BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6459

Length=698
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAM15096.1|  putative prolylcarboxypeptidase                         292   1e-92   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850050.1|  alpha/beta-Hydrolases superfamily protein             291   2e-92   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294084.1|  hypothetical protein CARUB_v10023078mg             290   7e-92   Capsella rubella
emb|CDY20293.1|  BnaC04g36630D                                          289   2e-91   Brassica napus [oilseed rape]
ref|XP_007011978.1|  Alpha/beta-Hydrolases superfamily protein is...    286   6e-91   
gb|KJB54926.1|  hypothetical protein B456_009G054400                    286   7e-91   Gossypium raimondii
ref|XP_010472431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    288   7e-91   Camelina sativa [gold-of-pleasure]
ref|XP_009767201.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        286   3e-90   Nicotiana sylvestris
gb|KJB54925.1|  hypothetical protein B456_009G054400                    286   3e-90   Gossypium raimondii
ref|XP_010419296.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    285   3e-90   
ref|XP_007011977.1|  Alpha/beta-Hydrolases superfamily protein is...    285   6e-90   
ref|XP_006404933.1|  hypothetical protein EUTSA_v10000143mg             285   7e-90   Eutrema salsugineum [saltwater cress]
ref|XP_009617834.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        285   8e-90   Nicotiana tomentosiformis
gb|EYU25337.1|  hypothetical protein MIMGU_mgv1a004964mg                285   1e-89   Erythranthe guttata [common monkey flower]
ref|XP_002523506.1|  lysosomal pro-X carboxypeptidase, putative         285   1e-89   Ricinus communis
ref|XP_010429398.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    285   1e-89   Camelina sativa [gold-of-pleasure]
emb|CDY46135.1|  BnaA04g14230D                                          284   2e-89   Brassica napus [oilseed rape]
gb|KHG26338.1|  Lysosomal Pro-X carboxypeptidase                        284   2e-89   Gossypium arboreum [tree cotton]
ref|XP_009140531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        285   3e-89   Brassica rapa
ref|XP_002878742.1|  serine carboxypeptidase S28 family protein         283   3e-89   Arabidopsis lyrata subsp. lyrata
ref|XP_002324555.2|  serine carboxypeptidase S28 family protein         283   6e-89   Populus trichocarpa [western balsam poplar]
ref|XP_010525816.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        282   1e-88   
ref|XP_011017985.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    282   1e-88   Populus euphratica
gb|KHG29529.1|  Lysosomal Pro-X carboxypeptidase                        281   2e-88   Gossypium arboreum [tree cotton]
emb|CDP10200.1|  unnamed protein product                                281   2e-88   Coffea canephora [robusta coffee]
gb|KJB07579.1|  hypothetical protein B456_001G030800                    281   4e-88   Gossypium raimondii
gb|KJB07578.1|  hypothetical protein B456_001G030800                    280   4e-88   Gossypium raimondii
ref|XP_012071462.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        281   6e-88   Jatropha curcas
emb|CBI18675.3|  unnamed protein product                                280   1e-87   Vitis vinifera
ref|XP_003633162.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        279   2e-87   
ref|XP_010419297.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    286   2e-87   
gb|KFK32665.1|  serine carboxypeptidase s28 family protein              278   6e-87   Arabis alpina [alpine rockcress]
ref|XP_006343677.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    277   1e-86   Solanum tuberosum [potatoes]
ref|XP_004242567.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        276   2e-86   Solanum lycopersicum
ref|XP_008457347.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        275   6e-86   Cucumis melo [Oriental melon]
emb|CDY28234.1|  BnaA01g06150D                                          268   7e-86   Brassica napus [oilseed rape]
ref|XP_004139280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        275   1e-85   Cucumis sativus [cucumbers]
ref|XP_010047139.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        274   2e-85   Eucalyptus grandis [rose gum]
ref|XP_008775539.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    266   1e-83   
ref|XP_010275727.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    268   2e-83   Nelumbo nucifera [Indian lotus]
ref|XP_010275726.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    269   3e-83   Nelumbo nucifera [Indian lotus]
ref|XP_002869352.1|  serine carboxypeptidase S28 family protein         266   2e-82   Arabidopsis lyrata subsp. lyrata
ref|XP_009127344.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    266   2e-82   Brassica rapa
ref|XP_010932235.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    266   3e-82   Elaeis guineensis
ref|XP_011622147.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    262   3e-81   Amborella trichopoda
ref|XP_006285773.1|  hypothetical protein CARUB_v10007247mg             263   3e-81   
ref|XP_010432914.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    263   4e-81   Camelina sativa [gold-of-pleasure]
ref|XP_006841179.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    262   1e-80   Amborella trichopoda
ref|XP_009390988.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        262   1e-80   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK43799.1|  hypothetical protein AALP_AA1G174100                    259   8e-80   Arabis alpina [alpine rockcress]
ref|XP_004965729.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    251   5e-76   Setaria italica
ref|XP_002438750.1|  hypothetical protein SORBIDRAFT_10g025520          251   8e-76   Sorghum bicolor [broomcorn]
gb|AFW76173.1|  putative serine peptidase S28 family protein            237   5e-74   
ref|XP_003563318.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        243   5e-73   Brachypodium distachyon [annual false brome]
gb|ACR34132.1|  unknown                                                 237   1e-72   Zea mays [maize]
ref|XP_008799734.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    241   1e-72   
dbj|BAJ86079.1|  predicted protein                                      241   1e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006657192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    238   2e-71   Oryza brachyantha
gb|EMT22763.1|  Lysosomal Pro-X carboxypeptidase                        232   3e-71   
dbj|BAJ92142.1|  predicted protein                                      238   4e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010931151.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    236   5e-71   Elaeis guineensis
ref|XP_008659849.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    237   6e-71   Zea mays [maize]
dbj|BAJ87416.1|  predicted protein                                      236   9e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW87519.1|  putative serine peptidase S28 family protein            237   1e-70   
ref|NP_001142279.1|  uncharacterized protein LOC100274448 precursor     236   2e-70   Zea mays [maize]
ref|NP_001058206.1|  Os06g0647400                                       236   2e-70   
ref|XP_007027868.1|  Alpha/beta-Hydrolases superfamily protein is...    232   2e-70   
emb|CAN61013.1|  hypothetical protein VITISV_036738                     236   3e-70   Vitis vinifera
emb|CBI30345.3|  unnamed protein product                                234   3e-70   Vitis vinifera
gb|KDO70542.1|  hypothetical protein CISIN_1g0106561mg                  231   3e-70   Citrus sinensis [apfelsine]
ref|XP_002281618.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    234   4e-70   Vitis vinifera
ref|XP_006430124.1|  hypothetical protein CICLE_v10011529mg             231   7e-70   
gb|ACG41459.1|  lysosomal Pro-X carboxypeptidase precursor              234   9e-70   Zea mays [maize]
ref|XP_006481710.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    233   2e-69   Citrus sinensis [apfelsine]
ref|XP_010246130.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    233   2e-69   Nelumbo nucifera [Indian lotus]
gb|KJB16581.1|  hypothetical protein B456_002G237800                    231   2e-69   Gossypium raimondii
gb|KCW90505.1|  hypothetical protein EUGRSUZ_A02624                     231   3e-69   Eucalyptus grandis [rose gum]
gb|KJB16583.1|  hypothetical protein B456_002G237800                    230   3e-69   Gossypium raimondii
gb|EMT03388.1|  Lysosomal Pro-X carboxypeptidase                        230   5e-69   
gb|EMT22761.1|  Lysosomal Pro-X carboxypeptidase                        232   5e-69   
gb|EEC81080.1|  hypothetical protein OsI_23902                          232   5e-69   Oryza sativa Indica Group [Indian rice]
gb|KJB16582.1|  hypothetical protein B456_002G237800                    230   5e-69   Gossypium raimondii
ref|XP_006430123.1|  hypothetical protein CICLE_v10011529mg             231   6e-69   Citrus clementina [clementine]
ref|XP_010059402.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    231   7e-69   Eucalyptus grandis [rose gum]
ref|XP_007027867.1|  Alpha/beta-Hydrolases superfamily protein is...    231   1e-68   
gb|KJB16580.1|  hypothetical protein B456_002G237800                    230   2e-68   Gossypium raimondii
ref|XP_002308456.2|  hypothetical protein POPTR_0006s22440g             229   3e-68   Populus trichocarpa [western balsam poplar]
ref|XP_012074389.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    229   3e-68   Jatropha curcas
emb|CDP10629.1|  unnamed protein product                                229   3e-68   Coffea canephora [robusta coffee]
ref|XP_011046918.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    229   4e-68   Populus euphratica
ref|XP_011094280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        229   5e-68   Sesamum indicum [beniseed]
gb|EMS54706.1|  Lysosomal Pro-X carboxypeptidase                        231   8e-68   Triticum urartu
ref|XP_006854747.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        228   9e-68   Amborella trichopoda
ref|XP_006836096.2|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    222   2e-67   
gb|EMT13135.1|  Lysosomal Pro-X carboxypeptidase                        228   2e-67   
ref|XP_009372536.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    227   3e-67   Pyrus x bretschneideri [bai li]
gb|KFK28424.1|  hypothetical protein AALP_AA8G512800                    227   3e-67   Arabis alpina [alpine rockcress]
gb|KDO78810.1|  hypothetical protein CISIN_1g0096312mg                  220   4e-67   Citrus sinensis [apfelsine]
ref|XP_007162943.1|  hypothetical protein PHAVU_001G193200g             226   5e-67   Phaseolus vulgaris [French bean]
ref|XP_008350184.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    226   5e-67   
ref|XP_009624783.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    226   6e-67   Nicotiana tomentosiformis
ref|XP_009801420.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    226   1e-66   Nicotiana sylvestris
ref|XP_002530520.1|  lysosomal pro-X carboxypeptidase, putative         226   1e-66   Ricinus communis
gb|KEH24168.1|  lysosomal pro-X carboxypeptidase-like protein           224   1e-66   Medicago truncatula
ref|XP_002438752.1|  hypothetical protein SORBIDRAFT_10g025540          219   2e-66   
gb|EPS74090.1|  hypothetical protein M569_00662                         224   2e-66   Genlisea aurea
ref|XP_007047633.1|  Serine carboxypeptidase S28 family protein i...    221   4e-66   
ref|XP_009383556.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    224   4e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH24167.1|  lysosomal pro-X carboxypeptidase-like protein           224   4e-66   Medicago truncatula
ref|XP_007203816.1|  hypothetical protein PRUPE_ppa005504m2g            219   4e-66   
gb|KEH24169.1|  lysosomal pro-X carboxypeptidase-like protein           223   5e-66   Medicago truncatula
ref|XP_010683638.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    223   7e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010518734.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        223   7e-66   Tarenaya hassleriana [spider flower]
gb|KJB18075.1|  hypothetical protein B456_003G033300                    223   7e-66   Gossypium raimondii
gb|KJB18076.1|  hypothetical protein B456_003G033300                    224   8e-66   Gossypium raimondii
ref|XP_010680789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    223   8e-66   
gb|KDO78808.1|  hypothetical protein CISIN_1g0096312mg                  219   1e-65   Citrus sinensis [apfelsine]
gb|EPS59259.1|  hypothetical protein M569_15548                         222   1e-65   Genlisea aurea
ref|XP_010024706.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    223   2e-65   
emb|CDY45627.1|  BnaCnng13350D                                          222   2e-65   Brassica napus [oilseed rape]
ref|XP_006577089.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    219   2e-65   Glycine max [soybeans]
ref|XP_007205160.1|  hypothetical protein PRUPE_ppa005445mg             218   3e-65   
ref|XP_007047632.1|  Serine carboxypeptidase S28 family protein i...    222   3e-65   
gb|EYU41362.1|  hypothetical protein MIMGU_mgv1a0060842mg               215   4e-65   Erythranthe guttata [common monkey flower]
gb|KDO78806.1|  hypothetical protein CISIN_1g0096312mg                  219   4e-65   Citrus sinensis [apfelsine]
ref|XP_006380821.1|  hypothetical protein POPTR_0007s14600g             220   5e-65   
ref|XP_007205161.1|  hypothetical protein PRUPE_ppa005445mg             218   6e-65   
ref|XP_010245642.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    219   6e-65   Nelumbo nucifera [Indian lotus]
gb|KDO78803.1|  hypothetical protein CISIN_1g0096312mg                  220   8e-65   Citrus sinensis [apfelsine]
ref|XP_011031335.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        221   8e-65   Populus euphratica
gb|EYU18082.1|  hypothetical protein MIMGU_mgv1a005183mg                220   9e-65   Erythranthe guttata [common monkey flower]
gb|AAL77662.1|  AT5g65760/MPA24_11                                      220   9e-65   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201377.2|  Serine carboxypeptidase S28 family protein            221   9e-65   Arabidopsis thaliana [mouse-ear cress]
gb|ABR17702.1|  unknown                                                 221   9e-65   Picea sitchensis
ref|XP_004494225.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    220   9e-65   Cicer arietinum [garbanzo]
ref|XP_010245641.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    218   1e-64   Nelumbo nucifera [Indian lotus]
ref|XP_002310325.2|  hypothetical protein POPTR_0007s14600g             220   1e-64   
ref|XP_006466409.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    220   1e-64   
ref|XP_009773191.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        219   2e-64   Nicotiana sylvestris
ref|XP_010099406.1|  Lysosomal Pro-X carboxypeptidase                   219   2e-64   Morus notabilis
ref|XP_010023342.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    220   2e-64   Eucalyptus grandis [rose gum]
ref|XP_010463531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    219   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_011466418.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    219   2e-64   Fragaria vesca subsp. vesca
ref|XP_007205162.1|  hypothetical protein PRUPE_ppa005445mg             218   3e-64   
emb|CDY08753.1|  BnaA06g24710D                                          219   3e-64   Brassica napus [oilseed rape]
ref|XP_009150668.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        219   3e-64   Brassica rapa
ref|XP_010316042.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    219   3e-64   Solanum lycopersicum
ref|XP_004288288.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    219   3e-64   Fragaria vesca subsp. vesca
ref|XP_006363792.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    219   3e-64   Solanum tuberosum [potatoes]
ref|XP_006577088.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    219   3e-64   Glycine max [soybeans]
gb|KHN33177.1|  Lysosomal Pro-X carboxypeptidase                        219   3e-64   Glycine soja [wild soybean]
ref|XP_010444594.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    219   3e-64   Camelina sativa [gold-of-pleasure]
gb|KHN02193.1|  Lysosomal Pro-X carboxypeptidase                        219   3e-64   Glycine soja [wild soybean]
ref|XP_004231954.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    219   3e-64   Solanum lycopersicum
ref|XP_006393989.1|  hypothetical protein EUTSA_v10003988mg             219   4e-64   Eutrema salsugineum [saltwater cress]
ref|XP_011073662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        219   4e-64   Sesamum indicum [beniseed]
ref|XP_006604647.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    219   4e-64   Glycine max [soybeans]
ref|XP_010245640.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    219   4e-64   Nelumbo nucifera [Indian lotus]
ref|XP_008237071.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        219   5e-64   Prunus mume [ume]
gb|KCW59601.1|  hypothetical protein EUGRSUZ_H023452                    216   7e-64   Eucalyptus grandis [rose gum]
ref|XP_008243494.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        218   8e-64   
emb|CDP02648.1|  unnamed protein product                                218   9e-64   Coffea canephora [robusta coffee]
gb|KCW59600.1|  hypothetical protein EUGRSUZ_H023452                    216   9e-64   Eucalyptus grandis [rose gum]
ref|XP_011467971.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    217   2e-63   Fragaria vesca subsp. vesca
ref|XP_006426159.1|  hypothetical protein CICLE_v10025375mg             217   2e-63   Citrus clementina [clementine]
ref|XP_008661011.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    217   3e-63   Zea mays [maize]
ref|XP_007155791.1|  hypothetical protein PHAVU_003G232100g             214   4e-63   Phaseolus vulgaris [French bean]
ref|XP_006280309.1|  hypothetical protein CARUB_v10026232mg             216   4e-63   Capsella rubella
ref|XP_009592890.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        216   4e-63   Nicotiana tomentosiformis
ref|XP_012079471.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        216   4e-63   Jatropha curcas
ref|XP_008442879.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    216   5e-63   Cucumis melo [Oriental melon]
ref|XP_010023346.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    216   6e-63   Eucalyptus grandis [rose gum]
gb|KCW90503.1|  hypothetical protein EUGRSUZ_A02623                     214   6e-63   Eucalyptus grandis [rose gum]
ref|XP_006577716.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    209   8e-63   
ref|XP_007155790.1|  hypothetical protein PHAVU_003G232100g             215   9e-63   Phaseolus vulgaris [French bean]
ref|XP_010026544.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    215   1e-62   Eucalyptus grandis [rose gum]
ref|XP_004136495.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    214   2e-62   Cucumis sativus [cucumbers]
gb|KCW59597.1|  hypothetical protein EUGRSUZ_H02342                     215   2e-62   Eucalyptus grandis [rose gum]
gb|KJB16585.1|  hypothetical protein B456_002G237800                    214   3e-62   Gossypium raimondii
ref|XP_008798889.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    213   4e-62   
gb|AGV54352.1|  lysosomal Pro-X carboxypeptidase-like protein           213   6e-62   Phaseolus vulgaris [French bean]
ref|XP_009342192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    213   7e-62   Pyrus x bretschneideri [bai li]
gb|KEH31545.1|  serine carboxypeptidase S28 family protein              213   9e-62   Medicago truncatula
ref|XP_008798888.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    212   1e-61   Phoenix dactylifera
ref|XP_006341228.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    212   1e-61   
ref|XP_002263389.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        212   1e-61   Vitis vinifera
ref|XP_004246480.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    211   4e-61   Solanum lycopersicum
emb|CAA16683.1|  lysosomal Pro-X carboxypeptidase - like protein        210   6e-61   Arabidopsis thaliana [mouse-ear cress]
gb|EMS54705.1|  Lysosomal Pro-X carboxypeptidase                        211   7e-61   Triticum urartu
ref|XP_004305645.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    210   8e-61   Fragaria vesca subsp. vesca
ref|XP_009406760.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    209   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAB10683.1|  lysosomal Pro-X carboxypeptidase                       209   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009406759.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    209   2e-60   
emb|CAF90249.1|  unnamed protein product                                207   6e-60   Tetraodon nigroviridis
dbj|BAK05623.1|  predicted protein                                      207   9e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010863507.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        206   2e-59   
ref|XP_010943424.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        206   4e-59   Elaeis guineensis
ref|XP_003549991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    205   5e-59   Glycine max [soybeans]
ref|XP_001776094.1|  predicted protein                                  205   6e-59   
ref|XP_002450303.1|  hypothetical protein SORBIDRAFT_05g003460          206   7e-59   Sorghum bicolor [broomcorn]
ref|XP_004509045.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    205   7e-59   Cicer arietinum [garbanzo]
ref|XP_010795079.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    199   1e-58   Notothenia coriiceps [yellowbelly rockcod]
gb|AFW87518.1|  putative serine peptidase S28 family protein            210   1e-58   
ref|XP_003576298.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    204   2e-58   Brachypodium distachyon [annual false brome]
ref|XP_008680725.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    204   3e-58   
ref|XP_005095813.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    202   4e-58   Aplysia californica
ref|XP_003968706.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        202   5e-58   
ref|XP_002962483.1|  hypothetical protein SELMODRAFT_78660              201   2e-57   
ref|XP_008842416.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    201   2e-57   Nannospalax galili
ref|XP_002737003.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    201   2e-57   Saccoglossus kowalevskii
gb|EMT30656.1|  Lysosomal Pro-X carboxypeptidase                        201   2e-57   
ref|XP_002962799.1|  hypothetical protein SELMODRAFT_78251              200   2e-57   
ref|XP_010260171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    201   2e-57   Nelumbo nucifera [Indian lotus]
ref|XP_002864979.1|  serine carboxypeptidase S28 family protein         201   3e-57   
ref|XP_005455120.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    199   4e-57   
ref|XP_009289789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    197   4e-57   
ref|XP_005455119.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    199   4e-57   Oreochromis niloticus
ref|XP_003450203.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    200   5e-57   Oreochromis niloticus
ref|XP_010190194.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    192   6e-57   Mesitornis unicolor
ref|XP_002601798.1|  hypothetical protein BRAFLDRAFT_279167             199   7e-57   Branchiostoma floridae
ref|XP_009289788.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    197   1e-56   Danio rerio [leopard danio]
ref|XP_004980174.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    199   1e-56   
gb|KHN38601.1|  Lysosomal Pro-X carboxypeptidase                        197   2e-56   Glycine soja [wild soybean]
ref|XP_004560588.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    198   2e-56   Maylandia zebra
ref|XP_008288574.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        198   2e-56   Stegastes partitus
ref|XP_006796688.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    198   2e-56   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005926584.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    198   3e-56   
ref|XP_006014312.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    191   3e-56   Latimeria chalumnae
ref|NP_001099751.2|  lysosomal Pro-X carboxypeptidase precursor         197   4e-56   Rattus norvegicus [brown rat]
ref|XP_005074170.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    197   5e-56   Mesocricetus auratus [Syrian golden hamster]
ref|NP_001002694.1|  lysosomal Pro-X carboxypeptidase precursor         197   6e-56   Danio rerio [leopard danio]
ref|XP_009289787.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    197   7e-56   Danio rerio [leopard danio]
ref|XP_004658181.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    196   1e-55   Jaculus jaculus
ref|XP_002108777.1|  hypothetical protein TRIADDRAFT_19181              196   1e-55   Trichoplax adhaerens
gb|AAH26424.1|  Prcp protein                                            195   1e-55   Mus musculus [mouse]
ref|XP_002188561.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        196   1e-55   Taeniopygia guttata
ref|XP_003203584.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        196   1e-55   Meleagris gallopavo [common turkey]
ref|XP_010629188.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    196   2e-55   Fukomys damarensis [Damara mole rat]
ref|XP_010139237.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        194   2e-55   Buceros rhinoceros silvestris
ref|XP_005510815.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        194   2e-55   
ref|XP_011230861.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        195   3e-55   
ref|XP_003129755.3|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    195   3e-55   
ref|NP_082519.1|  lysosomal Pro-X carboxypeptidase precursor            195   3e-55   Mus musculus [mouse]
gb|AAH55022.1|  Prcp protein                                            195   3e-55   Mus musculus [mouse]
ref|XP_008307030.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        195   3e-55   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_004632660.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        196   3e-55   
ref|XP_010738027.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        195   4e-55   
ref|XP_004763526.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    194   6e-55   
ref|XP_005026125.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        193   7e-55   
dbj|BAK01568.1|  predicted protein                                      194   7e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007664992.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    193   8e-55   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_425654.3|  PREDICTED: lysosomal Pro-X carboxypeptidase           194   8e-55   
gb|ABR16397.1|  unknown                                                 194   9e-55   Picea sitchensis
ref|XP_533994.2|  PREDICTED: lysosomal Pro-X carboxypeptidase iso...    194   9e-55   Canis lupus familiaris [dogs]
ref|XP_009511986.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        192   1e-54   Phalacrocorax carbo [common cormorant]
ref|XP_005038441.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        193   1e-54   
ref|XP_006747630.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        194   1e-54   Leptonychotes weddellii
ref|XP_006145040.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    193   1e-54   Tupaia chinensis
gb|ELK30246.1|  Lysosomal Pro-X carboxypeptidase                        190   1e-54   Myotis davidii
gb|KDR15687.1|  Lysosomal Pro-X carboxypeptidase                        193   1e-54   Zootermopsis nevadensis
ref|XP_008424607.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        194   1e-54   Poecilia reticulata
ref|NP_001248178.1|  lysosomal Pro-X carboxypeptidase precursor         193   1e-54   Macaca mulatta [rhesus macaque]
ref|XP_003910532.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    193   1e-54   Papio anubis [baboon]
ref|XP_011717518.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    193   1e-54   Macaca nemestrina [pigtail macaque]
ref|NP_001044360.1|  Os01g0767100                                       194   2e-54   
ref|XP_010361179.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        193   2e-54   Rhinopithecus roxellana
ref|XP_008018493.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    193   2e-54   Chlorocebus sabaeus
ref|XP_003780909.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    193   2e-54   Otolemur garnettii
ref|XP_007664991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    193   2e-54   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_011851800.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    193   2e-54   Mandrillus leucophaeus
ref|XP_004590083.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        193   2e-54   
ref|XP_007490949.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    193   2e-54   
ref|XP_007630098.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    193   2e-54   
ref|XP_011582829.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        192   2e-54   Aquila chrysaetos canadensis
ref|XP_005796946.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    193   2e-54   
ref|XP_004901733.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    193   2e-54   
ref|XP_007900913.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        193   2e-54   Callorhinchus milii [Australian ghost shark]
pdb|3N2Z|B  Chain B, The Structure Of Human Prolylcarboxypeptidas...    192   2e-54   Homo sapiens [man]
ref|XP_007079027.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        192   3e-54   Panthera tigris altaica
ref|XP_006936943.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    192   3e-54   
ref|XP_003992730.2|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    192   3e-54   
ref|XP_003507065.2|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    192   3e-54   
ref|XP_008654499.1|  PREDICTED: uncharacterized protein LOC100217...    192   4e-54   
gb|KFP36342.1|  Lysosomal Pro-X carboxypeptidase                        187   4e-54   
gb|KFP93888.1|  Lysosomal Pro-X carboxypeptidase                        187   4e-54   
ref|XP_010988501.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    192   4e-54   
ref|XP_010988491.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    192   4e-54   
gb|KFW73852.1|  Lysosomal Pro-X carboxypeptidase                        191   4e-54   
ref|XP_009967794.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        191   4e-54   
ref|XP_003569899.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        192   4e-54   
ref|XP_004364392.1|  prolylcarboxypeptidase                             192   5e-54   
ref|XP_009914701.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        188   5e-54   
ref|XP_003468571.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        192   5e-54   
ref|XP_010971745.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    192   5e-54   
gb|KFP53232.1|  Lysosomal Pro-X carboxypeptidase                        187   5e-54   
ref|XP_010399419.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        192   5e-54   
ref|XP_010971744.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    192   5e-54   
ref|XP_005516789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        191   6e-54   
ref|XP_001175153.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    192   6e-54   
ref|XP_004051942.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    192   6e-54   
ref|XP_006186742.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        192   6e-54   
ref|XP_005417883.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        191   6e-54   
ref|XP_007572435.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        192   6e-54   
gb|EFX79132.1|  hypothetical protein DAPPUDRAFT_225197                  191   7e-54   
ref|XP_005357661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        191   7e-54   
ref|NP_005031.1|  lysosomal Pro-X carboxypeptidase isoform 1 prep...    191   7e-54   
ref|XP_010575044.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        191   7e-54   
gb|KFQ19227.1|  Lysosomal Pro-X carboxypeptidase                        188   8e-54   
ref|XP_009485807.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        187   8e-54   
emb|CBI17114.3|  unnamed protein product                                190   8e-54   
ref|XP_008941332.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        189   8e-54   
ref|XP_006646360.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    191   9e-54   
gb|KFQ63531.1|  Lysosomal Pro-X carboxypeptidase                        186   9e-54   
ref|XP_010119894.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    188   1e-53   
ref|XP_006763798.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    191   1e-53   
ref|XP_004408704.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        191   1e-53   
ref|XP_002754795.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    191   1e-53   
dbj|BAG35764.1|  unnamed protein product                                191   1e-53   
ref|XP_009100981.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        191   1e-53   
ref|XP_010267351.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    190   1e-53   
ref|XP_007236792.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        191   1e-53   
ref|XP_006991950.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        191   1e-53   
gb|KFB48883.1|  AGAP000994-PA-like protein                              191   1e-53   
ref|NP_001125428.1|  lysosomal Pro-X carboxypeptidase precursor         191   1e-53   
emb|CDM83096.1|  unnamed protein product                                191   1e-53   
ref|XP_003935096.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    191   1e-53   
ref|XP_005323310.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        191   1e-53   
ref|XP_008537200.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        191   1e-53   
ref|XP_008702603.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        190   1e-53   
gb|KHN33176.1|  Lysosomal Pro-X carboxypeptidase                        189   1e-53   
gb|KFQ74207.1|  Lysosomal Pro-X carboxypeptidase                        186   2e-53   
gb|ACO10272.1|  Lysosomal Pro-X carboxypeptidase precursor              190   2e-53   
ref|XP_005612064.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        191   2e-53   
gb|KFO92702.1|  Lysosomal Pro-X carboxypeptidase                        189   2e-53   
gb|KDO44734.1|  hypothetical protein CISIN_1g0127111mg                  182   2e-53   
ref|XP_006763793.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    190   2e-53   
ref|XP_011403304.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    188   2e-53   
ref|NP_001065793.1|  Os11g0156200                                       190   2e-53   
ref|XP_002272152.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        190   2e-53   
ref|XP_012078951.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    190   2e-53   
ref|XP_010306431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        189   3e-53   
gb|EEC81081.1|  hypothetical protein OsI_23904                          183   3e-53   
ref|XP_004683302.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        190   3e-53   
ref|XP_009679016.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        189   3e-53   
ref|XP_001628070.1|  predicted protein                                  188   3e-53   
ref|XP_009930858.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        189   3e-53   
ref|XP_008148243.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        190   3e-53   
gb|EOA96670.1|  Lysosomal Pro-X carboxypeptidase                        188   3e-53   
gb|KFV84322.1|  Lysosomal Pro-X carboxypeptidase                        188   4e-53   
ref|XP_005379866.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    189   4e-53   
ref|XP_004075329.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        189   4e-53   
ref|XP_003521479.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    189   4e-53   
gb|EFB15217.1|  hypothetical protein PANDA_014943                       188   4e-53   
ref|XP_005884893.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    189   5e-53   
gb|EAY80009.1|  hypothetical protein OsI_35177                          189   6e-53   
ref|XP_006035578.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        188   6e-53   
gb|KFV54794.1|  Lysosomal Pro-X carboxypeptidase                        187   7e-53   
gb|ACJ72063.1|  prolylcarboxypeptidase                                  182   7e-53   
ref|XP_004271881.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        189   7e-53   
ref|XP_012063045.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        188   8e-53   
ref|XP_003418585.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        189   8e-53   
ref|XP_009952778.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        188   8e-53   
ref|XP_009279588.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        187   1e-52   
ref|XP_011438787.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    188   1e-52   
gb|KFP06048.1|  Lysosomal Pro-X carboxypeptidase                        187   1e-52   
gb|KFW04954.1|  Lysosomal Pro-X carboxypeptidase                        184   1e-52   
ref|XP_008498766.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    188   1e-52   
ref|XP_007944471.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        188   1e-52   
ref|XP_005884890.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    188   1e-52   
gb|KFP28018.1|  Lysosomal Pro-X carboxypeptidase                        187   1e-52   
gb|KFQ13604.1|  Lysosomal Pro-X carboxypeptidase                        187   1e-52   
gb|KFP78240.1|  Lysosomal Pro-X carboxypeptidase                        187   1e-52   
gb|AGM32450.1|  heat shock protein-like protein                         183   1e-52   
gb|KFR08386.1|  Lysosomal Pro-X carboxypeptidase                        187   1e-52   
ref|XP_009070789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        187   1e-52   
ref|XP_010175531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        187   1e-52   
ref|XP_010629189.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    187   1e-52   
ref|XP_010018717.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        187   1e-52   
gb|KFO13685.1|  Lysosomal Pro-X carboxypeptidase                        187   1e-52   
ref|XP_009468660.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        187   1e-52   
ref|XP_004970093.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    189   1e-52   
ref|XP_006098536.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    187   1e-52   
ref|XP_003697693.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    188   1e-52   
ref|XP_010203661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        187   1e-52   
gb|KFZ51659.1|  Lysosomal Pro-X carboxypeptidase                        187   1e-52   
gb|ACO10617.1|  Lysosomal Pro-X carboxypeptidase precursor              188   2e-52   
gb|KFR02889.1|  Lysosomal Pro-X carboxypeptidase                        186   2e-52   
ref|XP_009576105.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    185   2e-52   
ref|XP_011053362.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        187   2e-52   
ref|XP_006273509.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    187   2e-52   
ref|XP_007447423.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        187   2e-52   
gb|EDL06718.1|  prolylcarboxypeptidase (angiotensinase C)               186   2e-52   
gb|KFW74038.1|  Lysosomal Pro-X carboxypeptidase                        186   2e-52   
gb|KFP73631.1|  Lysosomal Pro-X carboxypeptidase                        186   2e-52   
ref|XP_008933120.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        186   2e-52   
ref|XP_010146580.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        186   2e-52   
ref|XP_002458558.1|  hypothetical protein SORBIDRAFT_03g035680          188   2e-52   
ref|XP_003490799.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    187   2e-52   
gb|KFQ54980.1|  Lysosomal Pro-X carboxypeptidase                        186   2e-52   
gb|EMC81816.1|  Lysosomal Pro-X carboxypeptidase                        186   2e-52   
gb|KFO60084.1|  Lysosomal Pro-X carboxypeptidase                        186   2e-52   
ref|XP_006865041.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    187   2e-52   
ref|XP_011240212.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    187   2e-52   
ref|XP_010247711.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    187   2e-52   
ref|XP_009985955.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        186   2e-52   
gb|ELU04397.1|  hypothetical protein CAPTEDRAFT_174591                  187   2e-52   
gb|KFV02463.1|  Lysosomal Pro-X carboxypeptidase                        186   2e-52   
ref|XP_008633192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        186   2e-52   
ref|XP_009640619.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        186   3e-52   
ref|XP_007120155.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    187   3e-52   
ref|XP_006098535.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    187   3e-52   
ref|XP_005074171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    187   3e-52   
ref|XP_009321727.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        186   3e-52   
gb|KFW66681.1|  Lysosomal Pro-X carboxypeptidase                        186   3e-52   
gb|KFO79296.1|  Lysosomal Pro-X carboxypeptidase                        186   3e-52   
ref|XP_007187662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        187   3e-52   
gb|KFP09734.1|  Lysosomal Pro-X carboxypeptidase                        186   3e-52   
ref|XP_003507068.2|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    187   4e-52   
gb|KFM08871.1|  Lysosomal Pro-X carboxypeptidase                        186   4e-52   
gb|EPY79539.1|  hypothetical protein CB1_000916021                      179   4e-52   
ref|XP_009812651.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    181   4e-52   
gb|EMP35010.1|  Lysosomal Pro-X carboxypeptidase                        186   4e-52   
ref|XP_009879496.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        186   4e-52   
gb|KEH38910.1|  lysosomal pro-X carboxypeptidase-like protein           187   4e-52   
gb|KGL90198.1|  Lysosomal Pro-X carboxypeptidase                        185   4e-52   
ref|XP_008842482.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    187   4e-52   
gb|KFV91939.1|  Lysosomal Pro-X carboxypeptidase                        185   5e-52   
emb|CCQ71326.1|  hypothetical Pro-X carboxypeptidase-like protein...    187   5e-52   
ref|XP_009877154.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        186   5e-52   
gb|ACE75287.1|  prolylcarboxypeptidase                                  186   5e-52   
ref|XP_009563433.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        186   5e-52   
ref|XP_623670.3|  PREDICTED: lysosomal Pro-X carboxypeptidase-like      186   5e-52   
ref|XP_006614443.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    186   6e-52   
ref|XP_009185279.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    185   6e-52   
ref|XP_004434101.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    186   8e-52   
ref|XP_008018495.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    185   8e-52   
ref|XP_005226767.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    186   9e-52   
ref|XP_003780910.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    186   9e-52   
ref|XP_006991953.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    186   1e-51   
ref|XP_002109366.1|  hypothetical protein TRIADDRAFT_21030              185   1e-51   
ref|XP_006197540.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    186   1e-51   
ref|XP_003393594.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    186   1e-51   
ref|XP_008333821.1|  PREDICTED: dipeptidyl peptidase 2 isoform X4       184   1e-51   
ref|XP_004901739.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    184   1e-51   
ref|XP_006926718.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    186   1e-51   
ref|XP_005434763.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        184   1e-51   
ref|XP_008385547.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    180   1e-51   
ref|XP_004901738.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    186   1e-51   
ref|XP_005149846.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        185   1e-51   
ref|XP_005485885.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        184   1e-51   
gb|KFZ57497.1|  Lysosomal Pro-X carboxypeptidase                        184   1e-51   
gb|EHH56621.1|  hypothetical protein EGM_06072                          186   2e-51   
ref|XP_005579269.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    186   2e-51   
ref|XP_011851799.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    186   2e-51   
gb|ACE75375.1|  prolylcarboxypeptidase                                  185   2e-51   
ref|NP_001072639.1|  lysosomal Pro-X carboxypeptidase precursor         185   2e-51   
ref|XP_007153468.1|  hypothetical protein PHAVU_003G038000g             185   2e-51   
ref|XP_008333819.1|  PREDICTED: dipeptidyl peptidase 2 isoform X2       184   2e-51   
ref|XP_005894702.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        185   2e-51   
gb|KGL80986.1|  Lysosomal Pro-X carboxypeptidase                        182   2e-51   
gb|KFU94741.1|  Lysosomal Pro-X carboxypeptidase                        183   2e-51   
ref|XP_010002716.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        183   3e-51   
ref|XP_010851518.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        184   3e-51   
ref|XP_972807.1|  PREDICTED: lysosomal Pro-X carboxypeptidase           184   3e-51   
ref|XP_010247724.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    184   3e-51   
ref|XP_008333818.1|  PREDICTED: dipeptidyl peptidase 2 isoform X1       184   3e-51   
ref|XP_011371423.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        184   3e-51   
gb|ACA09612.1|  prolyl carboxypeptidase                                 184   3e-51   
ref|XP_005232277.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        184   3e-51   
ref|XP_006055696.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        184   3e-51   
ref|XP_010218276.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        182   4e-51   
ref|XP_008261572.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        183   4e-51   
ref|XP_005975526.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    184   4e-51   
gb|ABR17682.1|  unknown                                                 184   4e-51   
ref|XP_005699540.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    184   4e-51   
ref|XP_011863698.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        184   5e-51   
ref|XP_004019471.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        184   5e-51   
ref|XP_001651053.1|  AAEL005521-PA                                      183   5e-51   
gb|KFQ73298.1|  Lysosomal Pro-X carboxypeptidase                        182   6e-51   
ref|XP_009005600.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    183   6e-51   
ref|XP_797434.3|  PREDICTED: dipeptidyl peptidase 2                     184   6e-51   
ref|XP_002599211.1|  hypothetical protein BRAFLDRAFT_200045             182   6e-51   
ref|XP_010283636.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        182   6e-51   
ref|XP_002271733.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        184   7e-51   
ref|XP_004051943.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    184   7e-51   
ref|XP_004473933.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    183   7e-51   
ref|NP_955450.2|  lysosomal Pro-X carboxypeptidase isoform 2 prep...    184   7e-51   
gb|ETN60051.1|  lysosomal Pro-X carboxypeptidase                        183   8e-51   
ref|XP_004385551.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        183   9e-51   
ref|XP_010152633.1|  PREDICTED: dipeptidyl peptidase 2-like             174   1e-50   
ref|XP_010493397.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    182   1e-50   
ref|XP_006408697.1|  hypothetical protein EUTSA_v10002179mg             181   1e-50   
ref|XP_006408695.1|  hypothetical protein EUTSA_v10001967mg             183   1e-50   
ref|XP_003706326.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        183   1e-50   
gb|KHN44803.1|  Lysosomal Pro-X carboxypeptidase                        182   1e-50   
gb|EPQ19311.1|  Lysosomal Pro-X carboxypeptidase                        181   1e-50   
ref|XP_003219412.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        183   1e-50   
gb|ACZ13347.1|  prolyl carboxy peptidase-like protein                   181   1e-50   
ref|XP_004473931.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    183   1e-50   
gb|KDP43937.1|  hypothetical protein JCGZ_05404                         182   1e-50   



>gb|AAM15096.1| putative prolylcarboxypeptidase [Arabidopsis thaliana]
Length=476

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  133  SKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYLIN  312
            ++ +Y PGG +  +SL+ + K+   K +LP+E +YFPQ +DHFSF P  YK+F+QKYLIN
Sbjct  16   AEATYSPGGFHHLSSLRLKKKVSKSKHELPFETRYFPQNLDHFSFTPDSYKVFHQKYLIN  75

Query  313  KDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSY  492
               W+KGGP+FVYTGNEGDIDWFA+NTGFMLDIAPKF ALL+FIEHRFYGES PFGK+S+
Sbjct  76   NRFWRKGGPIFVYTGNEGDIDWFASNTGFMLDIAPKFRALLVFIEHRFYGESTPFGKKSH  135

Query  493  KSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAI  672
            KSA+TLGYLNSQQALADYAILIRSLK+NLSSEASPVVVFGGSYGGMLAAWFRLKYPH+ I
Sbjct  136  KSAETLGYLNSQQALADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITI  195

Query  673  GALASSAP  696
            GALASSAP
Sbjct  196  GALASSAP  203



>ref|NP_850050.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAL25591.1| At2g24280/F27D4.19 [Arabidopsis thaliana]
 gb|AAM98275.1| At2g24280/F27D4.19 [Arabidopsis thaliana]
 gb|AEC07556.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=494

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  133  SKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYLIN  312
            ++ +Y PGG +  +SL+ + K+   K +LP+E +YFPQ +DHFSF P  YK+F+QKYLIN
Sbjct  16   AEATYSPGGFHHLSSLRLKKKVSKSKHELPFETRYFPQNLDHFSFTPDSYKVFHQKYLIN  75

Query  313  KDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSY  492
               W+KGGP+FVYTGNEGDIDWFA+NTGFMLDIAPKF ALL+FIEHRFYGES PFGK+S+
Sbjct  76   NRFWRKGGPIFVYTGNEGDIDWFASNTGFMLDIAPKFRALLVFIEHRFYGESTPFGKKSH  135

Query  493  KSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAI  672
            KSA+TLGYLNSQQALADYAILIRSLK+NLSSEASPVVVFGGSYGGMLAAWFRLKYPH+ I
Sbjct  136  KSAETLGYLNSQQALADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITI  195

Query  673  GALASSAP  696
            GALASSAP
Sbjct  196  GALASSAP  203



>ref|XP_006294084.1| hypothetical protein CARUB_v10023078mg [Capsella rubella]
 gb|EOA26982.1| hypothetical protein CARUB_v10023078mg [Capsella rubella]
Length=495

 Score =   290 bits (743),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  133  SKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYLIN  312
            ++ +Y+PGG +  +SL+++ K    K + P+E +YFPQ +DHFSF P  YK+F+QKYLIN
Sbjct  17   AEATYYPGGFHHLSSLRQRKKASKSKSEFPFETRYFPQNLDHFSFTPDSYKVFHQKYLIN  76

Query  313  KDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSY  492
               W+KGGP+FVYTGNEGDIDWFA NTGFM DIAPKF ALL+FIEHRFYGES PFGK+S+
Sbjct  77   SHFWRKGGPIFVYTGNEGDIDWFATNTGFMSDIAPKFRALLVFIEHRFYGESTPFGKKSH  136

Query  493  KSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAI  672
            KSA+TLGYLNSQQALAD+AILIRSLK+NLSSEASPVVVFGGSYGGMLAAWFRLKYPH+AI
Sbjct  137  KSAETLGYLNSQQALADFAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAI  196

Query  673  GALASSAP  696
            GALASSAP
Sbjct  197  GALASSAP  204



>emb|CDY20293.1| BnaC04g36630D [Brassica napus]
Length=492

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  133  SKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYLIN  312
            ++ +Y PGG +  +SL++  K    K +LP+E +YFPQ +DHFSF P  YK+F+QKYLIN
Sbjct  16   AEATYPPGGFHHLSSLRQNRKSSKSKSELPFETRYFPQNLDHFSFRPESYKVFHQKYLIN  75

Query  313  KDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSY  492
               W+KGGP+FVYTGNEGDIDWFA+NTGFM DIAPKF ALL+FIEHRFYGES PFGK+S+
Sbjct  76   SRFWRKGGPIFVYTGNEGDIDWFASNTGFMSDIAPKFRALLVFIEHRFYGESTPFGKKSH  135

Query  493  KSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAI  672
            KSA+TLGYLNSQQALADYAILIRSLK+NLSSEASPVVVFGGSYGGMLAAWFRLKYPH+AI
Sbjct  136  KSAETLGYLNSQQALADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAI  195

Query  673  GALASSAP  696
            GALASSAP
Sbjct  196  GALASSAP  203



>ref|XP_007011978.1| Alpha/beta-Hydrolases superfamily protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY29597.1| Alpha/beta-Hydrolases superfamily protein isoform 2, partial 
[Theobroma cacao]
Length=420

 Score =   286 bits (731),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 160/190 (84%), Gaps = 4/190 (2%)
 Frame = +1

Query  127  GESKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYL  306
              S  ++FPG +Y         +    KPKLP++V YFPQ +DHF+F P   KIFYQKYL
Sbjct  23   ANSLPTFFPGATY----QSLIKQAKTPKPKLPFKVHYFPQTLDHFTFQPKSSKIFYQKYL  78

Query  307  INKDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQ  486
            IN  +W KG P+FVYTGNEGDI+WFAANTGFMLDIAPKF ALL+FIEHRFYGES PFGK+
Sbjct  79   INSHYWHKGAPIFVYTGNEGDIEWFAANTGFMLDIAPKFKALLVFIEHRFYGESTPFGKE  138

Query  487  SYKSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHV  666
            SYKSAKTLGYLNSQQALAD+A+LIR+LK+NLSSEASPVVVFGGSYGGMLAAWFRLKYPH+
Sbjct  139  SYKSAKTLGYLNSQQALADFAVLIRNLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHI  198

Query  667  AIGALASSAP  696
            AIGALASSAP
Sbjct  199  AIGALASSAP  208



>gb|KJB54926.1| hypothetical protein B456_009G054400 [Gossypium raimondii]
Length=446

 Score =   286 bits (733),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFM  402
            ++ +YFPQ +DHFSF P   KIFYQKYLIN  +W KG P+FVYTGNEGDI+WFAANTGFM
Sbjct  54   FKTRYFPQTLDHFSFHPKSSKIFYQKYLINTQYWHKGAPIFVYTGNEGDIEWFAANTGFM  113

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS  582
            LDIAPKF ALLLFIEHRFYGESMPFGK SY+SAKT+GYLNSQQALAD+A+LIRSLK+NLS
Sbjct  114  LDIAPKFRALLLFIEHRFYGESMPFGKDSYQSAKTMGYLNSQQALADFAVLIRSLKQNLS  173

Query  583  SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            SEASPVVVFGGSYGGMLAAWFRLKYPH+AIGALASSAP
Sbjct  174  SEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAP  211



>ref|XP_010472431.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=495

 Score =   288 bits (737),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  133  SKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYLIN  312
            ++ +Y PGG +  +SL+++ K    KP+LP+E +YFPQ +DHFSF P  YK+F+QKYLIN
Sbjct  17   AEATYTPGGFHHLSSLRQKKKASKSKPELPFETRYFPQNLDHFSFTPESYKVFHQKYLIN  76

Query  313  KDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSY  492
               W+KGGP+FVYTGNEGDIDWFA+NTGFM DIAPKF ALL+FIEHRFYGES P GK+S+
Sbjct  77   NRSWRKGGPIFVYTGNEGDIDWFASNTGFMSDIAPKFRALLVFIEHRFYGESTPIGKKSH  136

Query  493  KSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAI  672
            KSA+TLGYLNSQQALAD+AILIRSLK+NLSSEASPVVVFGGSYGGMLAAWFRLKYPH+AI
Sbjct  137  KSAETLGYLNSQQALADFAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAI  196

Query  673  GALASSAP  696
            GALASSAP
Sbjct  197  GALASSAP  204



>ref|XP_009767201.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana sylvestris]
Length=497

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 165/191 (86%), Gaps = 6/191 (3%)
 Frame = +1

Query  124  VGESKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKY  303
            VGE K  Y PG      + +   +    K K+P++V YFPQ++DHF+F+P   K+F QKY
Sbjct  23   VGEIKPIYLPG------TYQSSLEKQHVKSKIPFKVHYFPQILDHFTFLPKSSKVFKQKY  76

Query  304  LINKDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGK  483
            LIN ++W++GGP+FVYTGNEG+IDWFAANTGFMLDIAPKFHALL+FIEHRFYG+SMPFGK
Sbjct  77   LINDNYWKQGGPIFVYTGNEGNIDWFAANTGFMLDIAPKFHALLVFIEHRFYGDSMPFGK  136

Query  484  QSYKSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPH  663
            +SYKS KTLGYLNSQQALADYA+LIRSLK+NLSSE+SPVVVFGGSYGGMLA+WFRLKYPH
Sbjct  137  KSYKSPKTLGYLNSQQALADYAVLIRSLKQNLSSESSPVVVFGGSYGGMLASWFRLKYPH  196

Query  664  VAIGALASSAP  696
            +AIGA+ASSAP
Sbjct  197  IAIGAVASSAP  207



>gb|KJB54925.1| hypothetical protein B456_009G054400 [Gossypium raimondii]
Length=501

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFM  402
            ++ +YFPQ +DHFSF P   KIFYQKYLIN  +W KG P+FVYTGNEGDI+WFAANTGFM
Sbjct  54   FKTRYFPQTLDHFSFHPKSSKIFYQKYLINTQYWHKGAPIFVYTGNEGDIEWFAANTGFM  113

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS  582
            LDIAPKF ALLLFIEHRFYGESMPFGK SY+SAKT+GYLNSQQALAD+A+LIRSLK+NLS
Sbjct  114  LDIAPKFRALLLFIEHRFYGESMPFGKDSYQSAKTMGYLNSQQALADFAVLIRSLKQNLS  173

Query  583  SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            SEASPVVVFGGSYGGMLAAWFRLKYPH+AIGALASSAP
Sbjct  174  SEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAP  211



>ref|XP_010419296.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=463

 Score =   285 bits (730),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = +1

Query  136  KTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYLINK  315
            + +Y PGG +  +SL+++ K    KP+LP+E +YFPQ +DHFSF P  YK+F+QKYLIN 
Sbjct  25   EATYSPGGFHHLSSLRQKKKTSKSKPELPFETRYFPQNLDHFSFTPESYKVFHQKYLINC  84

Query  316  DHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYK  495
              W+KGGP+FVYTGNEGDIDWFA+NTGFM DIAPKF ALL+FIEHRFYGES P GK+S+K
Sbjct  85   RFWRKGGPIFVYTGNEGDIDWFASNTGFMSDIAPKFRALLVFIEHRFYGESTPIGKKSHK  144

Query  496  SAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIG  675
            SA+TLGYLNSQQALAD+AILIRSLK+NLSSEASPVVVFGGSYGGMLAAWFRLKYPH+AIG
Sbjct  145  SAETLGYLNSQQALADFAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIG  204

Query  676  ALASSAP  696
            ALASS+P
Sbjct  205  ALASSSP  211



>ref|XP_007011977.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY29596.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=498

 Score =   285 bits (730),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 160/190 (84%), Gaps = 4/190 (2%)
 Frame = +1

Query  127  GESKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYL  306
              S  ++FPG +Y         +    KPKLP++V YFPQ +DHF+F P   KIFYQKYL
Sbjct  23   ANSLPTFFPGATY----QSLIKQAKTPKPKLPFKVHYFPQTLDHFTFQPKSSKIFYQKYL  78

Query  307  INKDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQ  486
            IN  +W KG P+FVYTGNEGDI+WFAANTGFMLDIAPKF ALL+FIEHRFYGES PFGK+
Sbjct  79   INSHYWHKGAPIFVYTGNEGDIEWFAANTGFMLDIAPKFKALLVFIEHRFYGESTPFGKE  138

Query  487  SYKSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHV  666
            SYKSAKTLGYLNSQQALAD+A+LIR+LK+NLSSEASPVVVFGGSYGGMLAAWFRLKYPH+
Sbjct  139  SYKSAKTLGYLNSQQALADFAVLIRNLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHI  198

Query  667  AIGALASSAP  696
            AIGALASSAP
Sbjct  199  AIGALASSAP  208



>ref|XP_006404933.1| hypothetical protein EUTSA_v10000143mg [Eutrema salsugineum]
 dbj|BAJ33970.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46386.1| hypothetical protein EUTSA_v10000143mg [Eutrema salsugineum]
Length=494

 Score =   285 bits (730),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = +1

Query  133  SKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYLIN  312
            ++ +Y PGG +  +SL++  K    K +LP+E  YFPQ +DHFSF P  YK+F+QKYLIN
Sbjct  16   AEATYPPGGFHHFSSLRQNKKASKSKSELPFETLYFPQNLDHFSFRPESYKVFHQKYLIN  75

Query  313  KDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSY  492
               W+KGGP+FVYTGNEGDIDWFA+NTGFM DIAPKF ALL+FIEHRFYGES PFGK+S+
Sbjct  76   SRFWRKGGPIFVYTGNEGDIDWFASNTGFMSDIAPKFGALLVFIEHRFYGESTPFGKKSH  135

Query  493  KSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAI  672
            KSA+TLGYLNSQQALADYAILIRSLK+NLSSEASPVVVFGGSYGGMLAAWFRLKYPH+AI
Sbjct  136  KSAETLGYLNSQQALADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAI  195

Query  673  GALASSAP  696
            GALASSAP
Sbjct  196  GALASSAP  203



>ref|XP_009617834.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana tomentosiformis]
Length=497

 Score =   285 bits (730),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFM  402
            ++  YFPQ++DHF+F+P   K+F QKYLIN  +WQKGGP+FVYTGNEG+IDWFAANTGFM
Sbjct  50   FKAHYFPQILDHFTFLPKSSKVFKQKYLINDKYWQKGGPIFVYTGNEGNIDWFAANTGFM  109

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS  582
            LDIAPKFHALL+FIEHRFYG SMPFGK+SYKS KTLGYLNSQQALADYA+LIRSLK+NLS
Sbjct  110  LDIAPKFHALLVFIEHRFYGNSMPFGKKSYKSPKTLGYLNSQQALADYAVLIRSLKQNLS  169

Query  583  SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            SE+SPVVVFGGSYGGMLA+WFRLKYPH+AIGA+ASSAP
Sbjct  170  SESSPVVVFGGSYGGMLASWFRLKYPHIAIGAVASSAP  207



>gb|EYU25337.1| hypothetical protein MIMGU_mgv1a004964mg [Erythranthe guttata]
Length=502

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 162/186 (87%), Gaps = 2/186 (1%)
 Frame = +1

Query  139  TSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYLINKD  318
            T+YFPG +Y   S  ++   I  KP++PYE  YFPQ +DHF+F+P  Y+IF QKYLIN+D
Sbjct  28   TTYFPGINY--QSALRKNGSINPKPEIPYETHYFPQNLDHFTFLPQSYRIFNQKYLINRD  85

Query  319  HWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKS  498
             WQKG P+FVYTGNEGDIDWFAANTGF+LD+AP+F ALL+FIEHR+YGES PFGK SYKS
Sbjct  86   FWQKGAPIFVYTGNEGDIDWFAANTGFLLDVAPRFRALLVFIEHRYYGESKPFGKDSYKS  145

Query  499  AKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGA  678
            AK LGYLNSQQA+AD+A+LIRSLK NLSS++SPVVVFGGSYGGMLAAWFRLKYPH+AIGA
Sbjct  146  AKKLGYLNSQQAMADFALLIRSLKHNLSSDSSPVVVFGGSYGGMLAAWFRLKYPHIAIGA  205

Query  679  LASSAP  696
            LASSAP
Sbjct  206  LASSAP  211



>ref|XP_002523506.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38845.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=501

 Score =   285 bits (728),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFM  402
            Y+ +YFPQ++DHF+F P+GYKIFYQKYLI+  +W K  P+FVYTGNEGDI+WFAANTGF+
Sbjct  50   YKTRYFPQLLDHFTFQPNGYKIFYQKYLISSQYWHKEAPIFVYTGNEGDIEWFAANTGFL  109

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS  582
            LDIAPKF ALL+FIEHRFYGESMPFGK SYKSA+TLGYLNSQQALAD+A+LIRSLK+NLS
Sbjct  110  LDIAPKFRALLVFIEHRFYGESMPFGKDSYKSAETLGYLNSQQALADFAVLIRSLKQNLS  169

Query  583  SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            SEASPVVVFGGSYGGMLA WFRLKYPH+AIGALASSAP
Sbjct  170  SEASPVVVFGGSYGGMLATWFRLKYPHIAIGALASSAP  207



>ref|XP_010429398.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=495

 Score =   285 bits (728),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  133  SKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYLIN  312
            ++ +Y PGG +  +SL+++ K    KP+LP+E +YFPQ +DHFSF P  YK+F+QKYLIN
Sbjct  17   AEATYSPGGFHHLSSLRQKKKASKSKPELPFETRYFPQNLDHFSFTPESYKVFHQKYLIN  76

Query  313  KDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSY  492
               W+KGGP+FVYTGNEGDIDWFA+NTGFM DIAPKF ALL+FIEHRFYGES P  K+S+
Sbjct  77   SRFWRKGGPIFVYTGNEGDIDWFASNTGFMSDIAPKFRALLVFIEHRFYGESTPIRKKSH  136

Query  493  KSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAI  672
            KSA+TLGYLNSQQALAD+AILIRSLK+NLSSEASPVVVFGGSYGGMLAAWFRLKYPH+AI
Sbjct  137  KSAETLGYLNSQQALADFAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAI  196

Query  673  GALASSAP  696
            GALASSAP
Sbjct  197  GALASSAP  204



>emb|CDY46135.1| BnaA04g14230D [Brassica napus]
Length=494

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = +1

Query  133  SKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYLIN  312
            ++ +Y PGG +  +SL++  K    K + P+E +YFPQ +DHFSF P  YK+F QKYLIN
Sbjct  16   AEATYPPGGFHHLSSLRQNKKTSKSKSESPFETRYFPQNLDHFSFRPESYKVFQQKYLIN  75

Query  313  KDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSY  492
            +  W+KGGP+FVYTGNEGDIDWFA+NTGFM DIAPKF ALL+FIEHRFYGES PFGK+S+
Sbjct  76   RRFWRKGGPIFVYTGNEGDIDWFASNTGFMSDIAPKFRALLVFIEHRFYGESTPFGKKSH  135

Query  493  KSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAI  672
            K+A+TLGYL+SQQALADYAILIRSLK+NLSSEASPVVVFGGSYGGMLAAWFRLKYPH+AI
Sbjct  136  KTAETLGYLSSQQALADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAI  195

Query  673  GALASSAP  696
            GALASSAP
Sbjct  196  GALASSAP  203



>gb|KHG26338.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=501

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFM  402
            ++ +YFPQ +DHFSF P   KIFYQKYLIN  +W KG P+FVYTGNEGDI+WFAANTGFM
Sbjct  54   FKTRYFPQTLDHFSFHPKSSKIFYQKYLINTQYWHKGSPIFVYTGNEGDIEWFAANTGFM  113

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS  582
            LDIAPKF ALLLFIEHRFYGESMPFGK SY+SAKTLGYLNSQQALAD A+LIRSLK+NLS
Sbjct  114  LDIAPKFRALLLFIEHRFYGESMPFGKDSYQSAKTLGYLNSQQALADLAVLIRSLKQNLS  173

Query  583  SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            SEASPVVVFGGSYGG+LAAWFRLKYPH+AIGALASSAP
Sbjct  174  SEASPVVVFGGSYGGLLAAWFRLKYPHIAIGALASSAP  211



>ref|XP_009140531.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=526

 Score =   285 bits (728),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = +1

Query  133  SKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYLIN  312
            ++ +Y PGG +  +SL++  K    K + P+E +YFPQ +DHFSF P  YK+F QKYLIN
Sbjct  48   AEATYPPGGFHHLSSLRQNKKTSKSKSESPFETRYFPQNLDHFSFRPESYKVFQQKYLIN  107

Query  313  KDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSY  492
            +  W+KGGP+FVYTGNEGDIDWFA+NTGFM DIAPKF ALL+FIEHRFYGES PFGK+S+
Sbjct  108  RRFWRKGGPIFVYTGNEGDIDWFASNTGFMSDIAPKFRALLVFIEHRFYGESTPFGKKSH  167

Query  493  KSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAI  672
            K+A+TLGYL+SQQALADYAILIRSLK+NLSSEASPVVVFGGSYGGMLAAWFRLKYPH+AI
Sbjct  168  KTAETLGYLSSQQALADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAI  227

Query  673  GALASSAP  696
            GALASSAP
Sbjct  228  GALASSAP  235



>ref|XP_002878742.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH55001.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=495

 Score =   283 bits (725),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +1

Query  133  SKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYLIN  312
            ++ +Y PGG +  +SL++Q K    K +LP+E +YFPQ +DHF F P  Y +F+QKYLIN
Sbjct  16   AEATYSPGGFHHLSSLRQQKKASKSKQELPFETRYFPQNLDHFGFTPESYTVFHQKYLIN  75

Query  313  KDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSY  492
               W+KGGP+FVYTGNEGDIDWFA+NTGFM DIAPKF ALL+FIEHRFYGES PFGK+S+
Sbjct  76   SRFWRKGGPIFVYTGNEGDIDWFASNTGFMSDIAPKFQALLVFIEHRFYGESTPFGKKSH  135

Query  493  KSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAI  672
            KSA+TLGYL+SQQALADYAILIRSLK+NLSSEASPVVVFGGSYGGMLAAWFRLKYPH+ I
Sbjct  136  KSAETLGYLSSQQALADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITI  195

Query  673  GALASSAP  696
            GALASSAP
Sbjct  196  GALASSAP  203



>ref|XP_002324555.2| serine carboxypeptidase S28 family protein [Populus trichocarpa]
 gb|ABK95724.1| unknown [Populus trichocarpa]
 gb|EEF03120.2| serine carboxypeptidase S28 family protein [Populus trichocarpa]
Length=500

 Score =   283 bits (724),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 162/191 (85%), Gaps = 3/191 (2%)
 Frame = +1

Query  124  VGESKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKY  303
            V +S  ++FP  SY Q+      +    KPK+PY+  YFPQV+DHF+F P   KIFYQKY
Sbjct  20   VIQSVPTFFPRPSYDQS---LAKQPKASKPKIPYKTHYFPQVLDHFTFQPKSSKIFYQKY  76

Query  304  LINKDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGK  483
            L+N  +W +G P+FVYTGNEGDI+WFAANTGF+LDIAPKF ALL+FIEHRFYGESMPFG 
Sbjct  77   LVNSHYWHRGAPIFVYTGNEGDIEWFAANTGFLLDIAPKFRALLVFIEHRFYGESMPFGN  136

Query  484  QSYKSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPH  663
            +SYKSA+TLGYLNSQQALAD+A+LIRSLK NLSSEASPVVVFGGSYGGMLAAWFRLKYPH
Sbjct  137  KSYKSAETLGYLNSQQALADFALLIRSLKHNLSSEASPVVVFGGSYGGMLAAWFRLKYPH  196

Query  664  VAIGALASSAP  696
            +AIGALASSAP
Sbjct  197  IAIGALASSAP  207



>ref|XP_010525816.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Tarenaya hassleriana]
Length=502

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = +1

Query  133  SKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYLIN  312
            S  +Y PG +Y  +SL++  KI   +  LP + +YFPQ++DHFSF P  Y+ F+QKYLIN
Sbjct  25   SMVTYVPGAAYHLSSLRQDRKISKPEFPLPLQTRYFPQILDHFSFRPDSYRTFHQKYLIN  84

Query  313  KDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSY  492
               W  GGP+FVYTGNEGDI+WFA+NTGFM DIAPKF ALL+FIEHRFYGES+PFGK+SY
Sbjct  85   SHFWHIGGPIFVYTGNEGDIEWFASNTGFMFDIAPKFRALLVFIEHRFYGESLPFGKKSY  144

Query  493  KSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAI  672
            KSA+TLGYLNSQQALAD+A+LIRSLK+NLSSEASPVVVFGGSYGGMLAAWFRLKYPH+++
Sbjct  145  KSAETLGYLNSQQALADFAVLIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHISL  204

Query  673  GALASSAP  696
            GALASSAP
Sbjct  205  GALASSAP  212



>ref|XP_011017985.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Populus 
euphratica]
Length=500

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 161/189 (85%), Gaps = 3/189 (2%)
 Frame = +1

Query  130  ESKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYLI  309
            +S  ++FP  SY Q+      +    KPK+PY+  YFPQV+DHF+F P   KIFYQKYL+
Sbjct  22   QSVPTFFPRPSYGQS---LAKQPKASKPKIPYKTHYFPQVLDHFTFQPKSSKIFYQKYLV  78

Query  310  NKDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQS  489
            N  +W +G P+FVYTGNEGDI+WFAANTGF+LDIAPKF ALL+FIEHRFYGESMPFG +S
Sbjct  79   NSHYWHRGAPIFVYTGNEGDIEWFAANTGFLLDIAPKFRALLVFIEHRFYGESMPFGNKS  138

Query  490  YKSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVA  669
            YKSA+TLGYLNSQQALAD+A+LIRSLK NLSSEASPVVVFGGSYGGMLAAWFRLKYPH+A
Sbjct  139  YKSAETLGYLNSQQALADFALLIRSLKHNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIA  198

Query  670  IGALASSAP  696
            IGALASSAP
Sbjct  199  IGALASSAP  207



>gb|KHG29529.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=492

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 160/190 (84%), Gaps = 4/190 (2%)
 Frame = +1

Query  127  GESKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYL  306
              S  ++FPG +Y         +    KPKLP++  YFPQ +DHF+F P   K+FYQKYL
Sbjct  20   ANSLPTFFPGATY----QSLIKQAKISKPKLPFKTHYFPQTLDHFTFQPKSSKLFYQKYL  75

Query  307  INKDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQ  486
            IN D+W+KG P+FVYTGNEG+I+WFAANTGFMLDIAPKF ALL+FIEHRFYG+SMPFGK 
Sbjct  76   INSDYWRKGAPIFVYTGNEGNIEWFAANTGFMLDIAPKFKALLVFIEHRFYGKSMPFGKD  135

Query  487  SYKSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHV  666
            SY+SAKTLGYLNSQQALAD+A+LI SLK+NLSSEASPVVVFGGSYGGMLAAWFRLKYPH+
Sbjct  136  SYQSAKTLGYLNSQQALADFAVLITSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHI  195

Query  667  AIGALASSAP  696
            AIGALASSAP
Sbjct  196  AIGALASSAP  205



>emb|CDP10200.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFM  402
            YE  YFPQV+DHF+F P  YKIFYQKYL+N  +W +G P+FVYTGNEGDI+WFAANTGFM
Sbjct  49   YEAHYFPQVLDHFTFRPRSYKIFYQKYLMNSQYWHEGAPIFVYTGNEGDIEWFAANTGFM  108

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS  582
            LDIAPKF ALL+FIEHRFYGES+PF K+   SAKTLGYL+SQQALADYA+LIRSLK+NLS
Sbjct  109  LDIAPKFRALLVFIEHRFYGESLPFHKKDLNSAKTLGYLSSQQALADYAVLIRSLKRNLS  168

Query  583  SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP
Sbjct  169  SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  206



>gb|KJB07579.1| hypothetical protein B456_001G030800 [Gossypium raimondii]
Length=492

 Score =   281 bits (718),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 160/190 (84%), Gaps = 4/190 (2%)
 Frame = +1

Query  127  GESKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYL  306
              S  ++FPG +Y         +    KPKLP++  YFPQ +DHF+F P   K+FYQKYL
Sbjct  20   ANSLPTFFPGAAY----QSLIKQAKISKPKLPFKTHYFPQTLDHFTFQPKSSKLFYQKYL  75

Query  307  INKDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQ  486
            IN D+W+KG P+FVYTGNEG+I+WFAANTGFMLDIAPKF ALL+FIEHRFYG+SMPFGK 
Sbjct  76   INSDYWRKGAPIFVYTGNEGNIEWFAANTGFMLDIAPKFKALLVFIEHRFYGKSMPFGKD  135

Query  487  SYKSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHV  666
            SY+SAKTLGYLNSQQALAD+A+LI SLK+NLSSEASPVVVFGGSYGGMLAAWFRLKYPH+
Sbjct  136  SYQSAKTLGYLNSQQALADFAVLITSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHI  195

Query  667  AIGALASSAP  696
            AIGALASSAP
Sbjct  196  AIGALASSAP  205



>gb|KJB07578.1| hypothetical protein B456_001G030800 [Gossypium raimondii]
Length=484

 Score =   280 bits (717),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 160/190 (84%), Gaps = 4/190 (2%)
 Frame = +1

Query  127  GESKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYL  306
              S  ++FPG +Y         +    KPKLP++  YFPQ +DHF+F P   K+FYQKYL
Sbjct  20   ANSLPTFFPGAAY----QSLIKQAKISKPKLPFKTHYFPQTLDHFTFQPKSSKLFYQKYL  75

Query  307  INKDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQ  486
            IN D+W+KG P+FVYTGNEG+I+WFAANTGFMLDIAPKF ALL+FIEHRFYG+SMPFGK 
Sbjct  76   INSDYWRKGAPIFVYTGNEGNIEWFAANTGFMLDIAPKFKALLVFIEHRFYGKSMPFGKD  135

Query  487  SYKSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHV  666
            SY+SAKTLGYLNSQQALAD+A+LI SLK+NLSSEASPVVVFGGSYGGMLAAWFRLKYPH+
Sbjct  136  SYQSAKTLGYLNSQQALADFAVLITSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHI  195

Query  667  AIGALASSAP  696
            AIGALASSAP
Sbjct  196  AIGALASSAP  205



>ref|XP_012071462.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Jatropha curcas]
 gb|KDP38645.1| hypothetical protein JCGZ_03998 [Jatropha curcas]
Length=501

 Score =   281 bits (718),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFM  402
            Y+  YFPQ++DHF+F P  Y+IFYQKYLIN  +W +G P+FVYTGNEGDIDWFAANTGF+
Sbjct  50   YKTHYFPQILDHFTFQPKSYEIFYQKYLINGQYWHRGAPIFVYTGNEGDIDWFAANTGFL  109

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS  582
            LDIAPKF ALL+FIEHRFYGES+PFGK SY SA+TLGYLNSQQALAD+++LIRSLK+NLS
Sbjct  110  LDIAPKFRALLVFIEHRFYGESLPFGKDSYNSAETLGYLNSQQALADFSVLIRSLKQNLS  169

Query  583  SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            SEASPVVVFGGSYGGMLAAWFRLKYPH+AIGA+ASSAP
Sbjct  170  SEASPVVVFGGSYGGMLAAWFRLKYPHIAIGAVASSAP  207



>emb|CBI18675.3| unnamed protein product [Vitis vinifera]
Length=502

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +1

Query  229  VQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFMLD  408
             QYFPQ++DHF+F P    IFYQKYLIN  +W  G P+FVYTGNEGDIDWFA+NTGF+LD
Sbjct  58   TQYFPQLLDHFTFTPKSSTIFYQKYLINTQYWTHGAPIFVYTGNEGDIDWFASNTGFLLD  117

Query  409  IAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLSSE  588
            IAP F A+L+FIEHRFYGESMPFGK+SYKS +TLGYLNSQQALAD+A+LIRSLK+NLSSE
Sbjct  118  IAPSFRAMLVFIEHRFYGESMPFGKESYKSPETLGYLNSQQALADFAVLIRSLKQNLSSE  177

Query  589  ASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            ASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP
Sbjct  178  ASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  213



>ref|XP_003633162.2| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=488

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +1

Query  229  VQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFMLD  408
             QYFPQ++DHF+F P    IFYQKYLIN  +W  G P+FVYTGNEGDIDWFA+NTGF+LD
Sbjct  44   TQYFPQLLDHFTFTPKSSTIFYQKYLINTQYWTHGAPIFVYTGNEGDIDWFASNTGFLLD  103

Query  409  IAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLSSE  588
            IAP F A+L+FIEHRFYGESMPFGK+SYKS +TLGYLNSQQALAD+A+LIRSLK+NLSSE
Sbjct  104  IAPSFRAMLVFIEHRFYGESMPFGKESYKSPETLGYLNSQQALADFAVLIRSLKQNLSSE  163

Query  589  ASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            ASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP
Sbjct  164  ASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  199



>ref|XP_010419297.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=810

 Score =   286 bits (733),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  133  SKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYLIN  312
            ++ +Y PGG +  +SL+++ K    KP+LP+E +YFPQ +DHFSF P  YK+F+QKYLIN
Sbjct  17   AEATYSPGGFHHLSSLRQKKKTSKSKPELPFETRYFPQNLDHFSFTPESYKVFHQKYLIN  76

Query  313  KDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSY  492
               W+KGGP+FVYTGNEGDIDWFA+NTGFM DIAPKF ALL+FIEHRFYGES P GK+S+
Sbjct  77   SRFWRKGGPIFVYTGNEGDIDWFASNTGFMSDIAPKFRALLVFIEHRFYGESTPIGKKSH  136

Query  493  KSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAI  672
            KSA+TLGYLNSQQALAD+AILIRSLK+NLSSEASPVVVFGGSYGGMLAAWFRLKYPH+AI
Sbjct  137  KSAETLGYLNSQQALADFAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAI  196

Query  673  GALASSAP  696
            GALASS+P
Sbjct  197  GALASSSP  204



>gb|KFK32665.1| serine carboxypeptidase s28 family protein [Arabis alpina]
Length=496

 Score =   278 bits (710),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFM  402
            +E +YFPQ +DHFSF P  YK+F+QKYLIN   W+KGGP+FVYTGNEGDIDWFA+NTGFM
Sbjct  48   FETRYFPQNLDHFSFKPESYKVFHQKYLINGSFWRKGGPIFVYTGNEGDIDWFASNTGFM  107

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS  582
             DIAPKF ALL+FIEHRFYGES P GK+S K+A+TLGYLNSQQALADYAILIRSLK+NLS
Sbjct  108  SDIAPKFKALLVFIEHRFYGESTPLGKKSPKTAETLGYLNSQQALADYAILIRSLKQNLS  167

Query  583  SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            SEASPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAP
Sbjct  168  SEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAP  205



>ref|XP_006343677.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=498

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 147/160 (92%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK--GGPMFVYTGNEGDIDWFAANTG  396
            ++  YFPQ++DHF+F+P   K+FYQKYLIN  +W K  GGP+FVYTGNEG+IDWFA NTG
Sbjct  49   FKTHYFPQILDHFTFLPKSSKVFYQKYLINDQYWHKEGGGPIFVYTGNEGNIDWFAVNTG  108

Query  397  FMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKN  576
            FM+DIAPKF+ALL+FIEHRFYG+SMPFG  SYKSAKTLGYLNSQQALADYA+LIRSLK+N
Sbjct  109  FMVDIAPKFNALLVFIEHRFYGDSMPFGNNSYKSAKTLGYLNSQQALADYAVLIRSLKQN  168

Query  577  LSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LSS++SPVVVFGGSYGGMLAAWFRLKYPH+AIGA+ASSAP
Sbjct  169  LSSDSSPVVVFGGSYGGMLAAWFRLKYPHIAIGAVASSAP  208



>ref|XP_004242567.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Solanum lycopersicum]
Length=498

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 146/160 (91%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK--GGPMFVYTGNEGDIDWFAANTG  396
            ++  YFPQ++DHF+F+P   K+FYQKYLIN  +W K  GGP+FVYTGNEG+IDWFAANTG
Sbjct  49   FKTHYFPQILDHFTFLPKSCKVFYQKYLINDQYWNKDGGGPIFVYTGNEGNIDWFAANTG  108

Query  397  FMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKN  576
            FM+DI P F+ALL+FIEHRFYG+SMPFG  SYKSAKTLGYLNSQQALADYA+LIRSLK+N
Sbjct  109  FMIDIVPNFNALLIFIEHRFYGDSMPFGNNSYKSAKTLGYLNSQQALADYAVLIRSLKQN  168

Query  577  LSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LSS++SPVVVFGGSYGGMLAAWFRLKYPH+AIGA+ASSAP
Sbjct  169  LSSDSSPVVVFGGSYGGMLAAWFRLKYPHIAIGAVASSAP  208



>ref|XP_008457347.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Cucumis melo]
Length=499

 Score =   275 bits (704),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFM  402
            +E +++PQ++DHF+F P   KIFYQKYLIN+++W+ G P+FVYTGNEGDI+WF ANTGF+
Sbjct  49   FETRFYPQLLDHFTFTPKSSKIFYQKYLINEEYWRNGAPIFVYTGNEGDIEWFTANTGFL  108

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS  582
             DIAPKFHALL+FIEHRFYGESMPFG  SY SA+TLGYL SQQALADYA+LIRSLK+NLS
Sbjct  109  PDIAPKFHALLVFIEHRFYGESMPFGNDSYNSAETLGYLTSQQALADYAVLIRSLKQNLS  168

Query  583  SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            SEASPVV FGGSYGGMLAAWFRLKYPH+ IGALASSAP
Sbjct  169  SEASPVVAFGGSYGGMLAAWFRLKYPHITIGALASSAP  206



>emb|CDY28234.1| BnaA01g06150D [Brassica napus]
Length=285

 Score =   268 bits (686),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 142/158 (90%), Gaps = 5/158 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFM  402
            +E +YFPQ +DHFSF P  Y++F+QKYLIN  +W+KGGP+FVYTGNEGDI+WFA+NTGFM
Sbjct  48   FETRYFPQNLDHFSFQPESYQVFHQKYLINSRYWRKGGPIFVYTGNEGDIEWFASNTGFM  107

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS  582
            LDIAPKF ALL+FIEHRFYGES P     +K A TLG+LNSQQALADYAILIRSLK+NL+
Sbjct  108  LDIAPKFQALLVFIEHRFYGESKP-----HKLANTLGFLNSQQALADYAILIRSLKQNLT  162

Query  583  SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            SEASPV+VFGGSYGGMLAAWFRLKYPH+AIGALASSAP
Sbjct  163  SEASPVIVFGGSYGGMLAAWFRLKYPHIAIGALASSAP  200



>ref|XP_004139280.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Cucumis sativus]
 gb|KGN60732.1| hypothetical protein Csa_2G008720 [Cucumis sativus]
Length=499

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFM  402
            +E +++PQ++DHF+F P   KIFYQKYLIN+++W+ G P+FVYTGNEGDI+WFAANTGF+
Sbjct  49   FETRFYPQLLDHFTFTPKSSKIFYQKYLINEEYWRNGAPIFVYTGNEGDIEWFAANTGFL  108

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS  582
             DIAP+FHALL+FIEHRFYGES PFG  SY SA+TLGYL SQQALADYA+LIRSLK+NLS
Sbjct  109  PDIAPEFHALLVFIEHRFYGESTPFGNDSYNSAETLGYLTSQQALADYAVLIRSLKQNLS  168

Query  583  SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            SEASPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAP
Sbjct  169  SEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAP  206



>ref|XP_010047139.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Eucalyptus grandis]
 gb|KCW78947.1| hypothetical protein EUGRSUZ_C00378 [Eucalyptus grandis]
Length=502

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFM  402
            ++ Q+FPQ++DHF++ P  Y IFYQKYLIN   W  G P+FVYTGNEG+I+WFAANTGF+
Sbjct  56   FKTQFFPQILDHFTYNPKSYIIFYQKYLINSQFWHHGAPIFVYTGNEGNIEWFAANTGFL  115

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS  582
            LDIAPKF ALL+FIEHR+YGES+PFGK SY SA+T+GYLNSQQALADYA+LIRSLK+NLS
Sbjct  116  LDIAPKFRALLVFIEHRYYGESLPFGKDSYNSAETVGYLNSQQALADYAVLIRSLKQNLS  175

Query  583  SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            SEASPVVVFGGSYGGMLAAWFRLKYPH+AIGALASSAP
Sbjct  176  SEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAP  213



>ref|XP_008775539.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Phoenix dactylifera]
Length=381

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 143/162 (88%), Gaps = 4/162 (2%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKG----GPMFVYTGNEGDIDWFAAN  390
            +   +FPQ +DHF+F P  YK+F QKYL+N  +W +G     P+FVYTGNEG+I+WFA N
Sbjct  51   FTTHFFPQQLDHFTFQPKAYKVFSQKYLMNSTYWDQGPNHTAPIFVYTGNEGNIEWFAEN  110

Query  391  TGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLK  570
            TGFMLDIAPKFHALL+FIEHRFYGESMPFGK+SY+SA+TLGYL S QALADYA+LIRSLK
Sbjct  111  TGFMLDIAPKFHALLVFIEHRFYGESMPFGKESYESAETLGYLTSTQALADYAVLIRSLK  170

Query  571  KNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            +NLS+EASPVVVFGGSYGGMLAAWFRLKYPH+AIGALASSAP
Sbjct  171  QNLSAEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAP  212



>ref|XP_010275727.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Nelumbo 
nucifera]
Length=491

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 143/158 (91%), Gaps = 1/158 (1%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFM  402
            Y+ Q+FPQ++DHF+F P   KIFYQKYLIN  +W+ G P+FVYTGNEG+I+WFA NTGFM
Sbjct  48   YKTQFFPQLLDHFTFQPQSSKIFYQKYLINDHYWEHGAPIFVYTGNEGNIEWFAENTGFM  107

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS  582
            LDIAPKF ALL+FIEHRFYGES+PFGK SYKSAKTLGYLNSQQALAD+A+LI+S+ KNL 
Sbjct  108  LDIAPKFRALLVFIEHRFYGESLPFGKDSYKSAKTLGYLNSQQALADFAVLIQSM-KNLL  166

Query  583  SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            SE SPV+VFGGSYGGMLAAWFRLKYPHVA+GALASSAP
Sbjct  167  SEVSPVLVFGGSYGGMLAAWFRLKYPHVALGALASSAP  204



>ref|XP_010275726.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Nelumbo 
nucifera]
Length=525

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 143/158 (91%), Gaps = 1/158 (1%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFM  402
            Y+ Q+FPQ++DHF+F P   KIFYQKYLIN  +W+ G P+FVYTGNEG+I+WFA NTGFM
Sbjct  48   YKTQFFPQLLDHFTFQPQSSKIFYQKYLINDHYWEHGAPIFVYTGNEGNIEWFAENTGFM  107

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS  582
            LDIAPKF ALL+FIEHRFYGES+PFGK SYKSAKTLGYLNSQQALAD+A+LI+S+ KNL 
Sbjct  108  LDIAPKFRALLVFIEHRFYGESLPFGKDSYKSAKTLGYLNSQQALADFAVLIQSM-KNLL  166

Query  583  SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            SE SPV+VFGGSYGGMLAAWFRLKYPHVA+GALASSAP
Sbjct  167  SEVSPVLVFGGSYGGMLAAWFRLKYPHVALGALASSAP  204



>ref|XP_002869352.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45611.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=497

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 152/193 (79%), Gaps = 9/193 (5%)
 Frame = +1

Query  124  VGESKTSYFPGGSY--LQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQ  297
            V E+K  Y PGGSY         +      +    ++ +YFPQ +DHFSF P  Y+IF+Q
Sbjct  18   VAEAK--YPPGGSYHLFSLRQNSKTSKSKAELPFHFQTRYFPQNLDHFSFQPESYRIFHQ  75

Query  298  KYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPF  477
            KYLI+   W+KGGP+FVYTGNEGDI+WFA+NTGFMLDIAPKF ALL+FIEHRFYGES P 
Sbjct  76   KYLISSHFWRKGGPIFVYTGNEGDIEWFASNTGFMLDIAPKFQALLVFIEHRFYGESKP-  134

Query  478  GKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKY  657
                +  AKTLGYLNSQQALADYAILIRSLK+NLSSEASPVVVFGGSYGGMLAAWFRLKY
Sbjct  135  ----HNLAKTLGYLNSQQALADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKY  190

Query  658  PHVAIGALASSAP  696
            PH+ IGALASSAP
Sbjct  191  PHITIGALASSAP  203



>ref|XP_009127344.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Brassica rapa]
Length=504

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 141/158 (89%), Gaps = 5/158 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFM  402
            +E +YFPQ +DHFSF P  Y++F+QKYLIN   W+KGGP+FVYTGNEGDI+WFA+NTGFM
Sbjct  57   FETRYFPQNLDHFSFQPESYQVFHQKYLINSRFWRKGGPIFVYTGNEGDIEWFASNTGFM  116

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS  582
            LDIAPKF ALL+FIEHRFYGES P     +K A TLG+LNSQQALADYAILIRSLK+NL+
Sbjct  117  LDIAPKFKALLVFIEHRFYGESKP-----HKLANTLGFLNSQQALADYAILIRSLKQNLT  171

Query  583  SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            SEASPV+VFGGSYGGMLAAWFRLKYPH+AIGALASSAP
Sbjct  172  SEASPVIVFGGSYGGMLAAWFRLKYPHIAIGALASSAP  209



>ref|XP_010932235.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Elaeis 
guineensis]
Length=525

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 142/162 (88%), Gaps = 4/162 (2%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKG----GPMFVYTGNEGDIDWFAAN  390
            +   +FPQ +DHF+F P  YK+FYQKYL+N  +W +G     P+FVYTGNEG+I+WFA N
Sbjct  75   FTTHFFPQQLDHFTFQPKAYKVFYQKYLMNSTYWDQGPNHTAPIFVYTGNEGNIEWFAEN  134

Query  391  TGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLK  570
            TGFMLDIAPKF+ALL+FIEHRFYGESMPFGK+SYKSA TLGYL S QALADYA+LIRSLK
Sbjct  135  TGFMLDIAPKFNALLVFIEHRFYGESMPFGKESYKSASTLGYLTSTQALADYAVLIRSLK  194

Query  571  KNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            +NLS+EASPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAP
Sbjct  195  QNLSAEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAP  236



>ref|XP_011622147.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Amborella 
trichopoda]
Length=459

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 142/161 (88%), Gaps = 3/161 (2%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+  +FPQ++DHF+F P   KIFYQKYL+N ++W   +K  P+FVYTGNEGDI+WFAANT
Sbjct  44   YKPHFFPQILDHFTFTPQSSKIFYQKYLLNSEYWDGPKKRAPIFVYTGNEGDIEWFAANT  103

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKK  573
            GF+LDIAPKF ALL+FIEHRFYGESMPFGK +YKSA TLGYL SQQALADYA LI SLK+
Sbjct  104  GFLLDIAPKFRALLVFIEHRFYGESMPFGKGAYKSATTLGYLTSQQALADYATLITSLKQ  163

Query  574  NLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            NLS++A PVVVFGGSYGGMLAAWFRLKYPH+A+GA+ASSAP
Sbjct  164  NLSAQACPVVVFGGSYGGMLAAWFRLKYPHIAMGAVASSAP  204



>ref|XP_006285773.1| hypothetical protein CARUB_v10007247mg [Capsella rubella]
 gb|EOA18671.1| hypothetical protein CARUB_v10007247mg [Capsella rubella]
Length=483

 Score =   263 bits (671),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 149/190 (78%), Gaps = 7/190 (4%)
 Frame = +1

Query  133  SKTSYFPGGSY--LQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYL  306
            +   Y PGGSY  L      +      +    ++  YFPQ +DHFSF P  Y+IF+QKYL
Sbjct  16   ADAKYPPGGSYHLLSLRQNMKISKSKAELPFHFQTHYFPQNLDHFSFQPESYRIFHQKYL  75

Query  307  INKDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQ  486
            I+   W+KGGP+FVYTGNEGDI+WFA+NTGFMLDIAPKF ALL+FIEHRFYGES P    
Sbjct  76   ISSHFWRKGGPIFVYTGNEGDIEWFASNTGFMLDIAPKFEALLVFIEHRFYGESKP----  131

Query  487  SYKSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHV  666
              +SAK +GYLNSQQALADYAILIRSLK+NLSSEASPVVV GGSYGGMLAAWFRLKYPH+
Sbjct  132  -PRSAKAMGYLNSQQALADYAILIRSLKQNLSSEASPVVVLGGSYGGMLAAWFRLKYPHI  190

Query  667  AIGALASSAP  696
            AIGALASSAP
Sbjct  191  AIGALASSAP  200



>ref|XP_010432914.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=499

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 159/193 (82%), Gaps = 9/193 (5%)
 Frame = +1

Query  124  VGESKTSYFPGGSYLQASlkkqgkiigkkpkl--pYEVQYFPQVVDHFSFIPSGYKIFYQ  297
            V E+K  Y PGGSY  +SL++  KI   K +L   ++ +YFPQ +DHFSF P  Y IF+Q
Sbjct  20   VAEAK--YPPGGSYHLSSLRQNMKISKSKAELPFHFQTRYFPQNLDHFSFQPESYIIFHQ  77

Query  298  KYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPF  477
            KYLI+   W+KGGP+FVYTGNEGDI+WFA+NTGFMLDIAPKF ALL+FIEHRFYGES P 
Sbjct  78   KYLISSHFWRKGGPIFVYTGNEGDIEWFASNTGFMLDIAPKFQALLIFIEHRFYGESNP-  136

Query  478  GKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKY  657
                 +SAK +GYLNSQQALADYAILIRSLK+NLSSEASPV+V GGSYGGMLAAWFRLKY
Sbjct  137  ----PRSAKKMGYLNSQQALADYAILIRSLKQNLSSEASPVIVLGGSYGGMLAAWFRLKY  192

Query  658  PHVAIGALASSAP  696
            PH+AIGALASSAP
Sbjct  193  PHIAIGALASSAP  205



>ref|XP_006841179.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Amborella 
trichopoda]
 gb|ERN02854.1| hypothetical protein AMTR_s00086p00173170 [Amborella trichopoda]
Length=511

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 142/161 (88%), Gaps = 3/161 (2%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+  +FPQ++DHF+F P   KIFYQKYL+N ++W   +K  P+FVYTGNEGDI+WFAANT
Sbjct  44   YKPHFFPQILDHFTFTPQSSKIFYQKYLLNSEYWDGPKKRAPIFVYTGNEGDIEWFAANT  103

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKK  573
            GF+LDIAPKF ALL+FIEHRFYGESMPFGK +YKSA TLGYL SQQALADYA LI SLK+
Sbjct  104  GFLLDIAPKFRALLVFIEHRFYGESMPFGKGAYKSATTLGYLTSQQALADYATLITSLKQ  163

Query  574  NLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            NLS++A PVVVFGGSYGGMLAAWFRLKYPH+A+GA+ASSAP
Sbjct  164  NLSAQACPVVVFGGSYGGMLAAWFRLKYPHIAMGAVASSAP  204



>ref|XP_009390988.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Musa acuminata subsp. 
malaccensis]
Length=506

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 139/162 (86%), Gaps = 4/162 (2%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKG----GPMFVYTGNEGDIDWFAAN  390
            +   +FPQ +DHF+F P  Y +FYQKYLIN  +W +G     P+FVYTGNEG+I+WFAAN
Sbjct  56   FTAHFFPQQLDHFTFRPKAYHVFYQKYLINSTYWDQGPVHTAPIFVYTGNEGNIEWFAAN  115

Query  391  TGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLK  570
            TGFMLDIAPKF ALL+FIEHRFYGESMPFG  SY+SA+ LGYL S QA+ADYAILIRSLK
Sbjct  116  TGFMLDIAPKFKALLVFIEHRFYGESMPFGNDSYESAEELGYLTSTQAMADYAILIRSLK  175

Query  571  KNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            KNLS+EASPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAP
Sbjct  176  KNLSAEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAP  217



>gb|KFK43799.1| hypothetical protein AALP_AA1G174100 [Arabis alpina]
Length=497

 Score =   259 bits (662),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 138/158 (87%), Gaps = 5/158 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFM  402
            +  +YFPQ +DHFSF P  Y+IF+QKYLI+   W+KGGP+FVYTGNE DI+WFA+NTGFM
Sbjct  51   FRTRYFPQNLDHFSFQPESYRIFHQKYLISSHFWRKGGPIFVYTGNEADIEWFASNTGFM  110

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS  582
            LDIAPKF AL++FIEHRFYGES P        AKT+GYLNSQQALADYAILIRSLK+NLS
Sbjct  111  LDIAPKFQALVVFIEHRFYGESKP-----QMLAKTMGYLNSQQALADYAILIRSLKQNLS  165

Query  583  SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            SEASPVVVFGGSYGGMLAAWFRLKYPH+AIGALASSAP
Sbjct  166  SEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAP  203



>ref|XP_004965729.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Setaria italica]
Length=544

 Score =   251 bits (640),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 137/167 (82%), Gaps = 9/167 (5%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK---------GGPMFVYTGNEGDID  375
            +   YFPQ +DHF+F P+   +FYQKYL+N  +W++          GP+FVYTGNEGDI+
Sbjct  86   FTAHYFPQELDHFTFTPNASMVFYQKYLVNDTYWRRPSGGRKGGAAGPLFVYTGNEGDIE  145

Query  376  WFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAIL  555
            WFA NTGFM DIAPKF ALL+FIEHRFYGES PFG  SYKSA+TLGYL S QALAD+AIL
Sbjct  146  WFATNTGFMFDIAPKFGALLVFIEHRFYGESKPFGNDSYKSAETLGYLTSTQALADFAIL  205

Query  556  IRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            I SLK+NLS+E +PVVVFGGSYGGMLA+WFR+KYPHVAIGALASSAP
Sbjct  206  IGSLKQNLSAEGAPVVVFGGSYGGMLASWFRIKYPHVAIGALASSAP  252



>ref|XP_002438750.1| hypothetical protein SORBIDRAFT_10g025520 [Sorghum bicolor]
 gb|EER90117.1| hypothetical protein SORBIDRAFT_10g025520 [Sorghum bicolor]
Length=558

 Score =   251 bits (640),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 136/166 (82%), Gaps = 8/166 (5%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK--------GGPMFVYTGNEGDIDW  378
            + V YF Q +DHF+F P+   +F QKYL+N   W++         GP+FVYTGNEGDI+W
Sbjct  101  FTVHYFAQELDHFTFTPNASMVFRQKYLLNDTFWRRPSAGDGDGAGPLFVYTGNEGDIEW  160

Query  379  FAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILI  558
            FA NTGFM DIAPKF ALL+FIEHRFYGES PFG  SYKSA+TLGYL S QALAD+AILI
Sbjct  161  FATNTGFMFDIAPKFGALLVFIEHRFYGESKPFGNDSYKSAETLGYLTSTQALADFAILI  220

Query  559  RSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            RSLKKNLS+EA+PVVVFGGSYGGMLA+WFRLKYPHV IGA+ASSAP
Sbjct  221  RSLKKNLSAEAAPVVVFGGSYGGMLASWFRLKYPHVTIGAVASSAP  266



>gb|AFW76173.1| putative serine peptidase S28 family protein, partial [Zea mays]
Length=266

 Score =   237 bits (605),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 133/167 (80%), Gaps = 9/167 (5%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGP---------MFVYTGNEGDID  375
            +   YFPQ++DHF+F P+   +F  KYL+N   W++ G          +FVYTGNEGDI+
Sbjct  84   FTAHYFPQLLDHFAFTPNASTVFRHKYLLNDTFWRRPGAGAGDDGPGPLFVYTGNEGDIE  143

Query  376  WFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAIL  555
            WFA NTGFM DIAP F ALL+FIEHRFYGES PFG  SY+SA+TLGYL S QALAD+A++
Sbjct  144  WFATNTGFMFDIAPTFGALLVFIEHRFYGESKPFGNDSYRSAETLGYLTSTQALADFAVV  203

Query  556  IRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            IR LK++L +EA+PVVVFGGSYGGMLA+WFRLKYPHVAIGALASSAP
Sbjct  204  IRGLKRDLGAEAAPVVVFGGSYGGMLASWFRLKYPHVAIGALASSAP  250



>ref|XP_003563318.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brachypodium distachyon]
Length=536

 Score =   243 bits (620),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 134/169 (79%), Gaps = 11/169 (7%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKG-----------GPMFVYTGNEGD  369
            +   YFPQ +DHF+F P+  +IFYQKYL+N   W+K            GP+FVYTGNEGD
Sbjct  76   FRAHYFPQELDHFTFTPNASRIFYQKYLVNDTFWRKPTGKGRGAAAAPGPVFVYTGNEGD  135

Query  370  IDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYA  549
            I+WFA N+GF+ DIAPKF ALL+FIEHRFYGES PFG +SY SA TLGYL S QALAD+A
Sbjct  136  IEWFATNSGFLFDIAPKFSALLVFIEHRFYGESKPFGNESYGSAATLGYLTSTQALADFA  195

Query  550  ILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            +LI SLK NLS+  +PVVVFGGSYGGMLA+WFRLKYPHVA+GALASSAP
Sbjct  196  VLITSLKHNLSAPVAPVVVFGGSYGGMLASWFRLKYPHVAMGALASSAP  244



>gb|ACR34132.1| unknown [Zea mays]
 gb|AFW76175.1| putative serine peptidase S28 family protein [Zea mays]
Length=372

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 133/167 (80%), Gaps = 9/167 (5%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGP---------MFVYTGNEGDID  375
            +   YFPQ++DHF+F P+   +F  KYL+N   W++ G          +FVYTGNEGDI+
Sbjct  84   FTAHYFPQLLDHFAFTPNASTVFRHKYLLNDTFWRRPGAGAGDDGPGPLFVYTGNEGDIE  143

Query  376  WFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAIL  555
            WFA NTGFM DIAP F ALL+FIEHRFYGES PFG  SY+SA+TLGYL S QALAD+A++
Sbjct  144  WFATNTGFMFDIAPTFGALLVFIEHRFYGESKPFGNDSYRSAETLGYLTSTQALADFAVV  203

Query  556  IRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            IR LK++L +EA+PVVVFGGSYGGMLA+WFRLKYPHVAIGALASSAP
Sbjct  204  IRGLKRDLGAEAAPVVVFGGSYGGMLASWFRLKYPHVAIGALASSAP  250



>ref|XP_008799734.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Phoenix dactylifera]
Length=501

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 130/161 (81%), Gaps = 3/161 (2%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQ-KGGPMFVYTGNEGDIDWFAANTGF  399
            YE +YF Q +DHF F P  Y  F Q+YL+N  HW  KG P+FVYTGNEGDI WFA NTGF
Sbjct  51   YETRYFTQGLDHFDFTPQSYGTFQQRYLVNDTHWGGKGAPIFVYTGNEGDIGWFAQNTGF  110

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSLKK  573
            M +IAP F ALL+FIEHR+YGESMPFG +  +Y +A TLGYL+S QALADYA LI  LKK
Sbjct  111  MYEIAPYFRALLVFIEHRYYGESMPFGGEEVAYSNATTLGYLSSTQALADYATLIIDLKK  170

Query  574  NLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            NLSSE SPVVVFGGSYGGMLAAWFRLKYPHV IGALASSAP
Sbjct  171  NLSSEGSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAP  211



>dbj|BAJ86079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=526

 Score =   241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 131/161 (81%), Gaps = 3/161 (2%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK---GGPMFVYTGNEGDIDWFAANT  393
            +   YF Q +DHF+F P+   +F QKYL+N   W++    GP+FVYTGNEGDI+WFA NT
Sbjct  76   FTAHYFQQELDHFTFTPNASNLFSQKYLLNDTFWRRKPAAGPLFVYTGNEGDIEWFATNT  135

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKK  573
            GFM DIAP F ALL+FIEHRFYGES PFG  SYKSA TLGYL S QALAD+A+LI SLK+
Sbjct  136  GFMFDIAPDFGALLVFIEHRFYGESKPFGNDSYKSADTLGYLTSTQALADFAVLITSLKQ  195

Query  574  NLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            NLS+  +PVVVFGGSYGGMLA+WFRLKYPHVAIGALASSAP
Sbjct  196  NLSAVDAPVVVFGGSYGGMLASWFRLKYPHVAIGALASSAP  236



>ref|XP_006657192.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Oryza brachyantha]
Length=532

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 133/166 (80%), Gaps = 8/166 (5%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK--------GGPMFVYTGNEGDIDW  378
            +  +YFPQ +DHF+F P+   +FYQKYL+N   W++         GP+FVYTGNEGDI+W
Sbjct  75   FTARYFPQELDHFTFTPNSSALFYQKYLVNDTFWRRSSGAGGDTAGPIFVYTGNEGDIEW  134

Query  379  FAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILI  558
            FA NTGFM DIAP+F A+L+FIEHRFYGES PFG  S  SA+ LGYL S QALAD+A+LI
Sbjct  135  FATNTGFMFDIAPRFGAMLVFIEHRFYGESKPFGNDSNSSAEKLGYLTSTQALADFAVLI  194

Query  559  RSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
             SLK+NLS+ A+PVVVFGGSYGGMLA+WFRLKYPHV IGA+ASSAP
Sbjct  195  TSLKQNLSAVAAPVVVFGGSYGGMLASWFRLKYPHVTIGAVASSAP  240



>gb|EMT22763.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=314

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 132/179 (74%), Gaps = 21/179 (12%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK---GGPMFVYTGNEGDIDWFAANT  393
            +   YFPQ +DHF+F P+  ++F QKYL+N   W++    GP+FVYTGNEGDI+WF  NT
Sbjct  63   FTAHYFPQELDHFTFTPNSSRVFSQKYLLNDTFWRRKPTAGPLFVYTGNEGDIEWFTTNT  122

Query  394  GFMLDIAPKFHALLLFIE------------------HRFYGESMPFGKQSYKSAKTLGYL  519
            GFM DIAP+F ALL+FIE                  HRFYGES PFG  S KSA TLGYL
Sbjct  123  GFMFDIAPEFGALLVFIEVARLRASQIGQQAAARPMHRFYGESQPFGNDSDKSADTLGYL  182

Query  520  NSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
             S QALAD+AILI SLK+NLS+  +PV+VFGGSYGGMLA+WFRLKYPHVA+GALASSAP
Sbjct  183  TSTQALADFAILITSLKQNLSAVDAPVIVFGGSYGGMLASWFRLKYPHVAMGALASSAP  241



>dbj|BAJ92142.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=535

 Score =   238 bits (607),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 130/161 (81%), Gaps = 3/161 (2%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK---GGPMFVYTGNEGDIDWFAANT  393
            +   YF Q +DHF+F P+   +F QKYL+N   W++    GP+FVYTGNEGDI+WFA NT
Sbjct  85   FTAHYFQQELDHFTFTPNASNLFSQKYLLNDTFWRRKPAAGPLFVYTGNEGDIEWFATNT  144

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKK  573
            GF+ DIAP F ALL+FIEHRFYGES PFG  SYKSA TLGYL S QALAD+A+LI SLK 
Sbjct  145  GFLFDIAPDFGALLVFIEHRFYGESKPFGNDSYKSADTLGYLTSTQALADFAVLITSLKH  204

Query  574  NLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            NLS+  +PVVVFGGSYGGMLA+WFRLKYPHVA+GA+ASSAP
Sbjct  205  NLSTVDAPVVVFGGSYGGMLASWFRLKYPHVAMGAVASSAP  245



>ref|XP_010931151.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Elaeis guineensis]
Length=500

 Score =   236 bits (603),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 132/161 (82%), Gaps = 3/161 (2%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQ-KGGPMFVYTGNEGDIDWFAANTGF  399
            YE ++F Q++DHF + P  Y+ F Q+YL+N  HW  KG P+FVYTGNEG+I WFA NTGF
Sbjct  52   YETRFFTQILDHFDYTPRSYETFQQRYLVNDTHWGGKGAPIFVYTGNEGEIGWFARNTGF  111

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSLKK  573
            M +IAP F ALL+FIEHR+YGES+PFG +  +Y +A TLGYL++ QALADYA LI  LKK
Sbjct  112  MYEIAPHFKALLVFIEHRYYGESIPFGGKEIAYSNATTLGYLSTTQALADYATLIIDLKK  171

Query  574  NLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            NLSSE SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAP
Sbjct  172  NLSSEGSPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAP  212



>ref|XP_008659849.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Zea mays]
Length=533

 Score =   237 bits (605),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 131/166 (79%), Gaps = 8/166 (5%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGP--------MFVYTGNEGDIDW  378
            +   YFPQ +DHF+F P+   +F QKYL+N   W++           +FVYTGNEGDI+W
Sbjct  73   FTTHYFPQELDHFTFTPNASMLFRQKYLVNDTFWRRPRRGGGGGAGPLFVYTGNEGDIEW  132

Query  379  FAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILI  558
            FA NTGFM DIAPKF ALL+FIEHRFYGES+PFG  SY SA+T GYL S QALAD+AILI
Sbjct  133  FATNTGFMFDIAPKFGALLVFIEHRFYGESLPFGDDSYSSAETEGYLTSTQALADFAILI  192

Query  559  RSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              LK+NLS+E +PVVVFGGSYGGMLA+WFRLKYPHVAIGALASSAP
Sbjct  193  TGLKRNLSAETAPVVVFGGSYGGMLASWFRLKYPHVAIGALASSAP  238



>dbj|BAJ87416.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   236 bits (603),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 130/161 (81%), Gaps = 3/161 (2%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK---GGPMFVYTGNEGDIDWFAANT  393
            +   YF Q +DHF+F P+   +F QKYL+N   W++    GP+FVYTGNEGDI+WFA NT
Sbjct  74   FTAHYFQQELDHFTFTPNASNLFSQKYLLNDTFWRRKPAAGPLFVYTGNEGDIEWFATNT  133

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKK  573
            GF+ DIAP F ALL+FIEHRFYGES PFG  SYKSA TLGYL S QALAD+A+LI SLK 
Sbjct  134  GFLFDIAPDFGALLVFIEHRFYGESKPFGNDSYKSADTLGYLTSTQALADFAVLITSLKH  193

Query  574  NLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            NLS+  +PVVVFGGSYGGMLA+WFRLKYPHVA+GA+ASSAP
Sbjct  194  NLSTVDAPVVVFGGSYGGMLASWFRLKYPHVAMGAVASSAP  234



>gb|AFW87519.1| putative serine peptidase S28 family protein [Zea mays]
Length=552

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 131/166 (79%), Gaps = 8/166 (5%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGP--------MFVYTGNEGDIDW  378
            +   YFPQ +DHF+F P+   +F QKYL+N   W++           +FVYTGNEGDI+W
Sbjct  73   FTTHYFPQELDHFTFTPNASMLFRQKYLVNDTFWRRPRRGGGGGAGPLFVYTGNEGDIEW  132

Query  379  FAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILI  558
            FA NTGFM DIAPKF ALL+FIEHRFYGES+PFG  SY SA+T GYL S QALAD+AILI
Sbjct  133  FATNTGFMFDIAPKFGALLVFIEHRFYGESLPFGDDSYSSAETEGYLTSTQALADFAILI  192

Query  559  RSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              LK+NLS+E +PVVVFGGSYGGMLA+WFRLKYPHVAIGALASSAP
Sbjct  193  TGLKRNLSAETAPVVVFGGSYGGMLASWFRLKYPHVAIGALASSAP  238



>ref|NP_001142279.1| uncharacterized protein LOC100274448 precursor [Zea mays]
 gb|ACF78774.1| unknown [Zea mays]
 gb|ACF88076.1| unknown [Zea mays]
 gb|AFW76174.1| putative serine peptidase S28 family protein [Zea mays]
Length=542

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 133/167 (80%), Gaps = 9/167 (5%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGP---------MFVYTGNEGDID  375
            +   YFPQ++DHF+F P+   +F  KYL+N   W++ G          +FVYTGNEGDI+
Sbjct  84   FTAHYFPQLLDHFAFTPNASTVFRHKYLLNDTFWRRPGAGAGDDGPGPLFVYTGNEGDIE  143

Query  376  WFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAIL  555
            WFA NTGFM DIAP F ALL+FIEHRFYGES PFG  SY+SA+TLGYL S QALAD+A++
Sbjct  144  WFATNTGFMFDIAPTFGALLVFIEHRFYGESKPFGNDSYRSAETLGYLTSTQALADFAVV  203

Query  556  IRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            IR LK++L +EA+PVVVFGGSYGGMLA+WFRLKYPHVAIGALASSAP
Sbjct  204  IRGLKRDLGAEAAPVVVFGGSYGGMLASWFRLKYPHVAIGALASSAP  250



>ref|NP_001058206.1| Os06g0647400 [Oryza sativa Japonica Group]
 dbj|BAD37324.1| putative prolylcarboxypeptidase isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20120.1| Os06g0647400 [Oryza sativa Japonica Group]
 dbj|BAG95990.1| unnamed protein product [Oryza sativa Japonica Group]
Length=539

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 130/166 (78%), Gaps = 8/166 (5%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK--------GGPMFVYTGNEGDIDW  378
            +   YFPQ +DHF+F P+   +FYQKYL+N   W++         GP+FVYTGNEGDI+W
Sbjct  82   FTAHYFPQELDHFTFTPNASAVFYQKYLVNDTFWRRSAAAGETPAGPIFVYTGNEGDIEW  141

Query  379  FAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILI  558
            FA NTGFM DIAP F ALL+FIEHRFYGES PFG +S  S + LGYL S QALAD+A+LI
Sbjct  142  FATNTGFMFDIAPSFGALLVFIEHRFYGESKPFGNESNSSPEKLGYLTSTQALADFAVLI  201

Query  559  RSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
             SLK NLS+ +SPVVVFGGSYGGMLA+WFRLKYPHV IGA+ASSAP
Sbjct  202  TSLKHNLSAVSSPVVVFGGSYGGMLASWFRLKYPHVTIGAVASSAP  247



>ref|XP_007027868.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY08370.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
Length=387

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 130/164 (79%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+ +YF Q++DHF+F P  Y+ F  +YLIN  +W   +K  P+FVYTGNEGDI+WFA NT
Sbjct  53   YKARYFTQILDHFNFNPKSYQTFQHRYLINDTYWSGPEKNSPIFVYTGNEGDIEWFAQNT  112

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM D+AP F ALL+FIEHRFYG+S+PFG     +Y +A TLGYL S QALADYA LI  
Sbjct  113  GFMFDVAPYFKALLVFIEHRFYGKSIPFGGDKDIAYSNASTLGYLTSTQALADYATLIID  172

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNL+++ SPVVVFGGSYGGMLA WFRLKYPH+ IGALASSAP
Sbjct  173  LKKNLTADDSPVVVFGGSYGGMLATWFRLKYPHIVIGALASSAP  216



>emb|CAN61013.1| hypothetical protein VITISV_036738 [Vitis vinifera]
Length=554

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 131/164 (80%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q++DHF++ P  Y+ F Q+YLIN  +W    K  P+FVYTGNEGDI+WFA NT
Sbjct  51   YEAKYFTQILDHFNYQPQSYRTFQQRYLINDKYWGGADKLAPIFVYTGNEGDIEWFAQNT  110

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQS---YKSAKTLGYLNSQQALADYAILIRS  564
            GFM D AP F ALL+FIEHRFYG+S+PFG  +   Y +A TLGYL+S QALADYA LI  
Sbjct  111  GFMFDTAPHFQALLVFIEHRFYGKSIPFGGDTNVAYSNASTLGYLSSTQALADYATLIID  170

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP
Sbjct  171  LKKNLSATNSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  214



>emb|CBI30345.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 131/164 (80%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q++DHF++ P  Y+ F Q+YLIN  +W    K  P+FVYTGNEGDI+WFA NT
Sbjct  29   YEAKYFTQLLDHFNYQPQSYRTFQQRYLINDKYWGGADKLAPIFVYTGNEGDIEWFAQNT  88

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQS---YKSAKTLGYLNSQQALADYAILIRS  564
            GFM D AP F ALL+FIEHRFYG+S+PFG  +   Y +A TLGYL+S QALADYA LI  
Sbjct  89   GFMFDTAPHFQALLVFIEHRFYGKSIPFGGDTNVAYSNASTLGYLSSTQALADYATLIID  148

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP
Sbjct  149  LKKNLSATNSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  192



>gb|KDO70542.1| hypothetical protein CISIN_1g0106561mg, partial [Citrus sinensis]
 gb|KDO70543.1| hypothetical protein CISIN_1g0106561mg, partial [Citrus sinensis]
 gb|KDO70544.1| hypothetical protein CISIN_1g0106561mg, partial [Citrus sinensis]
 gb|KDO70545.1| hypothetical protein CISIN_1g0106561mg, partial [Citrus sinensis]
Length=368

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 132/164 (80%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+ +Y  Q++DHF++ P  Y+ F Q+YLIN  HW   +   P+FVYTGNEGDI+WFA NT
Sbjct  53   YKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNT  112

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM D+APKF ALL+FIEHR+YG+S+P+G     +YK+A T GYL+S QALADYA LI  
Sbjct  113  GFMYDVAPKFKALLVFIEHRYYGKSIPYGGNKEIAYKNASTTGYLSSTQALADYASLIID  172

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNL++  SPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP
Sbjct  173  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  216



>ref|XP_002281618.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Vitis vinifera]
Length=507

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 131/164 (80%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q++DHF++ P  Y+ F Q+YLIN  +W    K  P+FVYTGNEGDI+WFA NT
Sbjct  51   YEAKYFTQLLDHFNYQPQSYRTFQQRYLINDKYWGGADKLAPIFVYTGNEGDIEWFAQNT  110

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQS---YKSAKTLGYLNSQQALADYAILIRS  564
            GFM D AP F ALL+FIEHRFYG+S+PFG  +   Y +A TLGYL+S QALADYA LI  
Sbjct  111  GFMFDTAPHFQALLVFIEHRFYGKSIPFGGDTNVAYSNASTLGYLSSTQALADYATLIID  170

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP
Sbjct  171  LKKNLSATNSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  214



>ref|XP_006430124.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
 gb|ESR43364.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
Length=426

 Score =   231 bits (590),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 133/164 (81%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+ +Y  Q++DHF++ P  Y+ F Q+YLIN  HW   +   P+FVYTGNEGDI+WFA NT
Sbjct  53   YKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNT  112

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GFM D+APKF ALL+FIEHR+YG+S+P+G   + +YK+A T GYL+S QALADYA LI  
Sbjct  113  GFMYDVAPKFKALLVFIEHRYYGKSIPYGGYKEIAYKNASTTGYLSSTQALADYASLIID  172

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNL++  SPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP
Sbjct  173  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  216



>gb|ACG41459.1| lysosomal Pro-X carboxypeptidase precursor [Zea mays]
Length=542

 Score =   234 bits (598),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 133/167 (80%), Gaps = 9/167 (5%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGP---------MFVYTGNEGDID  375
            +   YFPQ++DHF+F P+   +F  KYL+N   W++ G          +FVYTGNEGDI+
Sbjct  84   FTAHYFPQLLDHFAFTPNASTVFRHKYLLNDTFWRRPGAGAGDDGPGPLFVYTGNEGDIE  143

Query  376  WFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAIL  555
            WFA NTGFM DIAP F ALL+FIEH+FYGES PFG  SY+SA+TLGYL S QALAD+A++
Sbjct  144  WFATNTGFMFDIAPTFGALLVFIEHQFYGESKPFGNDSYRSAETLGYLTSTQALADFAVV  203

Query  556  IRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            IR LK++L +EA+PVVVFGGSYGGMLA+WFRLKYPHVAIGALASSAP
Sbjct  204  IRGLKRDLGAEAAPVVVFGGSYGGMLASWFRLKYPHVAIGALASSAP  250



>ref|XP_006481710.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=505

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 132/164 (80%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+ +Y  Q++DHF++ P  Y+ F Q+YLIN  HW   +   P+FVYTGNEGDI+WFA NT
Sbjct  53   YKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNT  112

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM D+APKF ALL+FIEHR+YG+SMP+G     +YK+A T GYL+S QALADYA LI  
Sbjct  113  GFMYDVAPKFKALLVFIEHRYYGKSMPYGGNKEIAYKNASTTGYLSSTQALADYASLIID  172

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNL++  SPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP
Sbjct  173  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  216



>ref|XP_010246130.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=504

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 130/164 (79%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHF+F P  Y+ F Q+YLIN  +W   Q   P+FVYTGNEGDI+WFA NT
Sbjct  52   YETKYFTQTLDHFNFQPQSYQTFQQRYLINDKYWGGAQNNAPIFVYTGNEGDIEWFAQNT  111

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GFM + APKF ALL+FIEHRFYG S+PFG   + +Y +A TLGYL+S QALADYA LI  
Sbjct  112  GFMYETAPKFKALLVFIEHRFYGSSIPFGGDKEVAYSNASTLGYLSSTQALADYATLIID  171

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNL++E SPV+ FGGSYGGMLAAWFRLKYPHV +GALASS+P
Sbjct  172  LKKNLTAEDSPVIAFGGSYGGMLAAWFRLKYPHVVVGALASSSP  215



>gb|KJB16581.1| hypothetical protein B456_002G237800 [Gossypium raimondii]
Length=436

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 131/164 (80%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+ +YF Q++DHF+F P  Y+ F  +YLIN  +W   +K  P+FVYTGNEGDI+WFA NT
Sbjct  56   YKTKYFTQILDHFNFNPKSYQKFQHRYLINDTYWGGPKKNSPIFVYTGNEGDIEWFAQNT  115

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM DIAP F ALL+FIEHRFYG+S+PFG     +Y +A TLGYL S QALADYA LI  
Sbjct  116  GFMFDIAPHFQALLVFIEHRFYGKSIPFGGDKDVAYSNASTLGYLTSTQALADYATLIID  175

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNL++  +PVVVFGGSYGGMLA+WFRLKYPHVAIGALASSAP
Sbjct  176  LKKNLTAVDAPVVVFGGSYGGMLASWFRLKYPHVAIGALASSAP  219



>gb|KCW90505.1| hypothetical protein EUGRSUZ_A02624 [Eucalyptus grandis]
Length=466

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 132/164 (80%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF QV+DHF F P  Y+ F Q+YLIN   W   Q+  P+FVYTGNEGDI+WF  NT
Sbjct  60   YETRYFTQVLDHFGFRPESYQTFQQRYLINSTFWGGPQRNAPIFVYTGNEGDIEWFTQNT  119

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GFM + AP+F+ALL+FIEHRFYG+S+PFG   + +Y ++ TLGYL+S QALADYA LI  
Sbjct  120  GFMFETAPRFNALLVFIEHRFYGKSIPFGGNKEVAYSNSSTLGYLSSTQALADYATLITD  179

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKN ++E SPVVVFGGSYGGMLAAWFRLKYPH+AIGAL+SS+P
Sbjct  180  LKKNWTAEDSPVVVFGGSYGGMLAAWFRLKYPHIAIGALSSSSP  223



>gb|KJB16583.1| hypothetical protein B456_002G237800 [Gossypium raimondii]
Length=436

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 131/164 (80%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+ +YF Q++DHF+F P  Y+ F  +YLIN  +W   +K  P+FVYTGNEGDI+WFA NT
Sbjct  56   YKTKYFTQILDHFNFNPKSYQKFQHRYLINDTYWGGPKKNSPIFVYTGNEGDIEWFAQNT  115

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM DIAP F ALL+FIEHRFYG+S+PFG     +Y +A TLGYL S QALADYA LI  
Sbjct  116  GFMFDIAPHFQALLVFIEHRFYGKSIPFGGDKDVAYSNASTLGYLTSTQALADYATLIID  175

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNL++  +PVVVFGGSYGGMLA+WFRLKYPHVAIGALASSAP
Sbjct  176  LKKNLTAVDAPVVVFGGSYGGMLASWFRLKYPHVAIGALASSAP  219



>gb|EMT03388.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=459

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 129/158 (82%), Gaps = 7/158 (4%)
 Frame = +1

Query  244  QVVDHFSFIPSGYKIFYQKYLINKDHWQKG-------GPMFVYTGNEGDIDWFAANTGFM  402
            + +DHF+F P+  ++F QKYL+N   W+K        GP+FVYTGNEGDI+WFA NTGFM
Sbjct  12   EELDHFTFTPNSSRVFSQKYLLNDTFWRKPTAGAGGVGPLFVYTGNEGDIEWFATNTGFM  71

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS  582
             DIAP+F ALL+FIEHR+YGES PFG  SY SA T+GYL S QALAD+AILI SLK+NLS
Sbjct  72   FDIAPEFGALLVFIEHRYYGESKPFGNDSYTSADTVGYLTSTQALADFAILITSLKQNLS  131

Query  583  SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            +  +PVVVFGGSYGGMLA+WFRLKYPHVA+GALASSAP
Sbjct  132  AVDAPVVVFGGSYGGMLASWFRLKYPHVAMGALASSAP  169



>gb|EMT22761.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=539

 Score =   232 bits (592),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 128/154 (83%), Gaps = 3/154 (2%)
 Frame = +1

Query  244  QVVDHFSFIPSGYKIFYQKYLINKDHWQK---GGPMFVYTGNEGDIDWFAANTGFMLDIA  414
            + +DHF+F P+  ++F  KYL+N   W++    GP+FVYTGNEGDI+WF  NTGFM DIA
Sbjct  70   EELDHFTFTPNASRLFSHKYLLNDTFWRRKPAAGPLFVYTGNEGDIEWFTTNTGFMFDIA  129

Query  415  PKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLSSEAS  594
            P+F ALL+FIEHRFYGES PFG  SYKSA TLGYL S QALAD+A+LI SLK+NLS+  +
Sbjct  130  PEFGALLVFIEHRFYGESKPFGNDSYKSADTLGYLTSTQALADFAVLITSLKQNLSAVDA  189

Query  595  PVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            PVVVFGGSYGGMLA+WFRLKYPHVA+GALASSAP
Sbjct  190  PVVVFGGSYGGMLASWFRLKYPHVAMGALASSAP  223



>gb|EEC81080.1| hypothetical protein OsI_23902 [Oryza sativa Indica Group]
Length=539

 Score =   232 bits (592),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 129/166 (78%), Gaps = 8/166 (5%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK--------GGPMFVYTGNEGDIDW  378
            +   YFPQ +DHF+F P+   +FYQKYL+N   W++         GP+FVYTGNEGDI+W
Sbjct  82   FTAHYFPQELDHFTFTPNASALFYQKYLVNDTFWRRSAAAGETPAGPIFVYTGNEGDIEW  141

Query  379  FAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILI  558
            FA NTGFM  IAP F ALL+FIEHRFYGES PFG +S  S + LGYL S QALAD+A+LI
Sbjct  142  FATNTGFMFHIAPSFGALLVFIEHRFYGESKPFGNESNSSPEKLGYLTSTQALADFAVLI  201

Query  559  RSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
             SLK NLS+ +SPVVVFGGSYGGMLA+WFRLKYPHV IGA+ASSAP
Sbjct  202  TSLKHNLSAVSSPVVVFGGSYGGMLASWFRLKYPHVTIGAVASSAP  247



>gb|KJB16582.1| hypothetical protein B456_002G237800 [Gossypium raimondii]
Length=451

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 131/164 (80%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+ +YF Q++DHF+F P  Y+ F  +YLIN  +W   +K  P+FVYTGNEGDI+WFA NT
Sbjct  56   YKTKYFTQILDHFNFNPKSYQKFQHRYLINDTYWGGPKKNSPIFVYTGNEGDIEWFAQNT  115

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM DIAP F ALL+FIEHRFYG+S+PFG     +Y +A TLGYL S QALADYA LI  
Sbjct  116  GFMFDIAPHFQALLVFIEHRFYGKSIPFGGDKDVAYSNASTLGYLTSTQALADYATLIID  175

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNL++  +PVVVFGGSYGGMLA+WFRLKYPHVAIGALASSAP
Sbjct  176  LKKNLTAVDAPVVVFGGSYGGMLASWFRLKYPHVAIGALASSAP  219



>ref|XP_006430123.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
 gb|ESR43363.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
Length=505

 Score =   231 bits (590),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 133/164 (81%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+ +Y  Q++DHF++ P  Y+ F Q+YLIN  HW   +   P+FVYTGNEGDI+WFA NT
Sbjct  53   YKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNT  112

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GFM D+APKF ALL+FIEHR+YG+S+P+G   + +YK+A T GYL+S QALADYA LI  
Sbjct  113  GFMYDVAPKFKALLVFIEHRYYGKSIPYGGYKEIAYKNASTTGYLSSTQALADYASLIID  172

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNL++  SPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP
Sbjct  173  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  216



>ref|XP_010059402.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW90504.1| hypothetical protein EUGRSUZ_A02624 [Eucalyptus grandis]
Length=516

 Score =   231 bits (590),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 132/164 (80%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF QV+DHF F P  Y+ F Q+YLIN   W   Q+  P+FVYTGNEGDI+WF  NT
Sbjct  60   YETRYFTQVLDHFGFRPESYQTFQQRYLINSTFWGGPQRNAPIFVYTGNEGDIEWFTQNT  119

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GFM + AP+F+ALL+FIEHRFYG+S+PFG   + +Y ++ TLGYL+S QALADYA LI  
Sbjct  120  GFMFETAPRFNALLVFIEHRFYGKSIPFGGNKEVAYSNSSTLGYLSSTQALADYATLITD  179

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKN ++E SPVVVFGGSYGGMLAAWFRLKYPH+AIGAL+SS+P
Sbjct  180  LKKNWTAEDSPVVVFGGSYGGMLAAWFRLKYPHIAIGALSSSSP  223



>ref|XP_007027867.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY08369.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=508

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 130/164 (79%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+ +YF Q++DHF+F P  Y+ F  +YLIN  +W   +K  P+FVYTGNEGDI+WFA NT
Sbjct  53   YKARYFTQILDHFNFNPKSYQTFQHRYLINDTYWSGPEKNSPIFVYTGNEGDIEWFAQNT  112

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM D+AP F ALL+FIEHRFYG+S+PFG     +Y +A TLGYL S QALADYA LI  
Sbjct  113  GFMFDVAPYFKALLVFIEHRFYGKSIPFGGDKDIAYSNASTLGYLTSTQALADYATLIID  172

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNL+++ SPVVVFGGSYGGMLA WFRLKYPH+ IGALASSAP
Sbjct  173  LKKNLTADDSPVVVFGGSYGGMLATWFRLKYPHIVIGALASSAP  216



>gb|KJB16580.1| hypothetical protein B456_002G237800 [Gossypium raimondii]
Length=511

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 131/164 (80%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+ +YF Q++DHF+F P  Y+ F  +YLIN  +W   +K  P+FVYTGNEGDI+WFA NT
Sbjct  56   YKTKYFTQILDHFNFNPKSYQKFQHRYLINDTYWGGPKKNSPIFVYTGNEGDIEWFAQNT  115

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM DIAP F ALL+FIEHRFYG+S+PFG     +Y +A TLGYL S QALADYA LI  
Sbjct  116  GFMFDIAPHFQALLVFIEHRFYGKSIPFGGDKDVAYSNASTLGYLTSTQALADYATLIID  175

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNL++  +PVVVFGGSYGGMLA+WFRLKYPHVAIGALASSAP
Sbjct  176  LKKNLTAVDAPVVVFGGSYGGMLASWFRLKYPHVAIGALASSAP  219



>ref|XP_002308456.2| hypothetical protein POPTR_0006s22440g [Populus trichocarpa]
 gb|EEE91979.2| hypothetical protein POPTR_0006s22440g [Populus trichocarpa]
Length=504

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 131/164 (80%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y  ++F QV+DH++F P  YK F Q+YLIN  +W   +K  P+F+YTGNEGDI+WFA NT
Sbjct  49   YHEKFFTQVLDHYTFRPQSYKTFQQRYLINDKYWGGAEKNAPIFLYTGNEGDIEWFAQNT  108

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GF+ DIAP F  LL+FIEHRFYG+SMPFG   + +Y ++ TLGYL S QALADYA LI  
Sbjct  109  GFIFDIAPHFKPLLVFIEHRFYGKSMPFGGNKEVAYSNSSTLGYLTSTQALADYATLIID  168

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPVVVFGGSYGGMLAAWFRLKYPHVAIGALASS+P
Sbjct  169  LKKNLSATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSSP  212



>ref|XP_012074389.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Jatropha curcas]
 gb|KDP36180.1| hypothetical protein JCGZ_08824 [Jatropha curcas]
Length=499

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 130/164 (79%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+ ++F QV+DHF+F P  Y  F ++YLIN   W   +K  P+F+YTGNEGDI+WFA NT
Sbjct  43   YKEKFFTQVLDHFNFNPESYHTFQERYLINDTFWGGPKKNAPIFLYTGNEGDIEWFAQNT  102

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GFM DIAP F+ALL+FIEHRFYG+S+PFG   K +Y +A TLGYL S QALADYA L+  
Sbjct  103  GFMFDIAPHFNALLVFIEHRFYGKSIPFGGDKKVAYSNASTLGYLTSTQALADYATLMTD  162

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LK NLS+  SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAP
Sbjct  163  LKNNLSATESPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAP  206



>emb|CDP10629.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 131/164 (80%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +Y+ Q++DHF+F P  Y+ F Q+YLI+  HW   +K  P+FVYTGNEGDI+WF  NT
Sbjct  49   YETKYYTQILDHFTFTPQSYQTFQQRYLISYKHWGGAKKNAPIFVYTGNEGDIEWFTQNT  108

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM + AP F ALL+FIEHRFYG+S+PFG     +Y ++ TLGYL+S QALADYA LI  
Sbjct  109  GFMFENAPHFKALLVFIEHRFYGKSIPFGGNKDVAYANSSTLGYLSSTQALADYATLIID  168

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP
Sbjct  169  LKKNLSAVDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  212



>ref|XP_011046918.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=504

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 131/164 (80%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y  ++F QV+DH++F P  YK F Q+YLIN  +W   +K  P+F+YTGNEGDI+WFA NT
Sbjct  49   YHEKFFTQVLDHYTFRPQSYKTFQQRYLINDKYWGGAEKNAPIFLYTGNEGDIEWFAQNT  108

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GF+ DIAP F  L++FIEHRFYG+SMPFG   + +Y ++ TLGYL S QALADYA LI  
Sbjct  109  GFIFDIAPHFKPLVVFIEHRFYGKSMPFGGNKEVAYSNSSTLGYLTSTQALADYATLIID  168

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPVVVFGGSYGGMLAAWFRLKYPHVAIGALASS+P
Sbjct  169  LKKNLSATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSSP  212



>ref|XP_011094280.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Sesamum indicum]
Length=510

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 134/165 (81%), Gaps = 7/165 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW----QKGGPMFVYTGNEGDIDWFAAN  390
            YE ++F Q++DHF++ P  Y+ F Q+YLIN ++W     K  P+FVYTGNEGDI+WFA N
Sbjct  49   YEEKFFTQILDHFNYNPQSYETFQQRYLINDNYWGGGADKNAPIFVYTGNEGDIEWFAQN  108

Query  391  TGFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIR  561
            TGFM + AP F ALLLFIEHR+YG+SMPFG   +++Y ++ TLGYL++ QALADYA LI 
Sbjct  109  TGFMFETAPIFKALLLFIEHRYYGKSMPFGGSKERAYANSSTLGYLSATQALADYATLIL  168

Query  562  SLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
             LKKNL++  SPVVVFGGSYGGMLAAWFRLKYPHVA+GALASSAP
Sbjct  169  DLKKNLTAIDSPVVVFGGSYGGMLAAWFRLKYPHVAVGALASSAP  213



>gb|EMS54706.1| Lysosomal Pro-X carboxypeptidase [Triticum urartu]
Length=632

 Score =   231 bits (589),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 127/158 (80%), Gaps = 3/158 (2%)
 Frame = +1

Query  232  QYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK---GGPMFVYTGNEGDIDWFAANTGFM  402
            Q  P  +DHF+F P+   +F  KYL+N   W++    GP+FVY GNEGDI+WFA NTGFM
Sbjct  98   QLTPVELDHFTFTPNASALFSHKYLLNDTFWRRKPTAGPLFVYMGNEGDIEWFATNTGFM  157

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS  582
             DIAP+F ALL+FIEHRFYGES PFG  SYKSA TLGYL S QALAD+A+LI SLK NLS
Sbjct  158  FDIAPQFGALLVFIEHRFYGESKPFGNDSYKSADTLGYLTSTQALADFAVLITSLKHNLS  217

Query  583  SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            +  +PVVVFGGSYGGMLA+WFRLKYPHVA+GALASSAP
Sbjct  218  AVDAPVVVFGGSYGGMLASWFRLKYPHVAMGALASSAP  255



>ref|XP_006854747.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Amborella trichopoda]
 gb|ERN16214.1| hypothetical protein AMTR_s00030p00247420 [Amborella trichopoda]
Length=517

 Score =   228 bits (582),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 132/163 (81%), Gaps = 5/163 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQ---KGGPMFVYTGNEGDIDWFAANT  393
            YE++YF Q +DHF+++P GY+ F Q+YLIN  +W       P+FVYTGNEGD++WFA NT
Sbjct  68   YEIKYFTQTLDHFNYVPWGYETFQQRYLINSKYWGGPIDKAPIFVYTGNEGDVEWFAQNT  127

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSL  567
            GFM + AP F ALL+FIEHR+YGES+P+G +  +YK+A T GYL+S QALADYA+LI  L
Sbjct  128  GFMFENAPYFKALLVFIEHRYYGESIPYGSEEIAYKNASTHGYLSSAQALADYAMLIIDL  187

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            KKNLS+E SPVVV GGSYGGMLA WFRLKYPHV IGALASSAP
Sbjct  188  KKNLSAEDSPVVVMGGSYGGMLATWFRLKYPHVCIGALASSAP  230



>ref|XP_006836096.2| PREDICTED: LOW QUALITY PROTEIN: lysosomal Pro-X carboxypeptidase, 
partial [Amborella trichopoda]
Length=304

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 128/163 (79%), Gaps = 5/163 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQ---KGGPMFVYTGNEGDIDWFAANT  393
            YE++YF Q  DHF+++P G + F Q+YLIN  +W       P+FVYTGNEGDI+WFA NT
Sbjct  41   YEIKYFTQTFDHFNYVPWGNETFQQRYLINSKYWGGPIDKAPIFVYTGNEGDIEWFAQNT  100

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSL  567
            GFM D AP F ALL+FIEHR+YGES+P+G +  +YK+  T GYL+S QA ADYA+LI  L
Sbjct  101  GFMFDNAPYFKALLVFIEHRYYGESIPYGSEEIAYKNVTTHGYLSSAQASADYAMLIIDL  160

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            KKNLS++ SPVVV GGSYGGMLA WFRLKYPHV IGALASSAP
Sbjct  161  KKNLSAKDSPVVVMGGSYGGMLATWFRLKYPHVCIGALASSAP  203



>gb|EMT13135.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=515

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 127/152 (84%), Gaps = 3/152 (2%)
 Frame = +1

Query  250  VDHFSFIPSGYKIFYQKYLINKDHWQK---GGPMFVYTGNEGDIDWFAANTGFMLDIAPK  420
            +DHF+F P+   +F QKYL+N   W++    GP+FVYTGNEG+I+WFA NTGFM DIAP+
Sbjct  64   LDHFTFTPNSSHLFSQKYLLNDTFWRRKPTAGPLFVYTGNEGEIEWFATNTGFMFDIAPE  123

Query  421  FHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPV  600
            F ALL+FIEHRFYGESMPFG   Y SA TLGYL S QALAD+A+LI SLK+NLS+  +PV
Sbjct  124  FGALLVFIEHRFYGESMPFGDGPYSSADTLGYLTSTQALADFAVLITSLKQNLSAVDAPV  183

Query  601  VVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            +VFGGSYGGMLA+WFRLKYPHVA+GA+ASSAP
Sbjct  184  IVFGGSYGGMLASWFRLKYPHVAMGAVASSAP  215



>ref|XP_009372536.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=514

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 130/164 (79%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y  +YF Q++DHF+F P  Y+ F Q+YLIN  HW   +   P+FVYTGNEG+IDWFA NT
Sbjct  59   YRTRYFTQILDHFNFYPKSYQTFQQRYLINDTHWGGAKSNAPIFVYTGNEGNIDWFAQNT  118

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GF+ + AP F AL++FIEHRFYG+S+P+G   + +Y +A TLGYL+S QALADYA LI  
Sbjct  119  GFLYETAPHFKALIVFIEHRFYGKSIPYGGNKEVAYGNATTLGYLSSTQALADYASLIID  178

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPVVVFGGSYGGMLAAWFRLKYPHV IGALASSAP
Sbjct  179  LKKNLSATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAP  222



>gb|KFK28424.1| hypothetical protein AALP_AA8G512800 [Arabis alpina]
Length=513

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 131/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKG---GPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  +    F Q+YLIN DHW      GP+F+Y GNEGDIDWFA N+
Sbjct  56   YETKYFTQQLDHFSF--ADLPKFSQRYLINSDHWLGASALGPIFLYCGNEGDIDWFATNS  113

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ DIAPKF ALL+F EHR+YGESMP+G  K++YK+A TL YL ++QALAD+A+ +  L
Sbjct  114  GFIWDIAPKFGALLVFPEHRYYGESMPYGSMKEAYKNATTLAYLTTEQALADFAVFVTDL  173

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+EA PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  174  KRNLSAEACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  216



>gb|KDO78810.1| hypothetical protein CISIN_1g0096312mg [Citrus sinensis]
Length=288

 Score =   220 bits (561),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 131/162 (81%), Gaps = 7/162 (4%)
 Frame = +1

Query  226  EVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANTG  396
            E +YF Q +DHFSF  +    F Q+YLIN DHW    + GP+F+Y GNEGDI+WFA N+G
Sbjct  69   ETRYFEQRLDHFSF--ADLPTFSQRYLINTDHWVGPNRLGPIFLYCGNEGDIEWFAVNSG  126

Query  397  FMLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSLK  570
            F+ DIAP+F A+L+F EHR+YGESMP+G    +Y++A TL YL ++QALAD+A+ I +LK
Sbjct  127  FVWDIAPRFGAMLVFPEHRYYGESMPYGSTEVAYQNATTLSYLTAEQALADFAVFITNLK  186

Query  571  KNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            +NLS+EASPVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  187  QNLSAEASPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  228



>ref|XP_007162943.1| hypothetical protein PHAVU_001G193200g [Phaseolus vulgaris]
 gb|ESW34937.1| hypothetical protein PHAVU_001G193200g [Phaseolus vulgaris]
Length=506

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 129/164 (79%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y  ++F Q++DHF+F P    +F Q+YLIN   W   +   P+FVYTGNEG+I+WF  NT
Sbjct  52   YRTKFFTQILDHFNFNPQSNHVFQQRYLINDTFWGGAKNNAPIFVYTGNEGNIEWFTQNT  111

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GFM + AP FHALL+FIEHRFYG+S+PFG   K +Y +A TLGYL+S QALADYA LI  
Sbjct  112  GFMFENAPSFHALLVFIEHRFYGKSIPFGGNRKVAYANASTLGYLSSTQALADYATLIID  171

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPVVVFGGSYGGMLAAWFR+KYPHVAIGALASSAP
Sbjct  172  LKKNLSATDSPVVVFGGSYGGMLAAWFRMKYPHVAIGALASSAP  215



>ref|XP_008350184.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Malus domestica]
Length=514

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 130/164 (79%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y  +YF Q++DHF+F P  Y+ F Q+YLIN  HW   +   P+FVYTGNEG+I+WFA NT
Sbjct  59   YRTRYFTQILDHFNFYPKSYQTFQQRYLINDTHWGGAKSNAPIFVYTGNEGNIEWFAQNT  118

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GF+ + AP F AL++FIEHRFYG+S+P+G   + +Y +A TLGYL+S QALADYA LI  
Sbjct  119  GFLYETAPHFKALIVFIEHRFYGKSIPYGGNKEVAYSNATTLGYLSSTQALADYASLIID  178

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPVVVFGGSYGGMLAAWFRLKYPHV IGALASSAP
Sbjct  179  LKKNLSATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAP  222



>ref|XP_009624783.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana tomentosiformis]
Length=508

 Score =   226 bits (576),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 127/164 (77%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+  YF Q++DHF++ P  Y+ F Q+YL N  HW   +   P+FVYTGNEGDI+WF  NT
Sbjct  52   YKTNYFTQILDHFNYNPDSYQTFQQRYLFNDKHWGGAKNNAPIFVYTGNEGDIEWFTQNT  111

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM +IAP F ALL+FIEHRFYG+S+P+G     +Y +  TLGYL+S QALADYA LI  
Sbjct  112  GFMFEIAPHFKALLVFIEHRFYGKSIPYGGDKVIAYSNTSTLGYLSSTQALADYATLIID  171

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNL++  SPVVVFGGSYGGMLAAWFRLKYPHV IGALASSAP
Sbjct  172  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAP  215



>ref|XP_009801420.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana sylvestris]
Length=508

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 129/164 (79%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q++DHF++ P  Y+ F Q+YL N  +W   +   P+FVYTGNEGDI+WF  NT
Sbjct  52   YETKYFTQILDHFNYNPDSYQTFQQRYLFNDKNWGGAKTNAPIFVYTGNEGDIEWFTQNT  111

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GFM +IAP F ALL+FIEHRFYG+S+P+G   + +Y +  TLGYL+S QALADYA LI  
Sbjct  112  GFMFEIAPHFKALLVFIEHRFYGKSIPYGGDKEIAYSNTSTLGYLSSTQALADYATLIID  171

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNL++  SPVVVFGGSYGGMLAAWFRLKYPHV IGALASSAP
Sbjct  172  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAP  215



>ref|XP_002530520.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF31852.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=508

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 130/164 (79%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+ ++F Q +DHF+F P  Y+ F Q+YLIN  +W   +   P+F+YTGNEG+I+WFA NT
Sbjct  52   YKEKFFTQTLDHFNFNPKSYQTFQQRYLINDTYWAGPKNNAPIFMYTGNEGEIEWFAQNT  111

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GFM D APKF+ALL+F+EHRFYG+S+PFG   + +Y +A TLGYL S Q+LADYA LI  
Sbjct  112  GFMFDNAPKFNALLVFVEHRFYGKSIPFGGNKEVAYSNASTLGYLTSTQSLADYATLITD  171

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LK NLS+  SPVVVFGGSYGGMLAAWFRLKYPHV IGALASSAP
Sbjct  172  LKNNLSATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAP  215



>gb|KEH24168.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=467

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 132/164 (80%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y  ++F Q++DHF++ P  Y+ F Q+YLIN  +W   +K  P+FVYTGNEG+I+WF  NT
Sbjct  65   YRTKFFTQILDHFNYNPQSYQKFQQRYLINDTYWGGAKKKAPIFVYTGNEGNIEWFTQNT  124

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GFM + AP F+ALL+FIEHRFYG+S+PFG   K +Y ++ TLGYL+S QALADYA LI  
Sbjct  125  GFMFEQAPYFNALLVFIEHRFYGKSIPFGGKKKVAYANSSTLGYLSSAQALADYATLIID  184

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPVVVFGGSYGGMLAAWFR+KYPHVAIGALASSAP
Sbjct  185  LKKNLSATESPVVVFGGSYGGMLAAWFRMKYPHVAIGALASSAP  228



>ref|XP_002438752.1| hypothetical protein SORBIDRAFT_10g025540 [Sorghum bicolor]
 gb|EER90119.1| hypothetical protein SORBIDRAFT_10g025540 [Sorghum bicolor]
Length=306

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 125/166 (75%), Gaps = 11/166 (7%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKG--------GPMFVYTGNEGDIDW  378
            +   YFPQ +DHF+F P+   +FYQKYL+N   W++         GP+FV+TG E DI+ 
Sbjct  84   FTEHYFPQELDHFTFRPNASTVFYQKYLVNDTFWRRSSGRKGGSTGPLFVFTGGETDIES  143

Query  379  FAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILI  558
             A N GFM DIAPKF ALL+FIEHRFYGESMPF   S    + LGYL S QALAD+AILI
Sbjct  144  IAINAGFMFDIAPKFGALLVFIEHRFYGESMPFRSNS---TEALGYLTSTQALADFAILI  200

Query  559  RSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
             SLK+NLS+E +PVVVFGGSYGGMLA+WFRLKYPHV IGALASSAP
Sbjct  201  TSLKQNLSAETAPVVVFGGSYGGMLASWFRLKYPHVTIGALASSAP  246



>gb|EPS74090.1| hypothetical protein M569_00662, partial [Genlisea aurea]
Length=490

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 130/164 (79%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y  ++  Q++DHF++ P  Y+ F Q+YL+N  HW     G P+FVYTGNEGDI+WFA NT
Sbjct  39   YTEKFCTQILDHFNYNPQSYRTFQQRYLVNDTHWGGAAAGSPIFVYTGNEGDIEWFAKNT  98

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM +IAP F AL++FIEHRFYG+S+P+G     +Y ++ TLGYL + QALADYA +I S
Sbjct  99   GFMYEIAPIFKALIVFIEHRFYGKSIPYGGNRTVAYSNSSTLGYLTATQALADYATVILS  158

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNL+SE SPV+VFGGSYGGMLAAWFRLKYPHVA GAL+SSAP
Sbjct  159  LKKNLTSENSPVIVFGGSYGGMLAAWFRLKYPHVAAGALSSSAP  202



>ref|XP_007047633.1| Serine carboxypeptidase S28 family protein isoform 2, partial 
[Theobroma cacao]
 gb|EOX91790.1| Serine carboxypeptidase S28 family protein isoform 2, partial 
[Theobroma cacao]
Length=382

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 131/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  S    F Q+YLIN +HW    + GP+F+Y GNEGDI+WFA NT
Sbjct  63   YETRYFSQRLDHFSF--SDLPNFRQRYLINTEHWVGASRLGPIFLYCGNEGDIEWFAVNT  120

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ DIAP F A++LF EHR+YGESMP+G  +++YK+A TL YL ++QALAD+A+LI  L
Sbjct  121  GFVWDIAPHFGAMVLFPEHRYYGESMPYGSKEEAYKNATTLSYLTTEQALADFAVLITDL  180

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+E  PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  181  KRNLSAEGCPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  223



>ref|XP_009383556.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Musa acuminata 
subsp. malaccensis]
Length=496

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 127/161 (79%), Gaps = 3/161 (2%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQ-KGGPMFVYTGNEGDIDWFAANTGF  399
            YE +YF Q +DHF+F P  Y  F Q+YL+N  +W  KG P+FVYTGNEG I+ FA NTGF
Sbjct  46   YETRYFTQTLDHFNFNPQSYAKFQQRYLVNHTYWGGKGSPIFVYTGNEGGIELFAKNTGF  105

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSLKK  573
            M DIAP F ALL+FIEHR+YGES+PFG +  +Y +A TLGYL   QA+AD+A LI  LKK
Sbjct  106  MFDIAPSFKALLVFIEHRYYGESIPFGGEDVAYSNASTLGYLCVTQAIADFATLIIDLKK  165

Query  574  NLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            NL+SE SPVV FGGSYGGMLAAWFRLKYPHV +GALASSAP
Sbjct  166  NLTSEDSPVVAFGGSYGGMLAAWFRLKYPHVVLGALASSAP  206



>gb|KEH24167.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 132/164 (80%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y  ++F Q++DHF++ P  Y+ F Q+YLIN  +W   +K  P+FVYTGNEG+I+WF  NT
Sbjct  47   YRTKFFTQILDHFNYNPQSYQKFQQRYLINDTYWGGAKKKAPIFVYTGNEGNIEWFTQNT  106

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GFM + AP F+ALL+FIEHRFYG+S+PFG   K +Y ++ TLGYL+S QALADYA LI  
Sbjct  107  GFMFEQAPYFNALLVFIEHRFYGKSIPFGGKKKVAYANSSTLGYLSSAQALADYATLIID  166

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPVVVFGGSYGGMLAAWFR+KYPHVAIGALASSAP
Sbjct  167  LKKNLSATESPVVVFGGSYGGMLAAWFRMKYPHVAIGALASSAP  210



>ref|XP_007203816.1| hypothetical protein PRUPE_ppa005504m2g, partial [Prunus persica]
 gb|EMJ05015.1| hypothetical protein PRUPE_ppa005504m2g, partial [Prunus persica]
Length=318

 Score =   219 bits (557),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 128/164 (78%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y  +YF Q++DHF+F P  Y+ F Q+YLI+   W   +   P+FVYTGNEG+I+WFA N 
Sbjct  56   YRTKYFTQILDHFNFYPKSYQTFQQRYLISDTFWGGAKNNAPIFVYTGNEGNIEWFAQNV  115

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GF+ + AP F AL++FIEHRFYG+S+P+G +   +Y +A TLG+L+S QALADYA LI  
Sbjct  116  GFLYETAPHFKALVVFIEHRFYGKSIPYGGKKSVAYSNATTLGHLSSTQALADYASLITD  175

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPVVVFGGSYGGMLAAWFRLKYPHV IGALASSAP
Sbjct  176  LKKNLSATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAP  219



>gb|KEH24169.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score =   223 bits (569),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 132/164 (80%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y  ++F Q++DHF++ P  Y+ F Q+YLIN  +W   +K  P+FVY GNEGDI WFA NT
Sbjct  52   YRTKFFTQILDHFNYNPQSYQTFQQRYLINDTYWGGAKKKAPIFVYMGNEGDIQWFAQNT  111

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GFM +IAP F+A+L+FIEHR+YG+S+PFG   + + K++ TLGY++S QALADYA LI  
Sbjct  112  GFMFEIAPYFNAILVFIEHRYYGKSIPFGGNDEVANKTSSTLGYMSSTQALADYATLIID  171

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPVVVFGGSYGGMLAAWFR+KYPHVAIGALASSAP
Sbjct  172  LKKNLSATDSPVVVFGGSYGGMLAAWFRMKYPHVAIGALASSAP  215



>ref|XP_010683638.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Beta vulgaris 
subsp. vulgaris]
Length=509

 Score =   223 bits (569),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 132/164 (80%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+ +Y+ Q++DHF++ P GY+ F Q+YLIN  +W   +   P+FVY GNEGDI+WFA NT
Sbjct  52   YKTKYYTQILDHFNYNPQGYQTFQQRYLINDTYWGGAKNNSPIFVYMGNEGDIEWFAQNT  111

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GFM + AP F ALL+F+EHRFYG+S+P+G   + +YK+A T GYL+S QALADYA +I  
Sbjct  112  GFMFENAPHFKALLVFVEHRFYGKSIPYGGDKEVAYKNATTQGYLSSTQALADYATIILD  171

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNL++  SPVVVFGGSYGGMLAAWFRLKYPHVAIGALASS+P
Sbjct  172  LKKNLTATESPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSSP  215



>ref|XP_010518734.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Tarenaya hassleriana]
Length=515

 Score =   223 bits (569),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 132/163 (81%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  +    F Q+YLIN DHW    + GP+F+Y GNEGDI+WFA N+
Sbjct  63   YETRYFSQRLDHFSF--ADLPTFSQRYLINFDHWLGPARLGPIFLYCGNEGDIEWFATNS  120

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GFM +IAPKF ALL+F EHR+YGESMPFG  +++YK+A TL YL ++QALAD+A+ I  L
Sbjct  121  GFMWEIAPKFGALLVFPEHRYYGESMPFGGREEAYKNASTLSYLTTEQALADFAVFITDL  180

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+E+ PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  181  KRNLSAESCPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  223



>gb|KJB18075.1| hypothetical protein B456_003G033300 [Gossypium raimondii]
Length=508

 Score =   223 bits (569),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 132/163 (81%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF+      F Q+YLIN +HW    + GP+F+Y GNEGDI+WFA NT
Sbjct  56   YETRYFSQPLDHFSFL--DLPRFRQRYLINTEHWVGPSRSGPIFLYCGNEGDIEWFAVNT  113

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ DIAP+F A++LF EHR+YG+SMPFG  +++Y++A TL YL ++QALAD+A+LI  L
Sbjct  114  GFVWDIAPRFGAMILFPEHRYYGDSMPFGSKEEAYRNATTLSYLTAEQALADFAVLITDL  173

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            KKNLS+E  PVV+FGGSYGGMLAAW RLKYPHVA+GALASSAP
Sbjct  174  KKNLSAEGCPVVLFGGSYGGMLAAWMRLKYPHVAVGALASSAP  216



>gb|KJB18076.1| hypothetical protein B456_003G033300, partial [Gossypium raimondii]
Length=539

 Score =   224 bits (571),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 132/163 (81%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF+      F Q+YLIN +HW    + GP+F+Y GNEGDI+WFA NT
Sbjct  99   YETRYFSQPLDHFSFL--DLPRFRQRYLINTEHWVGPSRSGPIFLYCGNEGDIEWFAVNT  156

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ DIAP+F A++LF EHR+YG+SMPFG  +++Y++A TL YL ++QALAD+A+LI  L
Sbjct  157  GFVWDIAPRFGAMILFPEHRYYGDSMPFGSKEEAYRNATTLSYLTAEQALADFAVLITDL  216

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            KKNLS+E  PVV+FGGSYGGMLAAW RLKYPHVA+GALASSAP
Sbjct  217  KKNLSAEGCPVVLFGGSYGGMLAAWMRLKYPHVAVGALASSAP  259



>ref|XP_010680789.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010680790.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Beta vulgaris 
subsp. vulgaris]
Length=498

 Score =   223 bits (568),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 131/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE QYF Q +DHFSF    Y  F Q+YLIN D W   Q+ GP+F+Y GNEGDI+WFA+N+
Sbjct  42   YETQYFTQKLDHFSF--HEYGNFSQRYLINTDDWVGAQRRGPIFMYCGNEGDIEWFASNS  99

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ DIAP F ALLLF EHR+YGESMP+G  +++YK + TL YL ++QA+ADYA+L+R L
Sbjct  100  GFLWDIAPHFGALLLFPEHRYYGESMPYGSKEEAYKDSTTLSYLTAEQAIADYAVLLREL  159

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS++  PVV+FGGSYGGMLAAW RLKYPH+ +GALASSAP
Sbjct  160  KRNLSAQDCPVVLFGGSYGGMLAAWMRLKYPHLTVGALASSAP  202



>gb|KDO78808.1| hypothetical protein CISIN_1g0096312mg [Citrus sinensis]
 gb|KDO78809.1| hypothetical protein CISIN_1g0096312mg [Citrus sinensis]
Length=380

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 131/162 (81%), Gaps = 7/162 (4%)
 Frame = +1

Query  226  EVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANTG  396
            E +YF Q +DHFSF  +    F Q+YLIN DHW    + GP+F+Y GNEGDI+WFA N+G
Sbjct  69   ETRYFEQRLDHFSF--ADLPTFSQRYLINTDHWVGPNRLGPIFLYCGNEGDIEWFAVNSG  126

Query  397  FMLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSLK  570
            F+ DIAP+F A+L+F EHR+YGESMP+G    +Y++A TL YL ++QALAD+A+ I +LK
Sbjct  127  FVWDIAPRFGAMLVFPEHRYYGESMPYGSTEVAYQNATTLSYLTAEQALADFAVFITNLK  186

Query  571  KNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            +NLS+EASPVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  187  QNLSAEASPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  228



>gb|EPS59259.1| hypothetical protein M569_15548, partial [Genlisea aurea]
Length=465

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 136/163 (83%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q++DHFSF  SG + F Q+YLI+ +HW    + GP+F+Y GNEGDI+WFA NT
Sbjct  23   YETRYFDQILDHFSF--SGPERFRQRYLISTEHWTGPDRQGPIFLYCGNEGDIEWFAENT  80

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAP+F A+++F EHR+YG+SMP+G  +++YK+A TL +L S+QALAD+AILI  L
Sbjct  81   GFVWEIAPRFGAMVVFTEHRYYGKSMPYGGEEEAYKNATTLAHLTSEQALADFAILITDL  140

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            KKNLS+++ PVV+FGGSYGGMLAAW RLKYPHVAIGALASSAP
Sbjct  141  KKNLSAQSCPVVLFGGSYGGMLAAWMRLKYPHVAIGALASSAP  183



>ref|XP_010024706.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=515

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 130/164 (79%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+ +YF Q++DHFS+ P  Y+ F Q+YLIN   W   ++  P+FVYTGNEGDI+WFA NT
Sbjct  62   YKTRYFTQILDHFSYRPESYQTFQQRYLINSTFWGGPRRNAPIFVYTGNEGDIEWFAQNT  121

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM + AP F+ALL+FIEHR+YG+SMPFG +   +Y +A  LGYL+S QALADYA LI  
Sbjct  122  GFMFETAPHFNALLVFIEHRYYGKSMPFGGKKEVAYSNASMLGYLSSTQALADYATLITD  181

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNL++E SPVVVFGGSYG +  +WFRLKYPH+AIGAL+SSAP
Sbjct  182  LKKNLTAEHSPVVVFGGSYGEVCCSWFRLKYPHIAIGALSSSAP  225



>emb|CDY45627.1| BnaCnng13350D [Brassica napus]
Length=506

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 131/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKG---GPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  +    F Q+YLIN DHW      GP+F+Y GNEGDI+WFA N+
Sbjct  49   YETKYFSQQLDHFSF--ADLPKFSQRYLINSDHWTGASELGPIFLYCGNEGDIEWFATNS  106

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAPKF ALL+F EHR+YGESMP+G   ++YK+A TL YL ++QALAD+A+ +  L
Sbjct  107  GFIWEIAPKFGALLVFPEHRYYGESMPYGSRDEAYKNATTLSYLTTEQALADFAVFVTDL  166

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+EASPVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  167  KRNLSAEASPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  209



>ref|XP_006577089.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Glycine 
max]
Length=411

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 125/164 (76%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y  ++F Q++DHF+F P     F Q+YLIN   W   +   P+FVYTGNEG+I+WF  NT
Sbjct  53   YRTKFFTQILDHFNFNPQSNHTFQQRYLINDTFWGGAKNNAPIFVYTGNEGNIEWFTQNT  112

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM + AP F ALL+FIEHRFYG+S+PFG     +Y +  TLGYL+S QALADYA LI  
Sbjct  113  GFMFENAPSFQALLVFIEHRFYGKSIPFGGNKTVAYANTSTLGYLSSTQALADYATLIID  172

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPVVVFGGSYGGMLAAWFR+KYPHVAIGALASSAP
Sbjct  173  LKKNLSATDSPVVVFGGSYGGMLAAWFRMKYPHVAIGALASSAP  216



>ref|XP_007205160.1| hypothetical protein PRUPE_ppa005445mg [Prunus persica]
 gb|EMJ06359.1| hypothetical protein PRUPE_ppa005445mg [Prunus persica]
Length=351

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 130/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  S    F Q+YLIN +HW   Q+ GP+F Y GNEGDI+WFA NT
Sbjct  70   YETRYFAQRLDHFSF--SDSPRFQQRYLINTEHWVGPQRLGPIFFYCGNEGDIEWFAENT  127

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ ++AP+F A++LF EHR+YGESMP+G   ++YK+A TL +L ++QALAD+A+LI  L
Sbjct  128  GFVWEVAPQFGAMILFPEHRYYGESMPYGSKDEAYKNASTLSFLTAEQALADFAVLIAEL  187

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NL +E  PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  188  KRNLRAEGCPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  230



>ref|XP_007047632.1| Serine carboxypeptidase S28 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91789.1| Serine carboxypeptidase S28 family protein isoform 1 [Theobroma 
cacao]
Length=510

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 131/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  S    F Q+YLIN +HW    + GP+F+Y GNEGDI+WFA NT
Sbjct  58   YETRYFSQRLDHFSF--SDLPNFRQRYLINTEHWVGASRLGPIFLYCGNEGDIEWFAVNT  115

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ DIAP F A++LF EHR+YGESMP+G  +++YK+A TL YL ++QALAD+A+LI  L
Sbjct  116  GFVWDIAPHFGAMVLFPEHRYYGESMPYGSKEEAYKNATTLSYLTTEQALADFAVLITDL  175

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+E  PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  176  KRNLSAEGCPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  218



>gb|EYU41362.1| hypothetical protein MIMGU_mgv1a0060842mg, partial [Erythranthe 
guttata]
Length=294

 Score =   215 bits (548),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 132/163 (81%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE++YF Q +DHFSF  S    F Q+YLIN ++W    K GP+F Y GNEGDI+WFAAN+
Sbjct  59   YEIRYFEQNLDHFSF--SNLPKFRQRYLINTENWSGPDKLGPIFFYCGNEGDIEWFAANS  116

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAP F A+++F EHR+YGESMP+G   ++YK+A TL +L ++QALAD+A+LI  L
Sbjct  117  GFVWEIAPPFGAMVVFPEHRYYGESMPYGSWNEAYKNATTLAHLTTEQALADFAVLITEL  176

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS++A PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  177  KRNLSAQACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  219



>gb|KDO78806.1| hypothetical protein CISIN_1g0096312mg [Citrus sinensis]
 gb|KDO78807.1| hypothetical protein CISIN_1g0096312mg [Citrus sinensis]
Length=436

 Score =   219 bits (559),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 131/162 (81%), Gaps = 7/162 (4%)
 Frame = +1

Query  226  EVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANTG  396
            E +YF Q +DHFSF  +    F Q+YLIN DHW    + GP+F+Y GNEGDI+WFA N+G
Sbjct  69   ETRYFEQRLDHFSF--ADLPTFSQRYLINTDHWVGPNRLGPIFLYCGNEGDIEWFAVNSG  126

Query  397  FMLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSLK  570
            F+ DIAP+F A+L+F EHR+YGESMP+G    +Y++A TL YL ++QALAD+A+ I +LK
Sbjct  127  FVWDIAPRFGAMLVFPEHRYYGESMPYGSTEVAYQNATTLSYLTAEQALADFAVFITNLK  186

Query  571  KNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            +NLS+EASPVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  187  QNLSAEASPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  228



>ref|XP_006380821.1| hypothetical protein POPTR_0007s14600g [Populus trichocarpa]
 gb|ERP58618.1| hypothetical protein POPTR_0007s14600g [Populus trichocarpa]
Length=463

 Score =   220 bits (560),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 133/163 (82%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF+      F Q+YLIN DHW   ++ GP+F+Y GNEGDI+WFA NT
Sbjct  63   YESKYFYQQLDHFSFL--NLPKFPQRYLINTDHWAGPERRGPIFLYCGNEGDIEWFAVNT  120

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAP F A++LF EHR+YGESMP+G  +++YK+A TL YL ++QALAD+A+LI  L
Sbjct  121  GFVWEIAPLFGAMVLFPEHRYYGESMPYGSREEAYKNASTLSYLTAEQALADFAVLITDL  180

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS++A PVV+FGGSYGGMLAAW RLKYPHVAIGALASSAP
Sbjct  181  KRNLSAQACPVVLFGGSYGGMLAAWMRLKYPHVAIGALASSAP  223



>ref|XP_007205161.1| hypothetical protein PRUPE_ppa005445mg [Prunus persica]
 gb|EMJ06360.1| hypothetical protein PRUPE_ppa005445mg [Prunus persica]
Length=382

 Score =   218 bits (554),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 130/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  S    F Q+YLIN +HW   Q+ GP+F Y GNEGDI+WFA NT
Sbjct  70   YETRYFAQRLDHFSF--SDSPRFQQRYLINTEHWVGPQRLGPIFFYCGNEGDIEWFAENT  127

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ ++AP+F A++LF EHR+YGESMP+G   ++YK+A TL +L ++QALAD+A+LI  L
Sbjct  128  GFVWEVAPQFGAMILFPEHRYYGESMPYGSKDEAYKNASTLSFLTAEQALADFAVLIAEL  187

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NL +E  PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  188  KRNLRAEGCPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  230



>ref|XP_010245642.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X3 [Nelumbo 
nucifera]
Length=431

 Score =   219 bits (557),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 130/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF QV+DHFSF  S    F Q+YLIN DHW       P+F+Y GNEGDI+WFA NT
Sbjct  64   YETRYFTQVLDHFSF--SNLPTFQQRYLINTDHWLGPNSMAPIFLYCGNEGDIEWFAVNT  121

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAP F+A+++F EHR+YG+SMPFG +  +YK+A +L YL ++QALAD+A LI  L
Sbjct  122  GFVWEIAPLFNAMVVFPEHRYYGKSMPFGSRDSAYKNAASLSYLTAEQALADFAALITDL  181

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+N+S+EA PVV+FGGSYGGMLAAW R+KYPH+AIGALASSAP
Sbjct  182  KRNMSAEACPVVLFGGSYGGMLAAWMRIKYPHIAIGALASSAP  224



>gb|KDO78803.1| hypothetical protein CISIN_1g0096312mg, partial [Citrus sinensis]
 gb|KDO78804.1| hypothetical protein CISIN_1g0096312mg, partial [Citrus sinensis]
 gb|KDO78805.1| hypothetical protein CISIN_1g0096312mg, partial [Citrus sinensis]
Length=474

 Score =   220 bits (560),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 131/162 (81%), Gaps = 7/162 (4%)
 Frame = +1

Query  226  EVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANTG  396
            E +YF Q +DHFSF  +    F Q+YLIN DHW    + GP+F+Y GNEGDI+WFA N+G
Sbjct  69   ETRYFEQRLDHFSF--ADLPTFSQRYLINTDHWVGPNRLGPIFLYCGNEGDIEWFAVNSG  126

Query  397  FMLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSLK  570
            F+ DIAP+F A+L+F EHR+YGESMP+G    +Y++A TL YL ++QALAD+A+ I +LK
Sbjct  127  FVWDIAPRFGAMLVFPEHRYYGESMPYGSTEVAYQNATTLSYLTAEQALADFAVFITNLK  186

Query  571  KNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            +NLS+EASPVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  187  QNLSAEASPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  228



>ref|XP_011031335.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Populus euphratica]
Length=515

 Score =   221 bits (562),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 133/163 (82%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF+      F Q+YLIN DHW   ++ GP+F+Y GNEGDI+WFA NT
Sbjct  63   YESKYFYQQLDHFSFL--NLPKFPQRYLINTDHWAGPERRGPIFLYCGNEGDIEWFAVNT  120

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAP F A++LF EHR+YGESMP+G  +++YK+A TL YL ++QALAD+A+LI  L
Sbjct  121  GFVWEIAPLFGAMVLFPEHRYYGESMPYGSREEAYKNASTLSYLTAEQALADFAVLITDL  180

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS++A PVV+FGGSYGGMLAAW RLKYPHVAIGALASSAP
Sbjct  181  KRNLSAQACPVVLFGGSYGGMLAAWMRLKYPHVAIGALASSAP  223



>gb|EYU18082.1| hypothetical protein MIMGU_mgv1a005183mg [Erythranthe guttata]
Length=494

 Score =   220 bits (561),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 130/164 (79%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+ ++F Q++DHF++ P  Y  F Q+YLIN ++W       P+FVYTGNEG IDWFA NT
Sbjct  38   YKEKFFTQILDHFNYNPQSYHTFQQRYLINDEYWGGPTTNSPIFVYTGNEGRIDWFAQNT  97

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GFM + AP+F+ALL+FIEHR+YG+S+PFG   + +Y ++ TLGYL+S QALADYA +I  
Sbjct  98   GFMFETAPRFNALLVFIEHRYYGKSVPFGGNKETAYANSSTLGYLSSAQALADYAAVILD  157

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LK NL++  SPVVVFGGSYGGMLAAW RLKYPHVAIGALASSAP
Sbjct  158  LKNNLTAADSPVVVFGGSYGGMLAAWLRLKYPHVAIGALASSAP  201



>gb|AAL77662.1| AT5g65760/MPA24_11 [Arabidopsis thaliana]
Length=491

 Score =   220 bits (560),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 131/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKG---GPMFVYTGNEGDIDWFAANT  393
            YE ++F Q +DHFSF  +    F Q+YLIN DHW      GP+F+Y GNEGDI+WFA N+
Sbjct  58   YETKFFSQQLDHFSF--ADLPKFSQRYLINSDHWLGASALGPIFLYCGNEGDIEWFATNS  115

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ DIAPKF ALL+F EHR+YGESMP+G  +++YK+A TL YL ++QALAD+A+ +  L
Sbjct  116  GFIWDIAPKFGALLVFPEHRYYGESMPYGSREEAYKNATTLSYLTTEQALADFAVFVTDL  175

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+EA PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  176  KRNLSAEACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  218



>ref|NP_201377.2| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
 gb|ABF57288.1| At5g65760 [Arabidopsis thaliana]
 dbj|BAF00060.1| lysosomal Pro-X carboxypeptidase [Arabidopsis thaliana]
 gb|AED98102.1| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
Length=515

 Score =   221 bits (562),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 131/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKG---GPMFVYTGNEGDIDWFAANT  393
            YE ++F Q +DHFSF  +    F Q+YLIN DHW      GP+F+Y GNEGDI+WFA N+
Sbjct  58   YETKFFSQQLDHFSF--ADLPKFSQRYLINSDHWLGASALGPIFLYCGNEGDIEWFATNS  115

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ DIAPKF ALL+F EHR+YGESMP+G  +++YK+A TL YL ++QALAD+A+ +  L
Sbjct  116  GFIWDIAPKFGALLVFPEHRYYGESMPYGSREEAYKNATTLSYLTTEQALADFAVFVTDL  175

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+EA PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  176  KRNLSAEACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  218



>gb|ABR17702.1| unknown [Picea sitchensis]
Length=509

 Score =   221 bits (562),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 126/163 (77%), Gaps = 5/163 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF       F Q+YLIN  +W   ++ GP+F Y GNEG IDWFA NT
Sbjct  54   YETKYFTQRLDHFSFKNHKNSTFQQRYLINDKYWLGAERMGPIFYYCGNEGYIDWFAVNT  113

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQS--YKSAKTLGYLNSQQALADYAILIRSL  567
            GFM DIAP+F ALL+F EHR+YGESMP+G QS  YK   +L YL ++QALAD+A LI  L
Sbjct  114  GFMWDIAPQFGALLVFPEHRYYGESMPYGSQSMAYKDGDSLSYLTAEQALADFATLIVDL  173

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            KKNLS+EA PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  174  KKNLSAEACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  216



>ref|XP_004494225.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cicer arietinum]
Length=511

 Score =   220 bits (561),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 130/164 (79%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y  +++ Q++DHF++ P  Y+ F Q+YLIN  +W   +K  P+FVYTGNEG+I+WF  NT
Sbjct  54   YRTKFYTQILDHFNYNPQSYQTFQQRYLINDTYWGGAKKKAPIFVYTGNEGNIEWFTQNT  113

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GFM + AP F+ALL+FIEHRFYG+SMPFG   K +Y ++ TLGYL+S QALADYA LI  
Sbjct  114  GFMFEKAPYFNALLVFIEHRFYGKSMPFGGNKKVAYANSSTLGYLSSTQALADYATLIID  173

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LK NLS+  SPVVVFGGSYGGMLAAWFR+KY HVAIGALASSAP
Sbjct  174  LKNNLSATDSPVVVFGGSYGGMLAAWFRMKYSHVAIGALASSAP  217



>ref|XP_010245641.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Nelumbo 
nucifera]
Length=435

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 130/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF QV+DHFSF  S    F Q+YLIN DHW       P+F+Y GNEGDI+WFA NT
Sbjct  64   YETRYFTQVLDHFSF--SNLPTFQQRYLINTDHWLGPNSMAPIFLYCGNEGDIEWFAVNT  121

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAP F+A+++F EHR+YG+SMPFG +  +YK+A +L YL ++QALAD+A LI  L
Sbjct  122  GFVWEIAPLFNAMVVFPEHRYYGKSMPFGSRDSAYKNAASLSYLTAEQALADFAALITDL  181

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+N+S+EA PVV+FGGSYGGMLAAW R+KYPH+AIGALASSAP
Sbjct  182  KRNMSAEACPVVLFGGSYGGMLAAWMRIKYPHIAIGALASSAP  224



>ref|XP_002310325.2| hypothetical protein POPTR_0007s14600g [Populus trichocarpa]
 gb|EEE90775.2| hypothetical protein POPTR_0007s14600g [Populus trichocarpa]
Length=515

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 133/163 (82%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF+      F Q+YLIN DHW   ++ GP+F+Y GNEGDI+WFA NT
Sbjct  63   YESKYFYQQLDHFSFL--NLPKFPQRYLINTDHWAGPERRGPIFLYCGNEGDIEWFAVNT  120

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAP F A++LF EHR+YGESMP+G  +++YK+A TL YL ++QALAD+A+LI  L
Sbjct  121  GFVWEIAPLFGAMVLFPEHRYYGESMPYGSREEAYKNASTLSYLTAEQALADFAVLITDL  180

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS++A PVV+FGGSYGGMLAAW RLKYPHVAIGALASSAP
Sbjct  181  KRNLSAQACPVVLFGGSYGGMLAAWMRLKYPHVAIGALASSAP  223



>ref|XP_006466409.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=520

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 132/162 (81%), Gaps = 7/162 (4%)
 Frame = +1

Query  226  EVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANTG  396
            E +YF Q +DHFSF  +    F Q+YLIN DHW    + GP+F+Y GNEGDI+WFA N+G
Sbjct  69   ETRYFEQRLDHFSF--ADLPTFSQRYLINTDHWVGPNRLGPIFLYCGNEGDIEWFAVNSG  126

Query  397  FMLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSLK  570
            F+ DIAP+F A+L+F EHR+YGESMP+G +  +Y++A TL YL ++QALAD+A+ I +LK
Sbjct  127  FVWDIAPRFGAMLVFPEHRYYGESMPYGSREVAYQNATTLSYLTAEQALADFAVFITNLK  186

Query  571  KNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            +NLS+EASPVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  187  QNLSAEASPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  228



>ref|XP_009773191.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana sylvestris]
Length=511

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 135/165 (82%), Gaps = 11/165 (7%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSF--IPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAA  387
            YE +YF Q +DHFSF  +PS    F Q+YLIN  HW    + GP+F+Y GNEGDI+WFAA
Sbjct  59   YETKYFQQKLDHFSFADLPS----FQQRYLINTQHWVGPSRLGPIFLYCGNEGDIEWFAA  114

Query  388  NTGFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIR  561
            NTGF+ +IAP+F AL++F EHR+YGESMP+G  +++YK+A TL YL ++QALAD+A+LI 
Sbjct  115  NTGFVWEIAPRFGALVIFPEHRYYGESMPYGSKEEAYKNATTLSYLTAEQALADFAVLIT  174

Query  562  SLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
             LK+NLS++A PVV+FGGSYGGMLAAW RLKYPH++IGALASSAP
Sbjct  175  ELKRNLSAQACPVVLFGGSYGGMLAAWMRLKYPHISIGALASSAP  219



>ref|XP_010099406.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB78251.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=514

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 133/163 (82%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  S +  F Q+YLI+ +HW    + GP+FVY GNEGDIDWFAANT
Sbjct  63   YETRYFSQRLDHFSF--SEHPRFSQRYLISTEHWVGPNRLGPIFVYCGNEGDIDWFAANT  120

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAP+F A++LF EHR+YGES+PFG  +++Y++A TL YL ++QALAD+A+LI  L
Sbjct  121  GFVWEIAPQFGAMVLFPEHRYYGESIPFGSREEAYRNASTLSYLTAEQALADFAVLITEL  180

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+N S+E  PVV+FGGSYGGMLA+W RLKYPH+AIGALASSAP
Sbjct  181  KRNFSAEDCPVVLFGGSYGGMLASWMRLKYPHIAIGALASSAP  223



>ref|XP_010023342.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 ref|XP_010023343.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW59598.1| hypothetical protein EUGRSUZ_H02343 [Eucalyptus grandis]
Length=532

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 132/163 (81%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQ---KGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF+      F Q+YLI+ +HW    + GP+FVY GNEGDI+WFAANT
Sbjct  69   YETRYFEQRLDHFSFLE--LPTFNQRYLISSEHWSGPSQLGPIFVYCGNEGDIEWFAANT  126

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ ++AP F A+++F EHR+YGESMPFG Q  +YK+A TL YL + QALAD+++LI +L
Sbjct  127  GFVWEMAPSFGAMVVFPEHRYYGESMPFGSQEEAYKNAATLSYLTADQALADFSVLITNL  186

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+EA PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  187  KRNLSAEACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  229



>ref|XP_010463531.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=505

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 129/163 (79%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE ++F Q +DHFSF  +    F Q+YLIN DHW       P+F+Y GNEGDI+WFA N+
Sbjct  48   YETKFFSQQLDHFSF--ADLPKFQQRYLINSDHWLGASSLAPIFLYCGNEGDIEWFATNS  105

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ DIAPKF ALL+F EHR+YGESMP+G   ++YK+A TL YL ++QALAD+A+ +  L
Sbjct  106  GFIWDIAPKFGALLVFPEHRYYGESMPYGSRDEAYKNATTLSYLTTEQALADFAVFVTDL  165

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+EA PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  166  KRNLSAEACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  208



>ref|XP_011466418.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Fragaria 
vesca subsp. vesca]
Length=506

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 132/163 (81%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YFPQ +DHFSF  S    F Q+YL+N ++W   Q+ GP+F+Y GNEGDI WFA NT
Sbjct  56   YETRYFPQNLDHFSF--SDTPKFQQRYLVNSENWVGPQRHGPIFLYCGNEGDIVWFAENT  113

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ ++AP+F A++LF EHR+YGESMPFG  +++YK+A TL +L ++QALAD+A+LI  L
Sbjct  114  GFVWELAPRFGAMVLFPEHRYYGESMPFGSEEEAYKNASTLSFLTAEQALADFAVLITEL  173

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+N S+E  PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  174  KRNWSAEGCPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  216



>ref|XP_007205162.1| hypothetical protein PRUPE_ppa005445mg [Prunus persica]
 gb|EMJ06361.1| hypothetical protein PRUPE_ppa005445mg [Prunus persica]
Length=461

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 130/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  S    F Q+YLIN +HW   Q+ GP+F Y GNEGDI+WFA NT
Sbjct  70   YETRYFAQRLDHFSF--SDSPRFQQRYLINTEHWVGPQRLGPIFFYCGNEGDIEWFAENT  127

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ ++AP+F A++LF EHR+YGESMP+G   ++YK+A TL +L ++QALAD+A+LI  L
Sbjct  128  GFVWEVAPQFGAMILFPEHRYYGESMPYGSKDEAYKNASTLSFLTAEQALADFAVLIAEL  187

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NL +E  PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  188  KRNLRAEGCPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  230



>emb|CDY08753.1| BnaA06g24710D [Brassica napus]
Length=506

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 131/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKG---GPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  +    F Q+YLIN  HW      GP+F+Y GNEGDI+WFA N+
Sbjct  49   YETKYFSQQLDHFSF--ADLPKFSQRYLINSAHWTGASELGPIFLYCGNEGDIEWFATNS  106

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAPKF ALL+F EHR+YGESMP+G  +++YK+A TL YL ++QALAD+A+ +  L
Sbjct  107  GFIWEIAPKFGALLVFPEHRYYGESMPYGSKEEAYKNATTLSYLTTEQALADFAVFVTDL  166

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+EASPVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  167  KRNLSAEASPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  209



>ref|XP_009150668.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=506

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 131/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKG---GPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  +    F Q+YLIN  HW      GP+F+Y GNEGDI+WFA N+
Sbjct  49   YETKYFSQQLDHFSF--ADLPKFSQRYLINSAHWTGASELGPIFLYCGNEGDIEWFATNS  106

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAPKF ALL+F EHR+YGESMP+G  +++YK+A TL YL ++QALAD+A+ +  L
Sbjct  107  GFIWEIAPKFGALLVFPEHRYYGESMPYGSREEAYKNATTLSYLTTEQALADFAVFVTDL  166

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+EASPVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  167  KRNLSAEASPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  209



>ref|XP_010316042.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Solanum 
lycopersicum]
Length=489

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 134/165 (81%), Gaps = 11/165 (7%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSF--IPSGYKIFYQKYLINKDHWQ---KGGPMFVYTGNEGDIDWFAA  387
            YE +YF Q +DHFSF  +PS    F Q+YLIN  HW+   +  P+F+Y GNEGDI+WFA 
Sbjct  36   YETKYFQQKLDHFSFADLPS----FSQRYLINTQHWEGPSRSAPIFLYCGNEGDIEWFAD  91

Query  388  NTGFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIR  561
            NTGF+ +IAP+F A+++F EHR+YGESMP+G  +++YK+A TL YL ++QALADYA+LI 
Sbjct  92   NTGFVWEIAPRFGAMVIFPEHRYYGESMPYGSKEEAYKNATTLSYLTAEQALADYAVLII  151

Query  562  SLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
             LK+NLS++A PVV+FGGSYGGMLAAW RLKYPH++IGALASSAP
Sbjct  152  ELKRNLSAQACPVVLFGGSYGGMLAAWMRLKYPHISIGALASSAP  196



>ref|XP_004288288.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Fragaria 
vesca subsp. vesca]
Length=509

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 132/163 (81%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YFPQ +DHFSF  S    F Q+YL+N ++W   Q+ GP+F+Y GNEGDI WFA NT
Sbjct  56   YETRYFPQNLDHFSF--SDTPKFQQRYLVNSENWVGPQRHGPIFLYCGNEGDIVWFAENT  113

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ ++AP+F A++LF EHR+YGESMPFG  +++YK+A TL +L ++QALAD+A+LI  L
Sbjct  114  GFVWELAPRFGAMVLFPEHRYYGESMPFGSEEEAYKNASTLSFLTAEQALADFAVLITEL  173

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+N S+E  PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  174  KRNWSAEGCPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  216



>ref|XP_006363792.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=521

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 134/165 (81%), Gaps = 11/165 (7%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSF--IPSGYKIFYQKYLINKDHWQ---KGGPMFVYTGNEGDIDWFAA  387
            YE +YF Q +DHFSF  +PS    F Q+YLIN  HW+      P+F+Y GNEGDI+WFAA
Sbjct  68   YETKYFQQKLDHFSFADLPS----FSQRYLINTQHWEGPSHSAPIFLYCGNEGDIEWFAA  123

Query  388  NTGFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIR  561
            NTGF+ +IAP+F A+++F EHR+YGESMP+G  +++YK+A TL YL ++QALADYA+LI 
Sbjct  124  NTGFVWEIAPRFGAMVIFPEHRYYGESMPYGSKEEAYKNATTLSYLTAEQALADYAVLIT  183

Query  562  SLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
             +K+NLS++A PVV+FGGSYGGMLAAW RLKYPH++IGALASSAP
Sbjct  184  EIKRNLSAQACPVVLFGGSYGGMLAAWMRLKYPHISIGALASSAP  228



>ref|XP_006577088.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Glycine 
max]
Length=509

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 125/164 (76%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y  ++F Q++DHF+F P     F Q+YLIN   W   +   P+FVYTGNEG+I+WF  NT
Sbjct  53   YRTKFFTQILDHFNFNPQSNHTFQQRYLINDTFWGGAKNNAPIFVYTGNEGNIEWFTQNT  112

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM + AP F ALL+FIEHRFYG+S+PFG     +Y +  TLGYL+S QALADYA LI  
Sbjct  113  GFMFENAPSFQALLVFIEHRFYGKSIPFGGNKTVAYANTSTLGYLSSTQALADYATLIID  172

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPVVVFGGSYGGMLAAWFR+KYPHVAIGALASSAP
Sbjct  173  LKKNLSATDSPVVVFGGSYGGMLAAWFRMKYPHVAIGALASSAP  216



>gb|KHN33177.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=509

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 125/164 (76%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y  ++F Q++DHF+F P     F Q+YLIN   W   +   P+FVYTGNEG+I+WF  NT
Sbjct  53   YRTKFFTQILDHFNFNPQSNHTFQQRYLINDTFWGGAKNNAPIFVYTGNEGNIEWFTQNT  112

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM + AP F ALL+FIEHRFYG+S+PFG     +Y +  TLGYL+S QALADYA LI  
Sbjct  113  GFMFENAPSFQALLVFIEHRFYGKSIPFGGNKTVAYANTSTLGYLSSTQALADYATLIID  172

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPVVVFGGSYGGMLAAWFR+KYPHVAIGALASSAP
Sbjct  173  LKKNLSATDSPVVVFGGSYGGMLAAWFRMKYPHVAIGALASSAP  216



>ref|XP_010444594.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=509

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 129/163 (79%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE ++F Q +DHFSF  +    F Q+YLIN DHW       P+F+Y GNEGDI+WFA N+
Sbjct  52   YETKFFSQQLDHFSF--ADLPKFQQRYLINSDHWLGASSLAPIFLYCGNEGDIEWFATNS  109

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ DIAPKF ALL+F EHR+YGESMP+G   ++YK+A TL YL ++QALAD+A+ +  L
Sbjct  110  GFIWDIAPKFGALLVFPEHRYYGESMPYGSRDEAYKNATTLSYLTTEQALADFAVFVTDL  169

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+EA PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  170  KRNLSAEACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  212



>gb|KHN02193.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=506

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 125/164 (76%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y  ++F Q++DHF+F P     F Q+YLIN   W   +   P+FVYTGNEG+I+WF  NT
Sbjct  52   YRTKFFTQILDHFNFNPQSNHTFQQRYLINDTFWGGAKNNAPIFVYTGNEGNIEWFTQNT  111

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM + AP F ALL+FIEHRFYG+S+PFG     +Y +  TLGYL+S QALADYA LI  
Sbjct  112  GFMFENAPSFQALLVFIEHRFYGKSIPFGGNKTVAYANTSTLGYLSSTQALADYAALIID  171

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPVVVFGGSYGGMLAAWFR+KYPHVAIGALASSAP
Sbjct  172  LKKNLSATDSPVVVFGGSYGGMLAAWFRMKYPHVAIGALASSAP  215



>ref|XP_004231954.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Solanum 
lycopersicum]
Length=505

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 134/165 (81%), Gaps = 11/165 (7%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSF--IPSGYKIFYQKYLINKDHWQ---KGGPMFVYTGNEGDIDWFAA  387
            YE +YF Q +DHFSF  +PS    F Q+YLIN  HW+   +  P+F+Y GNEGDI+WFA 
Sbjct  52   YETKYFQQKLDHFSFADLPS----FSQRYLINTQHWEGPSRSAPIFLYCGNEGDIEWFAD  107

Query  388  NTGFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIR  561
            NTGF+ +IAP+F A+++F EHR+YGESMP+G  +++YK+A TL YL ++QALADYA+LI 
Sbjct  108  NTGFVWEIAPRFGAMVIFPEHRYYGESMPYGSKEEAYKNATTLSYLTAEQALADYAVLII  167

Query  562  SLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
             LK+NLS++A PVV+FGGSYGGMLAAW RLKYPH++IGALASSAP
Sbjct  168  ELKRNLSAQACPVVLFGGSYGGMLAAWMRLKYPHISIGALASSAP  212



>ref|XP_006393989.1| hypothetical protein EUTSA_v10003988mg [Eutrema salsugineum]
 gb|ESQ31275.1| hypothetical protein EUTSA_v10003988mg [Eutrema salsugineum]
Length=526

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 131/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKG---GPMFVYTGNEGDIDWFAANT  393
            YE ++F Q +DHFSF  +    F Q+YLIN DHW      GP+F+Y GNEGDI+WFA N+
Sbjct  69   YETKFFSQQLDHFSF--ADLPKFSQRYLINSDHWLGASALGPIFLYCGNEGDIEWFATNS  126

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAPKF ALL+F EHR+YGESMP+G  +++YK+A TL YL ++QALAD+A+ +  L
Sbjct  127  GFLWEIAPKFGALLVFPEHRYYGESMPYGSREEAYKNATTLSYLTTEQALADFAVFVTDL  186

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+EA PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  187  KRNLSAEACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  229



>ref|XP_011073662.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Sesamum indicum]
Length=518

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 133/163 (82%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  S    F Q+YLIN ++W    K GP+F+Y GNEGDI+WFAANT
Sbjct  66   YETRYFDQNLDHFSF--SDLPTFRQRYLINTEYWGGPTKLGPIFLYCGNEGDIEWFAANT  123

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ ++AP+F A+++F EHR+YGESMP+G  +++YK+A TL +L ++QALAD+A+LI  L
Sbjct  124  GFVWELAPRFRAMIIFPEHRYYGESMPYGSWEEAYKNASTLAHLTAEQALADFAVLITEL  183

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            KKN S++A PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  184  KKNFSAQACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  226



>ref|XP_006604647.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
Length=508

 Score =   219 bits (557),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 125/164 (76%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y  ++F Q++DHF+F P     F Q+YLIN   W   +   P+FVYTGNEG+I+WF  NT
Sbjct  52   YRTKFFTQILDHFNFNPQSNHTFQQRYLINDTFWGGAKNNAPIFVYTGNEGNIEWFTQNT  111

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM + AP F ALL+FIEHRFYG+S+PFG     +Y +  TLGYL+S QALADYA LI  
Sbjct  112  GFMFENAPSFQALLVFIEHRFYGKSIPFGGNKTVAYANTSTLGYLSSTQALADYAALIID  171

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPVVVFGGSYGGMLAAWFR+KYPHVAIGALASSAP
Sbjct  172  LKKNLSATDSPVVVFGGSYGGMLAAWFRMKYPHVAIGALASSAP  215



>ref|XP_010245640.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Nelumbo 
nucifera]
Length=519

 Score =   219 bits (557),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 130/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF QV+DHFSF  S    F Q+YLIN DHW       P+F+Y GNEGDI+WFA NT
Sbjct  64   YETRYFTQVLDHFSF--SNLPTFQQRYLINTDHWLGPNSMAPIFLYCGNEGDIEWFAVNT  121

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAP F+A+++F EHR+YG+SMPFG +  +YK+A +L YL ++QALAD+A LI  L
Sbjct  122  GFVWEIAPLFNAMVVFPEHRYYGKSMPFGSRDSAYKNAASLSYLTAEQALADFAALITDL  181

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+N+S+EA PVV+FGGSYGGMLAAW R+KYPH+AIGALASSAP
Sbjct  182  KRNMSAEACPVVLFGGSYGGMLAAWMRIKYPHIAIGALASSAP  224



>ref|XP_008237071.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Prunus mume]
Length=517

 Score =   219 bits (557),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 130/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  S    F Q+YLIN +HW   Q+ GP+F Y GNEGDI+WFA NT
Sbjct  64   YETRYFAQRLDHFSF--SDSPRFQQRYLINTEHWVGPQRVGPIFFYCGNEGDIEWFAENT  121

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGK--QSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ ++AP+F A++LF EHR+YGESMP+G   ++YK+A TL +L ++QALAD+A+LI  L
Sbjct  122  GFVWEVAPQFGAMILFPEHRYYGESMPYGSKAEAYKNASTLSFLTAEQALADFAVLITEL  181

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NL +E  PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  182  KRNLRAEGCPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  224



>gb|KCW59601.1| hypothetical protein EUGRSUZ_H023452, partial [Eucalyptus grandis]
Length=425

 Score =   216 bits (550),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 131/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  +    F Q+YLI+ +HW    + GP+F+Y GNEGDI+WFAAN+
Sbjct  65   YETRYFEQQLDHFSF--AELPTFRQRYLISSEHWVGPDRLGPIFLYCGNEGDIEWFAANS  122

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAP F A+++F EHR+YGESMP+G Q  +YK+  +L YL ++QALAD+A+LI  L
Sbjct  123  GFVWEIAPSFGAMVVFPEHRYYGESMPYGSQEEAYKNGASLSYLTAEQALADFAVLITDL  182

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+EA PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  183  KRNLSAEACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  225



>ref|XP_008243494.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Prunus mume]
Length=504

 Score =   218 bits (555),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 140/194 (72%), Gaps = 8/194 (4%)
 Frame = +1

Query  133  SKTSYFPGGSYLQASlkkqgkiigkkpklpYEVQYFPQVVDHFSFIPSGYKIFYQKYLIN  312
            SKT+  P G+   +SL    K+        Y  +YF Q++DHF+F P  Y+ F Q+YLIN
Sbjct  21   SKTT--PAGARFPSSLITPEKVSASTQNKLYRTKYFTQILDHFNFYPKSYQTFQQRYLIN  78

Query  313  KDHW---QKGGPMFVYTGNEGDIDWFAANTGFMLDIAPKFHALLLFIEHRFYGESMPFGK  483
               W   +   P+FVYTGNEG+I+WFA N GF+ + AP F +L++FIEHRFYG+S+P+G 
Sbjct  79   DTFWGGAKNNAPIFVYTGNEGNIEWFAQNLGFLYETAPHFKSLVVFIEHRFYGKSIPYGG  138

Query  484  Q---SYKSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLK  654
            +   +Y +A TLG+L+S QALADYA LI  LKKNLS+  SPVVVFGGSYGGMLAAWFRLK
Sbjct  139  KKSVAYSNASTLGHLSSTQALADYASLIIDLKKNLSATDSPVVVFGGSYGGMLAAWFRLK  198

Query  655  YPHVAIGALASSAP  696
            YPHV IGALASS+P
Sbjct  199  YPHVTIGALASSSP  212



>emb|CDP02648.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   218 bits (554),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 132/165 (80%), Gaps = 11/165 (7%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSF--IPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAA  387
            YE +YF Q +DHFSF  +PS    F QKYLIN  HW    + GP+F Y GNEG+I+WFAA
Sbjct  51   YETRYFEQRLDHFSFADLPS----FRQKYLINTQHWLGPSRLGPIFFYCGNEGNIEWFAA  106

Query  388  NTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIR  561
            NTGF+ +IAP+F A+++F EHR+YGESMP+G +  +YK+A TL YL ++QALADYA+ I 
Sbjct  107  NTGFVWEIAPRFGAMIIFPEHRYYGESMPYGSREIAYKNASTLSYLTAEQALADYAVFIT  166

Query  562  SLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
             LK+NLS++A PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  167  ELKRNLSAQACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  211



>gb|KCW59600.1| hypothetical protein EUGRSUZ_H023452, partial [Eucalyptus grandis]
Length=428

 Score =   216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 131/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  +    F Q+YLI+ +HW    + GP+F+Y GNEGDI+WFAAN+
Sbjct  65   YETRYFEQQLDHFSF--AELPTFRQRYLISSEHWVGPDRLGPIFLYCGNEGDIEWFAANS  122

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAP F A+++F EHR+YGESMP+G Q  +YK+  +L YL ++QALAD+A+LI  L
Sbjct  123  GFVWEIAPSFGAMVVFPEHRYYGESMPYGSQEEAYKNGASLSYLTAEQALADFAVLITDL  182

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+EA PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  183  KRNLSAEACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  225



>ref|XP_011467971.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 127/164 (77%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y  +YF Q++DHF++ P  Y  F Q+YLIN   W   +   P+FVYTGNEG I+WFA NT
Sbjct  54   YRTKYFTQILDHFNYYPKSYDTFQQRYLINDTFWGGAKSNAPIFVYTGNEGIIEWFAQNT  113

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GF+ + AP F AL++FIEHRFYG+S+PFG +   +Y +A TLGYL+S QALADYA LI  
Sbjct  114  GFLYETAPHFKALIIFIEHRFYGKSIPFGGKKDVAYSNATTLGYLSSTQALADYASLIID  173

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNL++  SPVVVFGGSYGGMLAAWFRLKYPHV IGALASS+P
Sbjct  174  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSSP  217



>ref|XP_006426159.1| hypothetical protein CICLE_v10025375mg [Citrus clementina]
 gb|ESR39399.1| hypothetical protein CICLE_v10025375mg [Citrus clementina]
Length=517

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 130/160 (81%), Gaps = 7/160 (4%)
 Frame = +1

Query  232  QYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANTGFM  402
            +YF Q +DHFSF  +    F Q+YLIN DHW    + GP+F+Y GNEGDI+WFA N+GF+
Sbjct  68   RYFEQRLDHFSF--ADLPTFSQRYLINTDHWVGPNRLGPIFLYCGNEGDIEWFAVNSGFV  125

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSLKKN  576
             DIAP+F A+L+F EHR+YGESMP+G    +Y++A TL YL ++QALAD+A+ I +LK+N
Sbjct  126  WDIAPRFGAMLVFPEHRYYGESMPYGSTEVAYQNATTLSYLTAEQALADFAVFITNLKQN  185

Query  577  LSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LS+EASPVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  186  LSAEASPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  225



>ref|XP_008661011.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Zea mays]
Length=532

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 122/164 (74%), Gaps = 9/164 (5%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK------GGPMFVYTGNEGDIDWFA  384
            + V YF Q +DHFSF P+   +FYQKYL+N   W++       GP+ VY G E DI+  A
Sbjct  79   FTVHYFQQELDHFSFTPNASTVFYQKYLVNDTFWRRPGGGGTAGPLLVYVGGEADIECIA  138

Query  385  ANTGFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRS  564
             N GFM DIAP F ALL+F+EHRFYGES+PFG     SA+ LGYL S QALAD AILI  
Sbjct  139  HNVGFMFDIAPTFGALLVFVEHRFYGESLPFGN---NSAQALGYLTSTQALADLAILITD  195

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LK+NLS+E SPVV+FGGSYGGMLA+WFRLKYPHV IGALASSAP
Sbjct  196  LKRNLSAETSPVVIFGGSYGGMLASWFRLKYPHVTIGALASSAP  239



>ref|XP_007155791.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
 gb|ESW27785.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
Length=444

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 131/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  S    F Q+YLI+ DHW   Q+ GP+F+Y GNEGDI+WFA NT
Sbjct  54   YETRYFQQRLDHFSF--SELPTFPQRYLISTDHWVGPQRLGPIFLYCGNEGDIEWFAQNT  111

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAP+F A+++F EHR+YGES+PFG  K++YK A TL YL ++QALAD+++LI  L
Sbjct  112  GFVWEIAPQFGAMVVFPEHRYYGESIPFGSAKEAYKDATTLSYLTAEQALADFSVLITDL  171

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+N S++  PVV+FGGSYGGMLAAW RLKYPH+A+GALASSAP
Sbjct  172  KQNFSAKDCPVVLFGGSYGGMLAAWMRLKYPHIAVGALASSAP  214



>ref|XP_006280309.1| hypothetical protein CARUB_v10026232mg [Capsella rubella]
 gb|EOA13207.1| hypothetical protein CARUB_v10026232mg [Capsella rubella]
Length=518

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 129/163 (79%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKG---GPMFVYTGNEGDIDWFAANT  393
            YE ++F Q +DHFSF  +    F Q+YLIN DHW       P+F+Y GNEGDI+WFA N+
Sbjct  61   YETKFFSQQLDHFSF--ADLPKFPQRYLINSDHWLGASALAPIFLYCGNEGDIEWFATNS  118

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAPKF ALL+F EHR+YGESMP+G   ++YK+A TL YL ++QALAD+A+ +  L
Sbjct  119  GFIWEIAPKFGALLVFPEHRYYGESMPYGSRDEAYKNATTLSYLTTEQALADFAVFVTDL  178

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+EA PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  179  KRNLSAEACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  221



>ref|XP_009592890.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana tomentosiformis]
Length=511

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 133/165 (81%), Gaps = 11/165 (7%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSF--IPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAA  387
            YE +YF Q +DHFSF  +PS    F Q+YLIN  HW    +  P+F+Y GNEG I+WFAA
Sbjct  59   YETKYFQQKLDHFSFADLPS----FPQRYLINTQHWMGPSRLAPIFLYCGNEGGIEWFAA  114

Query  388  NTGFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIR  561
            NTGF+ +IAP+F A+++F EHR+YGESMPFG  +++YK+A TL YL ++QALADYA+LI 
Sbjct  115  NTGFVWEIAPRFGAMVIFPEHRYYGESMPFGSKEEAYKNATTLSYLTAEQALADYAVLIT  174

Query  562  SLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
             LK+NLS++A PVV+FGGSYGGMLAAW RLKYPH++IGALASSAP
Sbjct  175  ELKRNLSAQACPVVLFGGSYGGMLAAWMRLKYPHISIGALASSAP  219



>ref|XP_012079471.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Jatropha curcas]
 gb|KDP32128.1| hypothetical protein JCGZ_12589 [Jatropha curcas]
Length=514

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 130/162 (80%), Gaps = 7/162 (4%)
 Frame = +1

Query  226  EVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANTG  396
            E +YF Q +DHFSF  S    F Q+YL+N DHW    + GP+F+Y GNEGDI+WFA NTG
Sbjct  63   ETRYFYQKLDHFSF--SDLPKFPQRYLLNTDHWVGPNRLGPIFLYCGNEGDIEWFAVNTG  120

Query  397  FMLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSLK  570
            F+ DIAP+F A+++F EHR+YGESMP+G +  +YK+A TL +L ++QALAD+A+LI  LK
Sbjct  121  FVWDIAPRFGAMVVFPEHRYYGESMPYGSRDVAYKNATTLSHLTAEQALADFAVLITDLK  180

Query  571  KNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            +NLS+E  PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  181  RNLSAEGCPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  222



>ref|XP_008442879.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis melo]
Length=502

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 129/164 (79%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+  +F Q++DHF+F P  Y+ F Q+YLIN  +W       P+FVYTGNEG+I+WFA NT
Sbjct  49   YQTGFFTQILDHFNFNPQSYQYFQQRYLINDTYWGGAAHNSPIFVYTGNEGNIEWFAQNT  108

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GF+L  AP+F AL++FIEHRFYG+S+PFG     +  ++ TLG+L+S QALADYA LI  
Sbjct  109  GFLLQSAPRFRALVVFIEHRFYGKSIPFGGDEDVANSNSSTLGFLSSTQALADYATLITD  168

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPV+VFGGSYGGMLAAWFRLKYPH+A+GALASSAP
Sbjct  169  LKKNLSAVDSPVLVFGGSYGGMLAAWFRLKYPHIAMGALASSAP  212



>ref|XP_010023346.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=528

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 131/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  +    F Q+YLI+ +HW    + GP+F+Y GNEGDI+WFAAN+
Sbjct  65   YETRYFEQQLDHFSF--AELPTFRQRYLISSEHWVGPDRLGPIFLYCGNEGDIEWFAANS  122

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAP F A+++F EHR+YGESMP+G Q  +YK+  +L YL ++QALAD+A+LI  L
Sbjct  123  GFVWEIAPSFGAMVVFPEHRYYGESMPYGSQEEAYKNGASLSYLTAEQALADFAVLITDL  182

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+EA PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  183  KRNLSAEACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  225



>gb|KCW90503.1| hypothetical protein EUGRSUZ_A02623 [Eucalyptus grandis]
Length=465

 Score =   214 bits (546),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 128/164 (78%), Gaps = 11/164 (7%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+ +YF Q++DHFS+ P  Y+ F Q+YLIN   W   ++  P+FVYTGNEGDI+WFA NT
Sbjct  17   YKTRYFTQILDHFSYRPESYQTFQQRYLINSTFWGGPRRNAPIFVYTGNEGDIEWFAQNT  76

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM + AP F+ALL+FIEHR+YG+SMPFG +   +Y +A  LGYL+S QALADYA LI  
Sbjct  77   GFMFETAPHFNALLVFIEHRYYGKSMPFGGKKEVAYSNASMLGYLSSTQALADYATLITD  136

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNL++E SPVVVFGG     LAAWFRLKYPH+AIGAL+SSAP
Sbjct  137  LKKNLTAEHSPVVVFGG-----LAAWFRLKYPHIAIGALSSSAP  175



>ref|XP_006577716.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
Length=294

 Score =   209 bits (533),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 124/164 (76%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y  ++F Q++ HFS+ P  Y+ F Q+YLIN  +W   +   P+FVY GNEGDI+W A  T
Sbjct  51   YTTKFFTQILGHFSYNPQSYQTFQQRYLINDTYWGGAKNNAPIFVYMGNEGDIEWIAQIT  110

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GFM D AP F ALL+FIEHR+YG+S PFG   + +  ++ TLGYL+S QALADYA LI  
Sbjct  111  GFMFDTAPYFKALLVFIEHRYYGKSFPFGGNEEVANANSSTLGYLSSTQALADYATLIID  170

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPV+V GGSYGGMLAAWFRLKYPHVAIGAL+SSAP
Sbjct  171  LKKNLSATDSPVIVIGGSYGGMLAAWFRLKYPHVAIGALSSSAP  214



>ref|XP_007155790.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
 gb|ESW27784.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
Length=506

 Score =   215 bits (548),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 131/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  S    F Q+YLI+ DHW   Q+ GP+F+Y GNEGDI+WFA NT
Sbjct  54   YETRYFQQRLDHFSF--SELPTFPQRYLISTDHWVGPQRLGPIFLYCGNEGDIEWFAQNT  111

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAP+F A+++F EHR+YGES+PFG  K++YK A TL YL ++QALAD+++LI  L
Sbjct  112  GFVWEIAPQFGAMVVFPEHRYYGESIPFGSAKEAYKDATTLSYLTAEQALADFSVLITDL  171

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+N S++  PVV+FGGSYGGMLAAW RLKYPH+A+GALASSAP
Sbjct  172  KQNFSAKDCPVVLFGGSYGGMLAAWMRLKYPHIAVGALASSAP  214



>ref|XP_010026544.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=515

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 132/163 (81%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  S    F Q+YLI+ +HW   ++ GP+FVY GNEGDI+WFAANT
Sbjct  65   YETRYFEQRLDHFSF--SKLPKFSQRYLISSEHWSGPKRLGPIFVYCGNEGDIEWFAANT  122

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAP F A+++F EHR+YG+SMPFG  +++YK+A TL YL ++QALAD+  LI SL
Sbjct  123  GFVWEIAPSFGAMVVFPEHRYYGKSMPFGSTEKAYKNAATLSYLTTEQALADFTELIMSL  182

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+N+S+ A PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  183  KRNVSAAACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  225



>ref|XP_004136495.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN59164.1| hypothetical protein Csa_3G778210 [Cucumis sativus]
Length=502

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 127/164 (77%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+  +F Q++DHF+F P  Y+ F Q+YLIN  +W       P+FVYTGNEG+I+WFA NT
Sbjct  49   YQTSFFTQILDHFNFNPQSYQSFQQRYLINDTYWGGAAHNSPIFVYTGNEGNIEWFAQNT  108

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GF+L  AP F AL++FIEHRFYG+S+PFG     +  ++  LGYL+S QALADYA LI  
Sbjct  109  GFLLQYAPHFRALVVFIEHRFYGKSIPFGGDEDVANSNSSMLGYLSSTQALADYATLITD  168

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNLS+  SPV+VFGGSYGGMLAAWFRLKYPH+A+GALASSAP
Sbjct  169  LKKNLSAVDSPVLVFGGSYGGMLAAWFRLKYPHIALGALASSAP  212



>gb|KCW59597.1| hypothetical protein EUGRSUZ_H02342 [Eucalyptus grandis]
Length=550

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 132/163 (81%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  S    F Q+YLI+ +HW   ++ GP+FVY GNEGDI+WFAANT
Sbjct  100  YETRYFEQRLDHFSF--SKLPKFSQRYLISSEHWSGPKRLGPIFVYCGNEGDIEWFAANT  157

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAP F A+++F EHR+YG+SMPFG  +++YK+A TL YL ++QALAD+  LI SL
Sbjct  158  GFVWEIAPSFGAMVVFPEHRYYGKSMPFGSTEKAYKNAATLSYLTTEQALADFTELIMSL  217

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+N+S+ A PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  218  KRNVSAAACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  260



>gb|KJB16585.1| hypothetical protein B456_002G237800 [Gossypium raimondii]
Length=537

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 131/190 (69%), Gaps = 32/190 (17%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+ +YF Q++DHF+F P  Y+ F  +YLIN  +W   +K  P+FVYTGNEGDI+WFA NT
Sbjct  56   YKTKYFTQILDHFNFNPKSYQKFQHRYLINDTYWGGPKKNSPIFVYTGNEGDIEWFAQNT  115

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM DIAP F ALL+FIEHRFYG+S+PFG     +Y +A TLGYL S QALADYA LI  
Sbjct  116  GFMFDIAPHFQALLVFIEHRFYGKSIPFGGDKDVAYSNASTLGYLTSTQALADYATLIID  175

Query  565  LKKNLSSEASPVVVFGGSYGG--------------------------MLAAWFRLKYPHV  666
            LKKNL++  +PVVVFGGSYGG                          +LA+WFRLKYPHV
Sbjct  176  LKKNLTAVDAPVVVFGGSYGGSMIKIQFKQTLISFLFFSCLILMFWAVLASWFRLKYPHV  235

Query  667  AIGALASSAP  696
            AIGALASSAP
Sbjct  236  AIGALASSAP  245



>ref|XP_008798889.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Phoenix 
dactylifera]
Length=478

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 133/164 (81%), Gaps = 10/164 (6%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSF--IPSGYKIFYQKYLIN-KDHWQK-GGPMFVYTGNEGDIDWFAAN  390
            YE +YF Q +DHFSF  +PS    F Q+YL+   DHW +  GP+F Y GNEGDI+WFA+N
Sbjct  56   YETRYFRQRLDHFSFAELPS----FQQRYLVGPSDHWARPAGPIFFYCGNEGDIEWFASN  111

Query  391  TGFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRS  564
            TGF+ +IAP F AL++F EHR+YGESMP+G   ++Y++A++L YL ++QALAD+A+L+  
Sbjct  112  TGFVWEIAPLFSALVVFAEHRYYGESMPYGSRDRAYENAESLSYLTTEQALADFAVLLTD  171

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LK+NLS+E SPVV+FGGSYGGMLAAW RLKYPHVAIGALASSAP
Sbjct  172  LKRNLSAEDSPVVLFGGSYGGMLAAWMRLKYPHVAIGALASSAP  215



>gb|AGV54352.1| lysosomal Pro-X carboxypeptidase-like protein [Phaseolus vulgaris]
Length=506

 Score =   213 bits (542),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 130/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  S    F Q+YLI+ DHW   Q+ GP+F+Y GNEGDI+WFA NT
Sbjct  54   YETRYFQQRLDHFSF--SELPTFPQRYLISTDHWVGPQRLGPIFLYCGNEGDIEWFAQNT  111

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAP+F A+++F EHR+YGES+PFG  K++YK A TL YL ++QALAD+++LI  L
Sbjct  112  GFVWEIAPQFGAMVVFPEHRYYGESIPFGSAKEAYKDATTLSYLTAEQALADFSVLITDL  171

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+N S++  PVV+FGGSYGGMLAAW  LKYPH+A+GALASSAP
Sbjct  172  KQNFSAKDCPVVLFGGSYGGMLAAWMXLKYPHIAVGALASSAP  214



>ref|XP_009342192.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=521

 Score =   213 bits (543),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 129/163 (79%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  +    F Q+YLIN +HW   Q+ GP+F Y GNEG I+WFA NT
Sbjct  69   YETRYFAQRLDHFSF--TDTPKFQQRYLINTEHWVGAQRLGPIFFYCGNEGGIEWFAENT  126

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ ++AP+F A++LF EHR+YGESMP+G  +++YK+A TL +L + Q LAD+A+LI  L
Sbjct  127  GFVWELAPRFGAMVLFPEHRYYGESMPYGSEEEAYKNASTLSFLTAGQTLADFAVLITEL  186

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+E  PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  187  KRNLSAEGCPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  229



>gb|KEH31545.1| serine carboxypeptidase S28 family protein [Medicago truncatula]
Length=527

 Score =   213 bits (542),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 132/161 (82%), Gaps = 5/161 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKG-GPMFVYTGNEGDIDWFAANTGF  399
            YE ++F Q ++HFSF  +   +F Q+YLIN ++W  G GP+F+Y GNEGDI WFA NTGF
Sbjct  55   YETKFFQQRLNHFSFFKT--PMFPQRYLINTENWVVGSGPIFLYCGNEGDIVWFAQNTGF  112

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSLKK  573
            + +IAPKF A+++F EHR+YGES+PFG  +++YK+A TLGYLN+QQAL D+A+L+  LK+
Sbjct  113  IWEIAPKFGAMVVFPEHRYYGESVPFGSKEEAYKNASTLGYLNAQQALFDFAVLVTDLKR  172

Query  574  NLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            N S+ A PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  173  NYSANACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  213



>ref|XP_008798888.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Phoenix 
dactylifera]
Length=507

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 133/164 (81%), Gaps = 10/164 (6%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSF--IPSGYKIFYQKYLIN-KDHWQK-GGPMFVYTGNEGDIDWFAAN  390
            YE +YF Q +DHFSF  +PS    F Q+YL+   DHW +  GP+F Y GNEGDI+WFA+N
Sbjct  56   YETRYFRQRLDHFSFAELPS----FQQRYLVGPSDHWARPAGPIFFYCGNEGDIEWFASN  111

Query  391  TGFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRS  564
            TGF+ +IAP F AL++F EHR+YGESMP+G   ++Y++A++L YL ++QALAD+A+L+  
Sbjct  112  TGFVWEIAPLFSALVVFAEHRYYGESMPYGSRDRAYENAESLSYLTTEQALADFAVLLTD  171

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LK+NLS+E SPVV+FGGSYGGMLAAW RLKYPHVAIGALASSAP
Sbjct  172  LKRNLSAEDSPVVLFGGSYGGMLAAWMRLKYPHVAIGALASSAP  215



>ref|XP_006341228.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=493

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 127/164 (77%), Gaps = 8/164 (5%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE  YF Q++DHF++  +  + F Q+YL+N  +W   +   P+FVYTGNEG+I+WF  NT
Sbjct  40   YETNYFTQILDHFNY--NNPQTFQQRYLLNDKYWGGSKNNAPIFVYTGNEGNIEWFTQNT  97

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM +IAP F+ALL+FIEHRFYG+S+P+G     +Y +  TLGYL+S QALADYA LI  
Sbjct  98   GFMFEIAPHFNALLVFIEHRFYGKSIPYGGDKTIAYSNKTTLGYLSSTQALADYATLIID  157

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LK NL++  SPVVVFGGSYGGMLAAWFRLKYPHV IGALASSAP
Sbjct  158  LKNNLTAIDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAP  201



>ref|XP_002263389.2| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
 emb|CBI29519.3| unnamed protein product [Vitis vinifera]
Length=510

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 130/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFS   +    F Q+YLI+  HW    + GP+F+Y GNEGDI+WFAANT
Sbjct  58   YETRYFEQRLDHFSI--ADLPKFRQRYLISTRHWTGPDRMGPIFLYCGNEGDIEWFAANT  115

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ D+AP+F A++LF EHR+YGESMP+G   ++Y +A +L YL ++QALAD+A+L+ +L
Sbjct  116  GFVWDMAPRFGAMVLFPEHRYYGESMPYGSRDKAYANAASLSYLTAEQALADFAVLVTNL  175

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+E  PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  176  KRNLSAEGCPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  218



>ref|XP_004246480.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum lycopersicum]
Length=494

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 128/164 (78%), Gaps = 8/164 (5%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y+ +YF Q++DHF+F  +  + F Q+YL+N  +W   +   P+FVYTGNEG+I+WF  NT
Sbjct  41   YDTKYFTQILDHFNF--NNPQTFQQRYLLNDKYWGGSKNNAPIFVYTGNEGNIEWFTQNT  98

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GFM +IAP F+ALL+FIEHR+YG+S+P+G     +Y +  TLGYL+S QALADYA LI  
Sbjct  99   GFMFEIAPHFNALLVFIEHRYYGKSIPYGGDKTIAYSNKTTLGYLSSTQALADYATLIID  158

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LK NL++  SPVVVFGGSYGGMLAAWFRLKYPHV IGALASSAP
Sbjct  159  LKNNLTAIDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAP  202



>emb|CAA16683.1| lysosomal Pro-X carboxypeptidase - like protein [Arabidopsis 
thaliana]
Length=499

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 131/177 (74%), Gaps = 21/177 (12%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKG---GPMFVYTGNEGDIDWFAANT  393
            YE ++F Q +DHFSF  +    F Q+YLIN DHW      GP+F+Y GNEGDI+WFA N+
Sbjct  58   YETKFFSQQLDHFSF--ADLPKFSQRYLINSDHWLGASALGPIFLYCGNEGDIEWFATNS  115

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ DIAPKF ALL+F EHR+YGESMP+G  +++YK+A TL YL ++QALAD+A+ +  L
Sbjct  116  GFIWDIAPKFGALLVFPEHRYYGESMPYGSREEAYKNATTLSYLTTEQALADFAVFVTDL  175

Query  568  KKNLSSEASPVVVFGGSYGG--------------MLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+EA PVV+FGGSYGG              +LAAW RLKYPH+AIGALASSAP
Sbjct  176  KRNLSAEACPVVLFGGSYGGSNNCVFVFVVIDATVLAAWMRLKYPHIAIGALASSAP  232



>gb|EMS54705.1| Lysosomal Pro-X carboxypeptidase [Triticum urartu]
Length=568

 Score =   211 bits (538),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 126/167 (75%), Gaps = 14/167 (8%)
 Frame = +1

Query  238  FPQVVDHFSFIPSGYKIFYQKYLINKDHWQK---GGPMFVYTGNEGDIDWFAANTGFMLD  408
            F + +DHF+F P+   +F QKYL+N   W++    GP+FVYTGNEG+I+WF  NTGFM D
Sbjct  110  FIEELDHFTFTPNSSHVFSQKYLLNDTFWRRKPTAGPLFVYTGNEGEIEWFTTNTGFMFD  169

Query  409  IAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLSSE  588
            IAP+F ALL+FIEHRFYGESMPFG   Y S  TLGYL S QALAD+A+LI SLK+NLS+ 
Sbjct  170  IAPEFGALLVFIEHRFYGESMPFGDGPYSSPDTLGYLTSTQALADFAVLITSLKQNLSAV  229

Query  589  ASPVVVFGGSYGGML-----------AAWFRLKYPHVAIGALASSAP  696
             +PVVVFGGSYGG +           AAWFRLKYPHVA+GA+ASSAP
Sbjct  230  DAPVVVFGGSYGGRVNDFLSLLVLVLAAWFRLKYPHVAMGAVASSAP  276


 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 4/74 (5%)
 Frame = +1

Query  238  FPQVVDHFSFIPSGYKIFYQKYLINKDHWQK---GGPMFVYTGNEGDIDWFAANTGFMLD  408
            FP++ DHF+F P+   +F QKYL+N   W++    GP+FVYTGNEG+I+WF  NTGFM D
Sbjct  41   FPEL-DHFTFTPNSSHVFSQKYLLNDTFWRRKPTAGPLFVYTGNEGEIEWFTTNTGFMFD  99

Query  409  IAPKFHALLLFIEH  450
            IAP+F ALL+FIE 
Sbjct  100  IAPEFGALLVFIEE  113



>ref|XP_004305645.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=512

 Score =   210 bits (535),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 127/164 (77%), Gaps = 7/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y  +YF QV+DHF++ P  Y+ F  +YLIN  +W   +   P+FVYTGNEG+I+WFA NT
Sbjct  58   YTTKYFTQVLDHFNY-PKSYETFQHRYLINDTYWGGAKSNSPIFVYTGNEGNIEWFAENT  116

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQ---SYKSAKTLGYLNSQQALADYAILIRS  564
            GF+ + AP F AL++FIEHRFYG+S+PFG +   +Y +A TLGYL+S QALADYA LI  
Sbjct  117  GFLYETAPHFKALIIFIEHRFYGKSLPFGGKKDVAYSNATTLGYLSSTQALADYASLIID  176

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LKKNL++  SPVVV GGS+G MLAAWFRLKYPHV IGALASS+P
Sbjct  177  LKKNLTATDSPVVVLGGSHGEMLAAWFRLKYPHVTIGALASSSP  220



>ref|XP_009406760.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=498

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 129/162 (80%), Gaps = 6/162 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLI-NKDHWQK-GGPMFVYTGNEGDIDWFAANTG  396
            YE +YF Q +DHFSF  +    F Q+YLI N   W +  GP+F Y GNEGDI+WFA NTG
Sbjct  47   YEERYFRQSLDHFSF--ADLPPFDQRYLIANTGAWARPAGPIFFYCGNEGDIEWFADNTG  104

Query  397  FMLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSLK  570
            F+ DIAP+F AL++F EHR+YG+SMP+G Q  +YK+A++L YL ++QALAD++ L+  LK
Sbjct  105  FVWDIAPRFSALVVFAEHRYYGKSMPYGSQEKAYKNAESLSYLTTEQALADFSALLTDLK  164

Query  571  KNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            +NLSSE SPVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  165  RNLSSEESPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  206



>dbj|BAB10683.1| lysosomal Pro-X carboxypeptidase [Arabidopsis thaliana]
Length=529

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 131/177 (74%), Gaps = 21/177 (12%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKG---GPMFVYTGNEGDIDWFAANT  393
            YE ++F Q +DHFSF  +    F Q+YLIN DHW      GP+F+Y GNEGDI+WFA N+
Sbjct  58   YETKFFSQQLDHFSF--ADLPKFSQRYLINSDHWLGASALGPIFLYCGNEGDIEWFATNS  115

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ DIAPKF ALL+F EHR+YGESMP+G  +++YK+A TL YL ++QALAD+A+ +  L
Sbjct  116  GFIWDIAPKFGALLVFPEHRYYGESMPYGSREEAYKNATTLSYLTTEQALADFAVFVTDL  175

Query  568  KKNLSSEASPVVVFGGSYGG--------------MLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+EA PVV+FGGSYGG              +LAAW RLKYPH+AIGALASSAP
Sbjct  176  KRNLSAEACPVVLFGGSYGGSNNCVFVFVVIDATVLAAWMRLKYPHIAIGALASSAP  232



>ref|XP_009406759.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=500

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 129/162 (80%), Gaps = 6/162 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLI-NKDHWQK-GGPMFVYTGNEGDIDWFAANTG  396
            YE +YF Q +DHFSF  +    F Q+YLI N   W +  GP+F Y GNEGDI+WFA NTG
Sbjct  47   YEERYFRQSLDHFSF--ADLPPFDQRYLIANTGAWARPAGPIFFYCGNEGDIEWFADNTG  104

Query  397  FMLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSLK  570
            F+ DIAP+F AL++F EHR+YG+SMP+G Q  +YK+A++L YL ++QALAD++ L+  LK
Sbjct  105  FVWDIAPRFSALVVFAEHRYYGKSMPYGSQEKAYKNAESLSYLTTEQALADFSALLTDLK  164

Query  571  KNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            +NLSSE SPVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  165  RNLSSEESPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  206



>emb|CAF90249.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=487

 Score =   207 bits (527),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 122/160 (76%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y+  YF Q +DHF F+  G   F Q+YL+N  HWQ+ GGP+F YTGNEGDI WF  NTGF
Sbjct  46   YKTLYFDQKIDHFGFLEDG--TFKQRYLVNDKHWQQPGGPIFFYTGNEGDITWFCNNTGF  103

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M +IA +F A+L+F EHR+YGES+PFG  SY   K L YL S+QALAD+A+LI++LK  L
Sbjct  104  MWEIAEEFGAMLVFAEHRYYGESLPFGHDSYSDNKHLNYLTSEQALADFAVLIQNLKSTL  163

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              ++ SPV+  GGSYGGMLAAWFR+KYPH+ +GALASSAP
Sbjct  164  PGAQNSPVIAIGGSYGGMLAAWFRMKYPHMVVGALASSAP  203



>dbj|BAK05623.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=511

 Score =   207 bits (527),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 127/161 (79%), Gaps = 3/161 (2%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQ-KGGPMFVYTGNEGDIDWFAANTGF  399
            YE +Y+ Q +DHF+  P  Y  F Q+YL+N  +W  K  P+FVY GNEG I+ F  NTGF
Sbjct  59   YETRYYTQRLDHFNAAPVSYSTFPQRYLVNGTYWGGKTAPVFVYAGNEGSIELFTNNTGF  118

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSLKK  573
            M ++AP+F A+L+FIEHR+YG S+PFG +  ++K+A T+GYL++ QA+AD+A L++SLK 
Sbjct  119  MWELAPRFRAMLVFIEHRYYGRSVPFGSEEAAFKNASTMGYLSTTQAVADFATLVQSLKA  178

Query  574  NLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            NLS+ A+PVVVFGGSYGGMLAAW R+KYPHV IGA+ASSAP
Sbjct  179  NLSAPAAPVVVFGGSYGGMLAAWMRMKYPHVVIGAVASSAP  219



>ref|XP_010863507.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Esox lucius]
 ref|XP_010863508.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Esox lucius]
Length=499

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 122/160 (76%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW-QKGGPMFVYTGNEGDIDWFAANTGF  399
            Y+  YF Q +DHF F+  G   F Q+YL+N +HW QKGGP+  YTGNEGDI WF  NTGF
Sbjct  53   YKTLYFNQKIDHFGFLEDG--TFKQRYLVNDEHWHQKGGPILFYTGNEGDITWFCNNTGF  110

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M DIA +  A+L+F EHR+YGES+PFGK SY   K L YL+S+QALAD+A+LI+ LK+ +
Sbjct  111  MWDIAEELKAMLVFAEHRYYGESLPFGKDSYSDTKHLNYLSSEQALADFAVLIKELKRTV  170

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              S+ SPV+  GGSYGGML+AW R+KYP+V +GALA+SAP
Sbjct  171  PGSQLSPVIAIGGSYGGMLSAWMRMKYPNVVVGALAASAP  210



>ref|XP_010943424.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Elaeis guineensis]
Length=509

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 131/164 (80%), Gaps = 10/164 (6%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSF--IPSGYKIFYQKYLIN-KDHWQK-GGPMFVYTGNEGDIDWFAAN  390
            YE +YF Q +DHFSF  +PS    F Q+YL+   DHW +  GP+F Y GNEGDI+WFA+N
Sbjct  58   YETRYFQQRLDHFSFAELPS----FQQRYLVGPSDHWARPAGPIFFYCGNEGDIEWFASN  113

Query  391  TGFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRS  564
            TGF+ +IA  F AL++F EHR+YGESMP+G   ++Y++A +L YL ++QALAD+A+L+  
Sbjct  114  TGFVWEIAHLFSALVVFAEHRYYGESMPYGSKDRAYENAGSLSYLTTEQALADFAVLLTD  173

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LK+NLS+E SPVV+FGGSYGGM+AAW RLKYPH+A+GALASSAP
Sbjct  174  LKRNLSAEDSPVVLFGGSYGGMMAAWMRLKYPHIAVGALASSAP  217



>ref|XP_003549991.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
 gb|KHN01721.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=513

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 129/163 (79%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +YF Q +DHFSF  S    F Q+YLI+ +HW    + GP+F Y GNEGDI+WFA NT
Sbjct  61   YEKRYFQQRLDHFSF--SELPTFPQRYLISTEHWVGPHRLGPIFFYCGNEGDIEWFAQNT  118

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAP+F A+++F EHR+YGES+P+G  +++YK+A TL YL ++QALAD+++LI  L
Sbjct  119  GFVWEIAPRFGAMVVFPEHRYYGESVPYGSAEEAYKNATTLSYLTAEQALADFSVLITYL  178

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K N S++  PVV+FGGSYGGMLAAW RLKYPH+A+GALASSAP
Sbjct  179  KHNYSAKDCPVVLFGGSYGGMLAAWMRLKYPHIAVGALASSAP  221



>ref|XP_001776094.1| predicted protein [Physcomitrella patens]
 gb|EDQ59139.1| predicted protein [Physcomitrella patens]
Length=505

 Score =   205 bits (522),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 126/163 (77%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKG---GPMFVYTGNEGDIDWFAANT  393
            Y V YF QV+DHFSF       F Q+YLI K +W+     GP+F+Y GNEGD++WFA NT
Sbjct  39   YAVDYFTQVIDHFSFRREAS--FQQRYLIEKRYWKGAADRGPIFMYCGNEGDVEWFAKNT  96

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ +IAP F AL+LF EHR+YG+SMP+G  + SYK A +L  L S+QALAD+A L+  L
Sbjct  97   GFLWEIAPSFGALILFPEHRYYGKSMPYGTMEASYKDADSLSTLTSEQALADFATLVIDL  156

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            KKNL++ ASPVV+FGGSYGGMLA+W RLKYPH+AIGA+A+SAP
Sbjct  157  KKNLTAAASPVVLFGGSYGGMLASWMRLKYPHIAIGAVAASAP  199



>ref|XP_002450303.1| hypothetical protein SORBIDRAFT_05g003460 [Sorghum bicolor]
 gb|EES09291.1| hypothetical protein SORBIDRAFT_05g003460 [Sorghum bicolor]
Length=553

 Score =   206 bits (524),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 121/164 (74%), Gaps = 6/164 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE + + Q +DHF+ +PS Y  F Q+YLIN   W    +  P+F+Y GNEGDID F  NT
Sbjct  74   YETRRYTQRLDHFNSLPSSYATFQQRYLINDTFWGGRSRTAPIFLYAGNEGDIDLFTNNT  133

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GFM + AP+F A+L+F+EHR+YGESMPFG   + +++ A T GYL   QALADYA  + S
Sbjct  134  GFMWEAAPRFRAMLVFVEHRYYGESMPFGGTREAAFRDAATKGYLTVTQALADYASFVLS  193

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LK NLS  A+PVVVFGGSYGGMLAAW RLKYPHV +GA+ASSAP
Sbjct  194  LKANLSVPAAPVVVFGGSYGGMLAAWMRLKYPHVVMGAVASSAP  237



>ref|XP_004509045.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cicer arietinum]
Length=508

 Score =   205 bits (521),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 126/163 (77%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE ++F Q +DHFSF  S    F Q+YLIN DHW   Q  GP+F Y GNEGDI WFA NT
Sbjct  56   YETRFFQQQLDHFSF--SDLPTFPQRYLINTDHWLGPQHSGPIFFYCGNEGDIVWFAQNT  113

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ ++AP F A+++F EHR+YGES+P+G   ++YK+A TL +L ++QALAD+++L+  L
Sbjct  114  GFLWELAPSFGAMIVFPEHRYYGESVPYGSKDEAYKNATTLSFLTAEQALADFSVLLTDL  173

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+N S+   PVV+FGGSYGGMLAAW RLKYPH+A+GALASSAP
Sbjct  174  KRNYSAIDCPVVLFGGSYGGMLAAWMRLKYPHIAVGALASSAP  216



>ref|XP_010795079.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Notothenia 
coriiceps]
Length=316

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 122/160 (76%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            YE  YF Q +DH  F+  G   F Q+YL+   HWQ+ GGP+  YTGNEGDI WF  NTGF
Sbjct  50   YETLYFDQKIDHLGFLEDG--TFKQRYLVADKHWQQPGGPILFYTGNEGDITWFCNNTGF  107

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M +IA +  A+L+F EHR+YGES+PFG+ SY  +K L YL S+QALAD+A+LI+++K +L
Sbjct  108  MWEIAEELGAMLVFAEHRYYGESLPFGQDSYSDSKHLNYLTSEQALADFAVLIQNMKGSL  167

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
             +++ SPV+  GGSYGGMLAAWFR+KYP++ +GALA+SAP
Sbjct  168  PAAQQSPVIAVGGSYGGMLAAWFRMKYPNIVVGALAASAP  207



>gb|AFW87518.1| putative serine peptidase S28 family protein [Zea mays]
Length=1052

 Score =   210 bits (534),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 105/191 (55%), Positives = 122/191 (64%), Gaps = 36/191 (19%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK------GGPMFVYTGNEGDIDWFA  384
            + V YF Q +DHFSF P+   +FYQKYL+N   W++       GP+ VY G E DI+  A
Sbjct  79   FTVHYFQQELDHFSFTPNASTVFYQKYLVNDTFWRRPGGGGTAGPLLVYVGGEADIECIA  138

Query  385  ANTGFMLDIAPKFHALLLFIEH---------------------------RFYGESMPFGK  483
             N GFM DIAP F ALL+F+EH                           RFYGES+PFG 
Sbjct  139  HNVGFMFDIAPTFGALLVFVEHIEYIFGDLNIGPQKDMARVVWWSKRKHRFYGESLPFGN  198

Query  484  QSYKSAKTLGYLNSQQALADYAILIRSLKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPH  663
             S   A+ LGYL S QALAD AILI  LK+NLS+E SPVV+FGGSYGGMLA+WFRLKYPH
Sbjct  199  NS---AQALGYLTSTQALADLAILITDLKRNLSAETSPVVIFGGSYGGMLASWFRLKYPH  255

Query  664  VAIGALASSAP  696
            V IGALASSAP
Sbjct  256  VTIGALASSAP  266



>ref|XP_003576298.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Brachypodium 
distachyon]
Length=517

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 127/161 (79%), Gaps = 3/161 (2%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQ-KGGPMFVYTGNEGDIDWFAANTGF  399
            YE +Y+ Q +DHF  +P+ Y+ F Q+YL+N  +W  K  P+F+Y GNEG+++ F  NTGF
Sbjct  64   YETKYYEQRLDHFDALPASYRTFPQRYLVNGTYWGGKTSPVFLYAGNEGNVELFTNNTGF  123

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSLKK  573
            M ++AP+F ALLLF+EHR+YG+S PFG +  ++++  T+GYL + QA+AD A L++SLK 
Sbjct  124  MWELAPRFRALLLFVEHRYYGKSFPFGSEEAAFRNTSTVGYLTTTQAVADLATLVQSLKS  183

Query  574  NLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            NLS+ A+PV+VFGGSYGGMLAAW R+KYPHV +GA+ASSAP
Sbjct  184  NLSAHAAPVIVFGGSYGGMLAAWVRMKYPHVVMGAVASSAP  224



>ref|XP_008680725.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Zea mays]
 gb|AFW64865.1| putative serine peptidase S28 family protein [Zea mays]
Length=534

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 123/164 (75%), Gaps = 8/164 (5%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGP---MFVYTGNEGDIDWFAANT  393
            YE +++ Q +DHF+  P+ Y  F Q+YL+N   W  GGP   +F+Y GNEGD+D F  NT
Sbjct  63   YETRWYTQRLDHFNSAPASYATFQQRYLVNDTFW--GGPTAPIFLYAGNEGDVDLFTNNT  120

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG---KQSYKSAKTLGYLNSQQALADYAILIRS  564
            GFM + AP+F ALL+F+EHR+YGESMPFG     +++ A+T GYL   QALADYA  + S
Sbjct  121  GFMWESAPRFRALLVFVEHRYYGESMPFGGTRAAAFRDARTKGYLTVTQALADYASFVLS  180

Query  565  LKKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            LK NLS+ A+PVVVFGGSYGGMLAAW RLKYPH+ +GA+ASSAP
Sbjct  181  LKANLSAPAAPVVVFGGSYGGMLAAWMRLKYPHIVMGAVASSAP  224



>ref|XP_005095813.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Aplysia californica]
Length=488

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 121/159 (76%), Gaps = 3/159 (2%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFM  402
            Y+  Y+ Q +DHF F  +  K F QKYL     W K GP+F YTGNEG I+WF  NTGF+
Sbjct  48   YQTLYYDQQIDHFGF--ANEKTFKQKYLFADQFWNKKGPIFFYTGNEGTIEWFCNNTGFL  105

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS  582
             DIAP+F+ALL+F EHR+YG+S+PFGK+SY+++ TL +L S+QALAD+A LIR LK  + 
Sbjct  106  WDIAPQFNALLVFAEHRYYGDSLPFGKESYQNSSTLNFLTSEQALADFATLIRYLKATVP  165

Query  583  SEAS-PVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              A  PVV FGGSYGGMLAAWFR+KYP+V +G+LA+SAP
Sbjct  166  HAADKPVVAFGGSYGGMLAAWFRIKYPNVVVGSLAASAP  204



>ref|XP_003968706.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Takifugu rubripes]
 ref|XP_011606940.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Takifugu rubripes]
Length=500

 Score =   202 bits (515),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 120/160 (75%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y+  YF Q +DHF F+  G   F Q+YLI   HWQ+ GGP+F YTGNEGDI WF  NTGF
Sbjct  46   YKTLYFEQKIDHFGFLEDG--TFKQRYLIADKHWQQPGGPIFFYTGNEGDITWFCNNTGF  103

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M +IA +F A+L+F EHR+YGES+PFG  SY   K L YL S+QALAD+A+L+++LK   
Sbjct  104  MWEIAEEFGAMLVFAEHRYYGESLPFGADSYSDNKHLNYLTSEQALADFAVLVQNLKSTF  163

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              ++ SPV+  GGSYGGMLAAWFR+KYPH+ +GALASSAP
Sbjct  164  PGAQNSPVIAVGGSYGGMLAAWFRMKYPHIVVGALASSAP  203



>ref|XP_002962483.1| hypothetical protein SELMODRAFT_78660 [Selaginella moellendorffii]
 gb|EFJ35946.1| hypothetical protein SELMODRAFT_78660 [Selaginella moellendorffii]
Length=474

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 120/161 (75%), Gaps = 7/161 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQ---KGGPMFVYTGNEGDIDWFAANT  393
            Y   YF Q +DHF+       +F Q+YL++   W     G P+FVY GNEGDI WFA NT
Sbjct  20   YTEHYFQQTLDHFNV--GNITLFPQRYLLHNASWSGGASGAPIFVYCGNEGDIVWFAENT  77

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKK  573
            GFM DIAP F ALL+F EHRFYG+S PFG Q+    K L + +++QALAD+A LI  LK+
Sbjct  78   GFMFDIAPLFGALLVFPEHRFYGKSQPFGGQN--GPKELAFCSAEQALADFATLILDLKR  135

Query  574  NLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            NLS++ASPVVVFGGSYGGMLAAWFRLKYPH+AIGALASSAP
Sbjct  136  NLSAQASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAP  176



>ref|XP_008842416.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nannospalax 
galili]
Length=496

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 121/160 (76%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y V YFPQ VDHF F  +  K F Q+YLI   HW+K GG +  YTGNEGDI WF  NTGF
Sbjct  48   YSVLYFPQKVDHFGF--NNVKTFKQRYLIADKHWKKNGGSILFYTGNEGDIIWFCNNTGF  105

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M ++A +  A+L+F EHR+YGES+PFG+ S+K +K L +L S+QALADYA LIR LK+ +
Sbjct  106  MWNVAEELEAMLVFAEHRYYGESLPFGEDSFKDSKHLNFLTSEQALADYAELIRHLKRTI  165

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              +++ PV+  GGSYGGMLAAWFR+KYPH+ +GALA+SAP
Sbjct  166  PGADSQPVIAVGGSYGGMLAAWFRMKYPHLVVGALAASAP  205



>ref|XP_002737003.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Saccoglossus 
kowalevskii]
Length=501

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 123/159 (77%), Gaps = 3/159 (2%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFM  402
            Y+  YF Q +DHF+F  +G   F Q+YL++ D+W   GP+F YTGNEGDI WF  NTGF+
Sbjct  57   YQTLYFKQTLDHFNFANNG--TFSQRYLLSDDYWNSSGPIFFYTGNEGDITWFCNNTGFI  114

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS  582
             DIAP+F A+++F EHR+YGES+PFG +S+   + +GYL S+QALAD+A LI+ +K +  
Sbjct  115  WDIAPQFKAMVIFAEHRYYGESLPFGNESFSDLEHVGYLTSEQALADFATLIKYIKSSRP  174

Query  583  -SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
             ++ SPV+VFGGSYGGM+AAWFR+KYP++  GALA+SAP
Sbjct  175  GADKSPVIVFGGSYGGMMAAWFRMKYPNIVDGALAASAP  213



>gb|EMT30656.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=485

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 124/161 (77%), Gaps = 3/161 (2%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQ-KGGPMFVYTGNEGDIDWFAANTGF  399
            YE +   Q +DHF+  P+ Y+ F Q+YL+N  +W  K  P+FVY GNEG+I+ F  NTGF
Sbjct  4    YETRSHTQRLDHFNAAPASYRTFPQRYLVNGTYWGGKTAPVFVYAGNEGNIELFTNNTGF  63

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQ--SYKSAKTLGYLNSQQALADYAILIRSLKK  573
            M ++AP+F A+L+FIEHR+YG S+PFG +  ++++  T GYL + QA+AD+A L++SLK 
Sbjct  64   MWELAPRFRAMLVFIEHRYYGRSVPFGSEEAAFRNTSTAGYLTTTQAVADFATLVQSLKA  123

Query  574  NLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            NLS+  +PVVVFGGSYGGMLAAW R+KYPHV IGA+ASSAP
Sbjct  124  NLSAPTAPVVVFGGSYGGMLAAWMRMKYPHVVIGAVASSAP  164



>ref|XP_002962799.1| hypothetical protein SELMODRAFT_78251 [Selaginella moellendorffii]
 gb|EFJ36262.1| hypothetical protein SELMODRAFT_78251 [Selaginella moellendorffii]
Length=470

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 120/161 (75%), Gaps = 7/161 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQ---KGGPMFVYTGNEGDIDWFAANT  393
            Y   YF Q +DHF+       +F Q+YL++   W     G P+FVY GNEGDI WFA NT
Sbjct  20   YTEHYFQQTLDHFNV--GNITLFPQRYLLHNASWSGGASGAPIFVYCGNEGDIVWFAENT  77

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKK  573
            GFM DIAP F ALL+F EHRFYG+S PFG Q+    K L + +++QALAD+A LI  LK+
Sbjct  78   GFMFDIAPLFGALLVFPEHRFYGKSQPFGGQN--GPKELAFCSAEQALADFATLILDLKR  135

Query  574  NLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            NLS++ASPVVVFGGSYGGMLAAWFRLKYPH+AIGALASSAP
Sbjct  136  NLSAQASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAP  176



>ref|XP_010260171.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=506

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 124/163 (76%), Gaps = 5/163 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            Y V Y+ Q +DHF++ P  Y  F QKY+IN ++W       P+FVY G+E  ID     T
Sbjct  59   YNVYYYNQTLDHFNYRPESYTTFQQKYVINSNYWGGANSSAPIFVYLGDESAIDDDIRTT  118

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ + APKF+AL++FIEHR+YG+S+PFG   ++++ A TLGY +S QALADYA +I ++
Sbjct  119  GFLSENAPKFNALIVFIEHRYYGKSVPFGSRDEAFRDASTLGYFSSSQALADYAEIILAI  178

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            KKNLS+E SPV+V GGSYGGMLAAWFRLKYPH+A+GALASSAP
Sbjct  179  KKNLSAERSPVIVVGGSYGGMLAAWFRLKYPHIALGALASSAP  221



>ref|XP_002864979.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH41238.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=514

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 125/163 (77%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKG---GPMFVYTGNEGDIDWFAANT  393
            YE ++F Q +DHFSF  +    F Q+YLIN D+W      GP+F+Y GNEGDI+WFA N+
Sbjct  57   YETKFFSQQLDHFSF--ADLPKFPQRYLINSDYWLGASALGPIFLYCGNEGDIEWFATNS  114

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            GF+ DIAPKF ALL+F E R     MP+G  +++YK+A TL YL ++QALAD+A+ +  L
Sbjct  115  GFIWDIAPKFGALLVFPEVRSCLFCMPYGSMEEAYKNATTLSYLTTEQALADFAVFVTDL  174

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLS+EA PVV+FGGSYGGMLAAW RLKYPH+AIGALASSAP
Sbjct  175  KRNLSAEACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAP  217



>ref|XP_005455120.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X3 [Oreochromis 
niloticus]
Length=467

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 123/160 (77%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y+  YF Q +DHF F+  G   F Q+YL++  +WQ+ GGP+  YTGNEGDI WF  NTGF
Sbjct  15   YKTFYFDQKIDHFGFLEDG--TFKQRYLLSDKYWQQPGGPILFYTGNEGDITWFCNNTGF  72

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M +IA +  A+L+F EHR+YGES+PFG+ SY+ +K L YL S+QALAD+A+LI++LK  L
Sbjct  73   MWEIAEELDAMLVFAEHRYYGESLPFGQDSYRDSKHLNYLTSEQALADFAVLIQNLKGTL  132

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              ++ SPV+  GGSYGGML+AWFR+KYPHV +GALASSAP
Sbjct  133  PGAQHSPVIAVGGSYGGMLSAWFRMKYPHVVVGALASSAP  172



>ref|XP_009289789.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X3 [Danio 
rerio]
Length=369

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 119/160 (74%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y   Y  Q +DHF F+ +G   F Q+YL+N  HW K GGP+  YTGNEGDI WF  NTGF
Sbjct  47   YNTLYIDQQIDHFGFLENG--TFKQRYLLNDQHWHKDGGPILFYTGNEGDITWFCNNTGF  104

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M D+A +  ALL+F EHR+YGES+PFG++SY +AK L YL S+Q LAD+A+LI++LKK+ 
Sbjct  105  MWDVAEELGALLVFAEHRYYGESLPFGEESYSNAKYLNYLTSEQVLADFAVLIKALKKSQ  164

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              +E S V+  GGSYGGMLAAW R+KYP+  +GALA+SAP
Sbjct  165  PGAEKSSVIAIGGSYGGMLAAWLRMKYPNAVVGALAASAP  204



>ref|XP_005455119.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Oreochromis 
niloticus]
Length=475

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 123/160 (77%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y+  YF Q +DHF F+  G   F Q+YL++  +WQ+ GGP+  YTGNEGDI WF  NTGF
Sbjct  23   YKTFYFDQKIDHFGFLEDG--TFKQRYLLSDKYWQQPGGPILFYTGNEGDITWFCNNTGF  80

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M +IA +  A+L+F EHR+YGES+PFG+ SY+ +K L YL S+QALAD+A+LI++LK  L
Sbjct  81   MWEIAEELDAMLVFAEHRYYGESLPFGQDSYRDSKHLNYLTSEQALADFAVLIQNLKGTL  140

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              ++ SPV+  GGSYGGML+AWFR+KYPHV +GALASSAP
Sbjct  141  PGAQHSPVIAVGGSYGGMLSAWFRMKYPHVVVGALASSAP  180



>ref|XP_003450203.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Oreochromis 
niloticus]
Length=502

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 123/160 (77%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y+  YF Q +DHF F+  G   F Q+YL++  +WQ+ GGP+  YTGNEGDI WF  NTGF
Sbjct  50   YKTFYFDQKIDHFGFLEDG--TFKQRYLLSDKYWQQPGGPILFYTGNEGDITWFCNNTGF  107

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M +IA +  A+L+F EHR+YGES+PFG+ SY+ +K L YL S+QALAD+A+LI++LK  L
Sbjct  108  MWEIAEELDAMLVFAEHRYYGESLPFGQDSYRDSKHLNYLTSEQALADFAVLIQNLKGTL  167

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              ++ SPV+  GGSYGGML+AWFR+KYPHV +GALASSAP
Sbjct  168  PGAQHSPVIAVGGSYGGMLSAWFRMKYPHVVVGALASSAP  207



>ref|XP_010190194.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like, partial [Mesitornis 
unicolor]
Length=213

 Score =   192 bits (487),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 117/158 (74%), Gaps = 4/158 (3%)
 Frame = +1

Query  229  VQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKG-GPMFVYTGNEGDIDWFAANTGFML  405
             +Y  + +DHF F  +    F Q+YL+   HW+K  GP+  YTGNEGDI WF  NTGFM 
Sbjct  13   TRYMVEQIDHFGFDEN--LTFQQRYLVADQHWKKANGPILFYTGNEGDITWFCNNTGFMW  70

Query  406  DIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS-  582
            D+A + +A+L+F EHR+YGES+PFG +S+  +K L YL S+QALAD+A+LI  LK  ++ 
Sbjct  71   DVAEELNAMLVFAEHRYYGESLPFGNESFSDSKHLNYLTSEQALADFAVLIEHLKTTIAG  130

Query  583  SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            ++ SPV+  GGSYGGMLAAWFR+KYPHV +GALA+SAP
Sbjct  131  AQDSPVIAIGGSYGGMLAAWFRMKYPHVVVGALAASAP  168



>ref|XP_002601798.1| hypothetical protein BRAFLDRAFT_279167 [Branchiostoma floridae]
 gb|EEN57810.1| hypothetical protein BRAFLDRAFT_279167 [Branchiostoma floridae]
Length=481

 Score =   199 bits (506),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 122/160 (76%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQ-KGGPMFVYTGNEGDIDWFAANTGF  399
            Y+ +YF Q VDHFSF  +    F Q+YLIN  +++  GGP+F+YTGNEGDI  F  NTGF
Sbjct  40   YDTKYFTQPVDHFSFTRT--DTFDQRYLINMKYFEGTGGPIFLYTGNEGDITMFCDNTGF  97

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M DIAPKF AL++F EHR+YGESMP+GK SYK  + LGYL ++QALAD+A LI  LK ++
Sbjct  98   MWDIAPKFKALVVFAEHRYYGESMPYGKDSYKDPEHLGYLTAEQALADFARLITHLKASI  157

Query  580  SSEA-SPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
               A SPVV FGGSYGGMLAAWFR+KYP   IG+LA+SAP
Sbjct  158  PGAADSPVVAFGGSYGGMLAAWFRMKYPSSVIGSLAASAP  197



>ref|XP_009289788.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Danio 
rerio]
Length=417

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 119/160 (74%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y   Y  Q +DHF F+ +G   F Q+YL+N  HW K GGP+  YTGNEGDI WF  NTGF
Sbjct  47   YNTLYIDQQIDHFGFLENG--TFKQRYLLNDQHWHKDGGPILFYTGNEGDITWFCNNTGF  104

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M D+A +  ALL+F EHR+YGES+PFG++SY +AK L YL S+Q LAD+A+LI++LKK+ 
Sbjct  105  MWDVAEELGALLVFAEHRYYGESLPFGEESYSNAKYLNYLTSEQVLADFAVLIKALKKSQ  164

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              +E S V+  GGSYGGMLAAW R+KYP+  +GALA+SAP
Sbjct  165  PGAEKSSVIAIGGSYGGMLAAWLRMKYPNAVVGALAASAP  204



>ref|XP_004980174.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Setaria italica]
Length=520

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 122/161 (76%), Gaps = 3/161 (2%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQ-KGGPMFVYTGNEGDIDWFAANTGF  399
            YE +++ Q +DHF+  PS Y  F Q+YLIN   W+ K  P+F+Y GNEGD++ F  NTGF
Sbjct  66   YETRHYTQRLDHFNSAPSSYATFQQRYLINGTFWRGKTSPIFLYAGNEGDVELFTNNTGF  125

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSLKK  573
            M + AP+F A+L+FIEHR+YG+SMPFG  + +Y+ A T GYL   QALADYA  + SLK 
Sbjct  126  MWEAAPRFGAMLVFIEHRYYGKSMPFGGKEAAYRDAATKGYLTVPQALADYASFVLSLKA  185

Query  574  NLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            NLS+ A+PV+V GGSYGGMLAAW R+KYPH+ +GA+ASSAP
Sbjct  186  NLSAPAAPVLVLGGSYGGMLAAWMRIKYPHIVMGAVASSAP  226



>gb|KHN38601.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=440

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 126/163 (77%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW---QKGGPMFVYTGNEGDIDWFAANT  393
            YE +   Q +DHFSF  S    F Q+YLI+ +HW   ++ GP+F Y+GNE DI+WFA NT
Sbjct  184  YETRCIQQSLDHFSF--SELPTFPQRYLISTEHWVGPRRLGPVFFYSGNEDDIEWFAQNT  241

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            G + +IAP+F A+++F EH++YGES+P+G  +++YK+  TL YL S+QALAD+++LI  L
Sbjct  242  GVVWEIAPRFGAMVVFPEHQYYGESVPYGSAEEAYKNVTTLSYLTSEQALADFSVLIADL  301

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K N S++  PV++FGGSYGGMLAAW RLKYPHVA+GALASSAP
Sbjct  302  KHNFSTKDCPVILFGGSYGGMLAAWMRLKYPHVAVGALASSAP  344



>ref|XP_004560588.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Maylandia zebra]
 ref|XP_005736014.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pundamilia 
nyererei]
Length=502

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 122/160 (76%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y+  YF Q +DHF F+  G   F Q+YL++  +WQ+ GGP+  YTGNEGDI WF  NTGF
Sbjct  50   YKTFYFDQKIDHFGFLEDG--TFKQRYLLSDKYWQQPGGPILFYTGNEGDITWFCNNTGF  107

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M +IA +  A+L+F EHR+YGES+PFG+ SY  +K L YL S+QALAD+A+LI++LK  L
Sbjct  108  MWEIAEELGAMLVFAEHRYYGESLPFGQDSYSDSKHLNYLTSEQALADFAVLIQNLKGTL  167

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              ++ SPV+  GGSYGGML+AWFR+KYPHV +GALASSAP
Sbjct  168  PGAQHSPVIAVGGSYGGMLSAWFRMKYPHVVVGALASSAP  207



>ref|XP_008288574.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Stegastes partitus]
Length=506

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 121/160 (76%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y+  YF Q +DHF F+  G   F Q+YL+   HWQ+ GGP+  YTGNEGDI WF  NTGF
Sbjct  51   YKTFYFDQKIDHFGFLEDG--TFKQRYLVADKHWQQPGGPILFYTGNEGDITWFCNNTGF  108

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M +IA +  A+L+F EHR+YGES+PFG+ SY  +K L YL ++QALAD+A+LI++LK  L
Sbjct  109  MWEIAEELGAMLVFAEHRYYGESLPFGQDSYSDSKHLNYLTAEQALADFAVLIQNLKSTL  168

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              ++ SPV+  GGSYGGMLAAWFR+KYP+V +GALA+SAP
Sbjct  169  PGAQQSPVIAVGGSYGGMLAAWFRMKYPNVVVGALAASAP  208



>ref|XP_006796688.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Neolamprologus 
brichardi]
Length=502

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 122/160 (76%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y+  YF Q +DHF F+  G   F Q+YL++  +WQ+ GGP+  YTGNEGDI WF  NTGF
Sbjct  50   YKTFYFDQKIDHFGFLEDG--TFKQRYLLSDKYWQQPGGPILFYTGNEGDITWFCNNTGF  107

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M +IA +  A+L+F EHR+YGES+PFG+ SY  +K L YL S+QALAD+A+LI++LK  L
Sbjct  108  MWEIAEELGAMLVFAEHRYYGESLPFGQDSYSDSKHLNYLTSEQALADFAVLIQNLKGTL  167

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              ++ SPV+  GGSYGGML+AWFR+KYPHV +GALASSAP
Sbjct  168  PGAQHSPVIAVGGSYGGMLSAWFRMKYPHVVVGALASSAP  207



>ref|XP_005926584.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Haplochromis 
burtoni]
Length=502

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 122/160 (76%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y+  YF Q +DHF F+  G   F Q+YL++  +WQ+ GGP+  YTGNEGDI WF  NTGF
Sbjct  50   YKTFYFDQKIDHFGFLEDG--TFKQRYLLSDKYWQQPGGPILFYTGNEGDITWFCNNTGF  107

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M +IA +  A+L+F EHR+YGES+PFG+ SY  +K L YL S+QALAD+A+LI++LK  L
Sbjct  108  MWEIAEELGAMLVFAEHRYYGESLPFGQDSYSDSKHLNYLTSEQALADFAVLIQNLKGTL  167

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              ++ SPV+  GGSYGGML+AWFR+KYPHV +GALASSAP
Sbjct  168  PGAQHSPVIAVGGSYGGMLSAWFRMKYPHVVVGALASSAP  207



>ref|XP_006014312.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like, partial [Latimeria 
chalumnae]
Length=268

 Score =   191 bits (486),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 113/151 (75%), Gaps = 4/151 (3%)
 Frame = +1

Query  250  VDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGFMLDIAPKFH  426
            VDHF F       F Q+YL+   +W K GGP+  YTGNEGDI WF  NTGFM D+A +  
Sbjct  17   VDHFGFAED--STFKQRYLVADQYWNKDGGPILFYTGNEGDITWFCNNTGFMWDVAVELK  74

Query  427  ALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL-SSEASPVV  603
            A+L+F EHR+YGES+PFG+ S+   K L YL S+QALAD+A+LIR+LKK +  ++ SPV+
Sbjct  75   AMLVFAEHRYYGESLPFGESSFIDPKHLNYLTSEQALADFAVLIRNLKKTIPGTQNSPVI  134

Query  604  VFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              GGSYGGMLAAWFR+KYPHV +GALASSAP
Sbjct  135  AIGGSYGGMLAAWFRMKYPHVVVGALASSAP  165



>ref|NP_001099751.2| lysosomal Pro-X carboxypeptidase precursor [Rattus norvegicus]
Length=493

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 119/160 (74%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y V YF Q VDHF F  S  + F Q+YL+   HWQ+ GG +  YTGNEGDI WF  NTGF
Sbjct  45   YSVHYFQQKVDHFGF--SDTRTFKQRYLVADKHWQRNGGSILFYTGNEGDIVWFCNNTGF  102

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M D+A +  A+L+F EHR+YG+S+PFG+ S+K ++ L +L S+QALAD+A LIR LK+ +
Sbjct  103  MWDVAEELKAMLVFAEHRYYGKSLPFGRDSFKDSQHLNFLTSEQALADFAELIRHLKETI  162

Query  580  S-SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              +E  PV+  GGSYGGMLAAWFR+KYPH+ +GALA+SAP
Sbjct  163  PGTEGQPVIAIGGSYGGMLAAWFRMKYPHIVVGALAASAP  202



>ref|XP_005074170.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Mesocricetus 
auratus]
Length=492

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 118/160 (74%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQ-KGGPMFVYTGNEGDIDWFAANTGF  399
            Y V YF Q VDHF F  S  + F Q+YLI   HWQ  GG +  YTGNEGDI WF  NTGF
Sbjct  46   YSVLYFKQKVDHFGF--SDSRTFKQRYLIADKHWQTNGGSILFYTGNEGDIVWFCNNTGF  103

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M D+A +  A+L+F EHR+YGES+PFG+ S+K ++ L +L S+QALAD+A LIR LK+ +
Sbjct  104  MWDVAEELKAMLVFAEHRYYGESLPFGEDSFKDSRHLNFLTSEQALADFAELIRHLKRTV  163

Query  580  S-SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              +E  PV+  GGSYGGMLAAWFR+KYPH+ +GALA+SAP
Sbjct  164  PGAENQPVIALGGSYGGMLAAWFRMKYPHLVVGALAASAP  203



>ref|NP_001002694.1| lysosomal Pro-X carboxypeptidase precursor [Danio rerio]
 gb|AAH76507.1| Prolylcarboxypeptidase (angiotensinase C) [Danio rerio]
Length=490

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 119/160 (74%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y   Y  Q +DHF F+ +G   F Q+YL+N  HW K GGP+  YTGNEGDI WF  NTGF
Sbjct  47   YNTLYIDQQIDHFGFLENG--TFKQRYLLNDQHWHKDGGPILFYTGNEGDITWFCNNTGF  104

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M D+A +  ALL+F EHR+YGES+PFG++SY +AK L YL S+Q LAD+A+LI++LKK+ 
Sbjct  105  MWDVAEELGALLVFAEHRYYGESLPFGEESYSNAKYLNYLTSEQVLADFAVLIKALKKSQ  164

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              +E S V+  GGSYGGMLAAW R+KYP+  +GALA+SAP
Sbjct  165  PGAEKSSVIAIGGSYGGMLAAWLRMKYPNAVVGALAASAP  204



>ref|XP_009289787.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Danio 
rerio]
Length=521

 Score =   197 bits (501),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 119/160 (74%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y   Y  Q +DHF F+ +G   F Q+YL+N  HW K GGP+  YTGNEGDI WF  NTGF
Sbjct  47   YNTLYIDQQIDHFGFLENG--TFKQRYLLNDQHWHKDGGPILFYTGNEGDITWFCNNTGF  104

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M D+A +  ALL+F EHR+YGES+PFG++SY +AK L YL S+Q LAD+A+LI++LKK+ 
Sbjct  105  MWDVAEELGALLVFAEHRYYGESLPFGEESYSNAKYLNYLTSEQVLADFAVLIKALKKSQ  164

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              +E S V+  GGSYGGMLAAW R+KYP+  +GALA+SAP
Sbjct  165  PGAEKSSVIAIGGSYGGMLAAWLRMKYPNAVVGALAASAP  204



>ref|XP_004658181.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Jaculus jaculus]
Length=496

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 117/160 (73%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y V+Y  Q VDHF F     K F Q+YLI   HW+K GG +  YTGNEGDI W   NTGF
Sbjct  48   YLVRYIQQKVDHFGF--HNAKTFKQRYLIADKHWRKDGGSILFYTGNEGDITWICNNTGF  105

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M D+A +  A+L+F EHR+YGES+PFG+ S K +K L YL S+QALADYA+LIR LK+ +
Sbjct  106  MWDVAEEMKAMLVFAEHRYYGESLPFGEDSLKDSKHLNYLTSEQALADYAMLIRHLKRTI  165

Query  580  S-SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              ++  PV+  GGSYGGMLAAWFR+KYPH+ +GALASSAP
Sbjct  166  PGAKNQPVIAIGGSYGGMLAAWFRMKYPHIVVGALASSAP  205



>ref|XP_002108777.1| hypothetical protein TRIADDRAFT_19181 [Trichoplax adhaerens]
 gb|EDV29575.1| hypothetical protein TRIADDRAFT_19181 [Trichoplax adhaerens]
Length=463

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 123/159 (77%), Gaps = 3/159 (2%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKGGPMFVYTGNEGDIDWFAANTGFM  402
            Y+ +YF Q +DHFS  P+  + F Q+YLI++ +W+KG P+F YTGNEGDI WFA NTGFM
Sbjct  20   YQTKYFKQRLDHFS--PADDRKFQQRYLISQKYWKKGSPIFFYTGNEGDITWFAKNTGFM  77

Query  403  LDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLK-KNL  579
             DIAP+F+A+L+F+EHR+YG+++PFGK S+K  + L YL+S+QALAD+A  I   K +  
Sbjct  78   WDIAPEFNAMLIFVEHRYYGKTLPFGKDSFKDKEHLAYLSSEQALADFAQFIVDFKAETH  137

Query  580  SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
             ++ S V+ FGGSYGGML AW R+KYP++  GA+A+SAP
Sbjct  138  GTQNSSVIAFGGSYGGMLTAWLRIKYPNIVDGAIAASAP  176



>gb|AAH26424.1| Prcp protein, partial [Mus musculus]
Length=451

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 119/160 (74%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y V YF Q VDHF F  +  + F Q+YL+   HWQ+ GG +  YTGNEGDI WF  NTGF
Sbjct  6    YSVLYFEQKVDHFGF--ADMRTFKQRYLVADKHWQRNGGSILFYTGNEGDIVWFCNNTGF  63

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M D+A +  A+L+F EHR+YGES+PFG+ S+K ++ L +L S+QALAD+A LIR L+K +
Sbjct  64   MWDVAEELKAMLVFAEHRYYGESLPFGQDSFKDSQHLNFLTSEQALADFAELIRHLEKTI  123

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              ++  PV+  GGSYGGMLAAWFR+KYPH+ +GALA+SAP
Sbjct  124  PGAQGQPVIAIGGSYGGMLAAWFRMKYPHIVVGALAASAP  163



>ref|XP_002188561.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Taeniopygia guttata]
Length=479

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 120/160 (75%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y  +Y  Q +DHF F  +  + F Q+YL+   HW+K  GP+  YTGNEGDI+WF  NTGF
Sbjct  34   YLTRYLSQQIDHFGFDEN--RTFQQRYLLADQHWKKDNGPILFYTGNEGDIEWFCNNTGF  91

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M D+A + +A+L+F EHR+YGES+PFG +S+  +K L YL S+QALAD+A+L+  LK  +
Sbjct  92   MWDVAEELNAMLVFAEHRYYGESLPFGNESFSDSKHLNYLTSEQALADFAVLVEYLKTTI  151

Query  580  S-SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            + ++ SPV+  GGSYGGMLAAWFR+KYPHV +GALA+SAP
Sbjct  152  AGAQHSPVIAIGGSYGGMLAAWFRMKYPHVVVGALAASAP  191



>ref|XP_003203584.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Meleagris gallopavo]
Length=483

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 118/160 (74%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y  +Y  Q +DHF F  +    F Q+YLI   HWQK  GP+  YTGNEGDI WF  NTGF
Sbjct  38   YVTRYLTQQIDHFGFDEN--LTFQQRYLIADQHWQKDNGPILFYTGNEGDITWFCNNTGF  95

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M D+A + +A+L+F EHR+YGES+PFG +S+  +K L YL S+QALAD+A+LI  LK+ +
Sbjct  96   MWDVAEELNAMLVFAEHRYYGESLPFGNESFSDSKHLNYLTSEQALADFAVLIEYLKETI  155

Query  580  S-SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            + +  SPV+  GGSYGGMLAAWFR+KYPHV +GALA+SAP
Sbjct  156  AGARHSPVIAIGGSYGGMLAAWFRMKYPHVVVGALAASAP  195



>ref|XP_010629188.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Fukomys 
damarensis]
 gb|KFO30489.1| Lysosomal Pro-X carboxypeptidase [Fukomys damarensis]
Length=493

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 117/160 (73%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y V YF Q VDHF F  +  K F Q+YLI+  HWQ+ GG +  YTGNEGDI WF  NTGF
Sbjct  45   YSVLYFQQKVDHFGF--NNPKTFKQRYLISDKHWQRDGGSILFYTGNEGDIVWFCNNTGF  102

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M D+A +  A+L+F EHR+YGES+PFG  S+K ++ L +L S+QALAD+A LIR LK+ +
Sbjct  103  MWDVAEELKAMLVFAEHRYYGESLPFGADSFKDSRHLNFLTSEQALADFAELIRHLKRTI  162

Query  580  SSEAS-PVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
                  PV+  GGSYGGMLAAWFR+KYPHV +GALA+SAP
Sbjct  163  PGAGDQPVIAIGGSYGGMLAAWFRMKYPHVVVGALAASAP  202



>ref|XP_010139237.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Buceros rhinoceros 
silvestris]
Length=451

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 118/156 (76%), Gaps = 4/156 (3%)
 Frame = +1

Query  235  YFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGFMLDI  411
            YF Q +DHF F  +  + F Q+YL+   HW+K  GP+  YTGNEGDI WF  NTGFM D+
Sbjct  10   YFKQKIDHFGFDEN--RTFQQRYLVADQHWKKDNGPILFYTGNEGDITWFCNNTGFMWDV  67

Query  412  APKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNLS-SE  588
            A + +A+L+F EHR+YGES+PFG +S+  +K L YL S+QALAD+A+L+  LK +++ + 
Sbjct  68   AEELNAMLVFAEHRYYGESLPFGNESFSDSKHLNYLTSEQALADFAVLVEYLKTSIAGAR  127

Query  589  ASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
             SPV+  GGSYGGMLAAWFR+KYPHV +GALA+SAP
Sbjct  128  YSPVIAIGGSYGGMLAAWFRMKYPHVVVGALAASAP  163



>ref|XP_005510815.1| PREDICTED: lysosomal Pro-X carboxypeptidase, partial [Columba 
livia]
Length=453

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 118/160 (74%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQKG-GPMFVYTGNEGDIDWFAANTGF  399
            Y ++YF Q VDHF F       F Q+YLI   HW+K  GP+  YTGNEGDI WF+ NTGF
Sbjct  9    YLIRYFQQQVDHFGF--DDNLTFQQRYLIADQHWKKNNGPILFYTGNEGDITWFSNNTGF  66

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M D+A + +A+L+F EHR+YGES+PFG +SY  +K L YL S+QALAD+A+LI  LK  +
Sbjct  67   MWDVAQELNAMLVFAEHRYYGESLPFGNESYSDSKRLNYLTSEQALADFAVLIEHLKSTI  126

Query  580  S-SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            + +  SPV+  GGSY GMLAAWFR+KYPH+ +GALA+SAP
Sbjct  127  AGARYSPVIAIGGSYRGMLAAWFRMKYPHLVVGALAASAP  166



>ref|XP_011230861.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Ailuropoda melanoleuca]
Length=499

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 120/160 (75%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y + Y  Q VDHF F  +  + F Q+YLI  +HW+K GG +  YTGNEGDI WF  NTGF
Sbjct  50   YSIHYIQQKVDHFGF--TADETFKQRYLIADEHWKKNGGSILFYTGNEGDITWFCNNTGF  107

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M D+A +  A+L+F EHR+YGES+PFG +S+K ++ L +L S+QALAD+A+LI+ LK+ +
Sbjct  108  MWDVADQLKAMLVFAEHRYYGESLPFGNKSFKDSRHLNFLTSEQALADFAVLIKHLKRTI  167

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              ++  PV+  GGSYGGMLAAWFR+KYPH+ +GALA+SAP
Sbjct  168  PGAKNQPVIAVGGSYGGMLAAWFRMKYPHMVVGALAASAP  207



>ref|XP_003129755.3| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Sus scrofa]
 ref|XP_005667235.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Sus scrofa]
Length=493

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 117/160 (73%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y + Y  Q VDHF F  +  K F Q+YLI   HW+K GG +  YTGNEGDI WF  NTGF
Sbjct  44   YSIHYIQQKVDHFGF--NTDKTFKQRYLIADTHWRKDGGSILFYTGNEGDIIWFCNNTGF  101

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M D+A +  A+L+F EHR+YGES+PFG  S+K ++ L +L S+QALAD+A LIR LK+ +
Sbjct  102  MWDVAEELKAMLVFAEHRYYGESLPFGAHSFKDSRHLNFLTSEQALADFAELIRHLKRKI  161

Query  580  S-SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              +E  PV+  GGSYGGMLAAWFR+KYPH+ +GALASSAP
Sbjct  162  PGTENQPVIALGGSYGGMLAAWFRMKYPHMVVGALASSAP  201



>ref|NP_082519.1| lysosomal Pro-X carboxypeptidase precursor [Mus musculus]
 sp|Q7TMR0.2|PCP_MOUSE RecName: Full=Lysosomal Pro-X carboxypeptidase; AltName: Full=Proline 
carboxypeptidase; AltName: Full=Prolylcarboxypeptidase; 
Short=PRCP; Flags: Precursor [Mus musculus]
 dbj|BAC34716.1| unnamed protein product [Mus musculus]
 dbj|BAE20697.1| unnamed protein product [Mus musculus]
Length=491

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 119/160 (74%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y V YF Q VDHF F  +  + F Q+YL+   HWQ+ GG +  YTGNEGDI WF  NTGF
Sbjct  46   YSVLYFEQKVDHFGF--ADMRTFKQRYLVADKHWQRNGGSILFYTGNEGDIVWFCNNTGF  103

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M D+A +  A+L+F EHR+YGES+PFG+ S+K ++ L +L S+QALAD+A LIR L+K +
Sbjct  104  MWDVAEELKAMLVFAEHRYYGESLPFGQDSFKDSQHLNFLTSEQALADFAELIRHLEKTI  163

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              ++  PV+  GGSYGGMLAAWFR+KYPH+ +GALA+SAP
Sbjct  164  PGAQGQPVIAIGGSYGGMLAAWFRMKYPHIVVGALAASAP  203



>gb|AAH55022.1| Prcp protein [Mus musculus]
 dbj|BAE38679.1| unnamed protein product [Mus musculus]
Length=491

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 119/160 (74%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y V YF Q VDHF F  +  + F Q+YL+   HWQ+ GG +  YTGNEGDI WF  NTGF
Sbjct  46   YSVLYFEQKVDHFGF--ADMRTFKQRYLVADKHWQRNGGSILFYTGNEGDIVWFCNNTGF  103

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M D+A +  A+L+F EHR+YGES+PFG+ S+K ++ L +L S+QALAD+A LIR L+K +
Sbjct  104  MWDVAEELKAMLVFAEHRYYGESLPFGQDSFKDSQHLNFLTSEQALADFAELIRHLEKTI  163

Query  580  S-SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              ++  PV+  GGSYGGMLAAWFR+KYPH+ +GALA+SAP
Sbjct  164  PGAQGQPVIAIGGSYGGMLAAWFRMKYPHIVVGALAASAP  203



>ref|XP_008307030.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Cynoglossus semilaevis]
Length=496

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 117/160 (73%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHW-QKGGPMFVYTGNEGDIDWFAANTGF  399
            YE  YF Q +DHF F+  G   F Q+YL+   +W Q GGP+  YTGNEGDI WF  NTGF
Sbjct  48   YETLYFDQKIDHFGFVEDG--TFKQRYLVADKYWKQPGGPILFYTGNEGDIAWFCNNTGF  105

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M +IA +  A+L+F EHR+YGES+PFG+ S+   K L +L S+QALADYA+LI +LK+ L
Sbjct  106  MWEIAEELGAMLVFAEHRYYGESLPFGQDSHNDNKNLNFLTSEQALADYAVLIDNLKRTL  165

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              ++ SPV+  GGSYGGML+AW R+KYPH  +GALASSAP
Sbjct  166  PGAQHSPVIAIGGSYGGMLSAWLRMKYPHSVVGALASSAP  205



>ref|XP_004632660.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Octodon degus]
Length=571

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 118/160 (74%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y V YFPQ VDHF F  +  + F Q+YLI+  HW+K GG +  YTGNEGDI WF  NTGF
Sbjct  123  YSVLYFPQKVDHFGF--NNPRTFKQRYLISDKHWEKDGGSILFYTGNEGDIVWFCNNTGF  180

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M D+A +  A+L+F EHR+YGES+PFG  S+K ++ L +L S+QALAD+A LI+ L++ +
Sbjct  181  MWDVAEELKAMLVFAEHRYYGESLPFGADSFKDSRHLNFLTSEQALADFAELIKHLRRTI  240

Query  580  SS-EASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
               E  PV+  GGSYGGMLAAWFR+KYPH  +GALA+SAP
Sbjct  241  PGVEDQPVIAIGGSYGGMLAAWFRMKYPHAVVGALAASAP  280



>ref|XP_010738027.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Larimichthys crocea]
Length=497

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 118/160 (74%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y+  YF Q +DHF F+  G   F Q+YL+   HW K GGP+  YTGNEGDI WF  NTGF
Sbjct  49   YDTFYFDQKIDHFGFLEDG--TFKQRYLVADKHWHKPGGPILFYTGNEGDITWFCNNTGF  106

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M +IA +  A+L+F EHR+YGES+PFG  SY  +K L YL S+QALAD+A+LI+ +K  L
Sbjct  107  MWEIAEELGAMLVFAEHRYYGESLPFGPDSYSDSKHLNYLTSEQALADFAVLIQDMKSTL  166

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              ++ SPV+  GGSYGGML+AWFR+KYP++ +GALA+SAP
Sbjct  167  PGAQHSPVIAIGGSYGGMLSAWFRMKYPNIVVGALAASAP  206



>ref|XP_004763526.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Mustela 
putorius furo]
 ref|XP_004763527.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Mustela 
putorius furo]
 ref|XP_004763528.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X3 [Mustela 
putorius furo]
 ref|XP_004763529.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X4 [Mustela 
putorius furo]
 ref|XP_004763530.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X5 [Mustela 
putorius furo]
 ref|XP_004796005.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Mustela 
putorius furo]
 ref|XP_004796006.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Mustela 
putorius furo]
 ref|XP_004796007.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X3 [Mustela 
putorius furo]
 ref|XP_004796008.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X4 [Mustela 
putorius furo]
 ref|XP_004796009.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X5 [Mustela 
putorius furo]
Length=497

 Score =   194 bits (494),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 119/160 (74%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y V Y  Q VDHF F  S  K F Q+YLI   +W+K GG +  YTGNEGDI WF  NTGF
Sbjct  48   YSVHYIQQKVDHFGF--SADKTFKQRYLIADAYWKKNGGSILFYTGNEGDITWFCNNTGF  105

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M D+A +  A+L+F EHR+YGES+PFG +S++ ++ L +L S+QALAD+A+LI+ LKK +
Sbjct  106  MWDVADQLKAMLVFAEHRYYGESLPFGNKSFRDSRHLNFLTSEQALADFAVLIKHLKKTI  165

Query  580  -SSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
              ++  PV+  GGSYGGMLAAWFR+KYPH+ +GALA+SAP
Sbjct  166  PGAKNQPVIAIGGSYGGMLAAWFRMKYPHIVVGALAASAP  205



>ref|XP_005026125.1| PREDICTED: lysosomal Pro-X carboxypeptidase, partial [Anas platyrhynchos]
Length=452

 Score =   193 bits (491),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 118/160 (74%), Gaps = 4/160 (3%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQKYLINKDHWQK-GGPMFVYTGNEGDIDWFAANTGF  399
            Y  +Y  Q +DHF F  +    F Q+YLI   HW+K  GP+  YTGNEGDI WF  NTGF
Sbjct  7    YLTRYLSQQIDHFGFDEN--LTFQQRYLIADQHWKKDNGPILFYTGNEGDITWFCNNTGF  64

Query  400  MLDIAPKFHALLLFIEHRFYGESMPFGKQSYKSAKTLGYLNSQQALADYAILIRSLKKNL  579
            M D+A + +A+L+F EHR+YGES+PFG +S+  +K L YL S+QALAD+A+LI  LK+ +
Sbjct  65   MWDVAEELNAMLVFAEHRYYGESLPFGNESFSDSKHLNYLTSEQALADFAVLIEYLKETI  124

Query  580  S-SEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            + +  SPV+  GGSYGGMLAAWFR+KYPHV +GALA+SAP
Sbjct  125  AGARYSPVIAIGGSYGGMLAAWFRMKYPHVVVGALAASAP  164



>dbj|BAK01568.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=514

 Score =   194 bits (494),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 129/163 (79%), Gaps = 7/163 (4%)
 Frame = +1

Query  223  YEVQYFPQVVDHFSFIPSGYKIFYQ-KYLINKDHWQKGGP--MFVYTGNEGDIDWFAANT  393
            +E +YF Q +DHFSF  SG + F+Q +YL+ +     G    +F Y GNEGDI WFAAN+
Sbjct  52   FETRYFRQRLDHFSF--SGEEEFFQQRYLVGRAGGWAGPGGPIFFYCGNEGDIAWFAANS  109

Query  394  GFMLDIAPKFHALLLFIEHRFYGESMPFG--KQSYKSAKTLGYLNSQQALADYAILIRSL  567
            G + + AP+F AL++F EHR+YGESMPFG  +++Y S++++ YL ++QALADYA+L+  L
Sbjct  110  GLVWEAAPRFAALVVFAEHRYYGESMPFGSKEKAYNSSRSMAYLTAEQALADYAVLLTDL  169

Query  568  KKNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAP  696
            K+NLSSE+SPVV+FGGSYGGMLAAW RLKYPH+A+GALASSAP
Sbjct  170  KRNLSSESSPVVLFGGSYGGMLAAWMRLKYPHIAVGALASSAP  212



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1211687344902