEEALGQSLSLPDTGDFDVNGFVESVTGFATENPAIVAGGVAILAL  120

Query  448  pllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVT  627
            PL++SQ+  KPK WGVESAK AYAKL  D NAQLLDIR   E+++VGSPD+ GL+KK V+
Sbjct  121  PLVLSQVFKKPKAWGVESAKNAYAKLGADGNAQLLDIRALVEVRQVGSPDVGGLRKKAVS  180

Query  628  VSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            ++Y G+DK GFLKKL+LKFKEPENTTLFILDKFDG+SELVAELVT NGFKAAYA+K
Sbjct  181  IAYKGDDKSGFLKKLALKFKEPENTTLFILDKFDGNSELVAELVTVNGFKAAYAVK  236



>ref|XP_007135236.1| hypothetical protein PHAVU_010G112100g [Phaseolus vulgaris]
 gb|ESW07230.1| hypothetical protein PHAVU_010G112100g [Phaseolus vulgaris]
Length=451

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 140/236 (59%), Positives = 174/236 (74%), Gaps = 7/236 (3%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNE----PRKIpllpsslpfkslsssnsMEAISRNvkgglvl  276
            MEA+NA  LTPLSVLS+R+      P       S   F +   +     +S+++  GL L
Sbjct  1    MEALNAAALTPLSVLSDRKTTRKQPPVSACKGSSFSTFTNKKPTLLQSCLSKSLHSGLFL  60

Query  277  lssvmssglAKALTYEEALQQTSV---STDFDPSGVMETVTTFAGDNpvivaggvailav  447
             +S++S   A ALTYEEAL Q+     + DFD +G +E+VT FA +NP IVAGGVAILA+
Sbjct  61   AASLVSVDGASALTYEEALGQSLSLPDTGDFDVNGFVESVTGFATENPAIVAGGVAILAL  120

Query  448  pllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVT  627
            PL++SQ+  KPK WGVESAK AYAKL  D NAQLLDIR   E+++VGSPD+ GL+KK V+
Sbjct  121  PLVLSQVFKKPKAWGVESAKNAYAKLGADGNAQLLDIRALVEVRQVGSPDVGGLRKKAVS  180

Query  628  VSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            ++Y G+DK GFLKKL+LKFKEPENTTLFILDKFDG+SELVAELVT NGFKAAYA+K
Sbjct  181  IAYKGDDKSGFLKKLALKFKEPENTTLFILDKFDGNSELVAELVTVNGFKAAYAVK  236



>ref|XP_003528797.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
[Glycine max]
Length=444

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 144/237 (61%), Positives = 176/237 (74%), Gaps = 8/237 (3%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEA-----ISRNvkgglv  273
            MEA+NA  LTPLSVLS+R     K P + +       +S+N  +A     IS+ + GGL+
Sbjct  1    MEALNAAGLTPLSVLSDRTKTRTKHPSVSACKVSNFSTSTNKKQALLQSCISKTLHGGLI  60

Query  274  llssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvaila  444
            L +S ++ G A ALTY+EAL Q      + DFD +G +E+V  FA +NP IVAGGV +LA
Sbjct  61   LAASAVNGGAATALTYDEALGQPLSLPGTGDFDVNGFVESVAGFAAENPAIVAGGVVVLA  120

Query  445  vpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPV  624
            VPL++SQ+  KPK WGVESAK AYAKL  D NAQLLDIR   E+++VGSPD+ GLKKK V
Sbjct  121  VPLVLSQVFKKPKAWGVESAKNAYAKLGADGNAQLLDIRALVEIRQVGSPDVGGLKKKAV  180

Query  625  TVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            ++ Y G+DKPGFLKKL+LKFKEPENTTLFILDKFDG+SELVAELVT NGFKAAYAIK
Sbjct  181  SIPYKGDDKPGFLKKLALKFKEPENTTLFILDKFDGNSELVAELVTINGFKAAYAIK  237



>ref|XP_003548475.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
[Glycine max]
 gb|KHN15949.1| Hypothetical protein glysoja_013165 [Glycine soja]
Length=455

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 143/238 (60%), Positives = 176/238 (74%), Gaps = 9/238 (4%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSE----RRNEPR-KIpllpsslpfkslsssnsMEAISRNvkgglv  273
            MEA+NA  LTPLSVLS+    R   P   +  + +     +   +     IS+ + GGL+
Sbjct  1    MEALNAAGLTPLSVLSDAKTTRTKHPSVSVCKVSNFSTSTNKKQTLLQSCISKTLHGGLI  60

Query  274  llssvmssglAKALTYEEALQQ---TSVSTDFDPSGVMETVTTFAGDNpvivaggvaila  444
            L +SV++ G A ALTY+EAL Q      + DFD +G +E+VT FA +NP I+AGGVA+LA
Sbjct  61   LAASVVNGGAATALTYDEALGQPLSLPGAGDFDVNGFVESVTGFAAENPAILAGGVAVLA  120

Query  445  vpllvSQLL-SKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKP  621
            VPL++SQ+L  KPK WGVESAK AYAKL  D NAQLLDIR   E+++VGSPD+ GLKKK 
Sbjct  121  VPLVLSQVLFKKPKAWGVESAKNAYAKLGADGNAQLLDIRALVEIRQVGSPDVGGLKKKA  180

Query  622  VTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            V++ Y G+DKPGFLKKL+LKFKEPENTTLFILDKFDG+SELVAELVT NGFKAAYAIK
Sbjct  181  VSIPYKGDDKPGFLKKLALKFKEPENTTLFILDKFDGNSELVAELVTVNGFKAAYAIK  238



>ref|NP_567209.1| thylakoid rhodanese-like protein [Arabidopsis thaliana]
 sp|Q9M158.2|STR4_ARATH RecName: Full=Rhodanese-like domain-containing protein 4, chloroplastic; 
AltName: Full=Protein THYLAKOID RHODANESE-LIKE; 
AltName: Full=Sulfurtransferase 4; Short=AtStr4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL09804.1| AT4g01050/F2N1_31 [Arabidopsis thaliana]
 gb|AAL15331.1| AT4g01050/F2N1_31 [Arabidopsis thaliana]
 gb|AAM70579.1| AT4g01050/F2N1_31 [Arabidopsis thaliana]
 dbj|BAE98457.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE81973.1| thylakoid rhodanese-like protein [Arabidopsis thaliana]
Length=466

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 171/232 (74%), Gaps = 3/232 (1%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR-Nvkgglvllss  285
            MEA+     +P+SVLSE+R+EPRK   LP+  P KS    +    + R N    L+    
Sbjct  1    MEALKTATFSPMSVLSEKRSEPRKPFSLPNLFPPKSQRPISQESFLKRFNGGLALLTSVL  60

Query  286  vmssglAKALTYEEALQQT-SVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvS  462
              ++  AK+LTYEEALQQ+ + S+ FD  G++E ++ F  DNP+++AGGVA LAVP ++S
Sbjct  61   SSATAPAKSLTYEEALQQSMTTSSSFDSDGLIEGISNFVTDNPLVIAGGVAALAVPFVLS  120

Query  463  QLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  639
            Q+L+K PK WGVESAK AY KL  D NAQLLDIR   + ++VGSP+I+GL KK V+  YN
Sbjct  121  QVLNKKPKSWGVESAKNAYTKLGTDDNAQLLDIRATADFRQVGSPNIKGLGKKAVSTVYN  180

Query  640  GEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            GEDKPGFLKKLSLKFK+PENTTL+ILDKFDG+SELVAELV  NGFK+AYAIK
Sbjct  181  GEDKPGFLKKLSLKFKDPENTTLYILDKFDGNSELVAELVALNGFKSAYAIK  232



>ref|XP_010915675.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Elaeis guineensis]
Length=456

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 139/241 (58%), Positives = 175/241 (73%), Gaps = 12/241 (5%)
 Frame = +1

Query  109  MEAVNALRLTPLSV-----LSERRNEPRKIpllpsslpfkslsss--nsMEAISRN-vkg  264
            ME +NA  LTP+S+      SERR E +K      + P  S +    +  E +SR    G
Sbjct  1    MEVLNAAGLTPVSLHGTVGFSERRAESKKFFRFRLTKPSTSNAHPPFSLSELLSRGFAGG  60

Query  265  glvllssvmssglAKALTYEEALQQTS----VSTDFDPSGVMETVTTFAGDNpvivaggv  432
               L ++  + GLAKALTYEEAL Q+     VS DFD    ++ +  F  +NP++V GGV
Sbjct  61   LAALSAAPSAGGLAKALTYEEALGQSGSSFGVSADFDIGQFLDGIVKFGTENPLVVGGGV  120

Query  433  ailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLK  612
            A+LAVPL++S++L KPKPWGVESA+TAYAKL+DD +AQLLDIR  R+LKEVG PD+RGLK
Sbjct  121  AVLAVPLVLSRILQKPKPWGVESARTAYAKLSDDVDAQLLDIREGRDLKEVGKPDVRGLK  180

Query  613  KKPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAI  792
            KK V+++Y G DKPGFLKKL+LKFK+P NTTLF+LDKFDG+S+LVAELVT NGFKAAYAI
Sbjct  181  KKAVSITYRGNDKPGFLKKLALKFKDPGNTTLFVLDKFDGNSKLVAELVTANGFKAAYAI  240

Query  793  K  795
            K
Sbjct  241  K  241



>ref|XP_006286665.1| hypothetical protein CARUB_v10002584mg [Capsella rubella]
 gb|EOA19563.1| hypothetical protein CARUB_v10002584mg [Capsella rubella]
Length=472

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 172/232 (74%), Gaps = 3/232 (1%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR-Nvkgglvllss  285
            MEA+     +P+SVLSE+R+EPRK   LP+  P KS    +    + R N    L+    
Sbjct  1    MEALKTATFSPMSVLSEKRSEPRKPFSLPNLFPQKSPKPISQESFLKRFNGGLALLTSVL  60

Query  286  vmssglAKALTYEEALQQT-SVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvS  462
              ++  AK+LTYEEALQQ+ + S+ FD  G++E ++ F  DNP+++AGGVA LAVP ++S
Sbjct  61   SSATAPAKSLTYEEALQQSMTTSSSFDSDGLIEGISNFVTDNPLVIAGGVAALAVPFVLS  120

Query  463  QLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  639
            Q+L+K PK WGVESAK AY KL  D NAQLLDIR   ++++VGSP+I+GL KK V+  YN
Sbjct  121  QVLNKKPKAWGVESAKNAYTKLGTDDNAQLLDIRTTADVRQVGSPNIKGLGKKTVSTVYN  180

Query  640  GEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            G+DKPGFLKKLSLKFK+PENTTLFILDKFDG+SELVAELV  NGFK+AYAIK
Sbjct  181  GDDKPGFLKKLSLKFKDPENTTLFILDKFDGNSELVAELVALNGFKSAYAIK  232



>emb|CAB80914.1| hypothetical protein [Arabidopsis thaliana]
Length=457

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 171/232 (74%), Gaps = 3/232 (1%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR-Nvkgglvllss  285
            MEA+     +P+SVLSE+R+EPRK   LP+  P KS    +    + R N    L+    
Sbjct  42   MEALKTATFSPMSVLSEKRSEPRKPFSLPNLFPPKSQRPISQESFLKRFNGGLALLTSVL  101

Query  286  vmssglAKALTYEEALQQT-SVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvS  462
              ++  AK+LTYEEALQQ+ + S+ FD  G++E ++ F  DNP+++AGGVA LAVP ++S
Sbjct  102  SSATAPAKSLTYEEALQQSMTTSSSFDSDGLIEGISNFVTDNPLVIAGGVAALAVPFVLS  161

Query  463  QLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  639
            Q+L+K PK WGVESAK AY KL  D NAQLLDIR   + ++VGSP+I+GL KK V+  YN
Sbjct  162  QVLNKKPKSWGVESAKNAYTKLGTDDNAQLLDIRATADFRQVGSPNIKGLGKKAVSTVYN  221

Query  640  GEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            GEDKPGFLKKLSLKFK+PENTTL+ILDKFDG+SELVAELV  NGFK+AYAIK
Sbjct  222  GEDKPGFLKKLSLKFKDPENTTLYILDKFDGNSELVAELVALNGFKSAYAIK  273



>gb|KHN06295.1| Hypothetical protein glysoja_021133 [Glycine soja]
Length=441

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 166/234 (71%), Gaps = 5/234 (2%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvll--s  282
            MEA+NA  LTPLSVLS+R     K P + +       +S+N  +A+ ++     +     
Sbjct  1    MEALNAAGLTPLSVLSDRTKTRTKHPSVSACKVSNFSTSTNKKQALLQSCISKTLHGGLI  60

Query  283  svmssglAKALTYEEALQQ---TSVSTDFDPSGVMETVTTFAGDNpvivaggvailavpl  453
               S     ALTY+EAL Q      + DFD +G +E+V  FA +NP IVAGGV +LAVPL
Sbjct  61   LAASVVNGAALTYDEALGQPLSLPGTGDFDVNGFVESVAGFAAENPAIVAGGVVVLAVPL  120

Query  454  lvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVS  633
            ++SQ+  KPK WGVESAK AYAKL  D NAQLLDIR   E+++VGSPD+ GLKKK V++ 
Sbjct  121  VLSQVFKKPKAWGVESAKNAYAKLGADGNAQLLDIRALVEIRQVGSPDVGGLKKKAVSIP  180

Query  634  YNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            Y G+DKPGFLKKL+LKFKEPENTTLFILDKFDG+SELVAELVT NGFKAAYAIK
Sbjct  181  YKGDDKPGFLKKLALKFKEPENTTLFILDKFDGNSELVAELVTINGFKAAYAIK  234



>ref|XP_010427922.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Camelina sativa]
Length=476

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 136/232 (59%), Positives = 172/232 (74%), Gaps = 3/232 (1%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR-Nvkgglvllss  285
            MEA+     +P+SVLSE+R+EPRK   LP+  P KS    +    + R N    L+    
Sbjct  1    MEALKTATFSPMSVLSEKRSEPRKPFTLPNLFPQKSSKPISQENFLRRFNGGLALLTSVL  60

Query  286  vmssglAKALTYEEALQQTSVSTD-FDPSGVMETVTTFAGDNpvivaggvailavpllvS  462
              ++  AK+LTYEEALQQ++ ++  FD  G++E ++ F  DNP+++AGGVA LAVP ++S
Sbjct  61   SSATAPAKSLTYEEALQQSTTTSSSFDSDGLIEGISNFVTDNPLVIAGGVAALAVPFVLS  120

Query  463  QLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  639
            Q+L+K PK WGVESAK AYAKL  D NAQLLDIR   +L++VGSP+I+GL KK V+  YN
Sbjct  121  QVLNKKPKAWGVESAKNAYAKLGTDDNAQLLDIRATADLRQVGSPNIKGLGKKAVSTVYN  180

Query  640  GEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            GEDKPGFLKKLSLKFK+PENTTL+ILDKFDG+SELVAELV  NGFK AYAIK
Sbjct  181  GEDKPGFLKKLSLKFKDPENTTLYILDKFDGNSELVAELVALNGFKTAYAIK  232



>ref|XP_008783830.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Phoenix dactylifera]
Length=456

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 138/241 (57%), Positives = 174/241 (72%), Gaps = 12/241 (5%)
 Frame = +1

Query  109  MEAVNALRLTPLS-----VLSERRNEPRKIpllpsslpfkslsssn--sMEAISRN-vkg  264
            ME +NA  LTP+S     + SER+ EP+K+     + P  S +     S E +SR    G
Sbjct  1    MEVLNAAGLTPVSLHKTVISSERKAEPKKLFPFRLARPSTSDAHPPFPSSELLSRGFAGG  60

Query  265  glvllssvmssglAKALTYEEALQQTSVS----TDFDPSGVMETVTTFAGDNpvivaggv  432
               L ++  + GLAKALTYEEAL QT  S      FD    ++ +  F   NP++V GGV
Sbjct  61   LAALSAAPCAGGLAKALTYEEALGQTDFSFGGSASFDIGQFLDGIVKFGAANPLVVGGGV  120

Query  433  ailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLK  612
            A+LAVPL++S++L KPKPWGVESA+TA+AKL+DD +AQLLDIR  R+ KEVGSPD+RGLK
Sbjct  121  AVLAVPLVLSRILQKPKPWGVESARTAFAKLSDDVDAQLLDIREGRDFKEVGSPDVRGLK  180

Query  613  KKPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAI  792
            KK V+++Y G DKPGFLKKL+LKFK+P NTTLF+LDKFDG+SELVAELVT NGFKAAYAI
Sbjct  181  KKAVSITYRGNDKPGFLKKLALKFKDPANTTLFVLDKFDGNSELVAELVTANGFKAAYAI  240

Query  793  K  795
            +
Sbjct  241  R  241



>ref|XP_004516405.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
[Cicer arietinum]
Length=480

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 140/242 (58%), Positives = 179/242 (74%), Gaps = 13/242 (5%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssns-------MEAISRNvkgg  267
            MEA+N+   TPL VLS+R  +P+KI   P+    K  + S S        E +SRN + G
Sbjct  1    MEALNSTIYTPLCVLSDRTKQPKKISSHPAISTSKVSNFSTSNNRKHNLRECLSRNFQKG  60

Query  268  lvllssvmssgl-----AKALTYEEALQQTSVST-DFDPSGVMETVTTFAGDNpvivagg  429
            L+L +SV++  +     A ALTYEEALQQ+ +S  D D +G ++++ +FA +NP I+AGG
Sbjct  61   LILAASVVNVNVNVNGFANALTYEEALQQSPISGGDIDVNGFVDSLISFATENPAILAGG  120

Query  430  vailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGL  609
            VAILAVPL++SQ+L +PK WGVESAK AYAKL  D NA+LLDIR   E++ VG P++ GL
Sbjct  121  VAILAVPLVLSQILKEPKKWGVESAKNAYAKLGADGNAELLDIRGLSEIRTVGGPNVGGL  180

Query  610  KKKPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYA  789
            KKK V+++Y  +DKPGFLKKLSLKFKEPENTTLFILDKFDG+SELVAELVT NGFK+AY 
Sbjct  181  KKKSVSIAYKSDDKPGFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVTLNGFKSAYG  240

Query  790  IK  795
            IK
Sbjct  241  IK  242



>gb|ACJ86240.1| unknown [Medicago truncatula]
Length=480

 Score =   208 bits (530),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 169/237 (71%), Gaps = 8/237 (3%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSER--RNEPRKIpllpsslpfkslsssnsMEAISRNvkgg---lv  273
            MEA+N+  LTPLSVLS+R     P K     S+         N  E +S+N + G     
Sbjct  1    MEALNSTILTPLSVLSDRTKHKHPTKFSCKASNFSTSINKKQNLREFLSKNFQKGLFLAA  60

Query  274  llssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvaila  444
             + +V +   A ALTYEEAL Q+   S   D D +G +++V  FA +NPVI+AGGVAILA
Sbjct  61   SVVNVNNGEFANALTYEEALGQSPSASGGGDIDVNGFVDSVIGFATENPVILAGGVAILA  120

Query  445  vpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPV  624
            VPL++SQ+L KPK WGVESAK AYAKL  D NAQLLDIR   E+++VG P++ GLKKK V
Sbjct  121  VPLVLSQILKKPKAWGVESAKNAYAKLGADGNAQLLDIRGLAEIRQVGGPNVGGLKKKAV  180

Query  625  TVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             V+Y G+DKP FLKKLSLKFKEPENTTLFILDKFDG+SELVAELVT NGFK+AYAIK
Sbjct  181  AVTYKGDDKPVFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVTLNGFKSAYAIK  237



>gb|KEH18685.1| thylakoid rhodanese-like protein [Medicago truncatula]
Length=482

 Score =   208 bits (530),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 169/237 (71%), Gaps = 8/237 (3%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSER--RNEPRKIpllpsslpfkslsssnsMEAISRNvkgg---lv  273
            MEA+N+  LTPLSVLS+R     P K     S+         N  E +S+N + G     
Sbjct  1    MEALNSTILTPLSVLSDRTKHKHPTKFSCKASNFSTSINKKQNLREFLSKNFQKGLFLAA  60

Query  274  llssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvaila  444
             + +V +   A ALTYEEAL Q+   S   D D +G +++V  FA +NPVI+AGGVAILA
Sbjct  61   SVVNVNNGEFANALTYEEALGQSPSASGGGDIDVNGFVDSVIGFATENPVILAGGVAILA  120

Query  445  vpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPV  624
            VPL++SQ+L KPK WGVESAK AYAKL  D NAQLLDIR   E+++VG P++ GLKKK V
Sbjct  121  VPLVLSQILKKPKAWGVESAKNAYAKLGADGNAQLLDIRGLAEIRQVGGPNVGGLKKKAV  180

Query  625  TVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             V+Y G+DKP FLKKLSLKFKEPENTTLFILDKFDG+SELVAELVT NGFK+AYAIK
Sbjct  181  AVTYKGDDKPVFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVTLNGFKSAYAIK  237



>ref|XP_006396307.1| hypothetical protein EUTSA_v10028649mg [Eutrema salsugineum]
 gb|ESQ37760.1| hypothetical protein EUTSA_v10028649mg [Eutrema salsugineum]
Length=447

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 131/233 (56%), Positives = 166/233 (71%), Gaps = 5/233 (2%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR--Nvkgglvlls  282
            MEA+      P+SVLSE+R+EPRK P     L         S E+  R  N    L+   
Sbjct  1    MEALKTASFCPMSVLSEKRSEPRK-PFSLPKLFTPKSPKPISHESFFRSFNGGLALLTSV  59

Query  283  svmssglAKALTYEEALQQTSVS-TDFDPSGVMETVTTFAGDNpvivaggvailavpllv  459
               ++  AK+LTYEEALQQ+  S + FD  G ++ +++F  DNP+++AGG A  AVP ++
Sbjct  60   LSSATAPAKSLTYEEALQQSMTSPSSFDSDGFIDGISSFVTDNPLVIAGGFAAFAVPFVL  119

Query  460  SQLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY  636
            SQ+L+K PK +GVESAK AYAKL  D NAQLLDIR + + ++VG+P+I+GL KK V+  Y
Sbjct  120  SQVLNKKPKSFGVESAKNAYAKLGTDENAQLLDIRASADFRQVGTPNIKGLGKKTVSTVY  179

Query  637  NGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            NGEDKPGFLKKLSLKFK+PENTTLFILDKFDG+SELVAELV  NGFK+AYAIK
Sbjct  180  NGEDKPGFLKKLSLKFKDPENTTLFILDKFDGNSELVAELVALNGFKSAYAIK  232



>ref|XP_009421248.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=486

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 163/239 (68%), Gaps = 28/239 (12%)
 Frame = +1

Query  103  YAMEAVNALRLTPLSVLS------ERRNEPRKIpllpsslpfkslsssnsMEAISRNvkg  264
            YAM+ +NA  L P++ L       ERR EPR++                 + A+S     
Sbjct  67   YAMQVLNAAGLAPVASLHKATPSLERRPEPRRLLQFRLPK----------LAALS-----  111

Query  265  glvllssvmssglAKALTYEEALQQT--SVSTDFDPSGVMETVTTFAGDNpvivaggvai  438
                 S   + GLAKALTYE+AL QT  S S DFD  G+++ +  F  +NP+++ GG  +
Sbjct  112  -----SIFGAGGLAKALTYEQALDQTVGSSSLDFDVGGLLDGIVNFGTENPLLLGGGALV  166

Query  439  lavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKK  618
            LAVPL++SQ+L KPK WG+ SAK+AYAKL++D NAQLLDIR  ++ KEVG PD+RGLKKK
Sbjct  167  LAVPLILSQILKKPKNWGLASAKSAYAKLSEDGNAQLLDIREGKDFKEVGRPDLRGLKKK  226

Query  619  PVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             V ++Y GEDKPGFLKKL  KFK+P NTTLFILDKFDG SELVAELVT NGFKAAYAIK
Sbjct  227  AVAIAYKGEDKPGFLKKLESKFKDPTNTTLFILDKFDGKSELVAELVTVNGFKAAYAIK  285



>ref|XP_006396308.1| hypothetical protein EUTSA_v10028649mg [Eutrema salsugineum]
 gb|ESQ37761.1| hypothetical protein EUTSA_v10028649mg [Eutrema salsugineum]
Length=454

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 131/233 (56%), Positives = 166/233 (71%), Gaps = 5/233 (2%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR--Nvkgglvlls  282
            MEA+      P+SVLSE+R+EPRK P     L         S E+  R  N    L+   
Sbjct  1    MEALKTASFCPMSVLSEKRSEPRK-PFSLPKLFTPKSPKPISHESFFRSFNGGLALLTSV  59

Query  283  svmssglAKALTYEEALQQTSVS-TDFDPSGVMETVTTFAGDNpvivaggvailavpllv  459
               ++  AK+LTYEEALQQ+  S + FD  G ++ +++F  DNP+++AGG A  AVP ++
Sbjct  60   LSSATAPAKSLTYEEALQQSMTSPSSFDSDGFIDGISSFVTDNPLVIAGGFAAFAVPFVL  119

Query  460  SQLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY  636
            SQ+L+K PK +GVESAK AYAKL  D NAQLLDIR + + ++VG+P+I+GL KK V+  Y
Sbjct  120  SQVLNKKPKSFGVESAKNAYAKLGTDENAQLLDIRASADFRQVGTPNIKGLGKKTVSTVY  179

Query  637  NGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            NGEDKPGFLKKLSLKFK+PENTTLFILDKFDG+SELVAELV  NGFK+AYAIK
Sbjct  180  NGEDKPGFLKKLSLKFKDPENTTLFILDKFDGNSELVAELVALNGFKSAYAIK  232



>ref|XP_010669158.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=469

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 181/240 (75%), Gaps = 15/240 (6%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssns-------MEAISRNvkgg  267
            ME++NAL+L P+ VL ++R +PRK P +P+    K    S +        E ++R   G 
Sbjct  1    MESLNALQLKPICVLPDQRGKPRKFPQIPTLPSLKFPQFSTNKVNPPNFTEDLARKFHGS  60

Query  268  lvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvai  438
            LVLL+S  S+ +A ALTYEEA+ Q+   + + DFD   V+ET+      NP+I+AGGVA+
Sbjct  61   LVLLASAFSAQVAGALTYEEAISQSVNENPAADFDAGSVVETIV----QNPLIIAGGVAV  116

Query  439  lavpllvSQLL-SKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKK  615
            +AVPL++SQ+  SKPKP+GV+ AK AYAKLA+D NAQLLDIR  +E KEVGSPDIRGLKK
Sbjct  117  IAVPLVLSQVFGSKPKPFGVQPAKAAYAKLAEDPNAQLLDIRSLKESKEVGSPDIRGLKK  176

Query  616  KPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            K ++V Y GEDKPGFL+KLSLKFK+PENTTL+ILDKFDG+SELVAELVT NGFK+AYAIK
Sbjct  177  KAISVVYRGEDKPGFLQKLSLKFKDPENTTLYILDKFDGNSELVAELVTANGFKSAYAIK  236



>gb|AAB61039.1| A_IG002N01.31 gene product [Arabidopsis thaliana]
Length=968

 Score =   211 bits (538),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 171/233 (73%), Gaps = 3/233 (1%)
 Frame = +1

Query  106  AMEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR-Nvkgglvlls  282
             MEA+     +P+SVLSE+R+EPRK   LP+  P KS    +    + R N    L+   
Sbjct  510  VMEALKTATFSPMSVLSEKRSEPRKPFSLPNLFPPKSQRPISQESFLKRFNGGLALLTSV  569

Query  283  svmssglAKALTYEEALQQT-SVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllv  459
               ++  AK+LTYEEALQQ+ + S+ FD  G++E ++ F  DNP+++AGGVA LAVP ++
Sbjct  570  LSSATAPAKSLTYEEALQQSMTTSSSFDSDGLIEGISNFVTDNPLVIAGGVAALAVPFVL  629

Query  460  SQLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY  636
            SQ+L+K PK WGVESAK AY KL  D NAQLLDIR   + ++VGSP+I+GL KK V+  Y
Sbjct  630  SQVLNKKPKSWGVESAKNAYTKLGTDDNAQLLDIRATADFRQVGSPNIKGLGKKAVSTVY  689

Query  637  NGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            NGEDKPGFLKKLSLKFK+PENTTL+ILDKFDG+SELVAELV  NGFK+AYAIK
Sbjct  690  NGEDKPGFLKKLSLKFKDPENTTLYILDKFDGNSELVAELVALNGFKSAYAIK  742



>ref|XP_010456200.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Camelina sativa]
Length=530

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 171/232 (74%), Gaps = 3/232 (1%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR-Nvkgglvllss  285
            MEA+     +P+SVLSE+R+EPRK   LP+  P KS    +    + R N    L+    
Sbjct  55   MEALKTATFSPMSVLSEKRSEPRKPFTLPNLFPQKSPQPISQESFLRRFNGGLALLTSVL  114

Query  286  vmssglAKALTYEEALQQTSVSTD-FDPSGVMETVTTFAGDNpvivaggvailavpllvS  462
              ++  AK+LTYEEALQQ++ ++  FD  G++E ++ F  DNP+++AGGVA LAVP ++S
Sbjct  115  SSATAPAKSLTYEEALQQSTTTSSSFDSDGLIEGISNFVTDNPLVIAGGVAALAVPFVLS  174

Query  463  QLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  639
            Q+L+K PK WGVESAK AY KL  D NAQLLDIR   +L++VGSP+I+GL KK V+  YN
Sbjct  175  QVLNKKPKAWGVESAKNAYTKLGTDDNAQLLDIRATADLRQVGSPNIKGLGKKTVSTVYN  234

Query  640  GEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            GEDKPGFLKKLSLKFK+PENTTL+ILDK+DG+SELVAELV  NGFK AYAIK
Sbjct  235  GEDKPGFLKKLSLKFKDPENTTLYILDKYDGNSELVAELVALNGFKTAYAIK  286



>ref|XP_010422759.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Camelina sativa]
Length=603

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 171/232 (74%), Gaps = 3/232 (1%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR-Nvkgglvllss  285
            MEA+     TP+SVLSE+R+EPRK   LP+  P KS    +    + R N    L+    
Sbjct  128  MEALKTATFTPMSVLSEKRSEPRKPFTLPNLFPQKSPRPISQENFLRRFNGGLALLTSVL  187

Query  286  vmssglAKALTYEEALQQTSVSTD-FDPSGVMETVTTFAGDNpvivaggvailavpllvS  462
              ++  AK+LTYEEALQQ++ ++  FD  G++E ++ F  DNP+++AGGVA LAVP ++S
Sbjct  188  TSATAPAKSLTYEEALQQSTTTSSSFDSDGLIEGISNFVTDNPLVIAGGVAALAVPFVLS  247

Query  463  QLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  639
            Q+L+K PK WGVESAK AY KL  D NAQLLDIR   +L++VGSP+I+GL KK V+  YN
Sbjct  248  QVLNKKPKAWGVESAKNAYTKLGTDDNAQLLDIRATADLRQVGSPNIKGLGKKAVSTVYN  307

Query  640  GEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            G+DKPGFLKKLSLKFK+PENTTL+ILDKFDG+SELVAELV  NGFK AYAIK
Sbjct  308  GDDKPGFLKKLSLKFKDPENTTLYILDKFDGNSELVAELVALNGFKTAYAIK  359



>gb|KJB49531.1| hypothetical protein B456_008G124200 [Gossypium raimondii]
Length=415

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 136/164 (83%), Gaps = 2/164 (1%)
 Frame = +1

Query  304  AKALTYEEALQQTSVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvSQLLSKPK  483
            AKAL+Y+EALQQT+  T F   GV+++V  F  DNP +VAGG   LAVPL++SQ+L   K
Sbjct  62   AKALSYDEALQQTT--TSFSSDGVLDSVVNFISDNPTVVAGGAVALAVPLILSQVLKGSK  119

Query  484  PWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFL  663
            PWG+E+A++AY KL +D NAQLLDIR  +E K+VGSPDI+G  KKPV++++NGEDK GFL
Sbjct  120  PWGIETARSAYGKLGEDPNAQLLDIRGPKEFKDVGSPDIKGFGKKPVSIAFNGEDKLGFL  179

Query  664  KKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            KKL LKFKEPENTTLFI+DKF+G+SELVAELVT NGFKAAYAIK
Sbjct  180  KKLDLKFKEPENTTLFIIDKFNGNSELVAELVTVNGFKAAYAIK  223



>gb|KHG21564.1| hypothetical protein F383_26582 [Gossypium arboreum]
Length=420

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 135/164 (82%), Gaps = 2/164 (1%)
 Frame = +1

Query  304  AKALTYEEALQQTSVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvSQLLSKPK  483
            AKAL+Y+EALQQT+  T F   GV+ +V  F  DNP +VAGG   LAVPL++SQ+L   K
Sbjct  67   AKALSYDEALQQTT--TSFSSDGVLHSVVNFISDNPTVVAGGAVALAVPLILSQVLKGSK  124

Query  484  PWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFL  663
            PWG+E+A++AY KL +D NAQLLDIR  +E K+VGSPDI+G  KKPV++++NGEDK GFL
Sbjct  125  PWGIETARSAYGKLGEDPNAQLLDIRGPKEFKDVGSPDIKGFGKKPVSIAFNGEDKLGFL  184

Query  664  KKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            KKL LKFKEPENTTLFI+DKF+G+SELVAELVT NGFKAAYAIK
Sbjct  185  KKLDLKFKEPENTTLFIIDKFNGNSELVAELVTVNGFKAAYAIK  228



>ref|XP_009111413.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Brassica rapa]
Length=458

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 171/231 (74%), Gaps = 4/231 (2%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvllssv  288
            MEA+     +P+SVLSE+R+EPR+   LP+  P K +S  + +   S N    L+     
Sbjct  1    MEALKTASFSPMSVLSEKRSEPRRPFSLPTLFPPKPISQESFLR--SFNGGLALLTSVLS  58

Query  289  mssglAKALTYEEALQQTSVS-TDFDPSGVMETVTTFAGDNpvivaggvailavpllvSQ  465
             ++  AK+LTYEEALQQ+  S + FD  G ++ ++TF  DNP+++AGGVA  AVP ++SQ
Sbjct  59   SATAPAKSLTYEEALQQSVTSPSSFDSDGFIDGISTFVTDNPLVIAGGVAAFAVPFVLSQ  118

Query  466  LLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNG  642
            +L+K PK +GVESAK AY KL  D  AQLLDIR A + ++VGSP+I+GL KK V+V YNG
Sbjct  119  VLNKKPKSFGVESAKNAYTKLGTDETAQLLDIRAAADSRQVGSPNIKGLGKKTVSVVYNG  178

Query  643  EDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            EDK GFLKKLSLKFK+PENTTLFILDKFDG+SELVAELV+ NGFK+AYA+K
Sbjct  179  EDKDGFLKKLSLKFKDPENTTLFILDKFDGNSELVAELVSLNGFKSAYAVK  229



>ref|XP_008437912.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Cucumis melo]
Length=442

 Score =   202 bits (514),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 186/240 (78%), Gaps = 11/240 (5%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAIS--------RNvkg  264
            MEA+NA  L+PL+VLS+R+ EP+KI  +PSS  FK  +  +    +S        R+++G
Sbjct  1    MEALNAASLSPLAVLSDRKREPKKISPIPSSSSFKLPNFGSLNTNLSVPQGFCLSRSLQG  60

Query  265  glvllssvmssglAKALTYEEALQQ---TSVSTDFDPSGVMETVTTFAGDNpvivaggva  435
             L+LLSS  ++G++ ALTY+EALQQ   TS S D D +G+++ +  F  +NP IV GGV+
Sbjct  61   SLLLLSSAFNAGVSGALTYDEALQQSMTTSSSGDLDLNGILDGIVNFGTENPGIVVGGVS  120

Query  436  ilavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKK  615
            ILA+PL+ S    K KPWGVESAK+AYAKL++D+NAQLLDIR   E+++VG+PD++GL K
Sbjct  121  ILALPLIFSLFQGKSKPWGVESAKSAYAKLSEDSNAQLLDIRSPVEIRKVGAPDLKGLGK  180

Query  616  KPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            KPV+++Y GEDKPGFLKKL LKFKEP+NTTLFILDK+DGSSELVAELVT NGFKAA+AIK
Sbjct  181  KPVSIAYKGEDKPGFLKKLGLKFKEPQNTTLFILDKYDGSSELVAELVTVNGFKAAFAIK  240



>emb|CDY07169.1| BnaCnng01840D [Brassica napus]
Length=498

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 171/231 (74%), Gaps = 4/231 (2%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvllssv  288
            MEA+     +P++VLSE+R+EPR+   LP+  P K +S  + + +   N    L+     
Sbjct  43   MEALRTASFSPIAVLSEKRSEPRRPFSLPTLFPPKPISQESFLRSF--NGGLALLTSVLS  100

Query  289  mssglAKALTYEEALQQTSVS-TDFDPSGVMETVTTFAGDNpvivaggvailavpllvSQ  465
             ++  AK+LTYEEALQQ+  S + FD  G ++ ++TF  DNP+++AGGVA  AVP ++SQ
Sbjct  101  GATAPAKSLTYEEALQQSVTSPSSFDSDGFIDGISTFVTDNPLVIAGGVAAFAVPFVLSQ  160

Query  466  LLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNG  642
            +L+K PK +GVESAK AY KL  D  AQLLDIR A + ++VGSP+I+GL KK V+V YNG
Sbjct  161  VLNKKPKSFGVESAKNAYTKLGTDETAQLLDIRAAADSRQVGSPNIKGLGKKTVSVVYNG  220

Query  643  EDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            EDK GFLKKLSLKFK+PENTTLFILDKFDG+SELVAELVT NGFK+AYA+K
Sbjct  221  EDKDGFLKKLSLKFKDPENTTLFILDKFDGNSELVAELVTLNGFKSAYAVK  271



>emb|CDX74366.1| BnaA03g26810D [Brassica napus]
Length=466

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 169/233 (73%), Gaps = 5/233 (2%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR--Nvkgglvlls  282
            MEA+     +P SVLS++R+E RK P    SL         S E++ R  N    L+   
Sbjct  1    MEALKTASFSPTSVLSDKRSETRK-PFSLPSLFPPKPPKPISQESLFRSFNGGLALLTSV  59

Query  283  svmssglAKALTYEEALQQTSVS-TDFDPSGVMETVTTFAGDNpvivaggvailavpllv  459
               ++  AK+LTYEEALQQ++ S + FD  G+++ +++F  DNP+++AGGVA  AVP ++
Sbjct  60   LSSATAPAKSLTYEEALQQSTTSPSSFDSDGLIDGISSFVTDNPLVIAGGVAAFAVPFVL  119

Query  460  SQLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY  636
            SQ+L+K PK +GVESAK AY  L  D NAQLLDIR A +L++VGSP+I+GL KK V+  Y
Sbjct  120  SQVLNKKPKSFGVESAKNAYTNLGTDENAQLLDIRAAADLRQVGSPNIKGLGKKTVSAVY  179

Query  637  NGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            NGEDKPGFLKKLSLKFK+PENTTLFILDKFDG+SELVAELV  NGFK+AYAIK
Sbjct  180  NGEDKPGFLKKLSLKFKDPENTTLFILDKFDGNSELVAELVALNGFKSAYAIK  232



>ref|XP_009134504.1| PREDICTED: LOW QUALITY PROTEIN: rhodanese-like domain-containing 
protein 4, chloroplastic [Brassica rapa]
Length=527

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 133/233 (57%), Positives = 170/233 (73%), Gaps = 5/233 (2%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR--Nvkgglvlls  282
            MEA+     +P SVLS++R+E RK P    SL         S E++ R  N    L+   
Sbjct  1    MEALKTASFSPTSVLSDKRSETRK-PFSLPSLFPPKPPKPISQESLFRSFNGGLALLTSV  59

Query  283  svmssglAKALTYEEALQQTSVS-TDFDPSGVMETVTTFAGDNpvivaggvailavpllv  459
               ++  AK+LTYEEALQQ++ S + FD  G+++ +++F  DNP+++AGGVA  AVP ++
Sbjct  60   LSSATAPAKSLTYEEALQQSTTSPSSFDSDGLIDGISSFVTDNPLVIAGGVAAFAVPFVL  119

Query  460  SQLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY  636
            SQ+L+K PK +GVESAK AY KL  D NAQLLDIR A +L++VGSP+I+GL KK V+  Y
Sbjct  120  SQVLNKKPKTFGVESAKNAYTKLGTDENAQLLDIRAAADLRQVGSPNIKGLGKKTVSAVY  179

Query  637  NGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            NGEDKPGFLKKLSLKFK+PENTTLFILDKFDG+SELVAELV  NGFK+AYAIK
Sbjct  180  NGEDKPGFLKKLSLKFKDPENTTLFILDKFDGNSELVAELVALNGFKSAYAIK  232



>ref|XP_008350777.1| PREDICTED: LOW QUALITY PROTEIN: rhodanese-like domain-containing 
protein 4, chloroplastic [Malus domestica]
Length=420

 Score =   198 bits (504),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 174/232 (75%), Gaps = 4/232 (2%)
 Frame = +1

Query  109  MEAVNALRLTPL-SVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvllss  285
            MEA++A  LTP+ S+L +R+  P  +P +         S   S E+ SR+  GGL LLSS
Sbjct  1    MEALHAASLTPIRSLLGDRKKIP-SLPSISVPKFSNPTSLRASQESSSRSFHGGLPLLSS  59

Query  286  vmssglAKALTYEEALQQT--SVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllv  459
            V ++G AKALTYEEAL Q+      D +  GV++ V +F  DNP ++AGG A+LAVPL++
Sbjct  60   VFNAGFAKALTYEEALGQSVSGGGGDLEVGGVLDNVISFVTDNPAVIAGGFAVLAVPLVL  119

Query  460  SQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  639
            SQ+L  PKP+GV+SA++AYAKL +DANAQLLDIRP  E ++VG+PD++GL KK V++ Y 
Sbjct  120  SQVLKPPKPFGVDSARSAYAKLGEDANAQLLDIRPPAEFRQVGTPDVKGLGKKAVSIVYK  179

Query  640  GEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             EDKPGFLKKLSLKFKEPENTTLFILDKFDG+SEL AELV  NGFKAAYAIK
Sbjct  180  SEDKPGFLKKLSLKFKEPENTTLFILDKFDGNSELAAELVAVNGFKAAYAIK  231



>emb|CDY48498.1| BnaA09g00250D [Brassica napus]
Length=461

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 168/233 (72%), Gaps = 5/233 (2%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR--Nvkgglvlls  282
            MEA+     +P+SVLS++R+EPR+ P    SL         S E+  R  N    L+   
Sbjct  1    MEALKTASFSPMSVLSDKRSEPRR-PFSLPSLFPPKTPKPISQESFFRSFNGGLALLTSV  59

Query  283  svmssglAKALTYEEALQQTSVS-TDFDPSGVMETVTTFAGDNpvivaggvailavpllv  459
               ++  AK+LTYEEALQQ+  S + FD  G ++ +++F  DNP+++AGGVA  AVP ++
Sbjct  60   LSSATAPAKSLTYEEALQQSVTSPSSFDSDGFIDGISSFVTDNPLVIAGGVAAFAVPFVL  119

Query  460  SQLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY  636
            SQ+L+K PK +GVESAK AY KL  D  AQLLDIR A + ++VGSP+I+GL KK V+V Y
Sbjct  120  SQVLNKKPKSFGVESAKNAYTKLGTDETAQLLDIRAAADSRQVGSPNIKGLGKKTVSVVY  179

Query  637  NGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            NGEDK GFLKKLSLKFK+PENTTLFILDKFDG+SELVAELV+ NGFK+AYA+K
Sbjct  180  NGEDKDGFLKKLSLKFKDPENTTLFILDKFDGNSELVAELVSLNGFKSAYAVK  232



>ref|XP_009336810.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
isoform X3 [Pyrus x bretschneideri]
Length=421

 Score =   197 bits (500),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 172/233 (74%), Gaps = 5/233 (2%)
 Frame = +1

Query  109  MEAVNALRLTPL-SVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvllss  285
            MEA++A  LTP+ S+L +R+  P  +P +         S   S E+ SR+  GGL+LLSS
Sbjct  1    MEALHAASLTPIRSLLGDRKKIP-SLPSISVPKFSNPTSLRASQESSSRSFHGGLLLLSS  59

Query  286  vmssglAKALTYEEALQQ---TSVSTDFDPSGVMETVTTFAGDNpvivaggvailavpll  456
            V ++G AKALTYEEAL Q             G ++ V +F  DNP ++AGG A+LAVPL+
Sbjct  60   VFNAGFAKALTYEEALGQFVSGGGGDLEVGGGALDNVISFVTDNPAVIAGGFAVLAVPLV  119

Query  457  vSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY  636
            +SQ+L  PKP+GV+SA++AYAKL +DANAQLLDIRP  E ++VG+PD++GL KK V++ Y
Sbjct  120  LSQVLKPPKPFGVDSARSAYAKLGEDANAQLLDIRPPAEFRQVGTPDVKGLGKKAVSIVY  179

Query  637  NGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
              EDKPGFLKKLSLKFKEPENTTLFILDKFDG+SELVAELV  NGFKAAYAIK
Sbjct  180  KREDKPGFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVAVNGFKAAYAIK  232



>ref|XP_010534211.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Tarenaya hassleriana]
Length=430

 Score =   196 bits (499),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 170/236 (72%), Gaps = 8/236 (3%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISRN---vkgglvll  279
            MEA+     +P+SVLSE+R+EPR++  LPS    KS    +  E+  R+       L   
Sbjct  1    MEALKTASFSPISVLSEKRSEPRRLAWLPSLSSPKSPRPIS-QESFLRSFNGGLALLTSA  59

Query  280  ssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvailavp  450
             S  ++  AKALTYEEALQQ+   S S+ F+  G+++ +  F  +NP+++AGGVA+LAVP
Sbjct  60   LSSAATPAAKALTYEEALQQSVTSSSSSPFESDGLVDGIVGFVTENPLVIAGGVAVLAVP  119

Query  451  llvSQLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVT  627
             ++ Q+LSK PK WGVESAK+AY KL  D NAQL+DIR   E ++VG+PDI+GL K+PVT
Sbjct  120  WVLFQVLSKKPKSWGVESAKSAYTKLGTDENAQLVDIRSPGEARQVGTPDIKGLGKRPVT  179

Query  628  VSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            V Y GEDK GFLKKLSLKFKEP NTTLFILDK DG+SELVAELV  NGFKAAYAIK
Sbjct  180  VVYKGEDKTGFLKKLSLKFKEPGNTTLFILDKLDGNSELVAELVALNGFKAAYAIK  235



>ref|XP_009336808.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009336809.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=441

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 172/233 (74%), Gaps = 5/233 (2%)
 Frame = +1

Query  109  MEAVNALRLTPL-SVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvllss  285
            MEA++A  LTP+ S+L +R+  P  +P +         S   S E+ SR+  GGL+LLSS
Sbjct  1    MEALHAASLTPIRSLLGDRKKIP-SLPSISVPKFSNPTSLRASQESSSRSFHGGLLLLSS  59

Query  286  vmssglAKALTYEEALQQ---TSVSTDFDPSGVMETVTTFAGDNpvivaggvailavpll  456
            V ++G AKALTYEEAL Q             G ++ V +F  DNP ++AGG A+LAVPL+
Sbjct  60   VFNAGFAKALTYEEALGQFVSGGGGDLEVGGGALDNVISFVTDNPAVIAGGFAVLAVPLV  119

Query  457  vSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY  636
            +SQ+L  PKP+GV+SA++AYAKL +DANAQLLDIRP  E ++VG+PD++GL KK V++ Y
Sbjct  120  LSQVLKPPKPFGVDSARSAYAKLGEDANAQLLDIRPPAEFRQVGTPDVKGLGKKAVSIVY  179

Query  637  NGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
              EDKPGFLKKLSLKFKEPENTTLFILDKFDG+SELVAELV  NGFKAAYAIK
Sbjct  180  KREDKPGFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVAVNGFKAAYAIK  232



>gb|KFK30681.1| hypothetical protein AALP_AA6G014200 [Arabis alpina]
Length=465

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 131/233 (56%), Positives = 169/233 (73%), Gaps = 4/233 (2%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR--Nvkgglvlls  282
            MEA+     TP+SVLSE+R+EPRK   LP+  P KS    +      +  N    L+   
Sbjct  1    MEALKTASFTPMSVLSEKRSEPRKPFSLPNLFPQKSPKPISQESFFLKRFNGGLALLTSV  60

Query  283  svmssglAKALTYEEALQQT-SVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllv  459
               ++  AK+LTYEEALQQ+ + S+ FD    ++ +++F  DNP+++AGG A  AVP ++
Sbjct  61   LSNTTAPAKSLTYEEALQQSMTTSSSFDSDSFIDGISSFVTDNPLVIAGGFAAFAVPFVL  120

Query  460  SQLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY  636
            SQ+L+K PK +GVESAK AY KL  D NAQLLDIR + + ++VGSP+I+GL KK V++ Y
Sbjct  121  SQVLNKKPKSFGVESAKNAYTKLGTDDNAQLLDIRTSADFRQVGSPNIKGLGKKTVSIVY  180

Query  637  NGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            NGEDKPGFLKKLSLKFK+PENTTLFILDKFDG+SELVAELV  NGFK+AYAIK
Sbjct  181  NGEDKPGFLKKLSLKFKDPENTTLFILDKFDGNSELVAELVALNGFKSAYAIK  233



>ref|XP_002875001.1| hypothetical protein ARALYDRAFT_352729 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51260.1| hypothetical protein ARALYDRAFT_352729 [Arabidopsis lyrata subsp. 
lyrata]
Length=869

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 167/235 (71%), Gaps = 16/235 (7%)
 Frame = +1

Query  139  PLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR-NvkgglvllssvmssglAKAL  315
            P+SVLSE+R+EPRK   LP+  P KS    +    + R N    L+      ++  AK+L
Sbjct  459  PMSVLSEKRSEPRKPFSLPNLFPPKSPRPISQESFLKRFNGGLALLTSVLSSATAPAKSL  518

Query  316  TYEEALQQT-SVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvSQLLSK-PKPW  489
            TYEEALQQ+ + S+ FD  G++E ++ F  DNP++++GGVA LAVP ++SQ+L+K PK W
Sbjct  519  TYEEALQQSMTTSSSFDSDGLIEGISNFVTDNPLVISGGVAALAVPFVLSQVLNKKPKSW  578

Query  490  GVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKK  669
            GVESAK AY KL  D NAQLLDIR   + ++VGSP+I+GL KK V++ YNGEDKPGFLKK
Sbjct  579  GVESAKNAYTKLGTDDNAQLLDIRATADFRQVGSPNIKGLGKKAVSIVYNGEDKPGFLKK  638

Query  670  LSLKFKEPENTTLFILD-------------KFDGSSELVAELVTENGFKAAYAIK  795
            LSLKFK+PENTTLFILD             +FDG+SELVAELV  NGFK+AYAIK
Sbjct  639  LSLKFKDPENTTLFILDNSLIQSDLFEWKARFDGNSELVAELVALNGFKSAYAIK  693



>emb|CBI40498.3| unnamed protein product [Vitis vinifera]
Length=377

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 126/229 (55%), Positives = 146/229 (64%), Gaps = 34/229 (15%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvllssv  288
            MEA+N   LTPLSVL +RR EPRKI                 + A+S           ++
Sbjct  1    MEALNLAGLTPLSVLRDRRTEPRKISS---------------LPAVS-----------AL  34

Query  289  mssglAKALTYEEALQQTSVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvSQL  468
              S  A   T   ALQ+   +  F        V +F  +NP +VAGG  IL VPL++SQL
Sbjct  35   KISSSATFNTTPPALQEC-FTRSFH-------VISFGVENPAVVAGGALILVVPLVLSQL  86

Query  469  LSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGED  648
            L KPKPWGVESA+ AYAKL DDA AQLLDIR   E ++VGSPDIRGL+KKPV +   G D
Sbjct  87   LKKPKPWGVESARNAYAKLGDDATAQLLDIREPVEFRQVGSPDIRGLRKKPVAIPCKGGD  146

Query  649  KPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            K  FLKKLSLKFKEPENTTL ILDKFDG+SE+VAEL   NGFKAAYAIK
Sbjct  147  KQAFLKKLSLKFKEPENTTLLILDKFDGNSEMVAELAAVNGFKAAYAIK  195



>emb|CDX91872.1| BnaC03g31740D [Brassica napus]
Length=1004

 Score =   194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 166/234 (71%), Gaps = 5/234 (2%)
 Frame = +1

Query  106  AMEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR--Nvkgglvll  279
            AMEA+     +P SVLS++R+E RK P    SL         S E++ R  N    L+  
Sbjct  469  AMEALKTASFSPTSVLSDKRSETRK-PFSLPSLFPPKPPKPISQESLFRSFNGGLALLTS  527

Query  280  ssvmssglAKALTYEEALQQTSVS-TDFDPSGVMETVTTFAGDNpvivaggvailavpll  456
                ++  A +LTYEEALQQ++ S + FD  G+++ +++F  DNP+++AGGVA  AVP +
Sbjct  528  VLSSATAPAISLTYEEALQQSTTSPSSFDSDGLIDGISSFVTDNPLVIAGGVAAFAVPFV  587

Query  457  vSQLLS-KPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVS  633
            +SQ+L+ KPK +GVESAK AY K   D N QLLDIR A +L++VGSP+I+GL K  V+  
Sbjct  588  LSQVLNKKPKSFGVESAKNAYTKFGTDENVQLLDIRAAADLRQVGSPNIKGLGKNTVSAV  647

Query  634  YNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            YNGEDK GFLKKLSLKFK+PENTTLFILDKFDG+SELVAELV  NGFK+AYAIK
Sbjct  648  YNGEDKTGFLKKLSLKFKDPENTTLFILDKFDGNSELVAELVALNGFKSAYAIK  701



>gb|EPS66030.1| hypothetical protein M569_08743, partial [Genlisea aurea]
Length=390

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 133/174 (76%), Gaps = 16/174 (9%)
 Frame = +1

Query  304  AKALTYEEALQQTSVSTDFDPSGV----------METVTTFAGDNpvivaggvailavpl  453
            AK+LTYE+AL+Q+S      P+GV          +E+ TTFA +NP IVAGGVA+ AVPL
Sbjct  19   AKSLTYEQALEQSS------PAGVDFDFDFDFTGVESFTTFAAENPAIVAGGVAVFAVPL  72

Query  454  lvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVS  633
            LVS LL KP+ WGV+SA+ AY KL +D  AQLLDIR   ++ + GSPDI GLKKKP  V 
Sbjct  73   LVSLLLGKPRAWGVDSARNAYLKLGEDPAAQLLDIRSPGDIGQSGSPDISGLKKKPAAVL  132

Query  634  YNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            Y GEDKPGFLKKLS KFKEPENTTLFILDKFDG+SELVAEL T NGFKAAYAIK
Sbjct  133  YRGEDKPGFLKKLSAKFKEPENTTLFILDKFDGNSELVAELATANGFKAAYAIK  186



>ref|XP_007219299.1| hypothetical protein PRUPE_ppa018863mg, partial [Prunus persica]
 gb|EMJ20498.1| hypothetical protein PRUPE_ppa018863mg, partial [Prunus persica]
Length=336

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  460  SQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  639
            SQ+L  PKPWGV++A+ AYAKL DDANAQLLDIR   E ++VG+PD+RGL KK V + Y 
Sbjct  15   SQVLKPPKPWGVDTARNAYAKLGDDANAQLLDIRSPAEFRQVGTPDVRGLGKKAVPIVYK  74

Query  640  GEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            GEDKPGFLKKLSLKFKEPENTTLF+LDKFDG+SELVAELVT NGFKAAYAIK
Sbjct  75   GEDKPGFLKKLSLKFKEPENTTLFVLDKFDGNSELVAELVTVNGFKAAYAIK  126



>ref|XP_010424692.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Camelina sativa]
Length=208

 Score =   169 bits (428),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 150/208 (72%), Gaps = 3/208 (1%)
 Frame = +1

Query  109  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR-Nvkgglvllss  285
            MEA+     TP+SVLSE+R+EPRK   LP+  P KS    +    + R N    L+    
Sbjct  1    MEALKTATFTPMSVLSEKRSEPRKPFTLPNLFPQKSPRPISQENFLRRFNGGLALLTSVL  60

Query  286  vmssglAKALTYEEALQQTSVSTD-FDPSGVMETVTTFAGDNpvivaggvailavpllvS  462
              ++  AK+LTYEEALQQ++ ++  FD  G++E ++ F  DNP+++AGGVA LAVP ++S
Sbjct  61   TSATAPAKSLTYEEALQQSTTTSSSFDSDGLIEGISNFVTDNPLVIAGGVAALAVPFVLS  120

Query  463  QLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  639
            Q+L+K PK WGVESAK AY KL  D NAQLLDIR   +L++VGSP+I+GL KK V+  YN
Sbjct  121  QVLNKKPKAWGVESAKNAYTKLGTDDNAQLLDIRATADLRQVGSPNIKGLGKKAVSTVYN  180

Query  640  GEDKPGFLKKLSLKFKEPENTTLFILDK  723
            G+DKPGFLKKLSLKFK+PENTTL+ILDK
Sbjct  181  GDDKPGFLKKLSLKFKDPENTTLYILDK  208



>pdb|1VEE|A Chain A, Nmr Structure Of The Hypothetical Rhodanese Domain At4g01050 
From Arabidopsis Thaliana
 pdb|2DCQ|A Chain A, Fully Automated Nmr Structure Determination Of The Rhodanese 
Homology Domain At4g01050(175-295) From Arabidopsis 
Thaliana
Length=134

 Score =   149 bits (377),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +1

Query  502  AKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSLK  681
            AK AY KL  D NAQLLDIR   + ++VGSP+I+GL KK V+  YNGEDKPGFLKKLSLK
Sbjct  9    AKNAYTKLGTDDNAQLLDIRATADFRQVGSPNIKGLGKKAVSTVYNGEDKPGFLKKLSLK  68

Query  682  FKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            FK+PENTTL+ILDKFDG+SELVAELV  NGFK+AYAIK
Sbjct  69   FKDPENTTLYILDKFDGNSELVAELVALNGFKSAYAIK  106



>gb|ABR16588.1| unknown [Picea sitchensis]
Length=463

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 120/170 (71%), Gaps = 8/170 (5%)
 Frame = +1

Query  304  AKALTYEEALQQ------TSVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvSQ  465
            A ALTYEEALQQ      T    D D +G+ + V +F  +N V +  GV ++ +PL++++
Sbjct  83   ASALTYEEALQQGVSSSPTEAPADLDVNGITDAVLSFTAENSVAIIAGVVLVGLPLVLTR  142

Query  466  LLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGE  645
            +LS PK WG  SA+ AY+KL D+  AQL+DIR  +++KEVGSPDIR LKK+   + Y  E
Sbjct  143  ILSNPKTWGTVSAEDAYSKLGDEPEAQLVDIRTLQDIKEVGSPDIRSLKKRVAQIFY--E  200

Query  646  DKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            D   FL+ +S KFK+P NTTL+ILDKFDG+S  VA+LV ENGFK+A+AIK
Sbjct  201  DDESFLQTVSAKFKDPVNTTLYILDKFDGNSARVAKLVAENGFKSAFAIK  250



>ref|XP_003637723.1| hypothetical protein MTR_100s0011, partial [Medicago truncatula]
Length=192

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 109/138 (79%), Gaps = 3/138 (2%)
 Frame = +1

Query  304  AKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvSQLLS  474
            A ALTYEEAL Q+   S   D D +G +++V  FA +NPVI+AGGVAILAVPL++SQ+L 
Sbjct  55   ANALTYEEALGQSPSASGGGDIDVNGFVDSVIGFATENPVILAGGVAILAVPLVLSQILK  114

Query  475  KPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKP  654
            KPK WGVESAK AYAKL  D NAQLLDIR   E+++VG P++ GLKKK V V+Y G+DKP
Sbjct  115  KPKAWGVESAKNAYAKLGADGNAQLLDIRGLAEIRQVGGPNVGGLKKKAVAVTYKGDDKP  174

Query  655  GFLKKLSLKFKEPENTTL  708
             FLKKLSLKFKEPENTTL
Sbjct  175  VFLKKLSLKFKEPENTTL  192



>ref|XP_006847355.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Amborella trichopoda]
 gb|ERN08936.1| hypothetical protein AMTR_s00015p00257490 [Amborella trichopoda]
Length=455

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 117/249 (47%), Positives = 162/249 (65%), Gaps = 21/249 (8%)
 Frame = +1

Query  109  MEAVNALRLT--PLS-----VLSERRNEPRKIpllpssl------pfkslsssnsMEAIS  249
            ME +NA RLT  P+S     + S+R+ EPRK+     +          S  SSN  E +S
Sbjct  1    MEVLNAARLTLTPVSLYKPTITSDRKTEPRKLIYHQFATNPKLSTSSNSNPSSNLSEFLS  60

Query  250  RNvkgglvllssvm-ssglAKALTYEEALQQ-----TSVSTD-FDPSGVMETVTTFAGDN  408
            +++ G   +L S +     A ALTYEEA++Q     TS   D FD  G+++++  F  +N
Sbjct  61   KSLLGTATVLYSSIFGGNSADALTYEEAIEQSLQTFTSGGADSFDLGGLVDSIVQFGMEN  120

Query  409  pvivaggvailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVG  588
            P I+AGG  +LAVPL+++  L KPK WGV+SA TAY+KLA+D ++QLLDIR   +++ VG
Sbjct  121  PAILAGGATVLAVPLILASFLQKPKGWGVKSAITAYSKLAEDGDSQLLDIRGVEDIRMVG  180

Query  589  SPDIRGLKKKPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTEN  768
            SPD++ LKK+ V++ +   DK  FLKK+  KFK P +TTLFILDK+DG+S  VAELVT N
Sbjct  181  SPDLKSLKKRSVSIPFV-SDKVAFLKKVYAKFKVPTSTTLFILDKYDGNSTQVAELVTAN  239

Query  769  GFKAAYAIK  795
            GFKA +AIK
Sbjct  240  GFKAVFAIK  248



>ref|XP_003572147.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Brachypodium distachyon]
Length=471

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +1

Query  481  KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  660
            KP+G  S K AY +L ++ +AQL+DIRP ++ +EVGSPDIR  KKK V V Y+GEDK GF
Sbjct  123  KPYGTVSGKAAYQRLLEEPDAQLVDIRPLKDAREVGSPDIREAKKKAVAVPYDGEDKNGF  182

Query  661  LKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            LKKL L+ K+PENTTL ILDKFDG+SELVAELVT NG+KAA+A+K
Sbjct  183  LKKLQLRLKDPENTTLIILDKFDGNSELVAELVTANGYKAAFAVK  227



>gb|EMS45759.1| hypothetical protein TRIUR3_22780 [Triticum urartu]
Length=302

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +1

Query  481  KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  660
            KP+   S K AY +L ++ +AQL+DIRP ++ +EVG PDI   KKK V V Y+GEDK GF
Sbjct  61   KPYETVSVKAAYRRLLEEPDAQLVDIRPLKDAREVGLPDISEAKKKAVAVPYDGEDKNGF  120

Query  661  LKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            LKKL+L+FK+PENTTL ILDKFDG+SELVAELVT NG+K A+A+K
Sbjct  121  LKKLALRFKDPENTTLIILDKFDGNSELVAELVTSNGYKGAFAVK  165



>gb|EMT20251.1| hypothetical protein F775_01839 [Aegilops tauschii]
Length=291

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +1

Query  460  SQLLS-KPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY  636
            SQ+L    KP+   S K AY +L ++ +AQL+DIRP ++ +EVGSPDI   KKK   V Y
Sbjct  47   SQVLGGASKPYETVSVKAAYRRLLEEPDAQLVDIRPLKDAREVGSPDISEAKKKAAAVPY  106

Query  637  NGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            +GEDK GFLKKL+L+FK+PENTTL ILDKFDG+SELVAELVT NG+K A+A+K
Sbjct  107  DGEDKNGFLKKLALRFKDPENTTLIILDKFDGNSELVAELVTSNGYKGAFAVK  159



>gb|EAY85255.1| hypothetical protein OsI_06628 [Oryza sativa Indica Group]
Length=476

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +1

Query  481  KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  660
            KP+GV SA  AY  L ++  AQL+DIRP  + ++ G+PD+R  KKK   V Y+GEDK GF
Sbjct  124  KPYGVVSAAAAYRALVEEPGAQLVDIRPPGDARQSGAPDLREAKKKAAAVPYDGEDKNGF  183

Query  661  LKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            LKKLSL+FK+PENTTL ILDKFDG+SELVAELVT NG+KAA+A+K
Sbjct  184  LKKLSLRFKDPENTTLVILDKFDGNSELVAELVTANGYKAAFAVK  228



>ref|NP_001046473.1| Os02g0257300 [Oryza sativa Japonica Group]
 dbj|BAD27963.1| hydroxyproline-rich glycoprotein-like [Oryza sativa Japonica 
Group]
 dbj|BAF08387.1| Os02g0257300 [Oryza sativa Japonica Group]
 gb|EAZ22465.1| hypothetical protein OsJ_06134 [Oryza sativa Japonica Group]
Length=478

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +1

Query  481  KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  660
            KP+GV SA  AY  L ++  AQL+DIRP  + ++ G+PD+R  KKK   V Y+GEDK GF
Sbjct  126  KPYGVVSAAAAYRALVEEPGAQLVDIRPPGDARQSGAPDLREAKKKAAAVPYDGEDKNGF  185

Query  661  LKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            LKKLSL+FK+PENTTL ILDKFDG+SELVAELVT NG+KAA+A+K
Sbjct  186  LKKLSLRFKDPENTTLVILDKFDGNSELVAELVTANGYKAAFAVK  230



>gb|AFW71054.1| hypothetical protein ZEAMMB73_066102 [Zea mays]
Length=437

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +1

Query  481  KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  660
            KP+ V SAK AY +L ++ +AQL+DIRP ++ +E G+PD++  KKK   V YNGEDK GF
Sbjct  119  KPYSVLSAKAAYQRLLEEPDAQLVDIRPLKDAREAGTPDLKEAKKKAAAVPYNGEDKNGF  178

Query  661  LKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            LKKL+LKFK+PENTTL ILDKFDG+SELVAELVT NG+KAA+A+K
Sbjct  179  LKKLTLKFKDPENTTLIILDKFDGNSELVAELVTANGYKAAFAVK  223



>ref|XP_002451894.1| hypothetical protein SORBIDRAFT_04g009380 [Sorghum bicolor]
 gb|EES04870.1| hypothetical protein SORBIDRAFT_04g009380 [Sorghum bicolor]
Length=443

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +1

Query  481  KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  660
            KP+ V SA+ AY +L ++ +AQL+DIRP ++ +E G+PD++  KKK   V YNGEDK GF
Sbjct  120  KPYAVVSARAAYQRLLEEPDAQLVDIRPLKDAREDGTPDLKEAKKKVAAVPYNGEDKNGF  179

Query  661  LKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            LKKL+L+FK+PENTTL ILDKFDG+S LVAELVT NG+KAA+A+K
Sbjct  180  LKKLTLRFKDPENTTLVILDKFDGNSGLVAELVTANGYKAAFAVK  224



>ref|XP_008681054.1| PREDICTED: uncharacterized protein LOC100192599 isoform X1 [Zea 
mays]
 gb|AFW71053.1| hypothetical protein ZEAMMB73_066102 [Zea mays]
Length=466

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +1

Query  481  KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  660
            KP+ V SAK AY +L ++ +AQL+DIRP ++ +E G+PD++  KKK   V YNGEDK GF
Sbjct  119  KPYSVLSAKAAYQRLLEEPDAQLVDIRPLKDAREAGTPDLKEAKKKAAAVPYNGEDKNGF  178

Query  661  LKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            LKKL+LKFK+PENTTL ILDKFDG+SELVAELVT NG+KAA+A+K
Sbjct  179  LKKLTLKFKDPENTTLIILDKFDGNSELVAELVTANGYKAAFAVK  223



>ref|NP_001131286.1| uncharacterized protein LOC100192599 [Zea mays]
 gb|ACF79627.1| unknown [Zea mays]
Length=476

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +1

Query  481  KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  660
            KP+ V SAK AY +L ++ +AQL+DIRP ++ +E G+PD++  KKK   V YNGEDK GF
Sbjct  119  KPYSVLSAKAAYQRLLEEPDAQLVDIRPLKDAREAGTPDLKEAKKKAAAVPYNGEDKNGF  178

Query  661  LKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            LKKL+LKFK+PENTTL ILDKFDG+SELVAELVT NG+KAA+A+K
Sbjct  179  LKKLTLKFKDPENTTLIILDKFDGNSELVAELVTANGYKAAFAVK  223



>ref|XP_004951282.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
[Setaria italica]
Length=450

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +1

Query  481  KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  660
            K + V SA+TAY +L ++   QL+DIR  ++ +E G+PD+R  KKK   V YNGEDK GF
Sbjct  123  KSYAVVSARTAYQRLLEEPGVQLVDIRALKDAREAGAPDLREAKKKAAAVPYNGEDKNGF  182

Query  661  LKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            LKKL+L+FK+PENTTL I+DKFDG+SELVAELVT NG+KAA+A+K
Sbjct  183  LKKLALRFKDPENTTLIIIDKFDGNSELVAELVTTNGYKAAFAVK  227



>emb|CCJ09774.1| rhodanese homology domain protein, partial [Hirudo medicinalis]
Length=246

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +1

Query  598  IRGLKKKPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFK  777
            +RGLKK+ V V+Y GEDKPGFLKKL+LKFKEPENTTLFILDKFDG+SELVAELVT NG+K
Sbjct  1    VRGLKKRSVAVAYKGEDKPGFLKKLALKFKEPENTTLFILDKFDGNSELVAELVTANGYK  60

Query  778  AAYAIK  795
            AAYAIK
Sbjct  61   AAYAIK  66



>ref|XP_006648515.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
[Oryza brachyantha]
Length=350

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  562  PARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSE  741
            P  + +E GSP++R  KKK V V Y+GEDK GFLKKLSL+FK+PENTTL ILDKFDG+SE
Sbjct  19   PPGDARETGSPNLREAKKKAVAVPYDGEDKNGFLKKLSLRFKDPENTTLVILDKFDGNSE  78

Query  742  LVAELVTENGFKAAYAIK  795
            LVAELVT NG+KAA+A+K
Sbjct  79   LVAELVTANGYKAAFAVK  96



>ref|XP_002991602.1| hypothetical protein SELMODRAFT_448468 [Selaginella moellendorffii]
 gb|EFJ07356.1| hypothetical protein SELMODRAFT_448468 [Selaginella moellendorffii]
Length=438

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 99/142 (70%), Gaps = 2/142 (1%)
 Frame = +1

Query  373  VMETVTTFAGDNpvivaggvailavpllvSQLLSKPKPWGVESAKTAYAKLA-DDANAQL  549
            V E+V  F  DNP  VAGG+  +A+P+L+S+L    +PWGV SAK AY KLA  D   Q+
Sbjct  95   VAESVLGFVSDNPAAVAGGLLAIALPVLISRLAGGKQPWGVVSAKEAYEKLAVKDPAFQI  154

Query  550  LDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFD  729
            LDIR   ++K  G+PD+R  KK+ + VS++ +++  F+ K+  KFK+P +TTL+ILD+FD
Sbjct  155  LDIREPSDIKAEGTPDLRQFKKRVLQVSFS-QEQDAFVAKVKSKFKDPASTTLYILDRFD  213

Query  730  GSSELVAELVTENGFKAAYAIK  795
            G+S  VA+L+  NGFK AY IK
Sbjct  214  GNSLAVAKLLATNGFKEAYGIK  235



>ref|XP_002971531.1| hypothetical protein SELMODRAFT_441569 [Selaginella moellendorffii]
 gb|EFJ27280.1| hypothetical protein SELMODRAFT_441569 [Selaginella moellendorffii]
Length=438

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 99/142 (70%), Gaps = 2/142 (1%)
 Frame = +1

Query  373  VMETVTTFAGDNpvivaggvailavpllvSQLLSKPKPWGVESAKTAYAKLA-DDANAQL  549
            V E+V  F  DNP  VAGG+  +A+P+L+S+L    +PWGV SAK AY KLA  D   Q+
Sbjct  95   VAESVLGFVSDNPAAVAGGLLAIALPVLISRLAGGKQPWGVVSAKEAYEKLAVKDPAFQI  154

Query  550  LDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFD  729
            LDIR   ++K  G+PD+R  KK+ + VS++ +++  F+ K+  KFK+P +TTL+ILD+FD
Sbjct  155  LDIREPSDIKAEGTPDLRQFKKRVLQVSFS-QEQDAFVAKVKSKFKDPASTTLYILDRFD  213

Query  730  GSSELVAELVTENGFKAAYAIK  795
            G+S  VA+L+  NGFK AY IK
Sbjct  214  GNSLAVAKLLATNGFKEAYGIK  235



>ref|XP_002527287.1| chitinase, putative [Ricinus communis]
 gb|EEF35131.1| chitinase, putative [Ricinus communis]
Length=315

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL +D +AQLLDIR  + +K +GSP+++ L K  V V ++ ED+ GF+K +  
Sbjct  138  SAINAFRKLKEDKDAQLLDIRDKKSVKALGSPNLKILDKSVVQVMFSEEDEDGFVKNVLE  197

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            KF +P NTT+ ILD FDG+S  VAEL+ +NGFK AYAIK
Sbjct  198  KFPDPANTTMCILDNFDGNSIRVAELLVKNGFKEAYAIK  236



>ref|XP_002271020.2| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Vitis vinifera]
 emb|CBI23335.3| unnamed protein product [Vitis vinifera]
Length=355

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL DD NAQLLDIR  + L  +GSP+++ L K  V V ++ +D+  FLK +S 
Sbjct  148  SAINAFRKLRDDPNAQLLDIRDGKSLAYLGSPNLKILNKGVVQVQFSQDDEDAFLKVVST  207

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            KF +P NTT+ +LD FDG+S  VAEL+ +NGFK AYAI+
Sbjct  208  KFADPNNTTVCVLDNFDGNSMKVAELLFKNGFKEAYAIR  246



>emb|CAN80760.1| hypothetical protein VITISV_014603 [Vitis vinifera]
Length=636

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL DD NAQLLDIR  + L  +GSP+++ L K  V V ++ +D+  FLK +S 
Sbjct  146  SAINAFRKLRDDPNAQLLDIRDGKSLAYLGSPNLKILNKGVVQVQFSQDDEDAFLKSVST  205

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            KF +P+NTT+ +LD FDG+S  VAEL+ +NGFK AYAI+
Sbjct  206  KFADPKNTTVCVLDNFDGNSMKVAELLFKNGFKEAYAIR  244



>ref|XP_007049538.1| Rhodanese/Cell cycle control phosphatase superfamily protein, 
putative [Theobroma cacao]
 gb|EOX93695.1| Rhodanese/Cell cycle control phosphatase superfamily protein, 
putative [Theobroma cacao]
Length=369

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 67/99 (68%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL DD+NAQLLDIR  + L  + SP+++ L K  V V +  ED+ GF+KK+  
Sbjct  165  SAIDAFGKLRDDSNAQLLDIRDDKTLASLASPNLKFLNKDSVQVQFTAEDENGFVKKVLQ  224

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            KF  P NT L +LD FDG+S   AEL+ +NGFK AYAI+
Sbjct  225  KFPSPANTVLCLLDNFDGNSLKAAELLYQNGFKEAYAIR  263



>gb|EYU46074.1| hypothetical protein MIMGU_mgv1a008760mg [Erythranthe guttata]
Length=363

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = +1

Query  487  WGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLK  666
            + V SA  A+ KL DD  +QLLDIR ++ L  +GSP+++ L KK V V +   D+ GF+K
Sbjct  151  YKVISAINAFNKLRDDPTSQLLDIRDSKILASLGSPNLKFLNKKTVQVEFREGDEEGFVK  210

Query  667  KLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            ++   F+EP NT++ I+D FDG+S  VAEL+ +NGFK AYAI+
Sbjct  211  RVLQNFREPANTSVCIIDNFDGNSFKVAELLVKNGFKEAYAIR  253



>ref|XP_010678998.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010678999.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=290

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 67/99 (68%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA TA+ KL DD+  QLLDIR  +    +GSP++R   K  V V +N  D+ GFLKK+  
Sbjct  137  SALTAFRKLRDDSCVQLLDIRDEKSKGYLGSPNLRMFSKNVVQVPFNQSDEDGFLKKVLE  196

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             FK+P N +L I+D FDG+S  VAEL+ +NGFK A+AIK
Sbjct  197  SFKDPNNISLCIVDNFDGNSIKVAELLVKNGFKEAFAIK  235



>ref|XP_001764633.1| predicted protein [Physcomitrella patens]
 gb|EDQ70615.1| predicted protein, partial [Physcomitrella patens]
Length=115

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 72/100 (72%), Gaps = 2/100 (2%)
 Frame = +1

Query  499  SAKTAYAKLAD-DANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLS  675
            SA  AYAKL+D + NAQLLDIR   ++K  GSP+++ + K  + VSY   D   F++K+ 
Sbjct  8    SAIEAYAKLSDPELNAQLLDIRALEDVKAEGSPNLKSINKSVLKVSYAAGDSA-FVEKVL  66

Query  676  LKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             K K  E+TTL++LD+FDGSS  VA+L++ +GFK+AYAIK
Sbjct  67   AKCKAAEDTTLYVLDRFDGSSATVAKLLSNSGFKSAYAIK  106



>ref|XP_008458097.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Cucumis melo]
Length=366

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 69/99 (70%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ K+ D+ NAQLLD+R  + L  +GSP++R L K  V V Y+ ED+ GF+KK+  
Sbjct  162  SAIDAFRKIRDEPNAQLLDVREEKSLAVLGSPNLRILNKDVVRVVYSEEDEDGFVKKVKK  221

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F +  +T +F+LD FDG+S  VAEL+ +NGFK AYAIK
Sbjct  222  SFGDCADTIVFVLDNFDGNSMKVAELLVKNGFKEAYAIK  260



>ref|XP_006418623.1| hypothetical protein EUTSA_v10002639mg [Eutrema salsugineum]
 ref|XP_006418624.1| hypothetical protein EUTSA_v10002639mg [Eutrema salsugineum]
 gb|ESQ37059.1| hypothetical protein EUTSA_v10002639mg [Eutrema salsugineum]
 gb|ESQ37060.1| hypothetical protein EUTSA_v10002639mg [Eutrema salsugineum]
Length=270

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 66/99 (67%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL    ++QLLDIR  + L  + SP+++ L K  + V Y+ ED+ GFLK++  
Sbjct  127  SAMNAFRKLKSQPDSQLLDIRDEKTLASLASPNLKFLGKSSIQVPYSEEDESGFLKRVKG  186

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F +PENT + +LD FDG+S  VAEL+ ENGFK AY IK
Sbjct  187  SFSDPENTVVCVLDNFDGNSVKVAELLVENGFKEAYYIK  225



>ref|XP_010095587.1| hypothetical protein L484_007426 [Morus notabilis]
 gb|EXB61160.1| hypothetical protein L484_007426 [Morus notabilis]
Length=406

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 68/98 (69%), Gaps = 0/98 (0%)
 Frame = +1

Query  502  AKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSLK  681
            A  A+ KL DD N QLLDIR  + L+ + SP+++ L K  V V ++ +D+ GF+KK+   
Sbjct  208  AIDAFRKLRDDPNVQLLDIREEKILRSLKSPNLKILNKSAVQVPFSEDDEDGFVKKVLGN  267

Query  682  FKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            FKEPE T + ILD  DG+S  VAEL+ +NGFKAAYAIK
Sbjct  268  FKEPEYTVVCILDNLDGNSMKVAELLFKNGFKAAYAIK  305



>ref|XP_011080557.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Sesamum indicum]
Length=368

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 69/99 (70%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL +D N+QLLDIR ++ +  +GSP+++ L K  + V +   D+ GFLK++  
Sbjct  161  SAINAFKKLQEDPNSQLLDIRDSKSVAYLGSPNLKILNKSVMQVEFLEGDEEGFLKRVLE  220

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F+EP NTT+ I+D FDG+S  VAEL+  NGFK AYAI+
Sbjct  221  NFREPTNTTVCIVDNFDGNSMKVAELLVRNGFKEAYAIR  259



>ref|XP_012084520.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Jatropha curcas]
Length=339

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 71/111 (64%), Gaps = 3/111 (3%)
 Frame = +1

Query  463  QLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNG  642
            QLL K   +   SA  A+ KL DD NAQLLDIR  + +  + SP+++ L K    V ++ 
Sbjct  125  QLLRK---YNFISAIDAFRKLKDDKNAQLLDIREKKSMVALESPNLKILDKTACQVEFSE  181

Query  643  EDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            ED+ GF+K +  KF +P NT L ILD FDG+S   AEL+ +NGFK AYAI+
Sbjct  182  EDEDGFVKNVLEKFPDPANTILCILDNFDGNSMRAAELLFKNGFKEAYAIR  232



>gb|KDP45207.1| hypothetical protein JCGZ_15072 [Jatropha curcas]
Length=333

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 71/111 (64%), Gaps = 3/111 (3%)
 Frame = +1

Query  463  QLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNG  642
            QLL K   +   SA  A+ KL DD NAQLLDIR  + +  + SP+++ L K    V ++ 
Sbjct  119  QLLRK---YNFISAIDAFRKLKDDKNAQLLDIREKKSMVALESPNLKILDKTACQVEFSE  175

Query  643  EDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            ED+ GF+K +  KF +P NT L ILD FDG+S   AEL+ +NGFK AYAI+
Sbjct  176  EDEDGFVKNVLEKFPDPANTILCILDNFDGNSMRAAELLFKNGFKEAYAIR  226



>ref|XP_004149316.2| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Cucumis sativus]
 gb|KGN44672.1| hypothetical protein Csa_7G368730 [Cucumis sativus]
Length=366

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 68/99 (69%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ K+ D+ NAQLLD+R  + L  +GSP++R L K  V V Y+ ED+ GF+KK+  
Sbjct  162  SAINAFRKIRDEPNAQLLDVREEKSLAVLGSPNLRILNKDVVRVVYSEEDEDGFVKKVKK  221

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F +  +T +F+LD FDG+S   AEL+ +NGFK AYAIK
Sbjct  222  SFGDDADTIVFVLDNFDGNSMKAAELLVKNGFKEAYAIK  260



>ref|XP_010532931.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Tarenaya hassleriana]
Length=309

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 71/109 (65%), Gaps = 3/109 (3%)
 Frame = +1

Query  469  LSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGED  648
            LSK KP    SA  A+ KL    ++QLLDIR  + L  + SP+++ L K  V V Y+ ED
Sbjct  119  LSKFKPI---SAMNAFRKLKKLPSSQLLDIRDEKALASLSSPNLKLLGKSTVQVPYSEED  175

Query  649  KPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            + GFL+K+   F +PENT + +LD FDG+S  VAEL+ ENGF+ AY IK
Sbjct  176  ELGFLEKVKRSFSDPENTVVCVLDNFDGNSSKVAELLVENGFQEAYYIK  224



>ref|XP_009136118.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Brassica rapa]
Length=268

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 65/99 (66%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            +A  A+ KL    ++QLLDIR  + L  + SP ++ L K  V V Y+  D+PGF+K++  
Sbjct  126  TAINAFRKLKSQPDSQLLDIRDDKTLASLASPSLKFLGKSSVQVPYSENDEPGFVKRVKG  185

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F +PENT + +LD FDG+S  VAEL+ ENGFK AY IK
Sbjct  186  GFSDPENTVVCVLDNFDGNSMKVAELLVENGFKEAYYIK  224



>ref|XP_006858740.2| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Amborella trichopoda]
Length=282

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 68/96 (71%), Gaps = 2/96 (2%)
 Frame = +1

Query  511  AYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN-GEDKPGFLKKLSLKFK  687
            A+ KL DD +  LLDIRPA+ +  +GSP+++ LKK  V V Y  GED+  F+KK+  +  
Sbjct  172  AFRKLRDDPSFILLDIRPAKSVLAIGSPNLKTLKKTCVNVEYREGEDE-DFVKKVMEELS  230

Query  688  EPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            +P NTT+ +LD FDG+S  VA+L+ ENGFK AYAIK
Sbjct  231  DPPNTTVCVLDNFDGNSMKVAKLLVENGFKEAYAIK  266



>ref|XP_004246985.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Solanum lycopersicum]
Length=346

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 64/99 (65%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+AKL DD N QLLDIR  + L  + SP +R L K  + V +   D+  FL  +  
Sbjct  141  SAVDAFAKLRDDPNTQLLDIRDNKSLAYLPSPTLRMLNKSVIQVEFRQGDEDAFLNSVFQ  200

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            KF +P+NTTL ++D FDG+S  VAEL+ +NG K AYAI+
Sbjct  201  KFNDPQNTTLCVIDNFDGNSIKVAELLVKNGLKEAYAIR  239



>emb|CDY15093.1| BnaC03g44540D [Brassica napus]
Length=269

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 65/99 (66%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            +A  A+ KL    ++QLLDIR  + L  + SP ++ L K  V V Y+ ED+ GF+K++  
Sbjct  127  TAINAFLKLKSQPDSQLLDIRDDKTLASLASPSLKFLGKSSVQVPYSEEDESGFVKRVKG  186

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F +PENT + +LD FDG+S  VAEL+ ENGFK AY IK
Sbjct  187  GFSDPENTVVCVLDNFDGNSMKVAELLVENGFKEAYYIK  225



>ref|XP_011024728.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
isoform X1 [Populus euphratica]
Length=339

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 66/99 (67%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL D+ +AQLLDIR  R +  +GSP+++   K  V V ++  D+ GF+K +  
Sbjct  135  SAIDAFRKLRDNPDAQLLDIRDRRSVVALGSPNLKMFNKSVVQVEFSEGDEGGFVKNVLK  194

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F++P NT L ILD FDG S  VAEL+ +NGFK AYAI+
Sbjct  195  NFQDPANTILCILDNFDGDSMRVAELLFKNGFKEAYAIR  233



>ref|XP_011015310.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
isoform X1 [Populus euphratica]
Length=339

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 66/99 (67%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL D+ +AQLLDIR  R +  +GSP+++   K  V V ++  D+ GF+K +  
Sbjct  135  SAIDAFRKLRDNPDAQLLDIRDRRSVVALGSPNLKMFNKSVVQVEFSEGDEGGFVKNVLK  194

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F++P NT L ILD FDG S  VAEL+ +NGFK AYAI+
Sbjct  195  NFQDPANTILCILDNFDGDSMRVAELLFKNGFKEAYAIR  233



>ref|XP_011024729.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
isoform X2 [Populus euphratica]
Length=339

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 66/99 (67%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL D+ +AQLLDIR  R +  +GSP+++   K  V V ++  D+ GF+K +  
Sbjct  135  SAIDAFRKLRDNPDAQLLDIRDRRSVVALGSPNLKMFNKSVVQVEFSEGDEGGFVKNVLK  194

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F++P NT L ILD FDG S  VAEL+ +NGFK AYAI+
Sbjct  195  NFQDPANTILCILDNFDGDSMRVAELLFKNGFKEAYAIR  233



>ref|XP_011015311.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
isoform X2 [Populus euphratica]
Length=339

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 66/99 (67%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL D+ +AQLLDIR  R +  +GSP+++   K  V V ++  D+ GF+K +  
Sbjct  135  SAIDAFRKLRDNPDAQLLDIRDRRSVVALGSPNLKMFNKSVVQVEFSEGDEGGFVKNVLK  194

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F++P NT L ILD FDG S  VAEL+ +NGFK AYAI+
Sbjct  195  NFQDPANTILCILDNFDGDSMRVAELLFKNGFKEAYAIR  233



>emb|CDY52290.1| BnaA03g57830D [Brassica napus]
Length=268

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 65/99 (66%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            +A  A+ KL    ++QLLDIR  + L  + SP ++ L K  V V Y+ ED+ GF+K++  
Sbjct  126  TAINAFRKLKSQPDSQLLDIRDDKTLASLASPSLKFLGKSSVQVPYSEEDESGFVKRVKG  185

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F +PENT + +LD FDG+S  VAEL+ ENGFK AY IK
Sbjct  186  GFSDPENTVVCVLDNFDGNSMKVAELLVENGFKEAYYIK  224



>ref|XP_001767557.1| predicted protein [Physcomitrella patens]
 gb|EDQ67692.1| predicted protein, partial [Physcomitrella patens]
Length=120

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = +1

Query  499  SAKTAYAKLAD-DANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLS  675
            SA  A+ KL+D + NAQLLDIR   ++K  G+P+++ L+KK V V Y   D   FL K+ 
Sbjct  1    SALEAFTKLSDPEQNAQLLDIRAPEDIKSEGTPNLKSLRKKAVQVPYTAADD-SFLDKVF  59

Query  676  LKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             K+++ ENTT++ILD+ DG+S  VA+++  NGF+ AY+IK
Sbjct  60   AKYRDAENTTVYILDQLDGNSLAVAKILANNGFEKAYSIK  99



>gb|KDO43509.1| hypothetical protein CISIN_1g039798mg, partial [Citrus sinensis]
Length=229

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 64/98 (65%), Gaps = 0/98 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL +D NAQLLDIR  + +  +GSP+++ LKK  V V +   D+ GFL  +  
Sbjct  62   SAIDAFQKLRNDPNAQLLDIRNKKTMVSLGSPNLKSLKKSVVQVEFVEGDENGFLNNVLS  121

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAI  792
             F +P NT + ILD FDG+S   AEL+ +NGFK AYAI
Sbjct  122  NFADPINTVVCILDNFDGNSLKAAELLYKNGFKEAYAI  159



>ref|XP_002303025.1| hypothetical protein POPTR_0002s24080g [Populus trichocarpa]
 gb|EEE82298.1| hypothetical protein POPTR_0002s24080g [Populus trichocarpa]
Length=327

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 66/99 (67%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL D+ +AQLLDIR  R +  +GSP+++   K  V V +   D+ GF+K +  
Sbjct  135  SAIDAFRKLRDNPDAQLLDIRDRRSVIALGSPNLKMFDKSVVQVEFPEGDEGGFVKNVLK  194

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F++P NT+L ILD FDG S  VAEL+ +NGFK AYAI+
Sbjct  195  NFQDPANTSLCILDNFDGDSMRVAELLFKNGFKEAYAIR  233



>ref|XP_006469347.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic-like 
[Citrus sinensis]
Length=305

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 64/98 (65%), Gaps = 0/98 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL +D NAQLLDIR  + +  +GSP+++ LKK  V V +   D+ GFL  +  
Sbjct  138  SAIDAFQKLRNDPNAQLLDIRNKKTMVSLGSPNLKSLKKSVVQVEFVEGDENGFLNNVLS  197

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAI  792
             F +P NT + ILD FDG+S   AEL+ +NGFK AYAI
Sbjct  198  NFADPINTVVCILDNFDGNSLKAAELLYKNGFKEAYAI  235



>ref|XP_006645148.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic-like 
[Oryza brachyantha]
Length=339

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ +L D+  AQLLDIR  + ++ + SP++R ++K  V V ++ +D+ GF+K++  
Sbjct  131  SAIDAFRRLRDEPGAQLLDIRRGKSVRFMASPNLRLVEKSAVQVEFDEDDEGGFIKEVLP  190

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            +F +P NT + ILD FDG+S  VAEL+ +NGFK AYAIK
Sbjct  191  RFPDPANTVVCILDNFDGNSMKVAELLFKNGFKEAYAIK  229



>ref|XP_006447940.1| hypothetical protein CICLE_v10016082mg [Citrus clementina]
 ref|XP_006447941.1| hypothetical protein CICLE_v10016082mg [Citrus clementina]
 gb|ESR61180.1| hypothetical protein CICLE_v10016082mg [Citrus clementina]
 gb|ESR61181.1| hypothetical protein CICLE_v10016082mg [Citrus clementina]
Length=302

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 64/98 (65%), Gaps = 0/98 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL +D NAQLLDIR  + +  +GSP+++ LKK  V V +   D+ GFL  +  
Sbjct  135  SAIDAFQKLRNDPNAQLLDIRNKKTMVSLGSPNLKSLKKSVVQVEFVEGDENGFLNNVLS  194

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAI  792
             F +P NT + ILD FDG+S   AEL+ +NGFK AYAI
Sbjct  195  NFADPINTVVCILDNFDGNSLKAAELLYKNGFKEAYAI  232



>ref|XP_004493040.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic-like 
[Cicer arietinum]
Length=413

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL DD ++QLLDIR  + +K +GSP++  LKK+ V V +N  ++ GF+K +  
Sbjct  205  SAIDAFRKLRDDPDSQLLDIRDRKNVKFLGSPNLNMLKKEVVLVEFNEGNEDGFVKNVLE  264

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            +F++  NT + +LD FDG+S  VAEL+ +NGFK AYAIK
Sbjct  265  RFEDASNTVVCVLDSFDGNSMKVAELLFKNGFKEAYAIK  303



>ref|XP_002885723.1| hypothetical protein ARALYDRAFT_480047 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61982.1| hypothetical protein ARALYDRAFT_480047 [Arabidopsis lyrata subsp. 
lyrata]
Length=264

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 67/99 (68%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL  +A++QLLDIR  + L  + SP+++ L K  V V ++  D+ GFL K+  
Sbjct  122  SAMNAFRKLKMEADSQLLDIRDDKTLATLASPNLKFLGKSSVQVPFSENDEDGFLMKVKG  181

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            +F +PENT + +LD FDG+S  VAEL+ +NGFK AY I+
Sbjct  182  RFSDPENTVVCVLDNFDGNSSKVAELLIKNGFKEAYYIR  220



>emb|CDP03990.1| unnamed protein product [Coffea canephora]
Length=276

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 69/99 (70%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL DD N QLLDIR  + L  + SP+++ L K  + ++++  D+ GFL+++  
Sbjct  71   SAIDAFRKLRDDPNYQLLDIRDEKSLDFLNSPNLKILNKSVLQLAFSEGDEEGFLREVLE  130

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            KFKEP+ TT+ +LD FDG+S  VAEL+ +NG K AYAI+
Sbjct  131  KFKEPDKTTVCVLDNFDGNSMKVAELLAKNGLKEAYAIR  169



>gb|EPS68185.1| hypothetical protein M569_06591, partial [Genlisea aurea]
Length=229

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 66/99 (67%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL DD  AQLLDIR  R +  + +P+++ L K  V V +  ED+ GFLK++  
Sbjct  53   SAFKAFKKLQDDPTAQLLDIREDRNVGYLRTPNLKILNKSAVQVGFREEDEDGFLKRVLE  112

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            KF++P NT + I+D  DG+S  VAE + +NGFK AYAI+
Sbjct  113  KFEDPINTVVCIIDNVDGNSIKVAEFLVKNGFKEAYAIR  151



>ref|XP_010488649.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Camelina sativa]
Length=263

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 67/99 (68%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL ++ ++QLLDIR  + L  + SP++R L K  V V ++  D+ GFL+++  
Sbjct  121  SAVNAFRKLKNEPDSQLLDIRDDKTLALLASPNLRFLGKSSVQVPFSESDEEGFLRRVKG  180

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F +PENT + +LD FDG+S  VAEL+ E+GFK AY I+
Sbjct  181  SFSDPENTVVCVLDNFDGNSSKVAELLIEDGFKEAYYIR  219



>gb|ABN08992.1| Rhodanese-like [Medicago truncatula]
Length=350

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL D+A++QLLDIR  + +K +GSP ++ + K+ V   +   ++ GF+KK+  
Sbjct  140  SAIDAFRKLRDEADSQLLDIRDRKNVKFLGSPSLKMVNKEVVQFEFVEGNEDGFVKKVLE  199

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            +FK+  NT +F+LD FDG+S  VAEL+ +NGFK AYAIK
Sbjct  200  RFKDASNTAVFVLDSFDGNSMKVAELLFKNGFKEAYAIK  238



>ref|XP_003624244.1| Hydroxyproline-rich glycoprotein-like protein [Medicago truncatula]
 gb|AES80462.1| rhodanese/cell cycle control phosphatase superfamily protein, 
putative [Medicago truncatula]
Length=355

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL D+A++QLLDIR  + +K +GSP ++ + K+ V   +   ++ GF+KK+  
Sbjct  147  SAIDAFRKLRDEADSQLLDIRDRKNVKFLGSPSLKMVNKEVVQFEFVEGNEDGFVKKVLE  206

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            +FK+  NT +F+LD FDG+S  VAEL+ +NGFK AYAIK
Sbjct  207  RFKDASNTAVFVLDSFDGNSMKVAELLFKNGFKEAYAIK  245



>ref|XP_010251413.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
isoform X1 [Nelumbo nucifera]
Length=405

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 68/99 (69%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL DD ++QLLDIR  + L  +GSP++  L K+ V V ++  ++  F++KL  
Sbjct  201  SAINAFRKLRDDPSSQLLDIREKQSLLNLGSPNLNILNKRVVQVQFSEGEEKVFVRKLLE  260

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             FK+  NTT+ I+D FDG+S  VAEL+ +NGFK AYAIK
Sbjct  261  NFKDAGNTTVCIIDDFDGNSMKVAELLVKNGFKEAYAIK  299



>ref|XP_003564816.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Brachypodium distachyon]
Length=345

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 66/98 (67%), Gaps = 0/98 (0%)
 Frame = +1

Query  502  AKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSLK  681
            A  A+ KL D   AQLLDIR  + ++ + SP++R ++K  V V ++ ED+ GF+ K+  +
Sbjct  136  ALDAFRKLRDTPEAQLLDIRRGKSVQFMPSPNLRLIEKNAVQVEFDEEDEKGFVGKVLAR  195

Query  682  FKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            F +P NT + +LD FDG+S  VAEL+  NGFK AYAIK
Sbjct  196  FPDPANTVVCVLDNFDGNSMKVAELLVNNGFKEAYAIK  233



>ref|XP_008235871.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Prunus mume]
Length=373

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = +1

Query  511  AYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSLKFKE  690
            A+ KL DD N QLLDIR  + LK + SP+++ L K  V V ++ +D+ GF+KK+  +F+ 
Sbjct  172  AFRKLRDDPNVQLLDIRDEKSLKYLKSPNLKILNKATVQVPFSEDDEDGFVKKVLERFRN  231

Query  691  PENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            P +T L +L  FDG S  VAEL+ +NGFK AYAIK
Sbjct  232  PADTALCVLGNFDGISIKVAELLFKNGFKEAYAIK  266



>ref|XP_009382932.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=406

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 69/105 (66%), Gaps = 0/105 (0%)
 Frame = +1

Query  481  KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  660
            K +   SA  A+ KL D  NAQLLD+R  + +K + SP++R L K  V V Y+  ++ GF
Sbjct  198  KKYKFISAIDAFRKLRDMPNAQLLDVRKRQSVKFMDSPNLRILNKNVVQVEYSDGNEEGF  257

Query  661  LKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            +K++   F++P NT + +LD FDG S  +AEL+ +NGFK AYAIK
Sbjct  258  IKEVLRNFEDPGNTVICVLDNFDGDSLKLAELLYKNGFKEAYAIK  302



>gb|AFW84330.1| hypothetical protein ZEAMMB73_537769 [Zea mays]
Length=304

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 65/99 (66%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL D    QLLDIR  + ++ +  P ++ + K  V V ++ ED+ GF+K++  
Sbjct  144  SAIDAFRKLRDVPEVQLLDIRRGKSVRFMAPPKLKLIDKSTVQVEFDEEDEKGFVKEVLA  203

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            +F +P NT + +LD FDG+S  VAEL+ ENGFK AYAIK
Sbjct  204  RFPDPANTVVCVLDNFDGNSSKVAELLVENGFKEAYAIK  242



>ref|XP_009586824.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Nicotiana tomentosiformis]
Length=355

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 66/99 (67%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL DD ++ LLD+R  + L  + SP++R L K  V V +   D+  F+K++  
Sbjct  150  SAVDAFGKLRDDPSSLLLDVRDKKSLAYLPSPNLRMLNKSVVQVEFREGDEDAFVKRVFE  209

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             FK+PENTT+ +LD FDG+S  VAEL+ +NG K AYAI+
Sbjct  210  NFKQPENTTVCVLDNFDGNSIKVAELLVKNGLKEAYAIR  248



>ref|XP_004970853.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic-like 
isoform X1 [Setaria italica]
Length=358

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 68/99 (69%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+  L D   AQLLDIR A+ ++ +  P+++ ++K  V V ++ ED+ GF+K++  
Sbjct  144  SAIDAFRTLRDVPEAQLLDIRRAKSVRFMAPPNLKLVEKSAVQVEFDEEDEKGFVKEVLA  203

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            +F +P NT + +LD FDG+S  VAEL+ ENGFK AYAI+
Sbjct  204  RFPDPANTVVCVLDNFDGNSLRVAELLIENGFKEAYAIQ  242



>ref|XP_007199933.1| hypothetical protein PRUPE_ppa007412mg [Prunus persica]
 gb|EMJ01132.1| hypothetical protein PRUPE_ppa007412mg [Prunus persica]
Length=369

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%), Gaps = 0/95 (0%)
 Frame = +1

Query  511  AYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSLKFKE  690
            A+ KL DD N QLLDIR  + LK + SP+++ L K  V V ++ +D+ GF+KK+  +F  
Sbjct  168  AFRKLRDDPNVQLLDIRDEKSLKYLKSPNLKILNKATVQVPFSEDDEDGFVKKVLERFGN  227

Query  691  PENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            P +T L +L  FDG S  VAEL+ +NGFK AYAIK
Sbjct  228  PADTALCVLGNFDGISIKVAELLFKNGFKEAYAIK  262



>ref|XP_004970854.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic-like 
isoform X2 [Setaria italica]
Length=354

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 68/99 (69%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+  L D   AQLLDIR A+ ++ +  P+++ ++K  V V ++ ED+ GF+K++  
Sbjct  144  SAIDAFRTLRDVPEAQLLDIRRAKSVRFMAPPNLKLVEKSAVQVEFDEEDEKGFVKEVLA  203

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            +F +P NT + +LD FDG+S  VAEL+ ENGFK AYAI+
Sbjct  204  RFPDPANTVVCVLDNFDGNSLRVAELLIENGFKEAYAIQ  242



>ref|XP_010468493.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic, 
partial [Camelina sativa]
Length=248

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 65/99 (66%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL  + ++QLLDIR  + L  + SP+++ L K  V V ++  D+ GFLK++  
Sbjct  106  SAVNAFRKLKTEPDSQLLDIRDDKTLALLASPNLKFLGKSSVQVPFSESDEEGFLKRVKG  165

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F +PENT + +LD FDG+S  VAEL+ ENGFK  Y I+
Sbjct  166  IFSDPENTVVCVLDNFDGNSSKVAELLIENGFKETYYIR  204



>gb|AFW84331.1| hypothetical protein ZEAMMB73_537769 [Zea mays]
Length=354

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 65/99 (66%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL D    QLLDIR  + ++ +  P ++ + K  V V ++ ED+ GF+K++  
Sbjct  144  SAIDAFRKLRDVPEVQLLDIRRGKSVRFMAPPKLKLIDKSTVQVEFDEEDEKGFVKEVLA  203

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            +F +P NT + +LD FDG+S  VAEL+ ENGFK AYAIK
Sbjct  204  RFPDPANTVVCVLDNFDGNSSKVAELLVENGFKEAYAIK  242



>gb|AAM65517.1| unknown [Arabidopsis thaliana]
Length=264

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 66/99 (67%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL +++++QLLDIR  + L  + SP+++ L K  V V ++  D+ GFL K+  
Sbjct  122  SAMNAFRKLKNESDSQLLDIRDVKTLALLASPNLKFLGKSSVQVPFSENDEEGFLTKVKG  181

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F + ENT + +LD FDG+S  VAEL+ +NGFK AY I+
Sbjct  182  SFSDAENTVVCVLDNFDGNSSKVAELLIKNGFKEAYYIR  220



>ref|NP_566766.1| Rhodanese/Cell cycle control phosphatase superfamily protein 
[Arabidopsis thaliana]
 sp|Q56XR7.1|STR4A_ARATH RecName: Full=Rhodanese-like domain-containing protein 4A, chloroplastic; 
AltName: Full=Sulfurtransferase 4A; Short=AtStr4a; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAD95171.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABD19674.1| At3g25480 [Arabidopsis thaliana]
 gb|AEE77015.1| Rhodanese/Cell cycle control phosphatase superfamily protein 
[Arabidopsis thaliana]
Length=264

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 66/99 (67%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL +++++QLLDIR  + L  + SP+++ L K  V V ++  D+ GFL K+  
Sbjct  122  SAMNAFRKLKNESDSQLLDIRDVKTLALLASPNLKFLGKSSVQVPFSENDEEGFLTKVKG  181

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F + ENT + +LD FDG+S  VAEL+ +NGFK AY I+
Sbjct  182  SFSDAENTVVCVLDNFDGNSSKVAELLIKNGFKEAYYIR  220



>ref|XP_010514185.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Camelina sativa]
Length=264

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 64/99 (65%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL  + ++QLLDIR  + L  + SP+++ L K  V V +   D+ GFLK++  
Sbjct  122  SAVNAFRKLKTEPDSQLLDIRDDKTLALLASPNLKFLGKSSVQVPFCESDEEGFLKRVKG  181

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F  PE+T + +LD FDG+S  VAEL+ ENGFK AY I+
Sbjct  182  SFSNPEDTVVCVLDNFDGNSSKVAELLIENGFKEAYYIR  220



>ref|XP_009342380.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Pyrus x bretschneideri]
 ref|XP_009342396.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Pyrus x bretschneideri]
Length=364

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 63/95 (66%), Gaps = 0/95 (0%)
 Frame = +1

Query  511  AYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSLKFKE  690
            A+ KL DD NAQLLDIR  + L  + SP+++ L K  V V ++ +D+ GF+K++  +F  
Sbjct  164  AFRKLRDDPNAQLLDIRDEKSLGYLKSPNLKILNKGTVQVPFSEDDEAGFVKRVLERFAN  223

Query  691  PENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            P  T L IL  FDG S  VAEL+ +NGFK AYAIK
Sbjct  224  PAETVLCILGNFDGISIKVAELLFKNGFKEAYAIK  258



>gb|KHG15131.1| hypothetical protein F383_06661 [Gossypium arboreum]
Length=339

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 68/111 (61%), Gaps = 3/111 (3%)
 Frame = +1

Query  463  QLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNG  642
            Q LSK K      A  A+ KL DD +AQLLDIR  + L  + SP++  L K  V + +  
Sbjct  128  QYLSKCK---FIPAIDAFRKLRDDPSAQLLDIRKNKTLASLASPNLSFLNKDTVQLQFTA  184

Query  643  EDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            E++ GF+KK+  KF  P NT + +LD FDG+S   AEL+ + GFK AYAI+
Sbjct  185  ENEDGFVKKVLEKFPNPANTVICVLDNFDGNSLKAAELLYKKGFKEAYAIR  235



>ref|XP_008382545.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Malus domestica]
Length=364

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 63/95 (66%), Gaps = 0/95 (0%)
 Frame = +1

Query  511  AYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSLKFKE  690
            A+ KL DD NAQLLDIR  + L  + SP+++ L K  V V ++ +D+ GF+K++  +F  
Sbjct  164  AFRKLRDDPNAQLLDIRDQKSLGYLKSPNLKILNKGTVQVPFSEDDEAGFVKRVLERFAN  223

Query  691  PENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            P  T L +L  FDG S  VAEL+ +NGFK AYAIK
Sbjct  224  PAETVLCVLGNFDGISIKVAELLFKNGFKEAYAIK  258



>gb|EMT02847.1| hypothetical protein F775_12138 [Aegilops tauschii]
Length=413

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 64/95 (67%), Gaps = 0/95 (0%)
 Frame = +1

Query  511  AYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSLKFKE  690
            A+ KL D   AQLLDIR    ++ +  P++R ++K  V V ++ ED+ GFL+++  +F +
Sbjct  82   AFRKLRDVPEAQLLDIRRGNSVRFMAPPNLRLVEKSAVQVEFHEEDEKGFLREVLARFPD  141

Query  691  PENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            P NT + +LD FDG+S  VAEL+  NGFK AYAIK
Sbjct  142  PANTVVCVLDNFDGNSMKVAELLFNNGFKEAYAIK  176



>ref|XP_004290114.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=338

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 63/99 (64%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            S   A+ KL +D   QLLDIR  + LK + SP++R + K  V V ++  D+ GF+KK+  
Sbjct  130  SVFNAFRKLKEDPAVQLLDIRDEKSLKYLKSPNLRIVNKDAVQVRFDENDEDGFVKKVLQ  189

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            KF +P NT + +L  FDG S  VAEL+ +NGFK  YAIK
Sbjct  190  KFGDPGNTVVCVLGNFDGISIKVAELLVKNGFKETYAIK  228



>ref|XP_006350434.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic-like 
[Solanum tuberosum]
Length=381

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 63/99 (64%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+AKL DD  +QLLDIR  + L  + SP +R   K  + V +   D+  F+K +  
Sbjct  176  SAVEAFAKLRDDPTSQLLDIRDNKSLAYLPSPSLRMFNKSVMQVEFRQGDEDAFVKSVFQ  235

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            KF +P+NTTL ++D FDG+S  VAEL+ +NG K A AI+
Sbjct  236  KFNDPQNTTLCVIDNFDGNSIKVAELLVKNGLKEACAIR  274



>ref|XP_006299528.1| hypothetical protein CARUB_v10015700mg [Capsella rubella]
 gb|EOA32426.1| hypothetical protein CARUB_v10015700mg [Capsella rubella]
Length=263

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 65/99 (66%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL ++ ++QLLDIR  + L  + SP+++ L K  V V ++  D+  FLK++  
Sbjct  121  SAMNAFRKLKNEPDSQLLDIRDEKTLALLASPNLKFLGKSSVQVPFSESDEEEFLKRVKG  180

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F  PE+T + +LD FDG+S  VAEL+ ENGFK AY I+
Sbjct  181  CFSVPEDTVVCVLDNFDGNSSKVAELLIENGFKEAYYIR  219



>gb|KJB22677.1| hypothetical protein B456_004G060200 [Gossypium raimondii]
Length=353

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = +1

Query  511  AYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSLKFKE  690
            A+ KL DD +AQLLDIR  + L  + SP++  L K  V + +  E++ GF+K++  KF  
Sbjct  169  AFRKLRDDPSAQLLDIRENKTLASLASPNLSFLNKDTVQLQFTAENEDGFVKEVLEKFPN  228

Query  691  PENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            P NT + +LD FDG+S   AEL+ + GFK AYAI+
Sbjct  229  PANTVICVLDNFDGNSLKAAELLYKKGFKEAYAIR  263



>gb|KJB22678.1| hypothetical protein B456_004G060200 [Gossypium raimondii]
Length=356

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 63/98 (64%), Gaps = 0/98 (0%)
 Frame = +1

Query  502  AKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSLK  681
            A  A+ KL DD +AQLLDIR  + L  + SP++  L K  V + +  E++ GF+K++  K
Sbjct  166  AIDAFRKLRDDPSAQLLDIRENKTLASLASPNLSFLNKDTVQLQFTAENEDGFVKEVLEK  225

Query  682  FKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            F  P NT + +LD FDG+S   AEL+ + GFK AYAI+
Sbjct  226  FPNPANTVICVLDNFDGNSLKAAELLYKKGFKEAYAIR  263



>gb|KJB22675.1| hypothetical protein B456_004G060200 [Gossypium raimondii]
 gb|KJB22676.1| hypothetical protein B456_004G060200 [Gossypium raimondii]
Length=367

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 63/98 (64%), Gaps = 0/98 (0%)
 Frame = +1

Query  502  AKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSLK  681
            A  A+ KL DD +AQLLDIR  + L  + SP++  L K  V + +  E++ GF+K++  K
Sbjct  166  AIDAFRKLRDDPSAQLLDIRENKTLASLASPNLSFLNKDTVQLQFTAENEDGFVKEVLEK  225

Query  682  FKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            F  P NT + +LD FDG+S   AEL+ + GFK AYAI+
Sbjct  226  FPNPANTVICVLDNFDGNSLKAAELLYKKGFKEAYAIR  263



>ref|XP_001770053.1| predicted protein [Physcomitrella patens]
 gb|EDQ65229.1| predicted protein [Physcomitrella patens]
Length=567

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 69/100 (69%), Gaps = 2/100 (2%)
 Frame = +1

Query  499  SAKTAYAKLAD-DANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLS  675
            SA  AY KL++ +  AQLLDIR   ++K  GSP+++ +KK  + V Y  +D   F+ K+ 
Sbjct  152  SAVEAYDKLSNPELKAQLLDIRAPEDIKTEGSPNLKSIKKTVLKVPYAADDDT-FVDKVI  210

Query  676  LKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             K K+ ENTTL+ILD+FDG S  VA+L+  +GFK+AYAIK
Sbjct  211  AKSKDAENTTLYILDRFDGDSATVAKLLANSGFKSAYAIK  250



>ref|XP_009763928.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Nicotiana sylvestris]
Length=355

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 65/99 (66%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL DD ++ L+D+R  + L  + SP++  L K  V V +   D+  F+K++  
Sbjct  150  SAVDAFGKLRDDPSSLLIDVRDKKSLAYLPSPNLIMLNKSVVQVEFREGDEDAFVKRVFE  209

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             FK+PENTT+ +LD FDG+S  VAEL+ +NG K AYAI+
Sbjct  210  NFKQPENTTVCVLDNFDGNSIKVAELLVKNGLKEAYAIR  248



>dbj|BAK02213.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=482

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 63/95 (66%), Gaps = 0/95 (0%)
 Frame = +1

Query  511  AYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSLKFKE  690
            A+ KL D   A+LLDIR    ++ +  P++R ++K  V V ++ ED+ GFL ++  +F +
Sbjct  146  AFRKLRDVPEARLLDIRRGNSVRFMAPPNLRLVEKSAVQVEFDEEDEKGFLGEVLARFPD  205

Query  691  PENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            P NT + +LD FDG+S  VAEL+  NGFK AYAIK
Sbjct  206  PANTVVCVLDNFDGNSMKVAELLFNNGFKEAYAIK  240



>gb|AFK33973.1| unknown [Medicago truncatula]
Length=248

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL D+A++QLLDIR  + +K +GSP ++ + K+ V   +   ++ GF+KK+  
Sbjct  147  SAIDAFRKLRDEADSQLLDIRDRKNVKFLGSPSLKMVNKEVVQFEFVEGNEDGFVKKVLE  206

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFK  777
            +FK+  NT +F+LD FDG+S  VAEL+ +NGFK
Sbjct  207  RFKDASNTAVFVLDSFDGNSMKVAELLFKNGFK  239



>gb|KCW48714.1| hypothetical protein EUGRSUZ_K02359 [Eucalyptus grandis]
Length=271

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 63/99 (64%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL DD +AQLLDIR  + +  + SPD+  + K  V V ++   +  F K +  
Sbjct  140  SAIDAFRKLRDDPSAQLLDIRDRKSVAAMASPDLMYVSKAAVHVPFDEGREDEFAKAVLA  199

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F++P +T L ILD FDG+S  VAEL+ +NGFK AYAIK
Sbjct  200  SFEDPADTVLCILDNFDGNSMKVAELLFKNGFKEAYAIK  238



>gb|KCW48713.1| hypothetical protein EUGRSUZ_K02359 [Eucalyptus grandis]
Length=345

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 63/99 (64%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL DD +AQLLDIR  + +  + SPD+  + K  V V ++   +  F K +  
Sbjct  140  SAIDAFRKLRDDPSAQLLDIRDRKSVAAMASPDLMYVSKAAVHVPFDEGREDEFAKAVLA  199

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F++P +T L ILD FDG+S  VAEL+ +NGFK AYAIK
Sbjct  200  SFEDPADTVLCILDNFDGNSMKVAELLFKNGFKEAYAIK  238



>ref|XP_010037088.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Eucalyptus grandis]
Length=365

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 63/99 (64%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL DD +AQLLDIR  + +  + SPD+  + K  V V ++   +  F K +  
Sbjct  160  SAIDAFRKLRDDPSAQLLDIRDRKSVAAMASPDLMYVSKAAVHVPFDEGREDEFAKAVLA  219

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             F++P +T L ILD FDG+S  VAEL+ +NGFK AYAIK
Sbjct  220  SFEDPADTVLCILDNFDGNSMKVAELLFKNGFKEAYAIK  258



>gb|KHN40513.1| Hypothetical protein glysoja_001011 [Glycine soja]
Length=285

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 67/101 (66%), Gaps = 5/101 (5%)
 Frame = +1

Query  502  AKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY---NGEDKPGFLKKL  672
            A  A+ KL DD NAQLLDIR  + ++ + SP+++  +K+   V +     ED+  F+KK+
Sbjct  68   AIDAFRKLRDDPNAQLLDIRDEKNVRFLKSPNLKMFEKEVAQVEFAEDGNEDE--FVKKV  125

Query  673  SLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
              +FK+  NT + +LD FDG+S  VAE++ +NGFK AYAI+
Sbjct  126  LRRFKDAPNTVVCVLDSFDGNSMKVAEVLFKNGFKEAYAIR  166



>emb|CDM85401.1| unnamed protein product [Triticum aestivum]
Length=483

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = +1

Query  511  AYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSLKFKE  690
            A+ KL D   AQLLDIR    ++ +  P++R ++K  V + ++ ED+  FL ++  +F +
Sbjct  147  AFRKLRDVPEAQLLDIRRGNSVRFMAPPNLRLVEKSAVQMEFDEEDEKRFLGEVLARFPD  206

Query  691  PENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            P NT + +LD FDG+S  VAEL+  NGFK AYAIK
Sbjct  207  PANTVVCVLDNFDGNSMKVAELLFNNGFKEAYAIK  241



>gb|EAY76777.1| hypothetical protein OsI_04733 [Oryza sativa Indica Group]
Length=340

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 69/99 (70%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL D+  AQLLDIR  + ++ + SP++R ++K  V V ++ ED+ GF+K++  
Sbjct  147  SAIDAFRKLRDEPGAQLLDIRRGKSVRFMASPNLRLVEKSAVQVEFDEEDEEGFVKEVLA  206

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            +F +P NT + +LD FDG+S  VAEL+  NGFK AYAIK
Sbjct  207  RFPDPANTVVCVLDNFDGNSMKVAELLFNNGFKEAYAIK  245



>dbj|BAD82378.1| rhodanese domain-containing protein-like [Oryza sativa Japonica 
Group]
 gb|EEE55783.1| hypothetical protein OsJ_04356 [Oryza sativa Japonica Group]
Length=356

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 69/99 (70%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL D+  AQLLDIR  + ++ + SP++R ++K  V V ++ ED+ GF+K++  
Sbjct  147  SAIDAFRKLRDEPGAQLLDIRRGKSVRFMASPNLRLVEKSAVQVEFDEEDEEGFVKEVLA  206

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            +F +P NT + +LD FDG+S  VAEL+  NGFK AYAIK
Sbjct  207  RFPDPANTVVCVLDNFDGNSMKVAELLFNNGFKEAYAIK  245



>ref|NP_001045047.1| Os01g0889800 [Oryza sativa Japonica Group]
 dbj|BAF06961.1| Os01g0889800 [Oryza sativa Japonica Group]
 dbj|BAG91763.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96894.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 69/99 (70%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL D+  AQLLDIR  + ++ + SP++R ++K  V V ++ ED+ GF+K++  
Sbjct  152  SAIDAFRKLRDEPGAQLLDIRRGKSVRFMASPNLRLVEKSAVQVEFDEEDEEGFVKEVLA  211

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            +F +P NT + +LD FDG+S  VAEL+  NGFK AYAIK
Sbjct  212  RFPDPANTVVCVLDNFDGNSMKVAELLFNNGFKEAYAIK  250



>ref|XP_007139685.1| hypothetical protein PHAVU_008G050400g [Phaseolus vulgaris]
 gb|ESW11679.1| hypothetical protein PHAVU_008G050400g [Phaseolus vulgaris]
Length=336

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY-NGEDKPGFLKKLS  675
            SA  A+ +L DD +++LLDIR  + ++ + SP+++ ++K+ V V + +G ++  F+KK+ 
Sbjct  129  SAIDAFRRLRDDPSSKLLDIRDEKSVRFMRSPNLKFIEKEVVHVEFTDGGNEDEFVKKVL  188

Query  676  LKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             +FK+  NT L +LD FD +S  VAEL+ +NGFK AYAIK
Sbjct  189  GRFKDASNTALCVLDSFDDNSMKVAELLFKNGFKEAYAIK  228



>ref|XP_010908500.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Elaeis guineensis]
Length=368

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 67/99 (68%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL D  N+QLLDIR  + ++ + SP+++   K  V V +   ++ GF+K++  
Sbjct  162  SAIDAFRKLRDVPNSQLLDIRNKQSVQFISSPNLKIFDKDVVQVEFAEGEEEGFVKEVVK  221

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            KF++P NT + +LD FDG+S  VAEL+ +NGFK AYAIK
Sbjct  222  KFRDPGNTIICVLDNFDGNSLKVAELLFKNGFKEAYAIK  260



>ref|XP_006587793.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic-like 
isoform X2 [Glycine max]
Length=326

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 66/102 (65%), Gaps = 5/102 (5%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY---NGEDKPGFLKK  669
            SA  A+ KL DD NAQLLDIR  + ++ + SP+++  +K+   V +     ED+  F+ K
Sbjct  135  SAIDAFRKLRDDPNAQLLDIRDQKNVRFLKSPNLKMFEKEVAQVEFAEDGNEDE--FVNK  192

Query  670  LSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            +  +FK+  NT + +LD FD +S  VAEL+ +NGFK AYAI+
Sbjct  193  VLGRFKDAPNTVICVLDSFDSNSLKVAELLFKNGFKEAYAIR  234



>ref|XP_003534488.2| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic-like 
isoform X1 [Glycine max]
Length=342

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 66/102 (65%), Gaps = 5/102 (5%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY---NGEDKPGFLKK  669
            SA  A+ KL DD NAQLLDIR  + ++ + SP+++  +K+   V +     ED+  F+ K
Sbjct  135  SAIDAFRKLRDDPNAQLLDIRDQKNVRFLKSPNLKMFEKEVAQVEFAEDGNEDE--FVNK  192

Query  670  LSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            +  +FK+  NT + +LD FD +S  VAEL+ +NGFK AYAI+
Sbjct  193  VLGRFKDAPNTVICVLDSFDSNSLKVAELLFKNGFKEAYAIR  234



>gb|KHN22145.1| Hypothetical protein glysoja_042902 [Glycine soja]
Length=342

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 66/102 (65%), Gaps = 5/102 (5%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY---NGEDKPGFLKK  669
            SA  A+ KL DD NAQLLDIR  + ++ + SP+++  +K+   V +     ED+  F+ K
Sbjct  135  SAIDAFRKLRDDPNAQLLDIRDQKNVRFLKSPNLKMFEKEVAQVEFAEDGNEDE--FVNK  192

Query  670  LSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            +  +FK+  NT + +LD FD +S  VAEL+ +NGFK AYAI+
Sbjct  193  VLGRFKDAPNTVICVLDSFDSNSLKVAELLFKNGFKEAYAIR  234



>ref|XP_003551701.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic-like 
[Glycine max]
Length=341

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 67/102 (66%), Gaps = 5/102 (5%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY---NGEDKPGFLKK  669
            SA  A+ KL DD NAQLLDIR  + ++ + S +++  +K+   V +     ED+  F+KK
Sbjct  134  SAIDAFRKLRDDPNAQLLDIRDEKNVRFLKSSNLKMFEKEVAQVEFAEDGNEDE--FVKK  191

Query  670  LSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            +  +FK+  NT + +LD FDG+S  VAE++ +NGFK AYAI+
Sbjct  192  VLGRFKDAPNTVVCVLDSFDGNSMKVAEVLFKNGFKEAYAIR  233



>dbj|BAB01317.1| unnamed protein product [Arabidopsis thaliana]
Length=316

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 70/128 (55%), Gaps = 22/128 (17%)
 Frame = +1

Query  469  LSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGED  648
            L K KP    SA  A+ KL +++++QLLDIR  + L  + SP+++ L K  V V ++  D
Sbjct  148  LRKYKPI---SAMNAFRKLKNESDSQLLDIRDVKTLALLASPNLKFLGKSSVQVPFSEND  204

Query  649  KPGFLKKLSLKFKEPENTTLFILDK-------------------FDGSSELVAELVTENG  771
            + GFL K+   F + ENT + +LD                    FDG+S  VAEL+ +NG
Sbjct  205  EEGFLTKVKGSFSDAENTVVCVLDNCSLVERVVSYVFTFDVEGSFDGNSSKVAELLIKNG  264

Query  772  FKAAYAIK  795
            FK AY I+
Sbjct  265  FKEAYYIR  272



>ref|XP_008788262.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=368

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 64/99 (65%), Gaps = 0/99 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL D  N+QLLDIR  + ++ + SP++    K  V V +   ++ GF+K++  
Sbjct  162  SAIDAFRKLRDVPNSQLLDIRSKKSVQFMSSPNLNIFDKDAVQVEFAEGEEEGFVKEVMK  221

Query  679  KFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
             FK+P NT + +LD FDG S  VAEL+ +NGFK AYAIK
Sbjct  222  NFKDPANTIICVLDSFDGVSLEVAELLFKNGFKEAYAIK  260



>ref|XP_006418621.1| hypothetical protein EUTSA_v10002639mg [Eutrema salsugineum]
 gb|ESQ37057.1| hypothetical protein EUTSA_v10002639mg [Eutrema salsugineum]
Length=203

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL    ++QLLDIR  + L  + SP+++ L K  + V Y+ ED+ GFLK++  
Sbjct  127  SAMNAFRKLKSQPDSQLLDIRDEKTLASLASPNLKFLGKSSIQVPYSEEDESGFLKRVKG  186

Query  679  KFKEPENTTLFILDK  723
             F +PENT + +LDK
Sbjct  187  SFSDPENTVVCVLDK  201



>ref|XP_006418622.1| hypothetical protein EUTSA_v10002639mg [Eutrema salsugineum]
 gb|ESQ37058.1| hypothetical protein EUTSA_v10002639mg [Eutrema salsugineum]
Length=240

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL    ++QLLDIR  + L  + SP+++ L K  + V Y+ ED+ GFLK++  
Sbjct  127  SAMNAFRKLKSQPDSQLLDIRDEKTLASLASPNLKFLGKSSIQVPYSEEDESGFLKRVKG  186

Query  679  KFKEPENTTLFILDK  723
             F +PENT + +LDK
Sbjct  187  SFSDPENTVVCVLDK  201



>emb|CDX71001.1| BnaC03g10850D [Brassica napus]
Length=217

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  628  VSYNGEDKPGFLKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAA  783
            V Y+GED+ G LK++   F +PENT + +LD FDG+S  VAEL+ ENGFK A
Sbjct  166  VPYSGEDESGVLKRVKGSFSDPENTVVCVLDNFDGNSMKVAELLVENGFKEA  217



>gb|ERN20207.1| hypothetical protein AMTR_s00066p00130420 [Amborella trichopoda]
Length=242

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +1

Query  511  AYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN-GEDKPGFLKKLSLKFK  687
            A+ KL DD +  LLDIRPA+ +  +GSP+++ LKK  V V Y  GED+  F+KK+  +  
Sbjct  172  AFRKLRDDPSFILLDIRPAKSVLAIGSPNLKTLKKTCVNVEYREGEDE-DFVKKVMEELS  230

Query  688  EPENTTLFILDK  723
            +P NTT+ +LDK
Sbjct  231  DPPNTTVCVLDK  242



>ref|NP_001136579.1| hypothetical protein [Zea mays]
 gb|ACF82207.1| unknown [Zea mays]
 gb|AFW84329.1| hypothetical protein ZEAMMB73_537769 [Zea mays]
Length=218

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL D    QLLDIR  + ++ +  P ++ + K  V V ++ ED+ GF+K++  
Sbjct  144  SAIDAFRKLRDVPEVQLLDIRRGKSVRFMAPPKLKLIDKSTVQVEFDEEDEKGFVKEVLA  203

Query  679  KFKEPENTTLFILDK  723
            +F +P NT + +LDK
Sbjct  204  RFPDPANTVVCVLDK  218



>ref|XP_008788263.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
isoform X2 [Phoenix dactylifera]
Length=175

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  661  LKKLSLKFKEPENTTLFILDKFDGSSELVAELVTENGFKAAYAIK  795
            +K++   FK+P NT + +LD FDG S  VAEL+ +NGFK AYAIK
Sbjct  23   VKEVMKNFKDPANTIICVLDSFDGVSLEVAELLFKNGFKEAYAIK  67



>gb|KCW48715.1| hypothetical protein EUGRSUZ_K02359 [Eucalyptus grandis]
Length=214

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +1

Query  499  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGFLKKLSL  678
            SA  A+ KL DD +AQLLDIR  + +  + SPD+  + K  V V ++   +  F K +  
Sbjct  140  SAIDAFRKLRDDPSAQLLDIRDRKSVAAMASPDLMYVSKAAVHVPFDEGREDEFAKAVLA  199

Query  679  KFKEPENTTLFILDK  723
             F++P +T L ILDK
Sbjct  200  SFEDPADTVLCILDK  214



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1628027073272