BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6264

Length=816
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006342637.1|  PREDICTED: polyadenylate-binding protein 8-like    277   2e-84   
ref|XP_004252758.1|  PREDICTED: polyadenylate-binding protein 2-like    277   2e-84   Solanum lycopersicum
gb|AAF66825.1|  poly(A)-binding protein                                 272   3e-84   Nicotiana tabacum [American tobacco]
dbj|BAM15222.1|  poly(A)-binding protein                                273   1e-82   Nicotiana tabacum [American tobacco]
ref|XP_009782955.1|  PREDICTED: polyadenylate-binding protein 2-l...    272   2e-82   Nicotiana sylvestris
ref|XP_009782956.1|  PREDICTED: polyadenylate-binding protein 2-l...    272   2e-82   Nicotiana sylvestris
ref|XP_009606599.1|  PREDICTED: polyadenylate-binding protein 2-l...    272   2e-82   Nicotiana tomentosiformis
ref|XP_009606598.1|  PREDICTED: polyadenylate-binding protein 2-l...    272   2e-82   Nicotiana tomentosiformis
ref|XP_011074396.1|  PREDICTED: polyadenylate-binding protein 8-like    271   5e-82   Sesamum indicum [beniseed]
emb|CAJ38367.1|  polyA-binding protein                                  261   6e-82   Plantago major [cart-track plant]
ref|XP_011074395.1|  PREDICTED: polyadenylate-binding protein 8-like    268   7e-81   Sesamum indicum [beniseed]
ref|XP_009775186.1|  PREDICTED: polyadenylate-binding protein 2-like    263   5e-79   Nicotiana sylvestris
gb|AAK30205.1|AF349964_1  poly(A)-binding protein                       246   1e-72   Daucus carota [carrots]
ref|XP_009613515.1|  PREDICTED: polyadenylate-binding protein 2-like    244   5e-72   Nicotiana tomentosiformis
ref|XP_003544466.1|  PREDICTED: polyadenylate-binding protein 8-like    239   6e-70   Glycine max [soybeans]
ref|XP_007160868.1|  hypothetical protein PHAVU_001G023500g             237   2e-69   Phaseolus vulgaris [French bean]
gb|KHN12798.1|  Polyadenylate-binding protein 2                         235   2e-68   Glycine soja [wild soybean]
ref|XP_004499044.1|  PREDICTED: polyadenylate-binding protein 2-l...    234   2e-68   Cicer arietinum [garbanzo]
ref|XP_003550332.1|  PREDICTED: polyadenylate-binding protein 8-like    234   2e-68   Glycine max [soybeans]
ref|XP_011029544.1|  PREDICTED: polyadenylate-binding protein 2-like    224   2e-64   Populus euphratica
ref|XP_012068315.1|  PREDICTED: polyadenylate-binding protein 2-like    224   2e-64   
ref|XP_006374904.1|  hypothetical protein POPTR_0014s02550g             223   5e-64   Populus trichocarpa [western balsam poplar]
gb|ADE76290.1|  unknown                                                 212   5e-63   Picea sitchensis
gb|KDO84110.1|  hypothetical protein CISIN_1g006282mg                   216   1e-62   Citrus sinensis [apfelsine]
ref|XP_002510185.1|  polyadenylate-binding protein, putative            219   1e-62   Ricinus communis
gb|KDO84109.1|  hypothetical protein CISIN_1g006282mg                   216   7e-62   Citrus sinensis [apfelsine]
gb|KJB79366.1|  hypothetical protein B456_013G046000                    217   1e-61   Gossypium raimondii
ref|XP_008456143.1|  PREDICTED: polyadenylate-binding protein 8-l...    214   2e-61   Cucumis melo [Oriental melon]
ref|XP_002301171.2|  hypothetical protein POPTR_0002s12570g             216   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_006473293.1|  PREDICTED: polyadenylate-binding protein 8-like    215   5e-61   Citrus sinensis [apfelsine]
gb|KDO84107.1|  hypothetical protein CISIN_1g006282mg                   215   6e-61   Citrus sinensis [apfelsine]
ref|XP_008456142.1|  PREDICTED: polyadenylate-binding protein 2-l...    214   1e-60   Cucumis melo [Oriental melon]
ref|XP_011017176.1|  PREDICTED: polyadenylate-binding protein 8-like    213   3e-60   Populus euphratica
ref|XP_006434727.1|  hypothetical protein CICLE_v10000537mg             211   2e-59   Citrus clementina [clementine]
gb|KCW55175.1|  hypothetical protein EUGRSUZ_I01129                     205   9e-59   Eucalyptus grandis [rose gum]
ref|XP_004140705.1|  PREDICTED: polyadenylate-binding protein 8-like    209   9e-59   Cucumis sativus [cucumbers]
ref|XP_010028424.1|  PREDICTED: polyadenylate-binding protein 2         205   2e-57   Eucalyptus grandis [rose gum]
ref|XP_010519297.1|  PREDICTED: polyadenylate-binding protein 8-like    204   7e-57   Tarenaya hassleriana [spider flower]
gb|KJB58541.1|  hypothetical protein B456_009G214100                    203   1e-56   Gossypium raimondii
ref|NP_001061515.1|  Os08g0314800                                       202   2e-56   
ref|XP_010688794.1|  PREDICTED: polyadenylate-binding protein 2-like    201   6e-56   Beta vulgaris subsp. vulgaris [field beet]
gb|EEC77593.1|  hypothetical protein OsI_16552                          199   3e-55   Oryza sativa Indica Group [Indian rice]
emb|CAE02947.3|  OSJNBa0014K14.19                                       199   4e-55   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053248.1|  Os04g0504800                                       199   4e-55   
ref|XP_006659302.1|  PREDICTED: polyadenylate-binding protein 8-like    196   6e-54   Oryza brachyantha
gb|KJB14629.1|  hypothetical protein B456_002G134900                    193   6e-53   Gossypium raimondii
gb|KHG04753.1|  Polyadenylate-binding 2 -like protein                   191   2e-52   Gossypium arboreum [tree cotton]
dbj|BAJ97269.1|  predicted protein                                      190   6e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90169.1|  predicted protein                                      190   6e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT14398.1|  Polyadenylate-binding protein 2                         188   1e-51   
gb|EMS55649.1|  Polyadenylate-binding protein 2                         189   2e-51   Triticum urartu
gb|AAB38974.1|  poly(A)-binding protein                                 189   2e-51   Triticum aestivum [Canadian hard winter wheat]
gb|KJB14632.1|  hypothetical protein B456_002G134900                    188   3e-51   Gossypium raimondii
dbj|BAJ96406.1|  predicted protein                                      189   4e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001167831.1|  uncharacterized protein LOC100381531               176   9e-50   
tpg|DAA39543.1|  TPA: hypothetical protein ZEAMMB73_983793              172   1e-48   
ref|XP_006421219.1|  hypothetical protein CICLE_v10007158mg             176   6e-48   
emb|CDY62723.1|  BnaC03g77220D                                          178   8e-48   Brassica napus [oilseed rape]
ref|XP_009108756.1|  PREDICTED: polyadenylate-binding protein 2         178   9e-48   Brassica rapa
emb|CDY51957.1|  BnaA08g11610D                                          177   2e-47   Brassica napus [oilseed rape]
gb|KJB14633.1|  hypothetical protein B456_002G134900                    175   1e-46   Gossypium raimondii
ref|XP_003603074.1|  Poly(A)-binding protein                            174   4e-46   Medicago truncatula
gb|EPS62510.1|  hypothetical protein M569_12280                         171   1e-45   Genlisea aurea
ref|XP_008347611.1|  PREDICTED: polyadenylate-binding protein 8-like    160   3e-44   
ref|XP_002283105.1|  PREDICTED: polyadenylate-binding protein 2         164   9e-43   Vitis vinifera
ref|XP_010270544.1|  PREDICTED: polyadenylate-binding protein 2-l...    164   1e-42   Nelumbo nucifera [Indian lotus]
ref|XP_010270536.1|  PREDICTED: polyadenylate-binding protein 2-l...    164   1e-42   Nelumbo nucifera [Indian lotus]
ref|XP_009386708.1|  PREDICTED: polyadenylate-binding protein 2-l...    158   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386707.1|  PREDICTED: polyadenylate-binding protein 2-l...    158   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386706.1|  PREDICTED: polyadenylate-binding protein 2-l...    158   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386705.1|  PREDICTED: polyadenylate-binding protein 2-l...    158   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003529405.1|  PREDICTED: polyadenylate-binding protein 8-like    157   4e-40   Glycine max [soybeans]
gb|AAF66824.1|AF190656_1  poly(A)-binding protein                       152   5e-40   Nicotiana tabacum [American tobacco]
ref|NP_001292658.1|  polyadenylate-binding protein 2                    156   6e-40   Cucumis sativus [cucumbers]
gb|KGN43917.1|  hypothetical protein Csa_7G073530                       156   7e-40   Cucumis sativus [cucumbers]
ref|XP_006574897.1|  PREDICTED: polyadenylate-binding protein 8-like    156   9e-40   Glycine max [soybeans]
gb|KHN05826.1|  Polyadenylate-binding protein 2                         155   9e-40   Glycine soja [wild soybean]
ref|XP_008454965.1|  PREDICTED: polyadenylate-binding protein 2         155   1e-39   Cucumis melo [Oriental melon]
ref|XP_009600995.1|  PREDICTED: polyadenylate-binding protein 8-like    154   4e-39   Nicotiana tomentosiformis
ref|XP_009768210.1|  PREDICTED: polyadenylate-binding protein 8-like    154   4e-39   Nicotiana sylvestris
ref|XP_006346392.1|  PREDICTED: polyadenylate-binding protein 8-like    153   9e-39   Solanum tuberosum [potatoes]
ref|XP_010263472.1|  PREDICTED: polyadenylate-binding protein 2-like    152   1e-38   Nelumbo nucifera [Indian lotus]
gb|AFP74112.1|  poly-A binding protein                                  152   2e-38   Nicotiana benthamiana
gb|KJB29450.1|  hypothetical protein B456_005G101600                    152   2e-38   Gossypium raimondii
dbj|BAJ53195.1|  JHL03K20.4                                             152   3e-38   Jatropha curcas
ref|XP_007226962.1|  hypothetical protein PRUPE_ppa002618mg             151   5e-38   Prunus persica
ref|XP_008220252.1|  PREDICTED: polyadenylate-binding protein 2-like    150   6e-38   Prunus mume [ume]
ref|XP_009395913.1|  PREDICTED: polyadenylate-binding protein 2-like    150   7e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS61401.1|  hypothetical protein M569_13396                         149   9e-38   Genlisea aurea
ref|XP_002883899.1|  hypothetical protein ARALYDRAFT_899764             150   1e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_004230758.1|  PREDICTED: polyadenylate-binding protein 8-like    150   1e-37   Solanum lycopersicum
gb|EPS71660.1|  hypothetical protein M569_03099                         141   1e-37   Genlisea aurea
ref|XP_010093503.1|  Polyadenylate-binding protein 2                    150   1e-37   Morus notabilis
gb|KHG12838.1|  ELAV-like protein 2                                     150   1e-37   Gossypium arboreum [tree cotton]
gb|KJB79363.1|  hypothetical protein B456_013G046000                    149   2e-37   Gossypium raimondii
gb|KCW66377.1|  hypothetical protein EUGRSUZ_F00193                     148   2e-37   Eucalyptus grandis [rose gum]
gb|EYU36333.1|  hypothetical protein MIMGU_mgv1a002664mg                149   2e-37   Erythranthe guttata [common monkey flower]
ref|XP_002284923.1|  PREDICTED: polyadenylate-binding protein 8 i...    148   3e-37   Vitis vinifera
gb|KCW66375.1|  hypothetical protein EUGRSUZ_F00193                     148   4e-37   Eucalyptus grandis [rose gum]
ref|XP_009415843.1|  PREDICTED: polyadenylate-binding protein 2-like    148   4e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010059905.1|  PREDICTED: polyadenylate-binding protein 2-like    148   4e-37   Eucalyptus grandis [rose gum]
ref|XP_012079276.1|  PREDICTED: polyadenylate-binding protein 4-like    148   4e-37   Jatropha curcas
ref|XP_003589160.1|  Polyadenylate-binding protein                      148   6e-37   Medicago truncatula
ref|XP_006855143.1|  PREDICTED: polyadenylate-binding protein 2         147   1e-36   Amborella trichopoda
ref|XP_010928350.1|  PREDICTED: polyadenylate-binding protein 8-l...    147   1e-36   Elaeis guineensis
gb|KDO84108.1|  hypothetical protein CISIN_1g006282mg                   146   2e-36   Citrus sinensis [apfelsine]
ref|XP_010928349.1|  PREDICTED: polyadenylate-binding protein 2-l...    147   2e-36   Elaeis guineensis
gb|AAQ56324.1|  putative poly(A)-binding protein                        141   2e-36   Oryza sativa Japonica Group [Japonica rice]
gb|EEC83349.1|  hypothetical protein OsI_28748                          141   2e-36   Oryza sativa Indica Group [Indian rice]
gb|EEE68458.1|  hypothetical protein OsJ_26852                          141   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003573691.1|  PREDICTED: polyadenylate-binding protein 2-like    145   7e-36   Brachypodium distachyon [annual false brome]
gb|KJB32340.1|  hypothetical protein B456_005G236500                    145   7e-36   Gossypium raimondii
gb|KHG19377.1|  Polyadenylate-binding protein 1-like 2                  145   8e-36   Gossypium arboreum [tree cotton]
gb|EYU36334.1|  hypothetical protein MIMGU_mgv1a002624mg                144   9e-36   Erythranthe guttata [common monkey flower]
ref|XP_004956317.1|  PREDICTED: polyadenylate-binding protein 2-like    144   2e-35   Setaria italica
emb|CDP01307.1|  unnamed protein product                                143   2e-35   Coffea canephora [robusta coffee]
ref|XP_003576878.1|  PREDICTED: polyadenylate-binding protein 2-like    143   2e-35   Brachypodium distachyon [annual false brome]
ref|XP_010107907.1|  Polyadenylate-binding protein 2                    142   4e-35   Morus notabilis
ref|XP_008795896.1|  PREDICTED: polyadenylate-binding protein 2-like    142   6e-35   Phoenix dactylifera
gb|AAB61594.1|  poly(A)-binding protein                                 135   6e-35   Mesembryanthemum crystallinum
ref|XP_008788846.1|  PREDICTED: polyadenylate-binding protein 2-like    142   9e-35   Phoenix dactylifera
ref|XP_004499046.1|  PREDICTED: polyadenylate-binding protein 2-l...    141   1e-34   
gb|ABK94932.1|  unknown                                                 139   1e-34   Populus trichocarpa [western balsam poplar]
ref|XP_002313862.1|  polyadenylate-binding family protein               141   2e-34   
gb|EMT11581.1|  Polyadenylate-binding protein 2                         134   2e-34   
ref|XP_003607922.1|  Poly(A)-binding protein                            140   3e-34   Medicago truncatula
ref|XP_002518733.1|  polyadenylate-binding protein, putative            140   4e-34   Ricinus communis
emb|CDO97198.1|  unnamed protein product                                139   6e-34   Coffea canephora [robusta coffee]
emb|CDO97200.1|  unnamed protein product                                139   6e-34   Coffea canephora [robusta coffee]
ref|XP_007017178.1|  Poly(A) binding protein 8 isoform 1                139   1e-33   
gb|KJB40266.1|  hypothetical protein B456_007G054700                    138   1e-33   Gossypium raimondii
ref|XP_006422975.1|  hypothetical protein CICLE_v10027999mg             138   2e-33   Citrus clementina [clementine]
ref|NP_001168063.1|  uncharacterized protein LOC100381794               131   2e-33   
gb|EEE61291.1|  hypothetical protein OsJ_15377                          137   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|NP_564554.1|  poly(A) binding protein 8                             138   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb|KHG25571.1|  Polyadenylate-binding protein 1-like 2                  138   3e-33   Gossypium arboreum [tree cotton]
ref|XP_007047341.1|  Poly(A) binding protein 8                          137   4e-33   
ref|XP_002285190.1|  PREDICTED: polyadenylate-binding protein 2         137   4e-33   Vitis vinifera
ref|XP_008364810.1|  PREDICTED: polyadenylate-binding protein 8-like    137   4e-33   
gb|KJB40264.1|  hypothetical protein B456_007G054700                    137   5e-33   Gossypium raimondii
ref|XP_008393785.1|  PREDICTED: polyadenylate-binding protein 2-like    137   5e-33   
ref|XP_009359888.1|  PREDICTED: polyadenylate-binding protein 2-like    137   5e-33   Pyrus x bretschneideri [bai li]
gb|KJB40263.1|  hypothetical protein B456_007G054700                    137   5e-33   Gossypium raimondii
ref|XP_008378021.1|  PREDICTED: polyadenylate-binding protein 2-like    137   5e-33   
ref|XP_002300227.1|  polyadenylate-binding family protein               137   6e-33   Populus trichocarpa [western balsam poplar]
ref|XP_011000130.1|  PREDICTED: polyadenylate-binding protein 8-like    136   7e-33   Populus euphratica
ref|XP_006404818.1|  hypothetical protein EUTSA_v10000075mg             136   8e-33   Eutrema salsugineum [saltwater cress]
ref|XP_009408013.1|  PREDICTED: polyadenylate-binding protein 2-like    136   8e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002891531.1|  PAB8 binding protein 8                             135   2e-32   Arabidopsis lyrata subsp. lyrata
gb|KHG04776.1|  Polyadenylate-binding 2 -like protein                   134   3e-32   Gossypium arboreum [tree cotton]
ref|XP_004304018.1|  PREDICTED: polyadenylate-binding protein 8-like    135   3e-32   Fragaria vesca subsp. vesca
ref|XP_010906557.1|  PREDICTED: polyadenylate-binding protein 8-l...    134   3e-32   
ref|XP_007042478.1|  Poly(A) binding protein 8                          134   4e-32   
ref|XP_007201197.1|  hypothetical protein PRUPE_ppa002607mg             134   4e-32   Prunus persica
ref|XP_008236485.1|  PREDICTED: polyadenylate-binding protein 8         134   5e-32   Prunus mume [ume]
ref|XP_009398670.1|  PREDICTED: polyadenylate-binding protein 2-like    134   5e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001275799.1|  poly A-binding protein 2                           134   5e-32   Citrus sinensis [apfelsine]
dbj|BAJ53194.1|  JHL03K20.3                                             134   5e-32   Jatropha curcas
ref|XP_010906556.1|  PREDICTED: polyadenylate-binding protein 2-l...    134   5e-32   Elaeis guineensis
gb|KDO79129.1|  hypothetical protein CISIN_1g006290mg                   134   6e-32   Citrus sinensis [apfelsine]
ref|XP_006425947.1|  hypothetical protein CICLE_v10025109mg             134   6e-32   
ref|XP_006494495.1|  PREDICTED: polyadenylate-binding protein 4         134   6e-32   
ref|XP_006425948.1|  hypothetical protein CICLE_v10025109mg             134   6e-32   Citrus clementina [clementine]
ref|XP_010691731.1|  PREDICTED: polyadenylate-binding protein 2-like    134   7e-32   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAD94406.1|  putative poly(A) binding protein                       125   9e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010110808.1|  Polyadenylate-binding protein 2                    133   1e-31   Morus notabilis
tpg|DAA39541.1|  TPA: hypothetical protein ZEAMMB73_983793              133   1e-31   
tpg|DAA39542.1|  TPA: hypothetical protein ZEAMMB73_983793              133   1e-31   
ref|XP_008651618.1|  PREDICTED: uncharacterized protein LOC100381...    133   1e-31   
gb|AFK34295.1|  unknown                                                 123   2e-31   Medicago truncatula
gb|AFW58788.1|  hypothetical protein ZEAMMB73_448418                    126   3e-31   
ref|XP_010555994.1|  PREDICTED: polyadenylate-binding protein 8         132   3e-31   Tarenaya hassleriana [spider flower]
ref|XP_010530761.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    131   4e-31   Tarenaya hassleriana [spider flower]
ref|XP_007153579.1|  hypothetical protein PHAVU_003G0475001g            130   5e-31   Phaseolus vulgaris [French bean]
dbj|BAJ86310.1|  predicted protein                                      132   5e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK32750.1|  poly binding protein                                    131   5e-31   Arabis alpina [alpine rockcress]
gb|KHN22334.1|  Polyadenylate-binding protein 2                         130   7e-31   Glycine soja [wild soybean]
gb|EMT03423.1|  Polyadenylate-binding protein 2                         130   8e-31   
ref|XP_003525892.1|  PREDICTED: polyadenylate-binding protein 8-like    130   9e-31   Glycine max [soybeans]
gb|EMS47633.1|  Polyadenylate-binding protein 2                         130   1e-30   Triticum urartu
ref|XP_009147891.1|  PREDICTED: polyadenylate-binding protein 8         130   1e-30   Brassica rapa
ref|XP_006295403.1|  hypothetical protein CARUB_v10024499mg             130   1e-30   Capsella rubella
emb|CDY54068.1|  BnaCnng26160D                                          130   1e-30   Brassica napus [oilseed rape]
emb|CDX89562.1|  BnaC04g35810D                                          130   2e-30   
ref|XP_011000826.1|  PREDICTED: polyadenylate-binding protein 8-like    130   2e-30   Populus euphratica
ref|XP_003580095.1|  PREDICTED: polyadenylate-binding protein 2-like    130   2e-30   Brachypodium distachyon [annual false brome]
ref|XP_002448132.1|  hypothetical protein SORBIDRAFT_06g021850          129   3e-30   Sorghum bicolor [broomcorn]
ref|XP_012079275.1|  PREDICTED: polyadenylate-binding protein 4-like    129   3e-30   Jatropha curcas
ref|XP_010417088.1|  PREDICTED: polyadenylate-binding protein 4-like    129   4e-30   Camelina sativa [gold-of-pleasure]
ref|NP_001062583.1|  Os09g0115400                                       129   4e-30   
ref|XP_002878680.1|  PAB4 binding protein 4                             129   5e-30   Arabidopsis lyrata subsp. lyrata
ref|NP_001151785.1|  LOC100285420                                       129   5e-30   Zea mays [maize]
ref|NP_179916.1|  poly(A) binding protein 4                             128   8e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008663371.1|  PREDICTED: polyadenylate-binding protein 2-like    128   8e-30   
gb|AAK25927.1|AF360217_1  putative poly(A) binding protein              128   8e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526963.1|  PREDICTED: polyadenylate-binding protein 2-like    128   9e-30   Tarenaya hassleriana [spider flower]
ref|XP_006661030.1|  PREDICTED: polyadenylate-binding protein 8-like    127   9e-30   
ref|XP_011092553.1|  PREDICTED: polyadenylate-binding protein 2-like    127   2e-29   Sesamum indicum [beniseed]
emb|CDX71223.1|  BnaC07g05020D                                          127   2e-29   
gb|KHN04485.1|  Polyadenylate-binding protein 2                         125   4e-29   Glycine soja [wild soybean]
ref|XP_006393217.1|  hypothetical protein EUTSA_v10011289mg             126   5e-29   Eutrema salsugineum [saltwater cress]
ref|XP_003523956.1|  PREDICTED: polyadenylate-binding protein 8 i...    125   6e-29   Glycine max [soybeans]
ref|XP_006578033.1|  PREDICTED: polyadenylate-binding protein 8 i...    125   6e-29   Glycine max [soybeans]
ref|XP_006578034.1|  PREDICTED: polyadenylate-binding protein 8 i...    125   6e-29   Glycine max [soybeans]
ref|XP_008373847.1|  PREDICTED: polyadenylate-binding protein 8-like    125   6e-29   
gb|KFK35979.1|  hypothetical protein AALP_AA4G062600                    125   7e-29   Arabis alpina [alpine rockcress]
ref|XP_010531254.1|  PREDICTED: polyadenylate-binding protein 4         125   9e-29   Tarenaya hassleriana [spider flower]
gb|KFK40021.1|  hypothetical protein AALP_AA3G319900                    125   1e-28   Arabis alpina [alpine rockcress]
ref|XP_010429282.1|  PREDICTED: polyadenylate-binding protein 4         125   1e-28   Camelina sativa [gold-of-pleasure]
gb|EYU37653.1|  hypothetical protein MIMGU_mgv1a002809mg                124   1e-28   Erythranthe guttata [common monkey flower]
gb|EYU42687.1|  hypothetical protein MIMGU_mgv1a002746mg                124   2e-28   Erythranthe guttata [common monkey flower]
emb|CDY36634.1|  BnaA07g04230D                                          124   2e-28   Brassica napus [oilseed rape]
ref|XP_006409548.1|  hypothetical protein EUTSA_v10022589mg             124   2e-28   Eutrema salsugineum [saltwater cress]
ref|XP_009140459.1|  PREDICTED: polyadenylate-binding protein 4-like    124   3e-28   Brassica rapa
emb|CDY38939.1|  BnaA04g13600D                                          123   3e-28   Brassica napus [oilseed rape]
ref|XP_009119410.1|  PREDICTED: polyadenylate-binding protein 2         122   7e-28   Brassica rapa
ref|XP_010447142.1|  PREDICTED: polyadenylate-binding protein 2-like    120   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010432464.1|  PREDICTED: polyadenylate-binding protein 2-like    120   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010437669.1|  PREDICTED: polyadenylate-binding protein 2-like    120   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010432462.1|  PREDICTED: polyadenylate-binding protein 2-l...    120   6e-27   Camelina sativa [gold-of-pleasure]
emb|CDX75397.1|  BnaA01g03050D                                          119   6e-27   
gb|AID60122.1|  poly(A) binding protein 8                               119   7e-27   Brassica napus [oilseed rape]
ref|XP_006283328.1|  hypothetical protein CARUB_v10004368mg             119   1e-26   Capsella rubella
ref|XP_010447143.1|  PREDICTED: polyadenylate-binding protein 2         119   1e-26   Camelina sativa [gold-of-pleasure]
emb|CDX79295.1|  BnaC06g20080D                                          110   2e-26   
emb|CDX69025.1|  BnaC01g04280D                                          118   2e-26   
emb|CBI19489.3|  unnamed protein product                                118   3e-26   Vitis vinifera
pdb|2DYD|A  Chain A, Solution Structure Of The Pabc Domain From T...    109   3e-26   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002869174.1|  predicted protein                                  117   4e-26   
ref|XP_010527159.1|  PREDICTED: polyadenylate-binding protein 4-like    117   4e-26   Tarenaya hassleriana [spider flower]
ref|XP_009117148.1|  PREDICTED: polyadenylate-binding protein 2         116   8e-26   Brassica rapa
gb|KJB63885.1|  hypothetical protein B456_010G021800                    116   9e-26   Gossypium raimondii
dbj|BAD94856.1|  poly(A)-binding protein                                108   1e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KJB63886.1|  hypothetical protein B456_010G021800                    116   1e-25   Gossypium raimondii
ref|XP_006412276.1|  hypothetical protein EUTSA_v10024683mg             116   1e-25   
ref|XP_006412275.1|  hypothetical protein EUTSA_v10024683mg             115   1e-25   Eutrema salsugineum [saltwater cress]
emb|CDX89664.1|  BnaC03g45780D                                          115   2e-25   
ref|XP_006842170.1|  PREDICTED: polyadenylate-binding protein 5         115   2e-25   
emb|CBI19492.3|  unnamed protein product                                108   3e-25   Vitis vinifera
ref|XP_009136273.1|  PREDICTED: polyadenylate-binding protein 2-l...    114   4e-25   Brassica rapa
ref|XP_009136272.1|  PREDICTED: polyadenylate-binding protein 2-l...    114   5e-25   Brassica rapa
gb|KFK30042.1|  hypothetical protein AALP_AA7G209600                    114   6e-25   Arabis alpina [alpine rockcress]
gb|KHG16756.1|  Polyadenylate-binding 2 -like protein                   113   6e-25   Gossypium arboreum [tree cotton]
emb|CDY08990.1|  BnaC01g31010D                                          105   7e-25   Brassica napus [oilseed rape]
ref|XP_010261307.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    114   7e-25   
emb|CDY67364.1|  BnaA03g57630D                                          110   9e-25   Brassica napus [oilseed rape]
ref|XP_004978120.1|  PREDICTED: polyadenylate-binding protein 2-like    113   1e-24   
ref|XP_004291087.1|  PREDICTED: polyadenylate-binding protein 2-like    112   2e-24   Fragaria vesca subsp. vesca
ref|XP_011092554.1|  PREDICTED: polyadenylate-binding protein 2-like    112   3e-24   Sesamum indicum [beniseed]
emb|CAN61506.1|  hypothetical protein VITISV_011738                     110   3e-24   Vitis vinifera
ref|XP_007201196.1|  hypothetical protein PRUPE_ppa002584mg             111   6e-24   Prunus persica
ref|XP_002307526.2|  hypothetical protein POPTR_0005s22040g             110   1e-23   
ref|NP_195137.5|  polyadenylate-binding protein 2                       110   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAL86321.1|  putative poly(A)-binding protein                        110   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008237538.1|  PREDICTED: polyadenylate-binding protein 3-like    109   4e-23   
ref|XP_002987288.1|  hypothetical protein SELMODRAFT_269256             108   4e-23   Selaginella moellendorffii
ref|XP_008337230.1|  PREDICTED: polyadenylate-binding protein 3-like    107   2e-22   
emb|CBI32381.3|  unnamed protein product                                106   5e-22   Vitis vinifera
ref|XP_011044832.1|  PREDICTED: polyadenylate-binding protein 3-like    105   5e-22   Populus euphratica
ref|XP_002863435.1|  predicted protein                                  103   6e-22   
ref|XP_008787484.1|  PREDICTED: polyadenylate-binding protein 2-like    106   6e-22   
emb|CAN75447.1|  hypothetical protein VITISV_030926                     105   1e-21   Vitis vinifera
ref|XP_011459765.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    105   1e-21   Fragaria vesca subsp. vesca
ref|XP_010645822.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    104   2e-21   
emb|CBI29360.3|  unnamed protein product                                103   2e-21   Vitis vinifera
ref|XP_009335160.1|  PREDICTED: polyadenylate-binding protein 3         103   2e-21   
gb|AAT08650.1|  poly(A)-binding protein                               97.1    3e-21   Hyacinthus orientalis [common hyacinth]
ref|XP_001761821.1|  predicted protein                                97.8    3e-21   
gb|KCW66376.1|  hypothetical protein EUGRSUZ_F00193                     102   3e-21   Eucalyptus grandis [rose gum]
ref|XP_001779388.1|  predicted protein                                  103   4e-21   
ref|XP_010089427.1|  Polyadenylate-binding protein 3                    102   7e-21   
gb|KDO59773.1|  hypothetical protein CISIN_1g010577mg                   100   2e-20   Citrus sinensis [apfelsine]
gb|AGF69179.1|  polyadenylate-binding protein 2-like protein            100   2e-20   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009342699.1|  PREDICTED: polyadenylate-binding protein 3         100   2e-20   Pyrus x bretschneideri [bai li]
ref|XP_002985732.1|  hypothetical protein SELMODRAFT_122762             100   3e-20   
ref|XP_002974435.1|  hypothetical protein SELMODRAFT_101161             100   3e-20   
ref|XP_001780529.1|  predicted protein                                  100   4e-20   
ref|XP_001770548.1|  predicted protein                                  100   5e-20   
ref|XP_004496416.1|  PREDICTED: polyadenylate-binding protein 3-l...  99.8    5e-20   Cicer arietinum [garbanzo]
ref|XP_004496415.1|  PREDICTED: polyadenylate-binding protein 3-l...  99.8    6e-20   
ref|XP_004505404.1|  PREDICTED: polyadenylate-binding protein 2-like  99.8    6e-20   
gb|EYU24331.1|  hypothetical protein MIMGU_mgv1a025142mg              99.8    6e-20   
ref|XP_008793488.1|  PREDICTED: polyadenylate-binding protein 3       99.4    8e-20   
ref|XP_002527095.1|  polyadenylate-binding protein, putative          99.4    9e-20   
gb|AFG69765.1|  hypothetical protein CL4424Contig1_01                 91.3    1e-19   
emb|CDY67921.1|  BnaC08g49200D                                        98.6    1e-19   
ref|XP_002960874.1|  hypothetical protein SELMODRAFT_21095            98.2    2e-19   
gb|AEW09165.1|  hypothetical protein CL4424Contig1_01                 90.1    3e-19   
ref|XP_009402160.1|  PREDICTED: polyadenylate-binding protein 5-like  97.1    4e-19   
gb|KDO83840.1|  hypothetical protein CISIN_1g006641mg                 97.1    4e-19   
ref|XP_006434548.1|  hypothetical protein CICLE_v10003530mg           97.1    5e-19   
gb|ABF13311.1|  poly-A binding protein                                91.7    7e-19   
ref|XP_008456718.1|  PREDICTED: polyadenylate-binding protein 3       96.3    1e-18   
ref|XP_006473877.1|  PREDICTED: polyadenylate-binding protein 3-like  95.1    2e-18   
gb|KEH43623.1|  polyadenylate-binding protein                         94.7    2e-18   
gb|KJB79365.1|  hypothetical protein B456_013G046000                  94.4    3e-18   
ref|XP_010915083.1|  PREDICTED: polyadenylate-binding protein 3       94.7    3e-18   
ref|XP_002300896.1|  Polyadenylate-binding protein 5                  94.7    3e-18   
ref|XP_007140277.1|  hypothetical protein PHAVU_008G098700g           94.4    3e-18   
ref|XP_010540373.1|  PREDICTED: polyadenylate-binding protein 2-like  94.7    3e-18   
gb|ABC47858.1|  poly(A)-binding protein                               87.0    3e-18   
emb|CDX92325.1|  BnaA05g20820D                                        92.0    4e-18   
gb|AAK51123.1|  polyadenylated mRNA-binding protein 2                 93.6    4e-18   
ref|XP_009608720.1|  PREDICTED: polyadenylate-binding protein 3       94.4    4e-18   
ref|XP_007017179.1|  Poly(A) binding protein 8 isoform 2              92.8    5e-18   
ref|XP_009117286.1|  PREDICTED: polyadenylate-binding protein 4-like  94.0    5e-18   
emb|CDY46079.1|  BnaA09g42030D                                        94.0    6e-18   
ref|XP_006279092.1|  hypothetical protein CARUB_v10012708mg           93.2    7e-18   
ref|XP_011026320.1|  PREDICTED: polyadenylate-binding protein 3       93.6    8e-18   
ref|XP_011042916.1|  PREDICTED: polyadenylate-binding protein 3-like  93.2    8e-18   
ref|XP_010314905.1|  PREDICTED: polyadenylate-binding protein 3 i...  93.2    9e-18   
ref|XP_004253267.1|  PREDICTED: polyadenylate-binding protein 3 i...  93.2    9e-18   
gb|KJB32341.1|  hypothetical protein B456_005G236500                  92.8    1e-17   
ref|XP_006359024.1|  PREDICTED: polyadenylate-binding protein 3-like  92.4    2e-17   
ref|XP_011100720.1|  PREDICTED: polyadenylate-binding protein 3       92.4    2e-17   
ref|XP_009786468.1|  PREDICTED: polyadenylate-binding protein 3-l...  92.0    2e-17   
ref|XP_009786467.1|  PREDICTED: polyadenylate-binding protein 3-l...  92.0    2e-17   
ref|XP_010681423.1|  PREDICTED: polyadenylate-binding protein 5       90.9    5e-17   
gb|KJB63884.1|  hypothetical protein B456_010G021800                  89.7    7e-17   
gb|KJB40265.1|  hypothetical protein B456_007G054700                  89.7    8e-17   
ref|XP_007019672.1|  Polyadenylate-binding protein 3-binding prot...  90.1    1e-16   
emb|CAN82615.1|  hypothetical protein VITISV_036127                   82.8    1e-16   
gb|KJB14631.1|  hypothetical protein B456_002G134900                  88.2    3e-16   
ref|XP_007011217.1|  Poly(A) binding 8-like protein                   84.7    4e-16   
emb|CAA81127.1|  poly(A)-mRNA binding protein                         87.8    5e-16   
gb|KJB66300.1|  hypothetical protein B456_010G134400                  87.4    8e-16   
ref|XP_010415886.1|  PREDICTED: polyadenylate-binding protein 5-like  87.0    1e-15   
gb|KJB63883.1|  hypothetical protein B456_010G021800                  86.3    1e-15   
ref|XP_010925352.1|  PREDICTED: polyadenylate-binding protein 2-like  86.7    1e-15   
emb|CDX79296.1|  BnaC06g20070D                                        82.4    1e-15   
ref|XP_010471184.1|  PREDICTED: polyadenylate-binding protein 5 i...  86.7    2e-15   
ref|XP_010471183.1|  PREDICTED: polyadenylate-binding protein 5 i...  86.7    2e-15   
ref|XP_003556172.1|  PREDICTED: polyadenylate-binding protein 3-l...  85.9    2e-15   
ref|XP_012074453.1|  PREDICTED: polyadenylate-binding protein 3       85.9    2e-15   
ref|XP_006406511.1|  hypothetical protein EUTSA_v10021822mg           79.7    3e-15   
gb|AFX97758.1|  poly(A)-binding protein                               78.2    4e-15   
ref|XP_007143593.1|  hypothetical protein PHAVU_007G084800g           84.7    5e-15   
ref|XP_006599461.1|  PREDICTED: polyadenylate-binding protein 3-like  84.3    6e-15   
ref|XP_010428010.1|  PREDICTED: polyadenylate-binding protein 5-l...  84.7    6e-15   
ref|XP_010428009.1|  PREDICTED: polyadenylate-binding protein 5-l...  84.7    6e-15   
gb|KHN32825.1|  Polyadenylate-binding protein 2                       84.7    6e-15   
emb|CDY37229.1|  BnaA09g08500D                                        80.9    7e-15   
ref|XP_010462849.1|  PREDICTED: polyadenylate-binding protein 3-like  80.9    7e-15   
ref|XP_006406509.1|  hypothetical protein EUTSA_v10021769mg           79.0    8e-15   
ref|XP_002888846.1|  hypothetical protein ARALYDRAFT_339396           84.3    9e-15   
emb|CEF98830.1|  Polyadenylate-binding protein/Hyperplastic disc ...  83.6    1e-14   
ref|XP_010549244.1|  PREDICTED: polyadenylate-binding protein 8-l...  82.4    1e-14   
ref|XP_010549245.1|  PREDICTED: polyadenylate-binding protein 8-l...  82.4    1e-14   
emb|CAN78155.1|  hypothetical protein VITISV_032623                   83.6    1e-14   
ref|XP_006406512.1|  hypothetical protein EUTSA_v10020750mg           82.8    1e-14   
ref|XP_010549241.1|  PREDICTED: polyadenylate-binding protein 8-l...  82.8    2e-14   
ref|XP_010477542.1|  PREDICTED: polyadenylate-binding protein 3       82.8    2e-14   
ref|XP_010498759.1|  PREDICTED: polyadenylate-binding protein 3-l...  82.8    2e-14   
ref|XP_010460042.1|  PREDICTED: polyadenylate-binding protein 3-like  82.4    3e-14   
ref|XP_002890531.1|  PAB3 binding protein 3                           82.0    5e-14   
ref|XP_006304937.1|  hypothetical protein CARUB_v10011423mg           81.6    6e-14   
ref|XP_010521107.1|  PREDICTED: polyadenylate-binding protein 3 i...  80.9    1e-13   
ref|XP_010521108.1|  PREDICTED: polyadenylate-binding protein 3 i...  80.5    1e-13   
ref|XP_006390745.1|  hypothetical protein EUTSA_v10018219mg           80.1    2e-13   
gb|KFK44367.1|  hypothetical protein AALP_AA1G248100                  80.1    2e-13   
ref|XP_007513597.1|  predicted protein                                79.7    2e-13   
ref|XP_001418998.1|  predicted protein                                79.3    2e-13   
gb|EYU42686.1|  hypothetical protein MIMGU_mgv1a023047mg              79.3    3e-13   
gb|EPS71718.1|  hypothetical protein M569_03039                       79.3    3e-13   
gb|AAN15424.1|  Strong similarity to poly(A)-binding protein (PABP5)  78.2    4e-13   
gb|AFI57844.1|  polyA binding protein                                 77.8    4e-13   
emb|CDX91689.1|  BnaC08g06080D                                        77.0    4e-13   
emb|CDY37935.1|  BnaC02g20760D                                        78.6    5e-13   
gb|AAG02117.1|AF293840_1  poly(A) binding protein                     78.6    5e-13   
ref|NP_173690.1|  polyadenylate-binding protein 3                     78.6    5e-13   
ref|XP_004140947.2|  PREDICTED: polyadenylate-binding protein 3       78.6    5e-13   
gb|AAC25510.1|  Strong similarity to gb|M97657 poly(A)-binding pr...  78.6    6e-13   
gb|KGN46101.1|  hypothetical protein Csa_6G052760                     78.6    6e-13   
gb|AAF43230.1|AC012654_14  Identical to the polyadenylate-binding...  78.2    7e-13   
ref|NP_177322.2|  polyadenylate-binding protein 5                     78.2    7e-13   
gb|ACJ85797.1|  unknown                                               77.8    8e-13   
ref|XP_003055549.1|  predicted protein                                77.8    1e-12   
emb|CDY36684.1|  BnaCnng07860D                                        77.8    1e-12   
emb|CDY41472.1|  BnaA08g20740D                                        77.4    1e-12   
ref|XP_009110128.1|  PREDICTED: polyadenylate-binding protein 3       77.4    1e-12   
emb|CDX68303.1|  BnaA07g23430D                                        77.0    2e-12   
gb|KFK41598.1|  hypothetical protein AALP_AA2G149300                  77.0    2e-12   
ref|XP_009104896.1|  PREDICTED: polyadenylate-binding protein 5-like  77.0    2e-12   
ref|XP_004292808.1|  PREDICTED: NAC domain-containing protein 66-...  75.9    2e-12   
emb|CDX72826.1|  BnaC06g32740D                                        76.3    3e-12   
gb|EEE65951.1|  hypothetical protein OsJ_21832                        76.3    4e-12   
dbj|BAD32907.1|  putative polyadenylate-binding protein               75.9    4e-12   
gb|EAZ01506.1|  hypothetical protein OsI_23538                        75.9    4e-12   
ref|XP_009105835.1|  PREDICTED: polyadenylate-binding protein 5       75.9    4e-12   
emb|CDX96344.1|  BnaA07g29550D                                        75.9    4e-12   
ref|XP_003519971.2|  PREDICTED: polyadenylate-binding protein 3-like  75.9    5e-12   
ref|NP_001057963.1|  Os06g0589700                                     75.1    5e-12   
gb|AGT16777.1|  hypothetical protein SHCRBa_152_D05_F_250             75.1    6e-12   
gb|AAA32832.1|  poly(A)-binding protein                               75.1    7e-12   
gb|AAQ56342.1|  putative poly(A)-binding protein                      74.7    9e-12   
emb|CDY03685.1|  BnaA02g15520D                                        74.7    9e-12   
ref|XP_002438617.1|  hypothetical protein SORBIDRAFT_10g022900        73.9    2e-11   
ref|XP_002503581.1|  predicted protein                                73.9    2e-11   
ref|XP_002294914.1|  polyadenlyte binding protein                     72.4    6e-11   
ref|XP_006301512.1|  hypothetical protein CARUB_v10021938mg           72.0    7e-11   
gb|EJK57169.1|  hypothetical protein THAOC_22818                      68.6    8e-11   
gb|EAX07261.1|  poly(A) binding protein, cytoplasmic 4 (inducible...  67.4    9e-11   
emb|CAN82975.1|  hypothetical protein VITISV_026120                   68.9    9e-11   
ref|XP_004266769.1|  PREDICTED: polyadenylate-binding protein 4-like  67.4    1e-10   
ref|XP_005534990.1|  polyadenylate-binding protein                    71.6    1e-10   
gb|EPB83095.1|  hypothetical protein HMPREF1544_10184                 71.2    1e-10   
ref|XP_007164842.1|  PREDICTED: polyadenylate-binding protein 4-like  67.4    1e-10   
pdb|3KUR|A  Chain A, Crystal Structure Of The Mlle Domain Of Poly...  66.2    1e-10   
pdb|1JGN|A  Chain A, Solution Structure Of The C-Terminal Pabc Do...  66.6    1e-10   
pdb|2X04|A  Chain A, Crystal Structure Of The Pabc-Tnrc6c Complex     65.9    1e-10   
ref|NP_001005062.1|  embryonic polyadenylate-binding protein          71.2    1e-10   
gb|KGG51518.1|  hypothetical protein DI09_32p30                       71.2    1e-10   
ref|XP_009041134.1|  hypothetical protein AURANDRAFT_70409            70.9    2e-10   
pdb|3KUS|A  Chain A, Crystal Structure Of The Mlle Domain Of Poly...  66.2    2e-10   
gb|ABQ22585.1|  polyadenylate-binding protein 4-like protein          67.0    2e-10   
emb|CDX82300.1|  BnaA03g35210D                                        66.6    2e-10   
pdb|2RQG|B  Chain B, Structure Of Gspt1ERF3A-Pabc                     65.5    2e-10   
pdb|3PTH|A  Chain A, The Pabc1 Mlle Domain Bound To The Variant P...  65.5    2e-10   
gb|EJK49989.1|  hypothetical protein THAOC_31088                      70.5    2e-10   
ref|XP_008946692.1|  PREDICTED: polyadenylate-binding protein 1       66.6    3e-10   
dbj|BAE36770.1|  unnamed protein product                              68.2    3e-10   
dbj|BAC56450.1|  similar to poly(A)-binding protein 1                 66.6    3e-10   
gb|AAD37807.1|  poly(A)-binding protein                               67.4    3e-10   
dbj|BAK62140.1|  polyadenylate-binding protein 4                      68.6    3e-10   
pdb|1G9L|A  Chain A, Solution Structure Of The Pabc Domain Of Hum...  66.6    3e-10   
gb|KJB14634.1|  hypothetical protein B456_002G134900                  69.7    3e-10   
ref|XP_009045956.1|  hypothetical protein LOTGIDRAFT_137449           70.1    3e-10   
ref|XP_011094453.1|  PREDICTED: polyadenylate-binding protein 7       70.1    3e-10   
ref|XP_006788161.1|  PREDICTED: polyadenylate-binding protein 1-like  65.9    3e-10   
gb|ACY30440.1|  poly(A)-binding protein                               65.5    4e-10   
gb|EMT11582.1|  Polyadenylate-binding protein 2                       69.7    4e-10   
dbj|BAE35896.1|  unnamed protein product                              67.8    4e-10   
ref|XP_005907837.1|  PREDICTED: polyadenylate-binding protein 4-like  68.6    4e-10   
ref|XP_007527155.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    4e-10   
ref|XP_007527156.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    4e-10   
gb|AEM37675.1|  molicular identification of Poly A binding protein    66.6    4e-10   
ref|XP_009789806.1|  PREDICTED: polyadenylate-binding protein 7-like  69.7    4e-10   
ref|XP_002883174.1|  predicted protein                                65.5    5e-10   
ref|XP_002824146.2|  PREDICTED: polyadenylate-binding protein 3       69.3    5e-10   
ref|XP_008538220.1|  PREDICTED: polyadenylate-binding protein 4       65.1    5e-10   
ref|XP_001365269.1|  PREDICTED: polyadenylate-binding protein 4       69.3    5e-10   
gb|ABB92428.1|  PABP3                                                 69.3    5e-10   
ref|XP_003765434.1|  PREDICTED: polyadenylate-binding protein 4       69.3    6e-10   
ref|XP_011101467.1|  PREDICTED: polyadenylate-binding protein 7-like  69.3    6e-10   
gb|ABB92431.1|  PABP3                                                 69.3    6e-10   
ref|XP_006745961.1|  PREDICTED: polyadenylate-binding protein 1-like  67.8    6e-10   
ref|XP_005704169.1|  poly(A) binding / translation initiation factor  69.3    6e-10   
gb|EWM30606.1|  poly binding protein 8                                68.2    6e-10   
gb|AGT16204.1|  poly(A)-binding protein                               65.1    6e-10   
gb|EDL75007.1|  rCG64099                                              68.2    7e-10   
ref|XP_004450673.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    7e-10   
ref|XP_004450672.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    7e-10   
ref|XP_004450675.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    7e-10   
dbj|BAE22747.1|  unnamed protein product                              68.9    7e-10   
gb|ADX97143.1|  polyadenylate-binding protein 1                       67.4    7e-10   
gb|AEG78330.1|  poly A binding protein, cytoplasmic 1 b               66.6    7e-10   
ref|XP_004450667.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    7e-10   
ref|XP_004450666.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    7e-10   
dbj|BAD92199.1|  PABPC4 protein variant                               68.6    8e-10   
ref|XP_004332635.1|  PREDICTED: LOW QUALITY PROTEIN: poly(A) bind...  68.9    8e-10   
gb|ERE85613.1|  polyadenylate-binding protein 4                       68.9    8e-10   
ref|XP_004450674.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    8e-10   
dbj|BAD96637.1|  PABPC4 protein variant                               68.6    8e-10   
ref|XP_011238800.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    8e-10   
ref|XP_008564078.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    8e-10   
gb|KFO32509.1|  Polyadenylate-binding protein 4                       68.9    8e-10   
ref|XP_004266461.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    8e-10   
ref|XP_005395301.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    8e-10   
gb|EPQ09237.1|  Polyadenylate-binding protein 4                       68.9    9e-10   
ref|XP_008052559.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_004266460.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_003989935.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_003415567.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_005628961.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
gb|EHH49800.1|  hypothetical protein EGM_00521                        68.9    9e-10   
ref|XP_011934739.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.6    9e-10   
gb|ELK19486.1|  Polyadenylate-binding protein 4                       68.9    9e-10   
ref|XP_008834424.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_006904016.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_008052557.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_005628958.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_005395300.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_005543927.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_004450671.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.6    9e-10   
ref|XP_005868703.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_003415566.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_006503085.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_006992307.1|  PREDICTED: polyadenylate-binding protein 4       68.9    9e-10   
ref|XP_006188091.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_005607239.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_010624186.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.6    9e-10   
ref|XP_004450668.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.6    9e-10   
ref|XP_005543925.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_007950869.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_007198714.1|  PREDICTED: LOW QUALITY PROTEIN: poly(A) bind...  68.9    9e-10   
ref|XP_011761903.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_005868702.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_003273358.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_010801966.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   
ref|XP_009250385.1|  PREDICTED: polyadenylate-binding protein 4 i...  68.9    9e-10   



>ref|XP_006342637.1| PREDICTED: polyadenylate-binding protein 8-like [Solanum tuberosum]
Length=665

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 218/252 (87%), Positives = 237/252 (94%), Gaps = 5/252 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM PSLAPR+P+YPPGAPG+ QQLFYGQGPPA+IPPQAGFGYQQQLVPGMR
Sbjct  414  AQFSQLRPVAMPPSLAPRMPIYPPGAPGIGQQLFYGQGPPALIPPQAGFGYQQQLVPGMR  473

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFF+PMVQQGQQ  RPGGRRGAGPVQQ+QQP+PLMQQQM+PRGRMYRYP GRN
Sbjct  474  PGGAPMPNFFMPMVQQGQQGQRPGGRRGAGPVQQSQQPMPLMQQQMMPRGRMYRYPPGRN  533

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            V DGPMPGV GGM+S+PYDMGGMLPRDAA   PVPI+ LA+ALANAPPEQQRTMLGE+LY
Sbjct  534  VPDGPMPGVAGGMLSVPYDMGGMLPRDAAMGQPVPISTLATALANAPPEQQRTMLGESLY  593

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQA-KIPADQ  112
            PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKV+EA++VLRNVQQA   PADQ
Sbjct  594  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKVSEAMDVLRNVQQATSSPADQ  653

Query  111  LASLSLNDNLVA  76
            LASLSLNDNLV+
Sbjct  654  LASLSLNDNLVS  665



>ref|XP_004252758.1| PREDICTED: polyadenylate-binding protein 2-like [Solanum lycopersicum]
Length=666

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 218/253 (86%), Positives = 237/253 (94%), Gaps = 6/253 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM PSLAPR+P+YPPGAPG+ QQLFYGQGPPA+IPPQAGFGYQQQLVPGMR
Sbjct  414  AQFSQLRPVAMPPSLAPRMPIYPPGAPGIGQQLFYGQGPPALIPPQAGFGYQQQLVPGMR  473

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFF+PMVQQGQQ  RPGGRRGAGPVQQ+QQP+PLMQQQM+PRGRMYRYP GRN
Sbjct  474  PGGAPMPNFFMPMVQQGQQGQRPGGRRGAGPVQQSQQPMPLMQQQMMPRGRMYRYPPGRN  533

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGENL  292
            V DGPMPGV GGM+S+PYDMGGMLPRDAA    PVPI+ LA+ALANAPPEQQRTMLGE+L
Sbjct  534  VPDGPMPGVAGGMLSVPYDMGGMLPRDAAAMGQPVPISTLATALANAPPEQQRTMLGESL  593

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQA-KIPAD  115
            YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKV+EA++VLRNVQQA   PAD
Sbjct  594  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKVSEAMDVLRNVQQATSSPAD  653

Query  114  QLASLSLNDNLVA  76
            QLASLSLNDNLV+
Sbjct  654  QLASLSLNDNLVS  666



>gb|AAF66825.1| poly(A)-binding protein [Nicotiana tabacum]
Length=479

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 217/251 (86%), Positives = 235/251 (94%), Gaps = 4/251 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM PSLAPR+P+YPPGAPG+ QQLFYGQGPPA+IPPQAGFGYQQQLVPGMR
Sbjct  229  AQFSQLRPVAMPPSLAPRMPIYPPGAPGIGQQLFYGQGPPAMIPPQAGFGYQQQLVPGMR  288

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFF+P+VQQGQQ  RPGGRRGAGPVQQTQQP+PLMQQQMLPRGRMYRYP GRN
Sbjct  289  PGGAPMPNFFMPLVQQGQQGQRPGGRRGAGPVQQTQQPMPLMQQQMLPRGRMYRYPPGRN  348

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
              +GPMPGV GGM+S+PYDMGGMLPRD+A   P+PI+ LASALANAPPEQQRTMLGE+LY
Sbjct  349  GPEGPMPGVPGGMLSVPYDMGGMLPRDSAMGQPMPISTLASALANAPPEQQRTMLGESLY  408

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQL  109
            PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNVQQ   PADQL
Sbjct  409  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVQQTTNPADQL  468

Query  108  ASLSLNDNLVA  76
            ASLSLNDNLV+
Sbjct  469  ASLSLNDNLVS  479



>dbj|BAM15222.1| poly(A)-binding protein [Nicotiana tabacum]
Length=657

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 217/251 (86%), Positives = 235/251 (94%), Gaps = 4/251 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM PSLAPR+P+YPPGAPG+ QQLFYGQGPPA+IPPQAGFGYQQQLVPGMR
Sbjct  407  AQFSQLRPVAMPPSLAPRMPIYPPGAPGIGQQLFYGQGPPAMIPPQAGFGYQQQLVPGMR  466

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFF+P+VQQGQQ  RPGGRRGAGPVQQTQQP+PLMQQQMLPRGRMYRYP GRN
Sbjct  467  PGGAPMPNFFMPLVQQGQQGQRPGGRRGAGPVQQTQQPMPLMQQQMLPRGRMYRYPPGRN  526

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
              +GPMPGV GGM+S+PYDMGGMLPRD+A   P+PI+ LASALANAPPEQQRTMLGE+LY
Sbjct  527  GPEGPMPGVPGGMLSVPYDMGGMLPRDSAMGQPMPISTLASALANAPPEQQRTMLGESLY  586

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQL  109
            PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNVQQ   PADQL
Sbjct  587  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVQQTTNPADQL  646

Query  108  ASLSLNDNLVA  76
            ASLSLNDNLV+
Sbjct  647  ASLSLNDNLVS  657



>ref|XP_009782955.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Nicotiana 
sylvestris]
Length=661

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 217/251 (86%), Positives = 235/251 (94%), Gaps = 4/251 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM PSLAPR+P+YPPGAPG+ QQLFYGQGPPA+IPPQAGFGYQQQLVPGMR
Sbjct  411  AQFSQLRPVAMPPSLAPRMPIYPPGAPGIGQQLFYGQGPPAMIPPQAGFGYQQQLVPGMR  470

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFF+P+VQQGQQ  RPGGRRGAGPVQQTQQP+PLMQQQMLPRGRMYRYP GRN
Sbjct  471  PGGAPMPNFFMPLVQQGQQGQRPGGRRGAGPVQQTQQPMPLMQQQMLPRGRMYRYPPGRN  530

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
              +GPMPGV GGM+S+PYDMGGMLPRD+A   P+PI+ LASALANAPPEQQRTMLGE+LY
Sbjct  531  GPEGPMPGVPGGMLSVPYDMGGMLPRDSAMGQPMPISTLASALANAPPEQQRTMLGESLY  590

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQL  109
            PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNVQQ   PADQL
Sbjct  591  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVQQTASPADQL  650

Query  108  ASLSLNDNLVA  76
            ASLSLNDNLV+
Sbjct  651  ASLSLNDNLVS  661



>ref|XP_009782956.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Nicotiana 
sylvestris]
Length=658

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 217/251 (86%), Positives = 235/251 (94%), Gaps = 4/251 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM PSLAPR+P+YPPGAPG+ QQLFYGQGPPA+IPPQAGFGYQQQLVPGMR
Sbjct  408  AQFSQLRPVAMPPSLAPRMPIYPPGAPGIGQQLFYGQGPPAMIPPQAGFGYQQQLVPGMR  467

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFF+P+VQQGQQ  RPGGRRGAGPVQQTQQP+PLMQQQMLPRGRMYRYP GRN
Sbjct  468  PGGAPMPNFFMPLVQQGQQGQRPGGRRGAGPVQQTQQPMPLMQQQMLPRGRMYRYPPGRN  527

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
              +GPMPGV GGM+S+PYDMGGMLPRD+A   P+PI+ LASALANAPPEQQRTMLGE+LY
Sbjct  528  GPEGPMPGVPGGMLSVPYDMGGMLPRDSAMGQPMPISTLASALANAPPEQQRTMLGESLY  587

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQL  109
            PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNVQQ   PADQL
Sbjct  588  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVQQTASPADQL  647

Query  108  ASLSLNDNLVA  76
            ASLSLNDNLV+
Sbjct  648  ASLSLNDNLVS  658



>ref|XP_009606599.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=657

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 217/251 (86%), Positives = 235/251 (94%), Gaps = 4/251 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM PSLAPR+P+YPPGAPG+ QQLFYGQGPPA+IPPQAGFGYQQQLVPGMR
Sbjct  407  AQFSQLRPVAMPPSLAPRMPIYPPGAPGIGQQLFYGQGPPAMIPPQAGFGYQQQLVPGMR  466

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFF+P+VQQGQQ  RPGGRRGAGPVQQTQQP+PLMQQQMLPRGRMYRYP GRN
Sbjct  467  PGGAPMPNFFMPLVQQGQQGQRPGGRRGAGPVQQTQQPMPLMQQQMLPRGRMYRYPPGRN  526

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
              +GPMPGV GGM+S+PYDMGGMLPRD+A   P+PI+ LASALANAPPEQQRTMLGE+LY
Sbjct  527  GPEGPMPGVPGGMLSVPYDMGGMLPRDSAMGQPMPISTLASALANAPPEQQRTMLGESLY  586

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQL  109
            PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNVQQ   PADQL
Sbjct  587  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVQQTANPADQL  646

Query  108  ASLSLNDNLVA  76
            ASLSLNDNLV+
Sbjct  647  ASLSLNDNLVS  657



>ref|XP_009606598.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=660

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 217/251 (86%), Positives = 235/251 (94%), Gaps = 4/251 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM PSLAPR+P+YPPGAPG+ QQLFYGQGPPA+IPPQAGFGYQQQLVPGMR
Sbjct  410  AQFSQLRPVAMPPSLAPRMPIYPPGAPGIGQQLFYGQGPPAMIPPQAGFGYQQQLVPGMR  469

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFF+P+VQQGQQ  RPGGRRGAGPVQQTQQP+PLMQQQMLPRGRMYRYP GRN
Sbjct  470  PGGAPMPNFFMPLVQQGQQGQRPGGRRGAGPVQQTQQPMPLMQQQMLPRGRMYRYPPGRN  529

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
              +GPMPGV GGM+S+PYDMGGMLPRD+A   P+PI+ LASALANAPPEQQRTMLGE+LY
Sbjct  530  GPEGPMPGVPGGMLSVPYDMGGMLPRDSAMGQPMPISTLASALANAPPEQQRTMLGESLY  589

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQL  109
            PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNVQQ   PADQL
Sbjct  590  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVQQTANPADQL  649

Query  108  ASLSLNDNLVA  76
            ASLSLNDNLV+
Sbjct  650  ASLSLNDNLVS  660



>ref|XP_011074396.1| PREDICTED: polyadenylate-binding protein 8-like [Sesamum indicum]
Length=654

 Score =   271 bits (692),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 218/251 (87%), Positives = 232/251 (92%), Gaps = 5/251 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+APR+PMYPPGAPG+ QQLFYGQ PPAIIP QAGFGYQQQLVPGMR
Sbjct  405  AQFSQMRPVAMPPSMAPRMPMYPPGAPGIGQQLFYGQAPPAIIP-QAGFGYQQQLVPGMR  463

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFFVP+VQQGQQ  RPGGRRG GPVQQ QQP+PLMQQQMLPRGRMYR+P GRN
Sbjct  464  PGGAPMPNFFVPLVQQGQQGQRPGGRRGGGPVQQNQQPVPLMQQQMLPRGRMYRFPPGRN  523

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            V D P+PGV GGM+S+PYDMGGMLPRDAA   P+PITALASALANA PEQQRTMLGENLY
Sbjct  524  VPDVPIPGVAGGMLSVPYDMGGMLPRDAAIPQPMPITALASALANATPEQQRTMLGENLY  583

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQL  109
            PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLRNVQQA  PADQL
Sbjct  584  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRNVQQANSPADQL  643

Query  108  ASLSLNDNLVA  76
            ASLSLNDNLV+
Sbjct  644  ASLSLNDNLVS  654



>emb|CAJ38367.1| polyA-binding protein [Plantago major]
Length=314

 Score =   261 bits (666),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 209/253 (83%), Positives = 227/253 (90%), Gaps = 7/253 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+APR+PMYPPGAPG+ QQLFYGQGPPA+IP QAGFGYQQQLVPGMR
Sbjct  63   AQFSQMRPVAMPPSIAPRMPMYPPGAPGIGQQLFYGQGPPAMIPSQAGFGYQQQLVPGMR  122

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFF+PMVQQGQQ  RPGGRRG GP+QQ QQP+P+MQQQM+PRGRMYR+P GRN
Sbjct  123  PGGTPMPNFFMPMVQQGQQGQRPGGRRGGGPMQQAQQPVPVMQQQMMPRGRMYRFPPGRN  182

Query  456  VSDGPMPGVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGENLY  289
            V D PM G GGM S+PYDM GMLPRDAA    P+P+TALASALANA PEQQRTMLGENLY
Sbjct  183  VPDVPMTG-GGMFSVPYDMTGMLPRDAAAIPQPMPVTALASALANATPEQQRTMLGENLY  241

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQA--KIPAD  115
            PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP+ALK+KV EA+EVLRNVQQ     PAD
Sbjct  242  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPDALKSKVNEAMEVLRNVQQQGNNSPAD  301

Query  114  QLASLSLNDNLVA  76
            QLASLSLNDNLV+
Sbjct  302  QLASLSLNDNLVS  314



>ref|XP_011074395.1| PREDICTED: polyadenylate-binding protein 8-like [Sesamum indicum]
Length=654

 Score =   268 bits (684),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 217/251 (86%), Positives = 231/251 (92%), Gaps = 5/251 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+APR+PMYPPGAPG+ QQLFYGQ PPAIIP Q GFGYQQQLVPGMR
Sbjct  405  AQFSQMRPVAMPPSMAPRMPMYPPGAPGIGQQLFYGQAPPAIIP-QPGFGYQQQLVPGMR  463

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFFVP+VQQGQQ  RPGGRRG GPVQQ QQP+PLMQQQMLPRGRMYR+P GRN
Sbjct  464  PGGAPMPNFFVPLVQQGQQGQRPGGRRGGGPVQQNQQPVPLMQQQMLPRGRMYRFPPGRN  523

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            V D P+PGV GGM+S+PYDMGGMLPRDAA   P+PITALASALANA PEQQRTMLGENLY
Sbjct  524  VPDVPIPGVAGGMLSVPYDMGGMLPRDAAVPQPMPITALASALANATPEQQRTMLGENLY  583

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQL  109
            PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLRNVQQA  PADQL
Sbjct  584  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRNVQQANSPADQL  643

Query  108  ASLSLNDNLVA  76
            ASLSLNDNLV+
Sbjct  644  ASLSLNDNLVS  654



>ref|XP_009775186.1| PREDICTED: polyadenylate-binding protein 2-like [Nicotiana sylvestris]
Length=662

 Score =   263 bits (672),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 209/251 (83%), Positives = 231/251 (92%), Gaps = 4/251 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM  S+APR+PMYPPGAPGM QQLFYGQ PP +IPPQAGFGYQQQLVPGMR
Sbjct  412  AQFSQLRPVAMAASMAPRMPMYPPGAPGMGQQLFYGQAPPGMIPPQAGFGYQQQLVPGMR  471

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG P+PNFF+P+VQQGQQ  RPGGRRGAGPVQQTQQP+P+MQQQMLPRGRMYRYP GRN
Sbjct  472  PGGAPLPNFFMPLVQQGQQGQRPGGRRGAGPVQQTQQPMPMMQQQMLPRGRMYRYPPGRN  531

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
              + P+PG+ GGM+S+PYDMGGMLPR+AA   P+PI+ LASALANAPPEQQRTMLGE+LY
Sbjct  532  GQEAPIPGLAGGMLSVPYDMGGMLPREAAMGQPMPISTLASALANAPPEQQRTMLGESLY  591

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQL  109
            PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKV EA+EVL+NVQQA  PADQL
Sbjct  592  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKVNEAMEVLKNVQQANSPADQL  651

Query  108  ASLSLNDNLVA  76
            ASLSLNDNLV+
Sbjct  652  ASLSLNDNLVS  662



>gb|AAK30205.1|AF349964_1 poly(A)-binding protein [Daucus carota]
Length=658

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 202/251 (80%), Positives = 225/251 (90%), Gaps = 5/251 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+ PR+PMY PGAPGM QQLFYGQ PPA+I PQAGFGYQQQLVPGMR
Sbjct  409  AQFSQMRPVAMPPSMGPRMPMYSPGAPGMGQQLFYGQAPPAMIAPQAGFGYQQQLVPGMR  468

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGGGPMPNFF+PMVQQGQQ  RPGGRRGAGP QQTQQP+P+M QQ++PRGRMYR+P GRN
Sbjct  469  PGGGPMPNFFMPMVQQGQQGQRPGGRRGAGPAQQTQQPVPMMPQQLMPRGRMYRFPPGRN  528

Query  456  VSDGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            V D  MPGVGG M+ +PY+MGGMLPR+AA   P+PITALASALANAP +QQRTMLGENLY
Sbjct  529  VGDVTMPGVGGGMLPVPYNMGGMLPREAAMGQPMPITALASALANAPADQQRTMLGENLY  588

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQL  109
            PLVDQLEH+HAAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA++VLRNV Q  + ADQL
Sbjct  589  PLVDQLEHDHAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMDVLRNVSQPNV-ADQL  647

Query  108  ASLSLNDNLVA  76
              LSLN+NLV+
Sbjct  648  GGLSLNENLVS  658



>ref|XP_009613515.1| PREDICTED: polyadenylate-binding protein 2-like [Nicotiana tomentosiformis]
Length=663

 Score =   244 bits (624),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 208/251 (83%), Positives = 232/251 (92%), Gaps = 4/251 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM  S+APR+PMYPPGAPG+ QQLFYGQ PP +IPPQAGFGYQQQLVPGMR
Sbjct  413  AQFSQLRPVAMAASMAPRMPMYPPGAPGIGQQLFYGQAPPGMIPPQAGFGYQQQLVPGMR  472

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG P+PNFF+P+VQQGQQ  RPGGRRGAGPVQQTQQP+P+MQQQ+LPRGRMYRYP GRN
Sbjct  473  PGGAPLPNFFMPLVQQGQQGQRPGGRRGAGPVQQTQQPMPMMQQQILPRGRMYRYPPGRN  532

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
              + P+PG+ GGM+S+PYDMGGMLPR+AA   P+PI+ALASALANAPPEQQRTMLGE+LY
Sbjct  533  GQEAPIPGLAGGMLSVPYDMGGMLPREAAMGQPMPISALASALANAPPEQQRTMLGESLY  592

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQL  109
            PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKV EA+EVL+NVQQA  PADQL
Sbjct  593  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPEALKAKVNEAMEVLKNVQQANSPADQL  652

Query  108  ASLSLNDNLVA  76
            ASLSLNDNLV+
Sbjct  653  ASLSLNDNLVS  663



>ref|XP_003544466.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
 gb|KHN35693.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=652

 Score =   239 bits (609),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 201/251 (80%), Positives = 226/251 (90%), Gaps = 4/251 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVA+TPS+APR+P+YPPGAPG+ QQ  YGQGPPA++PPQAGFGYQQQLVPGMR
Sbjct  402  AQFSQMRPVAITPSVAPRMPLYPPGAPGLGQQFLYGQGPPAMMPPQAGFGYQQQLVPGMR  461

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGGGPMP+FFVPMVQQGQQ  RPGGRRG GPVQQ QQP+P+MQQQMLPRGR+YRYP GRN
Sbjct  462  PGGGPMPSFFVPMVQQGQQGQRPGGRRGTGPVQQPQQPMPMMQQQMLPRGRVYRYPPGRN  521

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTMLGENLYP  286
            + D P+ GV GGM+S+PYDMGG+  RDA   P+PI ALA+ALANAPPEQQRTMLGE LYP
Sbjct  522  MQDVPLQGVAGGMMSVPYDMGGLPIRDAVGQPMPIQALATALANAPPEQQRTMLGEALYP  581

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQL  109
            LVDQLEH+ AAKVTGMLLEMDQ EVLHL+ESP+ALKAKVAEA++VLRNV QQ   PADQL
Sbjct  582  LVDQLEHDAAAKVTGMLLEMDQPEVLHLIESPDALKAKVAEAMDVLRNVAQQQTNPADQL  641

Query  108  ASLSLNDNLVA  76
            ASLSLNDNLV+
Sbjct  642  ASLSLNDNLVS  652



>ref|XP_007160868.1| hypothetical protein PHAVU_001G023500g [Phaseolus vulgaris]
 gb|ESW32862.1| hypothetical protein PHAVU_001G023500g [Phaseolus vulgaris]
Length=651

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 200/251 (80%), Positives = 226/251 (90%), Gaps = 4/251 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVA+TPS+APR+P+YPPGAPG+ QQ  YGQGPP +IPPQAGFGYQQQLVPGMR
Sbjct  401  AQFSQMRPVAITPSVAPRMPLYPPGAPGIGQQFMYGQGPPTMIPPQAGFGYQQQLVPGMR  460

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGGGPMP+FFVP+VQQGQQ  RPGGRRGAGPVQQ QQP+P+MQQQMLPRGR+YRYP GRN
Sbjct  461  PGGGPMPSFFVPLVQQGQQGQRPGGRRGAGPVQQPQQPLPMMQQQMLPRGRVYRYPPGRN  520

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTMLGENLYP  286
            + D P+ GV GGM+S+PYDMGG+  RD+   P+PI ALA+ALANAPPEQQRTMLGE LYP
Sbjct  521  MQDVPLQGVAGGMMSVPYDMGGLPIRDSVGQPMPIQALATALANAPPEQQRTMLGEALYP  580

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQL  109
            LVDQLEH+ AAKVTGMLLEMDQ EVLHL+ESP+ALKAKVAEA++VLRNV QQ   PADQL
Sbjct  581  LVDQLEHDAAAKVTGMLLEMDQPEVLHLIESPDALKAKVAEAMDVLRNVAQQQTNPADQL  640

Query  108  ASLSLNDNLVA  76
            ASLSLNDNLV+
Sbjct  641  ASLSLNDNLVS  651



>gb|KHN12798.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=654

 Score =   235 bits (599),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 198/251 (79%), Positives = 223/251 (89%), Gaps = 4/251 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVA+TPS+APR+P+YPPGAPG+ QQ  YGQGPPA++PPQAGFGYQQQLVPGMR
Sbjct  404  AQFSQMRPVAITPSVAPRMPLYPPGAPGLGQQFLYGQGPPAMMPPQAGFGYQQQLVPGMR  463

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGGGPMP+FFVPMVQQGQQ  RP GRRG GPVQQ QQP+P+MQQQMLPRGR+YRYP GRN
Sbjct  464  PGGGPMPSFFVPMVQQGQQGQRPVGRRGTGPVQQPQQPMPMMQQQMLPRGRVYRYPPGRN  523

Query  456  VSDGPMP-GVGGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTMLGENLYP  286
            + D P+    GGM+S+PYDMGG+  RDA   P+PI ALA+ALANAPPEQQRTMLGE LYP
Sbjct  524  MQDVPLQVAAGGMLSVPYDMGGLPIRDAVGQPMPIQALATALANAPPEQQRTMLGEALYP  583

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQL  109
            LVDQLEH+ AAKVTGMLLEMDQ EVLHL+ESP+ALKAKVAEA++VLRNV QQ   PADQL
Sbjct  584  LVDQLEHDSAAKVTGMLLEMDQPEVLHLIESPDALKAKVAEAMDVLRNVAQQQTNPADQL  643

Query  108  ASLSLNDNLVA  76
            ASLSLNDNLV+
Sbjct  644  ASLSLNDNLVS  654



>ref|XP_004499044.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004499045.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Cicer 
arietinum]
Length=648

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 194/250 (78%), Positives = 220/250 (88%), Gaps = 5/250 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVA+TPS+APR+P+YPPGAPG+ QQ  YGQGPPA+IPPQAGFGYQQQLVPGMR
Sbjct  401  AQFSQMRPVAITPSVAPRMPLYPPGAPGLGQQFMYGQGPPAMIPPQAGFGYQQQLVPGMR  460

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGGGPMP+FFVPMV+QGQQ PRPGGRRGAGP QQ Q   P+MQQQM+PR R+YRYP GRN
Sbjct  461  PGGGPMPSFFVPMVKQGQQGPRPGGRRGAGPGQQPQPQGPMMQQQMIPRQRIYRYPPGRN  520

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTMLGENLYP  286
            + D P+ GV GGM+S+PYDMGG+  RDA   P+PI ALA+ALANAP EQQRTMLGE LYP
Sbjct  521  MQDVPLQGVAGGMMSVPYDMGGLPIRDAVGQPMPIQALATALANAPSEQQRTMLGEALYP  580

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLA  106
            LVDQLEH+ AAKVTGMLLEMDQ EVLHL+ESP+ALKAKVAEA++VLRNV Q   PADQLA
Sbjct  581  LVDQLEHDAAAKVTGMLLEMDQPEVLHLIESPDALKAKVAEAMDVLRNVAQQ--PADQLA  638

Query  105  SLSLNDNLVA  76
            +LSLND LV+
Sbjct  639  TLSLNDTLVS  648



>ref|XP_003550332.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
Length=654

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 198/251 (79%), Positives = 223/251 (89%), Gaps = 4/251 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVA+TPS+APR+P+YPPGAPG+ QQ  YGQGPPA++PPQAGFGYQQQLVPGMR
Sbjct  404  AQFSQMRPVAITPSVAPRMPLYPPGAPGLGQQFLYGQGPPAMMPPQAGFGYQQQLVPGMR  463

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGGGPMP+FFVPMVQQGQQ  RP GRRG GPVQQ QQP+P+MQQQMLPRGR+YRYP GRN
Sbjct  464  PGGGPMPSFFVPMVQQGQQGQRPVGRRGTGPVQQPQQPMPMMQQQMLPRGRVYRYPPGRN  523

Query  456  VSDGPMP-GVGGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTMLGENLYP  286
            + D P+    GGM+S+PYDMGG+  RDA   P+PI ALA+ALANAPPEQQRTMLGE LYP
Sbjct  524  MQDVPLQVAAGGMLSVPYDMGGLPMRDAVGQPMPIQALATALANAPPEQQRTMLGEALYP  583

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQL  109
            LVDQLEH+ AAKVTGMLLEMDQ EVLHL+ESP+ALKAKVAEA++VLRNV QQ   PADQL
Sbjct  584  LVDQLEHDSAAKVTGMLLEMDQPEVLHLIESPDALKAKVAEAMDVLRNVAQQQTNPADQL  643

Query  108  ASLSLNDNLVA  76
            ASLSLNDNLV+
Sbjct  644  ASLSLNDNLVS  654



>ref|XP_011029544.1| PREDICTED: polyadenylate-binding protein 2-like [Populus euphratica]
Length=651

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 223/252 (88%), Gaps = 5/252 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV M PS+A R+PMYPPGAPGM QQ  YGQGPPA++PPQAGFGYQQQLVPGMR
Sbjct  400  AQFSQMRPVTMAPSVASRMPMYPPGAPGMGQQFLYGQGPPAMMPPQAGFGYQQQLVPGMR  459

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFFVP+VQQGQQ  RPGGRRG GPVQQTQQ +PLMQQQMLPRGR+YRYP GRN
Sbjct  460  PGGAPMPNFFVPLVQQGQQGQRPGGRRGGGPVQQTQQQVPLMQQQMLPRGRVYRYPPGRN  519

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA-PVPITALASALANAPPEQQRTMLGENLYPL  283
            + D PMPGV GGM+S+PYDMGGM  RDAA P+PITALA+ALANA PEQQRTMLGE+LYP+
Sbjct  520  MPDVPMPGVAGGMLSVPYDMGGMPIRDAAQPMPITALATALANATPEQQRTMLGESLYPI  579

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPADQ  112
            VDQLEH+ AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA++VLR V   QQ    ADQ
Sbjct  580  VDQLEHDSAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMDVLRTVAAQQQINSQADQ  639

Query  111  LASLSLNDNLVA  76
            L SLSLNDNLV+
Sbjct  640  LGSLSLNDNLVS  651



>ref|XP_012068315.1| PREDICTED: polyadenylate-binding protein 2-like [Jatropha curcas]
Length=653

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 207/254 (81%), Positives = 227/254 (89%), Gaps = 7/254 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM+PS+APR+PMY PGAPG+ QQ  YGQ PPAIIPPQAGFGYQQQLVPGMR
Sbjct  400  AQFSQMRPVAMSPSVAPRMPMYSPGAPGLGQQFLYGQAPPAIIPPQAGFGYQQQLVPGMR  459

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFFVP+VQQGQQ+ RPGGRRGAGPVQQ+QQP+PLM QQMLPRGR+YRYP GRN
Sbjct  460  PGGAPMPNFFVPLVQQGQQSQRPGGRRGAGPVQQSQQPVPLMHQQMLPRGRVYRYPTGRN  519

Query  456  VSDGPMPGVGGM-VSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            + D PM GV GM +S+PYDMGGM  RDAA   P+PITALA+ALANA PEQQRT+LGE+LY
Sbjct  520  MPDVPMAGVAGMPLSVPYDMGGMPIRDAATGQPMPITALATALANATPEQQRTLLGESLY  579

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPA  118
            PLVDQLEH+ AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV   QQA  PA
Sbjct  580  PLVDQLEHDSAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAVQQQAANPA  639

Query  117  DQLASLSLNDNLVA  76
            DQLASLSLND LV+
Sbjct  640  DQLASLSLNDGLVS  653



>ref|XP_006374904.1| hypothetical protein POPTR_0014s02550g [Populus trichocarpa]
 gb|ERP52701.1| hypothetical protein POPTR_0014s02550g [Populus trichocarpa]
Length=651

 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 206/252 (82%), Positives = 224/252 (89%), Gaps = 5/252 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV M PS+A R+PMYPPGAPGM QQ  YGQGPPA++PPQAGFGYQQQLVPGMR
Sbjct  400  AQFSQMRPVTMAPSVASRMPMYPPGAPGMGQQFLYGQGPPAMMPPQAGFGYQQQLVPGMR  459

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFFVP+VQQGQQ  RPGGRRG GPVQQTQQP+PLMQQQMLPRGR+YRYP GRN
Sbjct  460  PGGAPMPNFFVPLVQQGQQGQRPGGRRGGGPVQQTQQPVPLMQQQMLPRGRVYRYPPGRN  519

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA-PVPITALASALANAPPEQQRTMLGENLYPL  283
            + D PMPGV GGM+S+PYDMGGM  RDAA P+PITALA+ALANA PEQQRTMLGE+LYP+
Sbjct  520  MPDVPMPGVAGGMLSVPYDMGGMPIRDAAQPMPITALATALANATPEQQRTMLGESLYPI  579

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPADQ  112
            VDQLEH+ AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR V   QQ    ADQ
Sbjct  580  VDQLEHDSAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRTVAAQQQINNQADQ  639

Query  111  LASLSLNDNLVA  76
            L SLSLNDNLV+
Sbjct  640  LGSLSLNDNLVS  651



>gb|ADE76290.1| unknown [Picea sitchensis]
Length=313

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 167/258 (65%), Positives = 197/258 (76%), Gaps = 11/258 (4%)
 Frame = -1

Query  816  AQFSEMR-PVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQA-GFGYQQQLVpg  643
            AQFS++R PV M P++  R+PMYPPG PG+ QQ+FYGQGPPA+IPPQA GFGYQQQL+PG
Sbjct  56   AQFSQLRNPVGMAPAVPARVPMYPPGGPGLNQQIFYGQGPPALIPPQAAGFGYQQQLIPG  115

Query  642  mrpgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypg-  466
            MRPG  P+PNF++P++Q  Q     G R G  P+QQ  Q    + QQ +       Y   
Sbjct  116  MRPGSAPIPNFYLPLMQAQQGQRPGGRRGGVAPIQQQPQQQLPLLQQQMLPRGNRVYRYP  175

Query  465  -gRNVSDGPMPGV-GGMVSLPYDMGGMLPRDAA-----PVPITALASALANAPPEQQRTM  307
             GRNV++ P+ GV GGM  LP DMGG+  R A      P+PI ALASALANA PEQQRTM
Sbjct  176  PGRNVNEIPLSGVAGGMHPLPLDMGGLPLRAAETTISQPIPIGALASALANATPEQQRTM  235

Query  306  LGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAK  127
            LGE+LYPLVDQLEH+HAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV QA+
Sbjct  236  LGESLYPLVDQLEHDHAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVTQAQ  295

Query  126  I-PADQLASLSLNDNLVA  76
              PA+QLA+LSLN+ LV+
Sbjct  296  ANPAEQLAALSLNETLVS  313



>gb|KDO84110.1| hypothetical protein CISIN_1g006282mg [Citrus sinensis]
Length=472

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 189/254 (74%), Positives = 211/254 (83%), Gaps = 7/254 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+ PR+PMYPPG  G+ QQ  YGQ PPAIIPPQAGFGYQQQLVPGMR
Sbjct  219  AQFSQMRPVAMGPSVPPRMPMYPPGPSGLGQQFLYGQAPPAIIPPQAGFGYQQQLVPGMR  278

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            P G PMPNFFVP+V QGQQ  RPGGRRGAGPVQQTQQP+P+M  QM PRG  YRYP GRN
Sbjct  279  PAGAPMPNFFVPVVSQGQQGQRPGGRRGAGPVQQTQQPLPIMPHQMPPRGHAYRYPLGRN  338

Query  456  VSDGPMP-GVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGENL  292
            + D P   G G M+ +P DMG  +PR  A    P+PITAL++ALANA PEQQRT+LGE+L
Sbjct  339  MQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGESL  398

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPA  118
            YPLV+QLE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V  QQA  PA
Sbjct  399  YPLVEQLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAQQQANNPA  458

Query  117  DQLASLSLNDNLVA  76
            DQLASLSLN+NLV+
Sbjct  459  DQLASLSLNENLVS  472



>ref|XP_002510185.1| polyadenylate-binding protein, putative [Ricinus communis]
 gb|EEF52372.1| polyadenylate-binding protein, putative [Ricinus communis]
Length=658

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 201/254 (79%), Positives = 218/254 (86%), Gaps = 7/254 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+ PR+P+Y PGAPGM QQ  YGQGPP +IPPQ GFGYQQQLVPG+R
Sbjct  405  AQFSQMRPVAMAPSVGPRMPIYSPGAPGMGQQFLYGQGPPTMIPPQGGFGYQQQLVPGIR  464

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFFVPMVQQGQQ  R GGRRGA PVQQ QQP+PLM QQMLPRGR+YRYP GRN
Sbjct  465  PGGAPMPNFFVPMVQQGQQGQRHGGRRGAVPVQQNQQPVPLMHQQMLPRGRVYRYPPGRN  524

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            + D PMPGV GGM+S+PYDMGGM  RDAA   PVPITALA+ALANA PE QRT+LGE+LY
Sbjct  525  MPDVPMPGVAGGMLSVPYDMGGMPIRDAAAGQPVPITALATALANASPEHQRTLLGESLY  584

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPA  118
            PLVDQLEHE AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V   Q A   A
Sbjct  585  PLVDQLEHESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAAQQHANNTA  644

Query  117  DQLASLSLNDNLVA  76
            DQL SLSLND LV+
Sbjct  645  DQLTSLSLNDGLVS  658



>gb|KDO84109.1| hypothetical protein CISIN_1g006282mg [Citrus sinensis]
Length=575

 Score =   216 bits (549),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 189/254 (74%), Positives = 211/254 (83%), Gaps = 7/254 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+ PR+PMYPPG  G+ QQ  YGQ PPAIIPPQAGFGYQQQLVPGMR
Sbjct  322  AQFSQMRPVAMGPSVPPRMPMYPPGPSGLGQQFLYGQAPPAIIPPQAGFGYQQQLVPGMR  381

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            P G PMPNFFVP+V QGQQ  RPGGRRGAGPVQQTQQP+P+M  QM PRG  YRYP GRN
Sbjct  382  PAGAPMPNFFVPVVSQGQQGQRPGGRRGAGPVQQTQQPLPIMPHQMPPRGHAYRYPLGRN  441

Query  456  VSDGPMP-GVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGENL  292
            + D P   G G M+ +P DMG  +PR  A    P+PITAL++ALANA PEQQRT+LGE+L
Sbjct  442  MQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGESL  501

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPA  118
            YPLV+QLE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V  QQA  PA
Sbjct  502  YPLVEQLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAQQQANNPA  561

Query  117  DQLASLSLNDNLVA  76
            DQLASLSLN+NLV+
Sbjct  562  DQLASLSLNENLVS  575



>gb|KJB79366.1| hypothetical protein B456_013G046000 [Gossypium raimondii]
Length=649

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 185/255 (73%), Positives = 207/255 (81%), Gaps = 9/255 (4%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV M+PS+APR+PMYPPG PG+ QQ+FYGQ PPA+ P Q GFGYQQQLVPGMR
Sbjct  396  AQFSQMRPVTMSPSVAPRMPMYPPGGPGLGQQIFYGQAPPAMFP-QPGFGYQQQLVPGMR  454

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFFVPMVQQGQQ  RPGGRR     Q  Q    + QQ MLPRGR+YRYP GR 
Sbjct  455  PGGAPMPNFFVPMVQQGQQGQRPGGRRAGAGQQSQQPVPLMQQQVMLPRGRVYRYPPGRG  514

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            + D  MP + GGM+S+PYDMGGM  RDA+   P+PI ALASALANA P+QQRTMLGENLY
Sbjct  515  LPDVSMPNIAGGMLSVPYDMGGMPMRDASISQPIPIGALASALANATPDQQRTMLGENLY  574

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAK----IP  121
            PLV+QLE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR V Q +      
Sbjct  575  PLVEQLEPDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRTVAQQQQTGGAA  634

Query  120  ADQLASLSLNDNLVA  76
            ADQLASLSL+DNLV+
Sbjct  635  ADQLASLSLSDNLVS  649



>ref|XP_008456143.1| PREDICTED: polyadenylate-binding protein 8-like isoform X2 [Cucumis 
melo]
Length=552

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 186/257 (72%), Positives = 207/257 (81%), Gaps = 10/257 (4%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM  S+APR+P+YPPG PG+ QQLFYGQ PPA+IP Q GFGYQQQLVPG+R
Sbjct  296  AQFSQIRPVAMPASVAPRMPIYPPGGPGIGQQLFYGQAPPAMIPSQGGFGYQQQLVPGIR  355

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGGGPMPNFFVPMVQQGQQ  RPGGRR     Q  Q    + QQ +   GR+YRYP GR 
Sbjct  356  PGGGPMPNFFVPMVQQGQQGQRPGGRRAGAVQQTQQPVPMMQQQMLPRGGRVYRYPPGRG  415

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            + D  MPGV GGM S+PYDMGGM  RDAA   P+PI ALASALANA P+QQRTMLGENLY
Sbjct  416  LPDVAMPGVAGGMFSVPYDMGGMPLRDAAHSQPIPIGALASALANATPDQQRTMLGENLY  475

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV------QQAK  127
            PLV+QLE ++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV      QQA 
Sbjct  476  PLVEQLEPDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAAAQQQQQAG  535

Query  126  IPADQLASLSLNDNLVA  76
              ADQLASLSL +NLV+
Sbjct  536  NAADQLASLSLTENLVS  552



>ref|XP_002301171.2| hypothetical protein POPTR_0002s12570g [Populus trichocarpa]
 gb|EEE80444.2| hypothetical protein POPTR_0002s12570g [Populus trichocarpa]
Length=657

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 207/254 (81%), Positives = 224/254 (88%), Gaps = 8/254 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+APR+ MYPPGAPG+ QQ  YGQGPPA+IP QAGFGYQQQLVPGMR
Sbjct  399  AQFSQMRPVAMAPSVAPRMQMYPPGAPGLGQQFLYGQGPPAMIP-QAGFGYQQQLVPGMR  457

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFFVP+VQQGQQ  RPGGRRG GPVQQTQQP+PLMQQQMLPRGR+YRYP GRN
Sbjct  458  PGGAPMPNFFVPLVQQGQQGQRPGGRRGGGPVQQTQQPVPLMQQQMLPRGRVYRYPPGRN  517

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            + D PMPGV GGM+S+PYDMG M  RDAA   P+PITALA+ALANA PEQQRTMLGE LY
Sbjct  518  MPDVPMPGVAGGMLSVPYDMGVMPIRDAAGGQPMPITALATALANATPEQQRTMLGEGLY  577

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPA  118
            PLVDQLEH+ AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR V   QQ   PA
Sbjct  578  PLVDQLEHDSAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRTVAAQQQINNPA  637

Query  117  DQLASLSLNDNLVA  76
            DQLASLSLN+NLV+
Sbjct  638  DQLASLSLNENLVS  651



>ref|XP_006473293.1| PREDICTED: polyadenylate-binding protein 8-like [Citrus sinensis]
Length=652

 Score =   215 bits (547),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 189/254 (74%), Positives = 211/254 (83%), Gaps = 7/254 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+ PR+PMYPPG  G+ QQ  YGQ PPAIIPPQAGFGYQQQLVPGMR
Sbjct  399  AQFSQMRPVAMGPSVPPRMPMYPPGPSGLGQQFLYGQAPPAIIPPQAGFGYQQQLVPGMR  458

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            P G PMPNFFVP+V QGQQ  RPGGRRGAGPVQQTQQP+P+M  QM PRG  YRYP GRN
Sbjct  459  PAGAPMPNFFVPVVSQGQQGQRPGGRRGAGPVQQTQQPLPIMPHQMPPRGHAYRYPLGRN  518

Query  456  VSDGPMP-GVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGENL  292
            + D P   G G M+ +P DMG  +PR  A    P+PITAL++ALANA PEQQRT+LGE+L
Sbjct  519  MQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGESL  578

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPA  118
            YPLV+QLE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V  QQA  PA
Sbjct  579  YPLVEQLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAQQQANNPA  638

Query  117  DQLASLSLNDNLVA  76
            DQLASLSLN+NLV+
Sbjct  639  DQLASLSLNENLVS  652



>gb|KDO84107.1| hypothetical protein CISIN_1g006282mg [Citrus sinensis]
Length=652

 Score =   215 bits (547),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 189/254 (74%), Positives = 211/254 (83%), Gaps = 7/254 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+ PR+PMYPPG  G+ QQ  YGQ PPAIIPPQAGFGYQQQLVPGMR
Sbjct  399  AQFSQMRPVAMGPSVPPRMPMYPPGPSGLGQQFLYGQAPPAIIPPQAGFGYQQQLVPGMR  458

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            P G PMPNFFVP+V QGQQ  RPGGRRGAGPVQQTQQP+P+M  QM PRG  YRYP GRN
Sbjct  459  PAGAPMPNFFVPVVSQGQQGQRPGGRRGAGPVQQTQQPLPIMPHQMPPRGHAYRYPLGRN  518

Query  456  VSDGPMP-GVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGENL  292
            + D P   G G M+ +P DMG  +PR  A    P+PITAL++ALANA PEQQRT+LGE+L
Sbjct  519  MQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGESL  578

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPA  118
            YPLV+QLE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V  QQA  PA
Sbjct  579  YPLVEQLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAQQQANNPA  638

Query  117  DQLASLSLNDNLVA  76
            DQLASLSLN+NLV+
Sbjct  639  DQLASLSLNENLVS  652



>ref|XP_008456142.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Cucumis 
melo]
Length=654

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 186/257 (72%), Positives = 207/257 (81%), Gaps = 10/257 (4%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM  S+APR+P+YPPG PG+ QQLFYGQ PPA+IP Q GFGYQQQLVPG+R
Sbjct  398  AQFSQIRPVAMPASVAPRMPIYPPGGPGIGQQLFYGQAPPAMIPSQGGFGYQQQLVPGIR  457

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGGGPMPNFFVPMVQQGQQ  RPGGRR     Q  Q    + QQ +   GR+YRYP GR 
Sbjct  458  PGGGPMPNFFVPMVQQGQQGQRPGGRRAGAVQQTQQPVPMMQQQMLPRGGRVYRYPPGRG  517

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            + D  MPGV GGM S+PYDMGGM  RDAA   P+PI ALASALANA P+QQRTMLGENLY
Sbjct  518  LPDVAMPGVAGGMFSVPYDMGGMPLRDAAHSQPIPIGALASALANATPDQQRTMLGENLY  577

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV------QQAK  127
            PLV+QLE ++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV      QQA 
Sbjct  578  PLVEQLEPDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAAAQQQQQAG  637

Query  126  IPADQLASLSLNDNLVA  76
              ADQLASLSL +NLV+
Sbjct  638  NAADQLASLSLTENLVS  654



>ref|XP_011017176.1| PREDICTED: polyadenylate-binding protein 8-like [Populus euphratica]
Length=651

 Score =   213 bits (542),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 205/254 (81%), Positives = 223/254 (88%), Gaps = 8/254 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+APR+ MYPPGAPG+ QQ  YGQGPPA+IP QAGFGYQQQLVPGMR
Sbjct  399  AQFSQMRPVAMAPSVAPRMQMYPPGAPGLGQQFLYGQGPPAMIP-QAGFGYQQQLVPGMR  457

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFF+P+VQQGQQA RPGGRRG GPVQQTQQP+PLMQQQMLPRGR YRYP GRN
Sbjct  458  PGGAPMPNFFMPLVQQGQQAQRPGGRRGGGPVQQTQQPVPLMQQQMLPRGRFYRYPPGRN  517

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            + D PMPGV GGM+S+PYDMG M  RDAA   P+PITALA+ALANA PEQQR MLGE+LY
Sbjct  518  MPDVPMPGVAGGMLSVPYDMGVMPIRDAAGGQPMPITALATALANATPEQQRMMLGESLY  577

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPA  118
            PLVDQLEH+ AAKVTGMLLEMDQTEVLHLLESPEALK KVAEA+EVLR V   QQ   PA
Sbjct  578  PLVDQLEHDSAAKVTGMLLEMDQTEVLHLLESPEALKEKVAEAMEVLRTVAAQQQINNPA  637

Query  117  DQLASLSLNDNLVA  76
            DQLASLSLN+NLV+
Sbjct  638  DQLASLSLNENLVS  651



>ref|XP_006434727.1| hypothetical protein CICLE_v10000537mg [Citrus clementina]
 gb|ESR47967.1| hypothetical protein CICLE_v10000537mg [Citrus clementina]
Length=651

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 189/254 (74%), Positives = 211/254 (83%), Gaps = 8/254 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+ PR+PMYPPG  G+ QQ  YGQ PPAIIP QAGFGYQQQLVPGMR
Sbjct  399  AQFSQMRPVAMGPSVPPRMPMYPPGPSGLGQQFLYGQAPPAIIP-QAGFGYQQQLVPGMR  457

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            P G PMPNFFVP+V QGQQ  RPGGRRGAGPVQQTQQP+P+M  QM PRG  YRYP GRN
Sbjct  458  PAGAPMPNFFVPVVSQGQQGQRPGGRRGAGPVQQTQQPLPIMPHQMPPRGHAYRYPLGRN  517

Query  456  VSDGPMP-GVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGENL  292
            + D P   G GGM+ +P DMG  +PR  A    P+PITAL++ALANA PEQQRT+LGE+L
Sbjct  518  MQDFPFDMGAGGMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGESL  577

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPA  118
            YPLV+QLE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V  QQA  PA
Sbjct  578  YPLVEQLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAQQQANNPA  637

Query  117  DQLASLSLNDNLVA  76
            DQLASLSLN+NLV+
Sbjct  638  DQLASLSLNENLVS  651



>gb|KCW55175.1| hypothetical protein EUGRSUZ_I01129 [Eucalyptus grandis]
Length=471

 Score =   205 bits (522),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 187/252 (74%), Positives = 212/252 (84%), Gaps = 6/252 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM P++APR+P YPPG PG+ QQLFYGQ PPA++PPQ GFGYQQQLVPGMR
Sbjct  219  AQFSQMRPVAMAPTIAPRMPFYPPGGPGIGQQLFYGQAPPAVMPPQPGFGYQQQLVPGMR  278

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PG GPMPNF VPMV Q  Q  +  G R AG VQQ+QQP+P+MQQQMLPRGR+YRYP GR 
Sbjct  279  PGAGPMPNFLVPMVHQQGQQGQRPGGRRAGVVQQSQQPVPMMQQQMLPRGRVYRYPTGRG  338

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRD---AAPVPITALASALANAPPEQQRTMLGENLY  289
            + D  +PGV GGM+ +PYDMGGM  RD   + P+PITALASALANA P+QQRTMLGE+LY
Sbjct  339  LPDMSVPGVAGGMMPMPYDMGGMPLRDTPISQPLPITALASALANASPDQQRTMLGESLY  398

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPAD  115
            PLV+QLE + AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVLR+V  QQA    D
Sbjct  399  PLVEQLEPDAAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLRSVAQQQASGAVD  458

Query  114  QLASLSLNDNLV  79
            QLASLSLNDNLV
Sbjct  459  QLASLSLNDNLV  470



>ref|XP_004140705.1| PREDICTED: polyadenylate-binding protein 8-like [Cucumis sativus]
 gb|KGN57514.1| hypothetical protein Csa_3G202720 [Cucumis sativus]
Length=654

 Score =   209 bits (531),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 184/257 (72%), Positives = 205/257 (80%), Gaps = 10/257 (4%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++R V M  S+APR+P+YPPG PG+ QQLFYGQ PPA+IP Q GFGYQQQLVPG+R
Sbjct  398  AQFSQIRSVPMPASVAPRMPIYPPGGPGIGQQLFYGQAPPAMIPSQGGFGYQQQLVPGIR  457

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGGGPMPNFFVPMVQQGQQ  RPGGRR     Q  Q    + QQ +   GR+YRYP GR 
Sbjct  458  PGGGPMPNFFVPMVQQGQQGQRPGGRRAGAVQQTQQPVPMMQQQMLPRGGRVYRYPPGRG  517

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            + D  MPGV GGM S+PYDMGGM  RDAA   P+PI ALASALANA P+QQRTMLGENLY
Sbjct  518  LPDVAMPGVAGGMFSVPYDMGGMPLRDAAHSQPIPIGALASALANATPDQQRTMLGENLY  577

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV------QQAK  127
            PLV+QLE ++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV      QQA 
Sbjct  578  PLVEQLEPDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAAAQQQQQAG  637

Query  126  IPADQLASLSLNDNLVA  76
              ADQLASLSL +NLV+
Sbjct  638  NAADQLASLSLTENLVS  654



>ref|XP_010028424.1| PREDICTED: polyadenylate-binding protein 2 [Eucalyptus grandis]
 gb|KCW55174.1| hypothetical protein EUGRSUZ_I01129 [Eucalyptus grandis]
Length=646

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 187/252 (74%), Positives = 212/252 (84%), Gaps = 6/252 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM P++APR+P YPPG PG+ QQLFYGQ PPA++PPQ GFGYQQQLVPGMR
Sbjct  394  AQFSQMRPVAMAPTIAPRMPFYPPGGPGIGQQLFYGQAPPAVMPPQPGFGYQQQLVPGMR  453

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PG GPMPNF VPMV Q  Q  +  G R AG VQQ+QQP+P+MQQQMLPRGR+YRYP GR 
Sbjct  454  PGAGPMPNFLVPMVHQQGQQGQRPGGRRAGVVQQSQQPVPMMQQQMLPRGRVYRYPTGRG  513

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRD---AAPVPITALASALANAPPEQQRTMLGENLY  289
            + D  +PGV GGM+ +PYDMGGM  RD   + P+PITALASALANA P+QQRTMLGE+LY
Sbjct  514  LPDMSVPGVAGGMMPMPYDMGGMPLRDTPISQPLPITALASALANASPDQQRTMLGESLY  573

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPAD  115
            PLV+QLE + AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVLR+V  QQA    D
Sbjct  574  PLVEQLEPDAAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLRSVAQQQASGAVD  633

Query  114  QLASLSLNDNLV  79
            QLASLSLNDNLV
Sbjct  634  QLASLSLNDNLV  645



>ref|XP_010519297.1| PREDICTED: polyadenylate-binding protein 8-like [Tarenaya hassleriana]
Length=649

 Score =   204 bits (518),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 191/253 (75%), Positives = 212/253 (84%), Gaps = 7/253 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQF+++RPV M P++APR+PMYPPG PG+ QQLFYGQGPPA+IPPQ GFGYQQQLVPGMR
Sbjct  396  AQFAQLRPVNMPPNVAPRMPMYPPGGPGIGQQLFYGQGPPAMIPPQPGFGYQQQLVPGMR  455

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFF+PMVQQGQQ  +  G R  G VQQ+QQP P+MQQQML RGRMYRYP    
Sbjct  456  PGGAPMPNFFMPMVQQGQQQQQRPGGRRGGAVQQSQQPAPMMQQQMLSRGRMYRYPQRGG  515

Query  456  VSDGPMPGVG-GMVSLPYDM-GGMLP-RDAA---PVPITALASALANAPPEQQRTMLGEN  295
            + D PMPGV   M+S+PYD+ GG  P RD+A   PVPI ALASALANA PEQQRTMLGEN
Sbjct  516  LPDVPMPGVSPSMLSVPYDIAGGAAPLRDSAVSQPVPIGALASALANASPEQQRTMLGEN  575

Query  294  LYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPA  118
            LYPLV+QLE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V QQA   A
Sbjct  576  LYPLVEQLEPDSAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVQQQAGGAA  635

Query  117  DQLASLSLNDNLV  79
            DQLASLSL DNLV
Sbjct  636  DQLASLSLKDNLV  648



>gb|KJB58541.1| hypothetical protein B456_009G214100 [Gossypium raimondii]
Length=650

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 197/253 (78%), Positives = 221/253 (87%), Gaps = 7/253 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+A++ S++PRIPMYP GAPG+ QQ  YGQGPPAIIPPQAGFGYQQQLVP MR
Sbjct  399  AQFSQMRPLAIS-SVSPRIPMYPSGAPGLGQQFLYGQGPPAIIPPQAGFGYQQQLVPEMR  457

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG P+PNFFVPMVQQGQQ  RPGGRRGAGPVQQTQQP+PLMQQQMLPRGR+YRYP GR 
Sbjct  458  PGGPPVPNFFVPMVQQGQQGQRPGGRRGAGPVQQTQQPLPLMQQQMLPRGRVYRYPPGRM  517

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            + +GPM  V GGM+S+PYDMGGM  RDA    P+P+ ALA+ALANA PEQQRTMLGE+LY
Sbjct  518  MPEGPMSNVPGGMLSVPYDMGGMPMRDAGVGQPMPVPALATALANATPEQQRTMLGESLY  577

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPAD  115
            PLV++LE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVL     QQA  PAD
Sbjct  578  PLVERLERDSAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLSVAAQQQANNPAD  637

Query  114  QLASLSLNDNLVA  76
            +LASLSLNDNLV+
Sbjct  638  RLASLSLNDNLVS  650



>ref|NP_001061515.1| Os08g0314800 [Oryza sativa Japonica Group]
 dbj|BAC92404.1| putative polyadenylate-binding protein [Oryza sativa Japonica 
Group]
 dbj|BAC92537.1| putative polyadenylate-binding protein [Oryza sativa Japonica 
Group]
 dbj|BAF23429.1| Os08g0314800 [Oryza sativa Japonica Group]
 dbj|BAG89395.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAI39945.1| putative poly(A)-binding protein [Oryza sativa Indica Group]
Length=660

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 161/252 (64%), Positives = 187/252 (74%), Gaps = 5/252 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+ M PS+APR+PMYPPG PG+ QQLFYGQ PPA + PQ GFG+QQ L+PGMR
Sbjct  409  AQFSQMRPMVMPPSVAPRMPMYPPGVPGVGQQLFYGQPPPAFVNPQPGFGFQQHLIPGMR  468

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            P  GP+PNF +PMVQQGQQ  RP GRR      Q   P+   Q         YRY  GR 
Sbjct  469  PSVGPIPNFVMPMVQQGQQPQRPAGRRAGTGGIQQPMPMGHQQMLPRGSRGGYRYASGRG  528

Query  456  VSDGPMPGVGGMVSLPYDMGGMLPRDAAP---VPITALASALANAPPEQQRTMLGENLYP  286
            + D    GVGG+V  PY+MG M   DA     VPI ALASALAN+PP+QQR MLGE+LYP
Sbjct  529  MPDNAFRGVGGLVPSPYEMGRMPLSDAGAPPQVPIGALASALANSPPDQQRLMLGESLYP  588

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQ  112
            LVDQLEH+ AAKVTGMLLEMDQTEVLHL+ESP+ALKAKVAEA+EVLRN   QQA  P DQ
Sbjct  589  LVDQLEHDQAAKVTGMLLEMDQTEVLHLIESPDALKAKVAEAMEVLRNAQQQQANTPTDQ  648

Query  111  LASLSLNDNLVA  76
            LA+L+L+D +V+
Sbjct  649  LAALTLSDGVVS  660



>ref|XP_010688794.1| PREDICTED: polyadenylate-binding protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=661

 Score =   201 bits (512),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 195/253 (77%), Positives = 219/253 (87%), Gaps = 11/253 (4%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+AMTPS+ PR+PM+PPGAPG+ QQ+FYGQ PP +IPPQ GFGYQQQLVPG+R
Sbjct  414  AQFSQMRPMAMTPSVGPRMPMFPPGAPGIGQQIFYGQAPP-MIPPQGGFGYQQQLVPGVR  472

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PG GPMPN+F+P +QQGQQ  RPGGRRGAGPVQQ QQP+P+MQQQMLPRGR+YRYP GRN
Sbjct  473  PGAGPMPNYFMPYMQQGQQGQRPGGRRGAGPVQQNQQPVPMMQQQMLPRGRVYRYPPGRN  532

Query  456  VSDGPMPGVGGMVSLP-YDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            + D PMPG      LP YDMGGM  RDA    PVPITALA+ALANA PEQQRTMLGE+LY
Sbjct  533  MPDVPMPGA----MLPGYDMGGMPLRDAGIAQPVPITALATALANASPEQQRTMLGESLY  588

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPAD  115
            PLVD +EH++AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVLRNV  QQ    AD
Sbjct  589  PLVDAIEHDNAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLRNVAAQQGSNAAD  648

Query  114  QLASLSLNDNLVA  76
            QLASLSLNDNLV+
Sbjct  649  QLASLSLNDNLVS  661



>gb|EEC77593.1| hypothetical protein OsI_16552 [Oryza sativa Indica Group]
Length=659

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 174/253 (69%), Positives = 197/253 (78%), Gaps = 7/253 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPV MTPS+APR+PMYPP AP + QQLFYGQ PPAI+PPQ GFG+QQQLVPGMR
Sbjct  408  AQFSQVRPVPMTPSMAPRLPMYPPMAP-LGQQLFYGQAPPAIMPPQPGFGFQQQLVPGMR  466

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG  MPN+FVP+VQQGQQ PRPG RR      Q QQ     QQQMLPRGR+YRYP   N
Sbjct  467  PGGAHMPNYFVPVVQQGQQGPRPGIRRSGAGSAQGQQSAQPFQQQMLPRGRVYRYPPAHN  526

Query  456  VSDGP-MPGVGGMVSLPYDMGGMLPRDA--APVPITALASALANAPPEQQRTMLGENLYP  286
            + D P MPGV G +   YDMGG   RDA  +P PI  L SALANA PEQQRT+LGE+LYP
Sbjct  527  MPDVPPMPGVAGGMIQSYDMGGFPVRDAGLSPAPIGTLTSALANANPEQQRTILGESLYP  586

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ---AKIPAD  115
            LV+ LE  HAAKVTGMLLEMDQTEVLHLLESPEALK+KVAEA++VLRNV Q   A  P  
Sbjct  587  LVELLEQNHAAKVTGMLLEMDQTEVLHLLESPEALKSKVAEAMDVLRNVAQQHNANTPTS  646

Query  114  QLASLSLNDNLVA  76
            QLA+LSL D +++
Sbjct  647  QLAALSLGDAIIS  659



>emb|CAE02947.3| OSJNBa0014K14.19 [Oryza sativa Japonica Group]
Length=657

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 174/253 (69%), Positives = 197/253 (78%), Gaps = 7/253 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPV MTPS+APR+PMYPP AP + QQLFYGQ PPAI+PPQ GFG+QQQLVPGMR
Sbjct  406  AQFSQVRPVPMTPSMAPRLPMYPPMAP-LGQQLFYGQAPPAIMPPQPGFGFQQQLVPGMR  464

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG  MPN+FVP+VQQGQQ PRPG RR      Q QQ     QQQMLPRGR+YRYP   N
Sbjct  465  PGGAHMPNYFVPVVQQGQQGPRPGIRRSGAGSAQGQQSAQPFQQQMLPRGRVYRYPPAHN  524

Query  456  VSDGP-MPGVGGMVSLPYDMGGMLPRDA--APVPITALASALANAPPEQQRTMLGENLYP  286
            + D P MPGV G +   YDMGG   RDA  +P PI  L SALANA PEQQRT+LGE+LYP
Sbjct  525  MPDVPPMPGVAGGMIQSYDMGGFPVRDAGLSPAPIGTLTSALANANPEQQRTILGESLYP  584

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ---AKIPAD  115
            LV+ LE  HAAKVTGMLLEMDQTEVLHLLESPEALK+KVAEA++VLRNV Q   A  P  
Sbjct  585  LVELLEQNHAAKVTGMLLEMDQTEVLHLLESPEALKSKVAEAMDVLRNVAQQHNANTPTS  644

Query  114  QLASLSLNDNLVA  76
            QLA+LSL D +++
Sbjct  645  QLAALSLGDAIIS  657



>ref|NP_001053248.1| Os04g0504800 [Oryza sativa Japonica Group]
 emb|CAE05558.1| OSJNBb0116K07.11 [Oryza sativa Japonica Group]
 dbj|BAF15162.1| Os04g0504800 [Oryza sativa Japonica Group]
 dbj|BAG90316.1| unnamed protein product [Oryza sativa Japonica Group]
Length=659

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 174/253 (69%), Positives = 197/253 (78%), Gaps = 7/253 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPV MTPS+APR+PMYPP AP + QQLFYGQ PPAI+PPQ GFG+QQQLVPGMR
Sbjct  408  AQFSQVRPVPMTPSMAPRLPMYPPMAP-LGQQLFYGQAPPAIMPPQPGFGFQQQLVPGMR  466

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG  MPN+FVP+VQQGQQ PRPG RR      Q QQ     QQQMLPRGR+YRYP   N
Sbjct  467  PGGAHMPNYFVPVVQQGQQGPRPGIRRSGAGSAQGQQSAQPFQQQMLPRGRVYRYPPAHN  526

Query  456  VSDGP-MPGVGGMVSLPYDMGGMLPRDA--APVPITALASALANAPPEQQRTMLGENLYP  286
            + D P MPGV G +   YDMGG   RDA  +P PI  L SALANA PEQQRT+LGE+LYP
Sbjct  527  MPDVPPMPGVAGGMIQSYDMGGFPVRDAGLSPAPIGTLTSALANANPEQQRTILGESLYP  586

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ---AKIPAD  115
            LV+ LE  HAAKVTGMLLEMDQTEVLHLLESPEALK+KVAEA++VLRNV Q   A  P  
Sbjct  587  LVELLEQNHAAKVTGMLLEMDQTEVLHLLESPEALKSKVAEAMDVLRNVAQQHNANTPTS  646

Query  114  QLASLSLNDNLVA  76
            QLA+LSL D +++
Sbjct  647  QLAALSLGDAIIS  659



>ref|XP_006659302.1| PREDICTED: polyadenylate-binding protein 8-like [Oryza brachyantha]
Length=659

 Score =   196 bits (497),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 187/252 (74%), Gaps = 6/252 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+ M PS+APR+PMYPPG PG+ QQLFYGQ PPA + PQ G+G+QQ L+PGMR
Sbjct  409  AQFSQMRPMVMPPSVAPRMPMYPPGVPGVGQQLFYGQPPPAFVNPQPGYGFQQHLIPGMR  468

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PG GP+PNF +PMVQQGQQ    G R GAG +QQ  Q           RG      G   
Sbjct  469  PGVGPIPNFVMPMVQQGQQPRPAGRRAGAGGIQQPMQMSHQQMLSRGGRGGYRYASGR-G  527

Query  456  VSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYP  286
            ++D    GVGG+V  PY+MG +   DA    P+PI ALASALAN+PP+QQR MLGE+LYP
Sbjct  528  MTDTGFRGVGGLVPSPYEMGRLPLSDAGAPQPLPIGALASALANSPPDQQRLMLGESLYP  587

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQ  112
            LVDQLEH+ AAKVTGMLLEMDQTEVLHL+ESP+ALKAKVAEA+EVL N   QQA  P D+
Sbjct  588  LVDQLEHDQAAKVTGMLLEMDQTEVLHLIESPDALKAKVAEAMEVLHNAQQQQANTPTDR  647

Query  111  LASLSLNDNLVA  76
            LA+L+L+D +V+
Sbjct  648  LAALTLSDGVVS  659



>gb|KJB14629.1| hypothetical protein B456_002G134900 [Gossypium raimondii]
Length=651

 Score =   193 bits (490),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 193/254 (76%), Positives = 219/254 (86%), Gaps = 9/254 (4%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+   PS+APR+PMYP GAPG+ QQ  YGQ PPA++PPQA FGYQQQL+PGMR
Sbjct  400  AQFSQMRPI--IPSVAPRMPMYPAGAPGLGQQFLYGQAPPAMLPPQASFGYQQQLLPGMR  457

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG P+PNFFVPMVQQGQQ  RPGGRRGAG VQQTQQP+P+MQQQM+PRGR YRYP GRN
Sbjct  458  PGGPPVPNFFVPMVQQGQQGQRPGGRRGAGAVQQTQQPMPMMQQQMMPRGRAYRYPPGRN  517

Query  456  VSDGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            + + P+  VGG M+S+PYDMGGM  RDAA   P+PI ALA+ALANA PEQQRTMLGE+LY
Sbjct  518  MPEVPLSNVGGGMLSVPYDMGGMSLRDAAIGQPMPIPALATALANATPEQQRTMLGESLY  577

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPA  118
            PLV++LE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V   QQA   A
Sbjct  578  PLVERLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAAQQQANNQA  637

Query  117  DQLASLSLNDNLVA  76
            DQLASLSLNDNLV+
Sbjct  638  DQLASLSLNDNLVS  651



>gb|KHG04753.1| Polyadenylate-binding 2 -like protein [Gossypium arboreum]
Length=590

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 192/254 (76%), Positives = 219/254 (86%), Gaps = 9/254 (4%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+   PS+APR+PM+PPGAPG+ QQ  YGQ PPA++PPQA FGYQQQL+PGMR
Sbjct  339  AQFSQMRPI--IPSVAPRMPMFPPGAPGLGQQFLYGQAPPAMLPPQASFGYQQQLLPGMR  396

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG P+PNFFVPMVQQGQQ  RPGGRRGAG VQQTQQP+P+MQQQM+PRGR YRYP GRN
Sbjct  397  PGGPPVPNFFVPMVQQGQQGQRPGGRRGAGAVQQTQQPMPMMQQQMMPRGRAYRYPPGRN  456

Query  456  VSDGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            + + P+  VGG M+S+PYDMGGM  RDA    P+PI ALA+ALANA PEQQRTMLGE+LY
Sbjct  457  MPEVPLSNVGGGMLSVPYDMGGMPLRDAGIGQPMPIPALATALANATPEQQRTMLGESLY  516

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPA  118
            PLV++LE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V   QQA   A
Sbjct  517  PLVERLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAAQQQANNQA  576

Query  117  DQLASLSLNDNLVA  76
            DQLASLSLNDNLV+
Sbjct  577  DQLASLSLNDNLVS  590



>dbj|BAJ97269.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=663

 Score =   190 bits (483),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 158/252 (63%), Positives = 182/252 (72%), Gaps = 6/252 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV M P +APR+PMYPPG PGM QQLFYGQ PPA + PQ G+G+QQ ++PGMR
Sbjct  412  AQFSQMRPV-MPPPVAPRMPMYPPGVPGMGQQLFYGQPPPAFVNPQPGYGFQQHMIPGMR  470

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PG  PMPNF +PMVQQGQQ  RP GRR      Q   P+   Q         YRY  GR 
Sbjct  471  PGVAPMPNFVMPMVQQGQQPQRPSGRRAGAGGMQQPMPMGHQQMVPRGGRGGYRYASGRG  530

Query  456  VSDGPMPGVGGMVSLPYDMGGMLPRDAAP---VPITALASALANAPPEQQRTMLGENLYP  286
            + +    GVGGM    Y+MG M P D      V   ALASALAN+PPEQQR MLGE+LYP
Sbjct  531  MPEAAFRGVGGMAPSLYEMGRMTPGDTGAPQQVSSGALASALANSPPEQQRLMLGESLYP  590

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQ  112
            LVDQLEH+ AAKVTGMLLEMDQTEVLHL+ESP+ALK+KVAEA+EVLR+   QQ  +PADQ
Sbjct  591  LVDQLEHDQAAKVTGMLLEMDQTEVLHLIESPDALKSKVAEAMEVLRSAQQQQTNVPADQ  650

Query  111  LASLSLNDNLVA  76
            LA+LSL+D  VA
Sbjct  651  LAALSLSDGFVA  662



>dbj|BAJ90169.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87575.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=663

 Score =   190 bits (483),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 158/252 (63%), Positives = 182/252 (72%), Gaps = 6/252 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV M P +APR+PMYPPG PGM QQLFYGQ PPA + PQ G+G+QQ ++PGMR
Sbjct  412  AQFSQMRPV-MPPPVAPRMPMYPPGVPGMGQQLFYGQPPPAFVNPQPGYGFQQHMIPGMR  470

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PG  PMPNF +PMVQQGQQ  RP GRR      Q   P+   Q         YRY  GR 
Sbjct  471  PGVAPMPNFVMPMVQQGQQPQRPSGRRAGAGGMQQPMPMGHQQMVPRGGRGGYRYASGRG  530

Query  456  VSDGPMPGVGGMVSLPYDMGGMLPRDAAP---VPITALASALANAPPEQQRTMLGENLYP  286
            + +    GVGGM    Y+MG M P D      V   ALASALAN+PPEQQR MLGE+LYP
Sbjct  531  MPEAAFRGVGGMAPSLYEMGRMTPGDTGAPQQVSSGALASALANSPPEQQRLMLGESLYP  590

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQ  112
            LVDQLEH+ AAKVTGMLLEMDQTEVLHL+ESP+ALK+KVAEA+EVLR+   QQ  +PADQ
Sbjct  591  LVDQLEHDQAAKVTGMLLEMDQTEVLHLIESPDALKSKVAEAMEVLRSAQQQQTNVPADQ  650

Query  111  LASLSLNDNLVA  76
            LA+LSL+D  VA
Sbjct  651  LAALSLSDGFVA  662



>gb|EMT14398.1| Polyadenylate-binding protein 2 [Aegilops tauschii]
Length=573

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 187/252 (74%), Gaps = 7/252 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV M  ++ PR+ M PPG P + QQ+FYGQ PPA I PQ GFG+QQ  +PGMR
Sbjct  323  AQFSQMRPVPMAQTVGPRMQMLPPGVP-VGQQMFYGQ-PPAFINPQPGFGFQQPFMPGMR  380

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNF +PMVQQGQQ  RP GRR      Q    +   Q      GR YRYP GR 
Sbjct  381  PGGAPMPNFMMPMVQQGQQPQRPAGRRAGAGGMQQSMQMGQQQMMGRGGGRGYRYPTGRG  440

Query  456  VSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYP  286
            + D  M GVGG+++ PY+MGGM  RDA    PVPI ALASALAN+PPE QR MLGENLYP
Sbjct  441  MPDPAMHGVGGVMTSPYEMGGMPMRDAGASQPVPIGALASALANSPPETQRMMLGENLYP  500

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ--AKIPADQ  112
            LVDQLEH+ AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVLR+ QQ   + P  Q
Sbjct  501  LVDQLEHDQAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLRSAQQHTNQSPEQQ  560

Query  111  LASLSLNDNLVA  76
            LASLSLND L++
Sbjct  561  LASLSLNDGLIS  572



>gb|EMS55649.1| Polyadenylate-binding protein 2 [Triticum urartu]
Length=625

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 187/252 (74%), Gaps = 7/252 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV M  ++ PR+ M PPG P + QQ+FYGQ PPA I PQ GFG+QQ  +PGMR
Sbjct  375  AQFSQMRPVPMAQTVGPRMQMLPPGVP-VGQQMFYGQ-PPAFINPQPGFGFQQPFMPGMR  432

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNF +PMVQQGQQ  RP GRR      Q    +   Q      GR YRYP GR 
Sbjct  433  PGGAPMPNFMMPMVQQGQQPQRPAGRRAGAGGMQQSMQMGQQQMMGRGGGRGYRYPTGRG  492

Query  456  VSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYP  286
            + D  M GVGG+++ PY+MGGM  RDA    PVPI ALASALAN+PPE QR MLGENLYP
Sbjct  493  MPDPAMHGVGGVMTSPYEMGGMPMRDAGASQPVPIGALASALANSPPETQRMMLGENLYP  552

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ--AKIPADQ  112
            LVDQLEH+ AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVLR+ QQ   + P  Q
Sbjct  553  LVDQLEHDQAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLRSAQQHTNQSPEQQ  612

Query  111  LASLSLNDNLVA  76
            LASLSLND L++
Sbjct  613  LASLSLNDGLIS  624



>gb|AAB38974.1| poly(A)-binding protein [Triticum aestivum]
Length=651

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 163/252 (65%), Positives = 186/252 (74%), Gaps = 7/252 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV M  ++ PR+ M PPG P + QQ+FYGQ PPA I PQ GFG+QQ  +PGMR
Sbjct  401  AQFSQMRPVPMAQTVGPRMQMLPPGVP-VGQQMFYGQ-PPAFINPQPGFGFQQPFMPGMR  458

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNF +PMVQQGQQ  RP GRR      Q    +   Q      GR YRY  GR 
Sbjct  459  PGGAPMPNFMMPMVQQGQQPQRPAGRRAGAGGMQQSMQMGQQQMLGRGGGRGYRYQTGRG  518

Query  456  VSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYP  286
            + D  M GVGG+++ PY+MGGM  RDA    PVPI ALASALAN+PPE QR MLGENLYP
Sbjct  519  MPDPAMHGVGGVMTSPYEMGGMPMRDAGESQPVPIGALASALANSPPETQRMMLGENLYP  578

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ--AKIPADQ  112
            LVDQLEH+ AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVLR+ QQ   + P  Q
Sbjct  579  LVDQLEHDQAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLRSAQQHTNQSPEQQ  638

Query  111  LASLSLNDNLVA  76
            LASLSLND L++
Sbjct  639  LASLSLNDGLIS  650



>gb|KJB14632.1| hypothetical protein B456_002G134900 [Gossypium raimondii]
Length=652

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 193/255 (76%), Positives = 219/255 (86%), Gaps = 10/255 (4%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+   PS+APR+PMYP GAPG+ QQ  YGQ PPA++PPQA FGYQQQL+PGMR
Sbjct  400  AQFSQMRPI--IPSVAPRMPMYPAGAPGLGQQFLYGQAPPAMLPPQASFGYQQQLLPGMR  457

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG P+PNFFVPMVQQGQQ  RPGGRRGAG VQQTQQP+P+MQQQM+PRGR YRYP GRN
Sbjct  458  PGGPPVPNFFVPMVQQGQQGQRPGGRRGAGAVQQTQQPMPMMQQQMMPRGRAYRYPPGRN  517

Query  456  VSDGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRT-MLGENL  292
            + + P+  VGG M+S+PYDMGGM  RDAA   P+PI ALA+ALANA PEQQRT MLGE+L
Sbjct  518  MPEVPLSNVGGGMLSVPYDMGGMSLRDAAIGQPMPIPALATALANATPEQQRTQMLGESL  577

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIP  121
            YPLV++LE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V   QQA   
Sbjct  578  YPLVERLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAAQQQANNQ  637

Query  120  ADQLASLSLNDNLVA  76
            ADQLASLSLNDNLV+
Sbjct  638  ADQLASLSLNDNLVS  652



>dbj|BAJ96406.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   189 bits (479),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 163/252 (65%), Positives = 186/252 (74%), Gaps = 7/252 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV M  ++ PR+ M PPG P + QQ+FYGQ PPA I PQ GFG+QQ  +PGMR
Sbjct  494  AQFSQMRPVPMAQTVGPRMQMLPPGVP-VGQQMFYGQ-PPAFINPQPGFGFQQPFMPGMR  551

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNF +PMVQQGQQ  RP GRR      Q    +   Q      GR YRYP GR 
Sbjct  552  PGGAPMPNFMMPMVQQGQQPQRPAGRRAGAGGMQQSMQMGQQQMMGRGGGRGYRYPTGRG  611

Query  456  VSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYP  286
            + D  M GVGG+++ PY+MGGM  RDA    PVPI ALASALAN+PPE QR MLGENLYP
Sbjct  612  MPDPAMHGVGGVMTSPYEMGGMPMRDAGASQPVPIGALASALANSPPETQRMMLGENLYP  671

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ--AKIPADQ  112
            LVDQLEH+ AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EV R+ QQ   + P  Q
Sbjct  672  LVDQLEHDQAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVFRSAQQHTNQSPEQQ  731

Query  111  LASLSLNDNLVA  76
            LASLSLND L++
Sbjct  732  LASLSLNDGLIS  743



>ref|NP_001167831.1| uncharacterized protein LOC100381531 [Zea mays]
 gb|ACN26239.1| unknown [Zea mays]
Length=249

 Score =   176 bits (445),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 182/249 (73%), Gaps = 8/249 (3%)
 Frame = -1

Query  801  MRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmrpgggp  622
            MRPVAM PS+ PR+PM+PP  PG+ QQLFYGQ PPA I PQAGF +QQ ++PGMRPGG  
Sbjct  1    MRPVAMAPSVGPRMPMFPPSVPGVGQQLFYGQPPPAFINPQAGFAFQQPMMPGMRPGGPM  60

Query  621  mPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRNVSDGP  442
              NF +PMVQQGQQ  RP GRR      Q   P+   QQ     GR YRY  GR + D  
Sbjct  61   P-NFMMPMVQQGQQPQRPAGRRAGSGGMQQPMPMGSQQQIFPRGGRGYRYATGRGMPDPG  119

Query  441  MPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQL  271
            M  VG ++  PY+MGGM  RDA    PVPI ALA+ALANA P+QQR MLGENLYPLV+QL
Sbjct  120  MHNVGAVMPSPYEMGGMAMRDAGVSQPVPIGALATALANASPDQQRLMLGENLYPLVEQL  179

Query  270  EHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLR---NVQQAKIPAD-QLAS  103
            E E AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVLR   ++QQ+    + QLA+
Sbjct  180  EREQAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLRSAQHLQQSNASTEQQLAN  239

Query  102  LSLNDNLVA  76
            LSLND +++
Sbjct  240  LSLNDGVLS  248



>tpg|DAA39543.1| TPA: hypothetical protein ZEAMMB73_983793 [Zea mays]
Length=246

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 150/248 (60%), Positives = 175/248 (71%), Gaps = 9/248 (4%)
 Frame = -1

Query  801  MRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmrpgggp  622
            MRPVAM PS+ PR+PM+PPG PG+ QQLFYGQ PPA I PQAGF +Q Q +      GGP
Sbjct  1    MRPVAMAPSVGPRMPMFPPGVPGVGQQLFYGQPPPAFINPQAGFAFQ-QPLMPGMRPGGP  59

Query  621  mPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRNVSDGP  442
            MPNF +PMVQQGQQ  RP GRR  G  Q               RG  Y       + D  
Sbjct  60   MPNFMMPMVQQGQQPQRPAGRRAGGMQQPMPMGGQQQVFPRGGRGYRYPTGR--GMPDPG  117

Query  441  MPGVGGMVSLPYDMGGMLPRDAAP--VPITALASALANAPPEQQRTMLGENLYPLVDQLE  268
            M  VG ++   Y+MGGM  R+AAP  VPI ALA+ALANAPP+QQR MLGENLYPLV+QLE
Sbjct  118  MHSVGAVMPPSYEMGGMPMREAAPQPVPIGALATALANAPPDQQRLMLGENLYPLVEQLE  177

Query  267  HEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLR---NVQQAKIPAD-QLASL  100
             E AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVLR   ++QQ+ +  + QLA+L
Sbjct  178  REQAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLRSAQHLQQSNVSTEQQLANL  237

Query  99   SLNDNLVA  76
            SLND +V+
Sbjct  238  SLNDGVVS  245



>ref|XP_006421219.1| hypothetical protein CICLE_v10007158mg, partial [Citrus clementina]
 gb|ESR34459.1| hypothetical protein CICLE_v10007158mg, partial [Citrus clementina]
Length=437

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 172/253 (68%), Positives = 195/253 (77%), Gaps = 22/253 (9%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MR VA+ PS+ PR+PMYP                PAIIPPQAGFGYQQQLV GM 
Sbjct  179  AQFSQMRTVAIAPSVPPRMPMYPHA--------------PAIIPPQAGFGYQQQLVLGMS  224

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFFVP+V QGQQ    GGRRGAGPVQQTQQP+P+MQQQMLPR  +YR P GRN
Sbjct  225  PGGAPMPNFFVPVVLQGQQDQCLGGRRGAGPVQQTQQPLPMMQQQMLPRAHVYRCPLGRN  284

Query  456  VSDGPMPGVGG-MVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGENL  292
            + D PM GV G M+ +P+DMG  +PR  A    P PIT L++ALANA PEQ+RT+ GE+L
Sbjct  285  MQDVPMQGVAGCMLPIPFDMGAGMPRRDASVGQPTPITPLSTALANASPEQRRTLPGESL  344

Query  291  YPLVDQLEHEHAA-KVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIP  121
            YPL++QLE + AA KVTGMLLEM QTEVLHLLESPEA KAKVAEA+EVLR+V  QQA  P
Sbjct  345  YPLIEQLERDAAAEKVTGMLLEMHQTEVLHLLESPEAFKAKVAEAMEVLRSVAQQQANNP  404

Query  120  ADQLASLSLNDNL  82
            ADQLASLSLNDNL
Sbjct  405  ADQLASLSLNDNL  417



>emb|CDY62723.1| BnaC03g77220D [Brassica napus]
Length=617

 Score =   178 bits (452),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 150/242 (62%), Positives = 172/242 (71%), Gaps = 14/242 (6%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+ RPVAM PS  PR+PM+PPG PG+ QQ+FYGQ PP +IPPQ G+GYQQQLVPGMR
Sbjct  390  AQFSQPRPVAMPPSAGPRMPMFPPGGPGIGQQMFYGQAPPTMIPPQPGYGYQQQLVPGMR  449

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGGG  PN+F+PMVQ  QQ P  GGRR  G  Q  QQP  +  Q               N
Sbjct  450  PGGGHGPNYFMPMVQPHQQRPGVGGRRPGGIQQFQQQPPMMQHQMHPRGR---------N  500

Query  456  VSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVD  277
            +      GV G    PYDMG     +  P+PI  LAS LANA PEQQRTMLGENLYPLV+
Sbjct  501  IRYSQGRGVSGGDVPPYDMG----NNNMPLPIGTLASNLANASPEQQRTMLGENLYPLVE  556

Query  276  QLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLS  97
            +LE E AAKVTGMLLEMDQTEVLHLLESPEAL+AKVAEA++VLR+V  A   A+QLASL+
Sbjct  557  KLEAESAAKVTGMLLEMDQTEVLHLLESPEALEAKVAEAMDVLRSV-AAGGAAEQLASLN  615

Query  96   LN  91
            L+
Sbjct  616  LS  617



>ref|XP_009108756.1| PREDICTED: polyadenylate-binding protein 2 [Brassica rapa]
Length=619

 Score =   178 bits (452),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 150/242 (62%), Positives = 172/242 (71%), Gaps = 14/242 (6%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+ RPVAM PS  PR+PM+PPG PG+ QQ+FYGQ PP +IPPQ G+GYQQQLVPGMR
Sbjct  392  AQFSQPRPVAMPPSAGPRMPMFPPGGPGIGQQMFYGQAPPTMIPPQPGYGYQQQLVPGMR  451

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGGG  PN+F+PMVQ  QQ P  GGRR  G  Q  QQP  +  Q               N
Sbjct  452  PGGGHGPNYFMPMVQPHQQRPGGGGRRPGGIQQFQQQPPMMQHQMHPRGR---------N  502

Query  456  VSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVD  277
            +      GV G    PYDMG     +  P+PI  LAS LANA PEQQRTMLGENLYPLV+
Sbjct  503  IRYSQGRGVSGGDVPPYDMG----NNNMPLPIGTLASNLANASPEQQRTMLGENLYPLVE  558

Query  276  QLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLS  97
            +LE E AAKVTGMLLEMDQTEVLHLLESPEAL+AKVAEA++VLR+V  A   A+QLASL+
Sbjct  559  KLEAESAAKVTGMLLEMDQTEVLHLLESPEALEAKVAEAMDVLRSV-AAGGAAEQLASLN  617

Query  96   LN  91
            L+
Sbjct  618  LS  619



>emb|CDY51957.1| BnaA08g11610D [Brassica napus]
Length=619

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 149/242 (62%), Positives = 172/242 (71%), Gaps = 14/242 (6%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+ RPVAM P+  PR+PM+PPG PG+ QQ+FYGQ PP +IPPQ G+GYQQQLVPGMR
Sbjct  392  AQFSQPRPVAMPPTAGPRMPMFPPGGPGIGQQMFYGQAPPTMIPPQPGYGYQQQLVPGMR  451

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGGG  PN+F+PMVQ  QQ P  GGRR  G  Q  QQP  +  Q               N
Sbjct  452  PGGGHGPNYFMPMVQPHQQRPGGGGRRPGGIQQFQQQPPMMQHQMHPRGR---------N  502

Query  456  VSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVD  277
            +      GV G    PYDMG     +  P+PI  LAS LANA PEQQRTMLGENLYPLV+
Sbjct  503  IRYSQGRGVSGGDVPPYDMG----NNNMPLPIGTLASNLANASPEQQRTMLGENLYPLVE  558

Query  276  QLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLS  97
            +LE E AAKVTGMLLEMDQTEVLHLLESPEAL+AKVAEA++VLR+V  A   A+QLASL+
Sbjct  559  KLEAESAAKVTGMLLEMDQTEVLHLLESPEALEAKVAEAMDVLRSV-AAGGAAEQLASLN  617

Query  96   LN  91
            L+
Sbjct  618  LS  619



>gb|KJB14633.1| hypothetical protein B456_002G134900 [Gossypium raimondii]
Length=645

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 188/254 (74%), Positives = 214/254 (84%), Gaps = 15/254 (6%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+   PS+APR+PMYP GAPG+ QQ  YGQ PPA++PPQ      QQL+PGMR
Sbjct  400  AQFSQMRPI--IPSVAPRMPMYPAGAPGLGQQFLYGQAPPAMLPPQ------QQLLPGMR  451

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG P+PNFFVPMVQQGQQ  RPGGRRGAG VQQTQQP+P+MQQQM+PRGR YRYP GRN
Sbjct  452  PGGPPVPNFFVPMVQQGQQGQRPGGRRGAGAVQQTQQPMPMMQQQMMPRGRAYRYPPGRN  511

Query  456  VSDGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            + + P+  VGG M+S+PYDMGGM  RDAA   P+PI ALA+ALANA PEQQRTMLGE+LY
Sbjct  512  MPEVPLSNVGGGMLSVPYDMGGMSLRDAAIGQPMPIPALATALANATPEQQRTMLGESLY  571

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPA  118
            PLV++LE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V   QQA   A
Sbjct  572  PLVERLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAAQQQANNQA  631

Query  117  DQLASLSLNDNLVA  76
            DQLASLSLNDNLV+
Sbjct  632  DQLASLSLNDNLVS  645



>ref|XP_003603074.1| Poly(A)-binding protein [Medicago truncatula]
 gb|AES73325.1| polyadenylate-binding protein [Medicago truncatula]
Length=622

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 170/247 (69%), Positives = 189/247 (77%), Gaps = 21/247 (9%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPV M P +APR+P YP G PGM QQ+ YGQ PPA I  QAGFGY QQLVPGMR
Sbjct  393  AQFSQVRPVTMAP-IAPRLPFYPAGVPGMGQQIMYGQAPPAFIS-QAGFGYPQQLVPGMR  450

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PMPNFF+PMVQQGQQ  RPGGRRGA P+QQ    +P+MQQQM PRGR+YRYP GRN
Sbjct  451  PGGAPMPNFFMPMVQQGQQGQRPGGRRGASPMQQLPHSLPMMQQQMHPRGRVYRYPTGRN  510

Query  456  VSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVD  277
                PMPGV G                   P+ ALA+ALANAPPEQQRTMLGE LYPLV+
Sbjct  511  PQGIPMPGVAG-----------------GTPMQALATALANAPPEQQRTMLGEVLYPLVE  553

Query  276  QLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQLAS  103
            ++EH  AAKVTGMLLEMDQ EVLHL+ESPEALK KVAEA++VLRNV  QQ+  P DQLAS
Sbjct  554  KIEHAGAAKVTGMLLEMDQPEVLHLIESPEALKTKVAEAVDVLRNVAQQQSNSPTDQLAS  613

Query  102  LSLNDNL  82
            LSLNDNL
Sbjct  614  LSLNDNL  620



>gb|EPS62510.1| hypothetical protein M569_12280, partial [Genlisea aurea]
Length=524

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 114/128 (89%), Gaps = 7/128 (5%)
 Frame = -1

Query  459  NVSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            N+ D P+P  GG++S+PYDMGGMLPRD A   P+PITALASALANA  EQQRTMLGENLY
Sbjct  401  NMPDVPIPS-GGLLSVPYDMGGMLPRDVAIPQPMPITALASALANATLEQQRTMLGENLY  459

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQL  109
            PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP+ALKAKV EA++VLRNVQQ   PADQL
Sbjct  460  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPDALKAKVGEAMDVLRNVQQ---PADQL  516

Query  108  ASLSLNDN  85
            ASLSLND+
Sbjct  517  ASLSLNDD  524


 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RP+AM PS+ PR+P+YPP A G+ QQLFYGQ PPA+IPPQAGFGYQ QLVPG+ 
Sbjct  280  AQFSQVRPIAMAPSIGPRMPLYPPVAAGIGQQLFYGQAPPAMIPPQAGFGYQHQLVPGIH  339

Query  636  pgggpmPNFFVPM  598
            PG GPMPN FVPM
Sbjct  340  PGAGPMPNIFVPM  352



>ref|XP_008347611.1| PREDICTED: polyadenylate-binding protein 8-like [Malus domestica]
Length=213

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 180/213 (85%), Gaps = 4/213 (2%)
 Frame = -1

Query  717  FYGQGPPAIIPPQAGFGYQQQLVpgmrpgggpmPNFFVPMvqqgqqaprpggrrgagpvq  538
             YGQ PPAIIPPQAGFGYQQQLVPG+RPGG PMPNFFVPMVQQGQQ  RPGGRRGAGPVQ
Sbjct  1    MYGQAPPAIIPPQAGFGYQQQLVPGLRPGGAPMPNFFVPMVQQGQQGQRPGGRRGAGPVQ  60

Query  537  qtqqpiplmqqqmlprgrmyrypggRNVSDGPMPGVGG-MVSLPYDMGGMLPRDAAP-VP  364
              QQP+P+MQQ MLPRGR+YRYP GRN+ + P  GVGG M S+PYDMG +  RDAA    
Sbjct  61   PNQQPVPMMQQHMLPRGRVYRYPPGRNMQEVPFSGVGGGMHSVPYDMGPIPIRDAAGGQG  120

Query  363  ITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPea  184
            + ALA+ALANA  EQQRTMLGE LYPLVDQLEHE AAKVTGMLLEMDQTEVLHLLESPEA
Sbjct  121  VPALATALANASTEQQRTMLGEALYPLVDQLEHESAAKVTGMLLEMDQTEVLHLLESPEA  180

Query  183  lkakvaealevLRNV--QQAKIPADQLASLSLN  91
            LKAKVAEA++VLRNV  QQA   ADQLASL+L 
Sbjct  181  LKAKVAEAMDVLRNVAQQQANSSADQLASLTLE  213



>ref|XP_002283105.1| PREDICTED: polyadenylate-binding protein 2 [Vitis vinifera]
 emb|CBI21386.3| unnamed protein product [Vitis vinifera]
Length=654

 Score =   164 bits (416),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 116/134 (87%), Gaps = 6/134 (4%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  292
            N++D P+PGV GGM+S PYDM GM  RDAA   P+PI ALA+ALANAPP+QQRT+LGENL
Sbjct  521  NMADVPIPGVPGGMLSAPYDMAGMPFRDAAVSQPMPIGALATALANAPPDQQRTLLGENL  580

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPA  118
            YPLVDQLEHE AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV  QQA  P 
Sbjct  581  YPLVDQLEHEMAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAQQQANNPT  640

Query  117  DQLASLSLNDNLVA  76
            D++ASLSLND L +
Sbjct  641  DRMASLSLNDTLTS  654


 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP AM PS+ PR+ MYPPGAPG+ QQLFYGQGPPA+IPPQ GFGYQ QLVPGMR
Sbjct  401  AQFSQMRPAAMAPSVGPRMSMYPPGAPGLGQQLFYGQGPPALIPPQPGFGYQHQLVPGMR  460

Query  636  pgggpmPNFFVPM  598
            PG  PMPNFFVPM
Sbjct  461  PGAAPMPNFFVPM  473



>ref|XP_010270544.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Nelumbo 
nucifera]
Length=648

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 116/138 (84%), Gaps = 10/138 (7%)
 Frame = -1

Query  459  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  295
            N+ D PMPGV G M+S+PYDMGGM  RDAA    P+PI ALASALANA PEQQRTMLGE+
Sbjct  511  NIPDVPMPGVAGSMLSVPYDMGGMPLRDAAAITQPIPIGALASALANATPEQQRTMLGES  570

Query  294  LYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKI---  124
            LYPLVDQLEHE AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV Q +    
Sbjct  571  LYPLVDQLEHEMAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAQQQQQQS  630

Query  123  --PADQLASLSLNDNLVA  76
              P DQLASLSLNDNLV+
Sbjct  631  VSPTDQLASLSLNDNLVS  648


 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 63/73 (86%), Gaps = 7/73 (10%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM+PS+APR+PMYPPG PG+ QQ+FYGQGPP +IPP      QQQLVPGMR
Sbjct  398  AQFSQMRPVAMSPSVAPRVPMYPPGGPGLGQQIFYGQGPP-LIPP------QQQLVPGMR  450

Query  636  pgggpmPNFFVPM  598
            PGG P+PNFFVP+
Sbjct  451  PGGAPLPNFFVPL  463



>ref|XP_010270536.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Nelumbo 
nucifera]
Length=654

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 116/138 (84%), Gaps = 10/138 (7%)
 Frame = -1

Query  459  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  295
            N+ D PMPGV G M+S+PYDMGGM  RDAA    P+PI ALASALANA PEQQRTMLGE+
Sbjct  517  NIPDVPMPGVAGSMLSVPYDMGGMPLRDAAAITQPIPIGALASALANATPEQQRTMLGES  576

Query  294  LYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKI---  124
            LYPLVDQLEHE AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV Q +    
Sbjct  577  LYPLVDQLEHEMAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAQQQQQQS  636

Query  123  --PADQLASLSLNDNLVA  76
              P DQLASLSLNDNLV+
Sbjct  637  VSPTDQLASLSLNDNLVS  654


 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 1/73 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM+PS+APR+PMYPPG PG+ QQ+FYGQGPP +IPPQ GFGYQQQLVPGMR
Sbjct  398  AQFSQMRPVAMSPSVAPRVPMYPPGGPGLGQQIFYGQGPP-LIPPQPGFGYQQQLVPGMR  456

Query  636  pgggpmPNFFVPM  598
            PGG P+PNFFVP+
Sbjct  457  PGGAPLPNFFVPL  469



>ref|XP_009386708.1| PREDICTED: polyadenylate-binding protein 2-like isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=652

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 114/135 (84%), Gaps = 8/135 (6%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENL  292
            N+ D P+PGV GGM+S PYDMGG+  RDA    P+PI ALASALANA PEQQR MLGENL
Sbjct  519  NMPDIPIPGVVGGMLS-PYDMGGLPMRDAPMSQPIPIGALASALANATPEQQRMMLGENL  577

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIP  121
            YPLV+QLEH+HAAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVLRNV    QA  P
Sbjct  578  YPLVEQLEHDHAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLRNVAQQHQANAP  637

Query  120  ADQLASLSLNDNLVA  76
             DQLA+LSLND LV+
Sbjct  638  TDQLAALSLNDGLVS  652


 Score = 90.9 bits (224),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM P+   R PMYPPGAPG+ Q +FYGQ PP +IPPQ GFG+QQQL+PGMR
Sbjct  399  AQFSQVRPVAMVPTAGTRFPMYPPGAPGVGQHIFYGQAPPGLIPPQPGFGFQQQLIPGMR  458

Query  636  pgggpmPNFFVPM  598
            P G PMPNF VP+
Sbjct  459  PTGAPMPNFLVPL  471



>ref|XP_009386707.1| PREDICTED: polyadenylate-binding protein 2-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=653

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 114/135 (84%), Gaps = 8/135 (6%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENL  292
            N+ D P+PGV GGM+S PYDMGG+  RDA    P+PI ALASALANA PEQQR MLGENL
Sbjct  520  NMPDIPIPGVVGGMLS-PYDMGGLPMRDAPMSQPIPIGALASALANATPEQQRMMLGENL  578

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIP  121
            YPLV+QLEH+HAAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVLRNV    QA  P
Sbjct  579  YPLVEQLEHDHAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLRNVAQQHQANAP  638

Query  120  ADQLASLSLNDNLVA  76
             DQLA+LSLND LV+
Sbjct  639  TDQLAALSLNDGLVS  653


 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM P+   R PMYPPGAPG+ Q +FYGQ PP +IPPQ GFG+QQQL+PGMR
Sbjct  399  AQFSQVRPVAMVPTAGTRFPMYPPGAPGVGQHIFYGQAPPGLIPPQPGFGFQQQLIPGMR  458

Query  636  pgggpmPNFFVPM  598
            P G PMPNF VP+
Sbjct  459  PTGAPMPNFLVPL  471



>ref|XP_009386706.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=657

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 114/135 (84%), Gaps = 8/135 (6%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENL  292
            N+ D P+PGV GGM+S PYDMGG+  RDA    P+PI ALASALANA PEQQR MLGENL
Sbjct  524  NMPDIPIPGVVGGMLS-PYDMGGLPMRDAPMSQPIPIGALASALANATPEQQRMMLGENL  582

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIP  121
            YPLV+QLEH+HAAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVLRNV    QA  P
Sbjct  583  YPLVEQLEHDHAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLRNVAQQHQANAP  642

Query  120  ADQLASLSLNDNLVA  76
             DQLA+LSLND LV+
Sbjct  643  TDQLAALSLNDGLVS  657


 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM P+   R PMYPPGAPG+ Q +FYGQ PP +IPPQ GFG+QQQL+PGMR
Sbjct  404  AQFSQVRPVAMVPTAGTRFPMYPPGAPGVGQHIFYGQAPPGLIPPQPGFGFQQQLIPGMR  463

Query  636  pgggpmPNFFVPM  598
            P G PMPNF VP+
Sbjct  464  PTGAPMPNFLVPL  476



>ref|XP_009386705.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=658

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 114/135 (84%), Gaps = 8/135 (6%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENL  292
            N+ D P+PGV GGM+S PYDMGG+  RDA    P+PI ALASALANA PEQQR MLGENL
Sbjct  525  NMPDIPIPGVVGGMLS-PYDMGGLPMRDAPMSQPIPIGALASALANATPEQQRMMLGENL  583

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIP  121
            YPLV+QLEH+HAAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVLRNV    QA  P
Sbjct  584  YPLVEQLEHDHAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLRNVAQQHQANAP  643

Query  120  ADQLASLSLNDNLVA  76
             DQLA+LSLND LV+
Sbjct  644  TDQLAALSLNDGLVS  658


 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM P+   R PMYPPGAPG+ Q +FYGQ PP +IPPQ GFG+QQQL+PGMR
Sbjct  404  AQFSQVRPVAMVPTAGTRFPMYPPGAPGVGQHIFYGQAPPGLIPPQPGFGFQQQLIPGMR  463

Query  636  pgggpmPNFFVPM  598
            P G PMPNF VP+
Sbjct  464  PTGAPMPNFLVPL  476



>ref|XP_003529405.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
 gb|KHN43051.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=651

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 114/131 (87%), Gaps = 6/131 (5%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D P+PGV GGM S+PYD+GGM  RDA+    +P+ ALA+ALANA PEQQRTMLGENLYPL
Sbjct  521  DVPIPGVAGGMFSVPYDVGGMPLRDASISQQIPVGALATALANASPEQQRTMLGENLYPL  580

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQL  109
            V+QLE ++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLRNV  QQA   ADQL
Sbjct  581  VEQLEPDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRNVAQQQAGGTADQL  640

Query  108  ASLSLNDNLVA  76
            ASLSLNDNLV+
Sbjct  641  ASLSLNDNLVS  651


 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQF++MRPV M PS+ PR+PMYPPG PG+ QQLFY QGPPAIIP Q GFGYQQQL+PGMR
Sbjct  400  AQFAQMRPVGMPPSVGPRVPMYPPGGPGIGQQLFYSQGPPAIIPSQPGFGYQQQLMPGMR  459

Query  636  pgggpmPNFFVPM  598
            PG  P+PNFFVPM
Sbjct  460  PGAAPVPNFFVPM  472



>gb|AAF66824.1|AF190656_1 poly(A)-binding protein [Nicotiana tabacum]
Length=330

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 110/131 (84%), Gaps = 6/131 (5%)
 Frame = -1

Query  450  DGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D   PGVGG M S+PYDMGGM  RDA    P+P+ ALA+ALAN+ P +QRTMLGENLYPL
Sbjct  200  DVAFPGVGGGMFSIPYDMGGMPVRDAGIVQPIPVGALATALANSSPTEQRTMLGENLYPL  259

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQL  109
            V+QLE E AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV  QQ+  PADQL
Sbjct  260  VEQLEPETAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVSQQQSSNPADQL  319

Query  108  ASLSLNDNLVA  76
            ASLSLND LV+
Sbjct  320  ASLSLNDGLVS  330


 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+AM  S+APR+PMYPPG PG+ QQ+FYGQ  PA++PPQAGFGYQQQLVPGMR
Sbjct  77   AQFSQMRPIAMASSVAPRMPMYPPGGPGLGQQIFYGQPQPAMLPPQAGFGYQQQLVPGMR  136

Query  636  pgggpmPNFFVPM  598
            PGGGPMPNFF+PM
Sbjct  137  PGGGPMPNFFMPM  149



>ref|NP_001292658.1| polyadenylate-binding protein 2 [Cucumis sativus]
 gb|AAF63202.1|AF240679_1 poly(A)-binding protein [Cucumis sativus]
Length=649

 Score =   156 bits (395),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 112/128 (88%), Gaps = 5/128 (4%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D PMPGV GGM S+PY+MGGM PRDA    PVP+ ALASALANA P+QQRTMLGENLYPL
Sbjct  520  DLPMPGVAGGMFSVPYEMGGMPPRDAVHPQPVPVGALASALANATPDQQRTMLGENLYPL  579

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQLA  106
            V+QLE ++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V QQ+   ADQLA
Sbjct  580  VEQLEPDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAQQSGNAADQLA  639

Query  105  SLSLNDNL  82
            SLSL DNL
Sbjct  640  SLSLTDNL  647


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPR-IPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgm  640
            AQFS+M+P+AM  S+APR +PMYPPG PG+ QQ+FYGQ PP II  Q GFGYQQQL+PGM
Sbjct  398  AQFSQMQPMAMASSVAPRGMPMYPPGGPGIGQQIFYGQAPPTIISSQPGFGYQQQLMPGM  457

Query  639  rpgggpmPNFFVPM  598
            RPGGGPMPNFFVPM
Sbjct  458  RPGGGPMPNFFVPM  471



>gb|KGN43917.1| hypothetical protein Csa_7G073530 [Cucumis sativus]
Length=649

 Score =   156 bits (395),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 112/128 (88%), Gaps = 5/128 (4%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D PMPGV GGM S+PY+MGGM PRDA    PVP+ ALASALANA P+QQRTMLGENLYPL
Sbjct  520  DLPMPGVAGGMFSVPYEMGGMPPRDAVHPQPVPVGALASALANATPDQQRTMLGENLYPL  579

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQLA  106
            V+QLE ++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V QQ+   ADQLA
Sbjct  580  VEQLEPDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAQQSGNAADQLA  639

Query  105  SLSLNDNL  82
            SLSL DNL
Sbjct  640  SLSLTDNL  647


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPR-IPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgm  640
            AQFS+M+P+AM  S+APR +PMYPPG PG+ QQ+FYGQ PP II  Q GFGYQQQL+PGM
Sbjct  398  AQFSQMQPMAMASSVAPRGMPMYPPGGPGIGQQIFYGQAPPTIISSQPGFGYQQQLMPGM  457

Query  639  rpgggpmPNFFVPM  598
            RPGGGPMPNFFVPM
Sbjct  458  RPGGGPMPNFFVPM  471



>ref|XP_006574897.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
Length=648

 Score =   156 bits (394),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 6/131 (5%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D  MPGV GGM S+PYD+GGM  RDA+    +P+ ALA+ALANA PEQQRTMLGENLYPL
Sbjct  518  DVSMPGVAGGMFSVPYDVGGMPLRDASISQQIPVGALATALANASPEQQRTMLGENLYPL  577

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQL  109
            V+QLE ++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLRNV  QQA   ADQL
Sbjct  578  VEQLEPDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRNVAQQQAGGTADQL  637

Query  108  ASLSLNDNLVA  76
            ASLSLNDNLV+
Sbjct  638  ASLSLNDNLVS  648


 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQF++MRPV M PS+ PR+PMYPPG PG+ QQ+FY QGPPAIIP Q GFGYQQQLVPGMR
Sbjct  397  AQFAQMRPVGMPPSVGPRVPMYPPGGPGIGQQIFYAQGPPAIIPSQPGFGYQQQLVPGMR  456

Query  636  pgggpmPNFFVPM  598
            PG  P+PNFFVPM
Sbjct  457  PGAAPVPNFFVPM  469



>gb|KHN05826.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=648

 Score =   155 bits (393),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 6/131 (5%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D  MPGV GGM S+PYD+GGM  RDA+    +P+ ALA+ALANA PEQQRTMLGENLYPL
Sbjct  518  DVSMPGVAGGMFSVPYDVGGMPLRDASISQQIPVGALATALANASPEQQRTMLGENLYPL  577

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQL  109
            V+QLE ++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLRNV  QQA   ADQL
Sbjct  578  VEQLEPDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRNVAQQQAGGTADQL  637

Query  108  ASLSLNDNLVA  76
            ASLSLNDNLV+
Sbjct  638  ASLSLNDNLVS  648


 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQF++MRPV M PS+ PR+PMYPPG PG+ QQ+FY QGPPAIIP Q GFGYQQQLVPGMR
Sbjct  397  AQFAQMRPVGMPPSVGPRVPMYPPGGPGIGQQIFYAQGPPAIIPSQPGFGYQQQLVPGMR  456

Query  636  pgggpmPNFFVPM  598
            PG  P+PNFFVPM
Sbjct  457  PGAAPVPNFFVPM  469



>ref|XP_008454965.1| PREDICTED: polyadenylate-binding protein 2 [Cucumis melo]
Length=649

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 111/128 (87%), Gaps = 5/128 (4%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D PMPGV GGM S+PY+MGGM PRDA    PVP+ ALASALANA P+QQRTMLGENLYPL
Sbjct  520  DLPMPGVAGGMFSVPYEMGGMPPRDAVHPQPVPVGALASALANATPDQQRTMLGENLYPL  579

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQLA  106
            V+QLE ++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V QQ    ADQLA
Sbjct  580  VEQLEPDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAQQTGNAADQLA  639

Query  105  SLSLNDNL  82
            SLSL DNL
Sbjct  640  SLSLTDNL  647


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPR-IPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgm  640
            AQFS+M+P+AM  S+APR +PMYPPG PG+ QQ+FYGQ PP II  Q GFGYQQQL+PGM
Sbjct  398  AQFSQMQPMAMASSVAPRGMPMYPPGGPGIGQQIFYGQAPPTIISSQPGFGYQQQLMPGM  457

Query  639  rpgggpmPNFFVPM  598
            RPGGGPMPNFFVPM
Sbjct  458  RPGGGPMPNFFVPM  471



>ref|XP_009600995.1| PREDICTED: polyadenylate-binding protein 8-like [Nicotiana tomentosiformis]
 gb|AAF66823.1|AF190655_1 poly(A)-binding protein [Nicotiana tabacum]
Length=649

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 110/131 (84%), Gaps = 6/131 (5%)
 Frame = -1

Query  450  DGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D   PGVGG M S+PYDMGGM  RDA    P+P+ ALA+ALAN+ P +QRTMLGENLYPL
Sbjct  519  DVAFPGVGGGMFSIPYDMGGMPVRDAGIVQPIPVGALATALANSSPTEQRTMLGENLYPL  578

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQL  109
            V+QLE E AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV  QQ+  PADQL
Sbjct  579  VEQLEPETAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVSQQQSSNPADQL  638

Query  108  ASLSLNDNLVA  76
            ASLSLND LV+
Sbjct  639  ASLSLNDGLVS  649


 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+AM  S+APR+PMYPPG PG+ QQ+FYGQ  PA++PPQAGFGYQQQLVPGMR
Sbjct  396  AQFSQMRPIAMASSVAPRMPMYPPGGPGLGQQIFYGQPQPAMLPPQAGFGYQQQLVPGMR  455

Query  636  pgggpmPNFFVPM  598
            PGGGPMPNFF+PM
Sbjct  456  PGGGPMPNFFMPM  468



>ref|XP_009768210.1| PREDICTED: polyadenylate-binding protein 8-like [Nicotiana sylvestris]
Length=649

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 109/131 (83%), Gaps = 6/131 (5%)
 Frame = -1

Query  450  DGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D   PGVGG M S+PYDMGGM  RDA    P+P+ ALA+ALANA P +QRTMLGENLYPL
Sbjct  519  DVAFPGVGGGMFSIPYDMGGMPVRDAGIVQPIPVGALATALANASPTEQRTMLGENLYPL  578

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQL  109
            V+QLE E AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV  QQ+  P DQL
Sbjct  579  VEQLEPETAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVSQQQSSNPTDQL  638

Query  108  ASLSLNDNLVA  76
            ASLSLND LV+
Sbjct  639  ASLSLNDGLVS  649


 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+AM  S+APR+PMYPPG  G+ QQ+FYGQ  PA++PPQAGFGYQQQLVPGMR
Sbjct  396  AQFSQMRPIAMASSVAPRMPMYPPGGHGLGQQIFYGQPQPAMLPPQAGFGYQQQLVPGMR  455

Query  636  pgggpmPNFFVPM  598
            PGGGPMPNFF+PM
Sbjct  456  PGGGPMPNFFMPM  468



>ref|XP_006346392.1| PREDICTED: polyadenylate-binding protein 8-like [Solanum tuberosum]
Length=643

 Score =   153 bits (386),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 109/131 (83%), Gaps = 6/131 (5%)
 Frame = -1

Query  450  DGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D   PGVGG M S+PYDMGGM  RDA    P+P+ ALA+ALANA P +QRTMLGENLYPL
Sbjct  513  DVGFPGVGGGMFSVPYDMGGMPVRDAGIAQPIPVGALATALANASPTEQRTMLGENLYPL  572

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQL  109
            V+QLE E AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLRNV  QQA   ADQL
Sbjct  573  VEQLEPETAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRNVPQQQASNAADQL  632

Query  108  ASLSLNDNLVA  76
            ASLSLND LV+
Sbjct  633  ASLSLNDGLVS  643


 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+ M  ++APR+PMYPPG PG+ QQ+FYGQ  PA++PPQAGFGYQQQLVPGMR
Sbjct  390  AQFSQMRPIGMASTVAPRMPMYPPGGPGLGQQIFYGQPQPAMLPPQAGFGYQQQLVPGMR  449

Query  636  pgggpmPNFFVPM  598
            PGGGPMPNFF+PM
Sbjct  450  PGGGPMPNFFMPM  462



>ref|XP_010263472.1| PREDICTED: polyadenylate-binding protein 2-like [Nelumbo nucifera]
Length=653

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 117/135 (87%), Gaps = 7/135 (5%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  292
            N+ D PM GV GGM+S+PYDMGGM  RDAA   P+PI ALA+ALANA PEQQRTMLGE+L
Sbjct  519  NMPDVPMSGVAGGMLSVPYDMGGMPLRDAAMSQPIPIGALATALANATPEQQRTMLGESL  578

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIP  121
            YPLVDQLEH+ AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV   QQA  P
Sbjct  579  YPLVDQLEHDMAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAQQQQANSP  638

Query  120  ADQLASLSLNDNLVA  76
             DQLASLSLNDNLV+
Sbjct  639  TDQLASLSLNDNLVS  653


 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM+PS+APR+PMYPPG PG+ QQ+FYGQGPP +IPPQ GFGYQQQLVPGMR
Sbjct  399  AQFSQMRPVAMSPSVAPRVPMYPPGGPGLGQQIFYGQGPPTLIPPQPGFGYQQQLVPGMR  458

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVP+
Sbjct  459  PGGAPMPNFFVPL  471



>gb|AFP74112.1| poly-A binding protein, partial [Nicotiana benthamiana]
Length=643

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 108/128 (84%), Gaps = 6/128 (5%)
 Frame = -1

Query  450  DGPMPGVGG-MVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQ  274
            DG  PGVGG M S+PYD+GG   R   P+P+ ALA+ALANA P +QRTMLGENLYPLV+Q
Sbjct  519  DGAFPGVGGGMFSIPYDIGG---RIVQPIPVGALATALANASPTEQRTMLGENLYPLVEQ  575

Query  273  LEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQLASL  100
            LE E AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV  QQ+  PADQLASL
Sbjct  576  LEPETAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVSQQQSSNPADQLASL  635

Query  99   SLNDNLVA  76
            SLND LV+
Sbjct  636  SLNDGLVS  643


 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+AM  S+APR+PMYPPG PG+ QQ+FYGQ PPA++PPQAGFGYQQQLVPGMR
Sbjct  396  AQFSQMRPIAMASSVAPRMPMYPPGGPGLGQQIFYGQPPPAMLPPQAGFGYQQQLVPGMR  455

Query  636  pgggpmPNFFVPM  598
            PGGGPMPNFF+PM
Sbjct  456  PGGGPMPNFFMPM  468



>gb|KJB29450.1| hypothetical protein B456_005G101600 [Gossypium raimondii]
Length=648

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 109/124 (88%), Gaps = 6/124 (5%)
 Frame = -1

Query  429  GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEH  259
            GGM+S+PYDMG M  RDA    P+P+TALA++LANA PEQQRTMLGE+LYPLV++LE + 
Sbjct  525  GGMLSIPYDMGSMPVRDAGSGQPIPVTALATSLANATPEQQRTMLGESLYPLVERLERDA  584

Query  258  AAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPADQLASLSLND  88
            AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V   QQ+  PADQL+SLSLND
Sbjct  585  AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAAQQQSNNPADQLSSLSLND  644

Query  87   NLVA  76
            NLV+
Sbjct  645  NLVS  648


 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+A+ PS APR+P+YP GAPG+ QQ FYGQ PP +IPPQAGFGYQQQLVPGMR
Sbjct  399  AQFSQMRPLAI-PSAAPRMPVYPSGAPGLGQQFFYGQAPPTVIPPQAGFGYQQQLVPGMR  457

Query  636  pgggpmPNFFVPM  598
            PGG PMPN+FVPM
Sbjct  458  PGGPPMPNYFVPM  470



>dbj|BAJ53195.1| JHL03K20.4 [Jatropha curcas]
Length=642

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 110/130 (85%), Gaps = 5/130 (4%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D PM G+ GGM+ +PYDMGGM  RD A   PV   ALA+ALANA PEQQRT+LGENLYPL
Sbjct  513  DVPMAGLPGGMLPVPYDMGGMPFRDGAFSQPVQTGALATALANAMPEQQRTLLGENLYPL  572

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQLA  106
            VDQLEHE+AAKVTGMLLEMDQTEVLHLLESPE+LKAKVAEA+EVLR V QQ   P D++A
Sbjct  573  VDQLEHENAAKVTGMLLEMDQTEVLHLLESPESLKAKVAEAMEVLRTVQQQVNSPTDRMA  632

Query  105  SLSLNDNLVA  76
            +LSLND+LV+
Sbjct  633  TLSLNDSLVS  642


 Score = 90.9 bits (224),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 56/73 (77%), Gaps = 7/73 (10%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQ+S++RP AM P + PR+P+YPPG PG+  QLFYGQGPPAI+PPQ GFGYQQQLV    
Sbjct  398  AQYSQIRP-AMAPPIGPRMPIYPPGTPGIGHQLFYGQGPPAIVPPQPGFGYQQQLV----  452

Query  636  pgggpmPNFFVPM  598
               G  PNFFVPM
Sbjct  453  --PGMRPNFFVPM  463



>ref|XP_007226962.1| hypothetical protein PRUPE_ppa002618mg [Prunus persica]
 ref|XP_007226963.1| hypothetical protein PRUPE_ppa002618mg [Prunus persica]
 gb|EMJ28161.1| hypothetical protein PRUPE_ppa002618mg [Prunus persica]
 gb|EMJ28162.1| hypothetical protein PRUPE_ppa002618mg [Prunus persica]
Length=651

 Score =   151 bits (381),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 110/132 (83%), Gaps = 4/132 (3%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYP  286
            N+ + P  GV  GM+S+PYDMGG+  RDAA    + ALA+ALANA  EQQRTMLGE LYP
Sbjct  520  NMQEVPFSGVPSGMLSVPYDMGGIPMRDAAGGQGVPALATALANASTEQQRTMLGEALYP  579

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQ  112
            LVDQLEHE AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV  QQA   ADQ
Sbjct  580  LVDQLEHESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAQQQANSSADQ  639

Query  111  LASLSLNDNLVA  76
            L+SLSLNDNLV+
Sbjct  640  LSSLSLNDNLVS  651


 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+APR+PMYPPGAPG+ QQ  YGQ PP+IIPPQAGFGYQQQLVPG+R
Sbjct  401  AQFSQMRPVAMAPSVAPRMPMYPPGAPGLGQQFLYGQAPPSIIPPQAGFGYQQQLVPGIR  460

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVPM
Sbjct  461  PGGAPMPNFFVPM  473



>ref|XP_008220252.1| PREDICTED: polyadenylate-binding protein 2-like [Prunus mume]
Length=651

 Score =   150 bits (380),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 110/132 (83%), Gaps = 4/132 (3%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYP  286
            N+ + P  GV  GM+S+PYDMGG+  RDAA    + ALA+ALANA  EQQRTMLGE LYP
Sbjct  520  NMQEVPFSGVPSGMLSVPYDMGGIPMRDAAGGQGVPALATALANASTEQQRTMLGEALYP  579

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQ  112
            LVDQLEHE AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV  QQA   ADQ
Sbjct  580  LVDQLEHESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAQQQANSSADQ  639

Query  111  LASLSLNDNLVA  76
            L+SLSLNDNLV+
Sbjct  640  LSSLSLNDNLVS  651


 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+APR+PMYPPGAPG+ QQ  YGQ PP+IIPPQAGFGYQQQLVPG+R
Sbjct  401  AQFSQMRPVAMAPSVAPRMPMYPPGAPGLGQQFLYGQAPPSIIPPQAGFGYQQQLVPGIR  460

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVPM
Sbjct  461  PGGAPMPNFFVPM  473



>ref|XP_009395913.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score =   150 bits (380),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 113/135 (84%), Gaps = 8/135 (6%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENL  292
            N+ D PMPGV  GM+S PY+MGG+  RD     P+PI ALASALAN+ PEQQR MLGE+L
Sbjct  519  NMPDVPMPGVVSGMLS-PYEMGGLPMRDVPIPQPIPIGALASALANSTPEQQRMMLGESL  577

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIP  121
            YPLV+QLE +HAAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEALEVLR V   QQA +P
Sbjct  578  YPLVEQLERDHAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEALEVLRTVAQQQQANVP  637

Query  120  ADQLASLSLNDNLVA  76
            ADQLA+LSLND LV+
Sbjct  638  ADQLAALSLNDGLVS  652


 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV M P++ PR+PMYPPGAPG+ QQ+FYGQGPPA+IPPQ GFG+QQQL+PGMR
Sbjct  399  AQFSQMRPVPMAPTVGPRVPMYPPGAPGLGQQIFYGQGPPALIPPQPGFGFQQQLIPGMR  458

Query  636  pgggpmPNFFVPM  598
            P G PMPNF VP+
Sbjct  459  PAGAPMPNFLVPL  471



>gb|EPS61401.1| hypothetical protein M569_13396, partial [Genlisea aurea]
Length=551

 Score =   149 bits (377),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 102/119 (86%), Gaps = 3/119 (3%)
 Frame = -1

Query  459  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  283
            N+ +  M G GG MVS PYDM  M+P+   P+PITALASALAN+ PEQQRTMLGENLYPL
Sbjct  435  NLGEVNMAGYGGGMVSSPYDMVAMIPQQ--PMPITALASALANSTPEQQRTMLGENLYPL  492

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLA  106
            VDQLEHEHAAK+TGMLLEMDQTEVLHLLESPEALKAKV+EA++VLRNV+ A   ADQLA
Sbjct  493  VDQLEHEHAAKITGMLLEMDQTEVLHLLESPEALKAKVSEAIDVLRNVEHANSAADQLA  551


 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQF ++RP+ + PS+A R+PMYPPG PG+ Q LFYGQG PA++PPQAGFGYQQQLVPG+R
Sbjct  316  AQFMQIRPMGVPPSIASRMPMYPPGTPGVGQHLFYGQG-PALLPPQAGFGYQQQLVPGVR  374

Query  636  pgggpmPNFFVPM  598
            PG  PM NFFVP 
Sbjct  375  PGAAPMHNFFVPF  387



>ref|XP_002883899.1| hypothetical protein ARALYDRAFT_899764 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60158.1| hypothetical protein ARALYDRAFT_899764 [Arabidopsis lyrata subsp. 
lyrata]
Length=655

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 160/251 (64%), Positives = 182/251 (73%), Gaps = 8/251 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM P + PR+P+YPPG PG+ Q +FYGQ PP +I  Q GFGYQQQLVPGMR
Sbjct  409  AQFSQMRPVAMPPPVGPRMPIYPPGGPGIGQPMFYGQAPPTMISSQPGFGYQQQLVPGMR  468

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGG PM NFF+PMVQQGQQ P      G    QQ QQ   + QQ  +             
Sbjct  469  PGGAPMHNFFMPMVQQGQQRPGGRHPGGIQQSQQQQQVPMMQQQHQMHPRGRMFRYPQGR  528

Query  456  VSDGPMPGVGGMVSLPYDMGGMLP-RD---AAPVPITALASALANAPPEQQRTMLGENLY  289
             S GP P V GM  LPY+MG  +P RD   +  VPI ALAS+LANA PE QRT+LGENLY
Sbjct  529  GSGGP-PDVPGM--LPYEMGSNMPLRDPVLSQHVPIGALASSLANAAPELQRTLLGENLY  585

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQL  109
            PLV+QLE E AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLR+V  A   A+QL
Sbjct  586  PLVEQLEAESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRSV-AAGGSAEQL  644

Query  108  ASLSLNDNLVA  76
            ASL+LNDNLV+
Sbjct  645  ASLNLNDNLVS  655



>ref|XP_004230758.1| PREDICTED: polyadenylate-binding protein 8-like [Solanum lycopersicum]
Length=643

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 108/131 (82%), Gaps = 6/131 (5%)
 Frame = -1

Query  450  DGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D   PGVGG M S+PYDMGGM  R A    P+P+ ALA+ALANA P +QRTMLGENLYPL
Sbjct  513  DVGFPGVGGGMFSVPYDMGGMPVRAAGIAQPIPVGALATALANASPTEQRTMLGENLYPL  572

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQL  109
            V+QLE E AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLRNV  QQA   ADQL
Sbjct  573  VEQLEPETAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRNVPQQQASNAADQL  632

Query  108  ASLSLNDNLVA  76
            ASLSLND LV+
Sbjct  633  ASLSLNDGLVS  643


 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+ M  ++APR+PMYPPG PG+ QQ+FYGQ  PA++PPQAGFGYQQQLVPGMR
Sbjct  390  AQFSQMRPIGMASTVAPRMPMYPPGGPGLGQQIFYGQPQPAMLPPQAGFGYQQQLVPGMR  449

Query  636  pgggpmPNFFVPM  598
            PGGGPMPNFF+PM
Sbjct  450  PGGGPMPNFFMPM  462



>gb|EPS71660.1| hypothetical protein M569_03099, partial [Genlisea aurea]
Length=150

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 101/118 (86%), Gaps = 4/118 (3%)
 Frame = -1

Query  429  GGMVSLPYDMGGMLPRD----AAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHE  262
            GGMV+LPYDMGG   R+    A PVPI ALASALANA P +QRT+LGE+LYPLV+Q+E E
Sbjct  33   GGMVTLPYDMGGFPLREIGIPAQPVPIGALASALANATPAEQRTLLGESLYPLVEQVEAE  92

Query  261  HAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSLND  88
             AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLRNV Q   PADQLA+LSLND
Sbjct  93   MAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRNVSQPPNPADQLAALSLND  150



>ref|XP_010093503.1| Polyadenylate-binding protein 2 [Morus notabilis]
 gb|EXB54169.1| Polyadenylate-binding protein 2 [Morus notabilis]
Length=647

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 112/136 (82%), Gaps = 8/136 (6%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRD---AAPVPITALASALANAPPEQQRTMLGENL  292
            N+SD P+ G  GGM+S+PY MGG+  RD     P+   ALAS+LANA P+QQRT+LGENL
Sbjct  512  NMSDIPIGGAPGGMLSVPYSMGGVPIRDTPYGQPMSTGALASSLANATPDQQRTLLGENL  571

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQ----QAKI  124
            YPLVDQLEHE+AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV     QA  
Sbjct  572  YPLVDQLEHENAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAQQTPQANS  631

Query  123  PADQLASLSLNDNLVA  76
            P D++A+LSLNDN+V+
Sbjct  632  PTDRMATLSLNDNIVS  647


 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 57/73 (78%), Gaps = 6/73 (8%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP AM   + PR+PMYPPGAPG+ QQLFYGQGPPA+IPPQ GFGYQQQLV    
Sbjct  398  AQFSQMRPPAMVAPVNPRMPMYPPGAPGLGQQLFYGQGPPALIPPQPGFGYQQQLV----  453

Query  636  pgggpmPNFFVPM  598
               G  PNFFVP+
Sbjct  454  --PGVRPNFFVPI  464



>gb|KHG12838.1| ELAV-like protein 2 [Gossypium arboreum]
Length=648

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 111/133 (83%), Gaps = 8/133 (6%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D  MP + GGM+S+PYDMGGM  RDA+   P+PI ALASALANA P+QQRTMLGENLYPL
Sbjct  516  DVSMPNIAGGMLSVPYDMGGMPMRDASISQPIPIGALASALANATPDQQRTMLGENLYPL  575

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAK----IPAD  115
            V+QLE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR V Q +      AD
Sbjct  576  VEQLEPDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRTVAQQQQTGGAAAD  635

Query  114  QLASLSLNDNLVA  76
            QLASLSL+DNLV+
Sbjct  636  QLASLSLSDNLVS  648


 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV M+PS+APR+PMYPPG PG+ QQ+FYGQ PPA+  PQ GFGYQQQLVPGMR
Sbjct  396  AQFSQMRPVTMSPSVAPRMPMYPPGGPGLGQQIFYGQAPPAMF-PQPGFGYQQQLVPGMR  454

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVPM
Sbjct  455  PGGAPMPNFFVPM  467



>gb|KJB79363.1| hypothetical protein B456_013G046000 [Gossypium raimondii]
Length=648

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 111/133 (83%), Gaps = 8/133 (6%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D  MP + GGM+S+PYDMGGM  RDA+   P+PI ALASALANA P+QQRTMLGENLYPL
Sbjct  516  DVSMPNIAGGMLSVPYDMGGMPMRDASISQPIPIGALASALANATPDQQRTMLGENLYPL  575

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAK----IPAD  115
            V+QLE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR V Q +      AD
Sbjct  576  VEQLEPDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRTVAQQQQTGGAAAD  635

Query  114  QLASLSLNDNLVA  76
            QLASLSL+DNLV+
Sbjct  636  QLASLSLSDNLVS  648


 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV M+PS+APR+PMYPPG PG+ QQ+FYGQ PPA+  PQ GFGYQQQLVPGMR
Sbjct  396  AQFSQMRPVTMSPSVAPRMPMYPPGGPGLGQQIFYGQAPPAMF-PQPGFGYQQQLVPGMR  454

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVPM
Sbjct  455  PGGAPMPNFFVPM  467



>gb|KCW66377.1| hypothetical protein EUGRSUZ_F00193 [Eucalyptus grandis]
Length=441

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 110/135 (81%), Gaps = 7/135 (5%)
 Frame = -1

Query  459  NVSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            N+ + PM G GGM  +PY MG M  R+ +   P+PITALA+ALAN+ PEQQRT+LGE+LY
Sbjct  307  NLQEVPMAGSGGMFPVPYGMGDMALREPSVPQPLPITALATALANSSPEQQRTLLGESLY  366

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV----QQAKIP  121
            PLVDQLEH++AAKVTGMLLEMDQTEVLHLLESP+ALKAKV EA++VLR+     QQA  P
Sbjct  367  PLVDQLEHDNAAKVTGMLLEMDQTEVLHLLESPDALKAKVEEAMDVLRSSAPQQQQANNP  426

Query  120  ADQLASLSLNDNLVA  76
             DQLA LSL+DNLV+
Sbjct  427  VDQLAGLSLSDNLVS  441


 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+AM PS+ PR+PMYPPGAPG+ QQ  YGQGPPAIIPPQAGFGY QQLVPGMR
Sbjct  189  AQFSQMRPIAMAPSVGPRMPMYPPGAPGLGQQFLYGQGPPAIIPPQAGFGYHQQLVPGMR  248

Query  636  pgggpmPNFFVPM  598
            PGG PMPN+FVP+
Sbjct  249  PGGAPMPNYFVPL  261



>gb|EYU36333.1| hypothetical protein MIMGU_mgv1a002664mg [Erythranthe guttata]
Length=649

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 110/122 (90%), Gaps = 7/122 (6%)
 Frame = -1

Query  420  VSLPYDMGGMLPRDAAPV------PITALASALANAPPEQQRTMLGENLYPLVDQLEHEH  259
            +S+PYDMGGMLPRD+AP+      PITALA+ALANA PEQQR MLGENLYPLVDQLEHEH
Sbjct  528  LSVPYDMGGMLPRDSAPIQPQQPMPITALATALANATPEQQRIMLGENLYPLVDQLEHEH  587

Query  258  AAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQLASLSLNDNL  82
            AAKVTGMLLEMDQTEVLHLLESP+ALKAKV EA++VL+NV QQA  P+DQLASLSLN+NL
Sbjct  588  AAKVTGMLLEMDQTEVLHLLESPDALKAKVNEAMDVLKNVQQQASSPSDQLASLSLNENL  647

Query  81   VA  76
            V+
Sbjct  648  VS  649


 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 68/73 (93%), Gaps = 1/73 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVA+ PS+APR+PMYPPGAP M QQLFYGQG PA+IPPQAGFGYQQQLVPGMR
Sbjct  399  AQFSQMRPVAIPPSIAPRMPMYPPGAPAMGQQLFYGQG-PAMIPPQAGFGYQQQLVPGMR  457

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFF+PM
Sbjct  458  PGGAPMPNFFMPM  470



>ref|XP_002284923.1| PREDICTED: polyadenylate-binding protein 8 isoform X1 [Vitis 
vinifera]
 ref|XP_010664560.1| PREDICTED: polyadenylate-binding protein 8 isoform X2 [Vitis 
vinifera]
 emb|CAN76464.1| hypothetical protein VITISV_017035 [Vitis vinifera]
Length=640

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 118/133 (89%), Gaps = 6/133 (5%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  292
            N+ D PMPGV GGM+S+PYDMGG+  RDAA   P+PI+ALASALANA P+QQRTMLGE+L
Sbjct  507  NMPDVPMPGVAGGMLSIPYDMGGVPLRDAAIGQPMPISALASALANATPDQQRTMLGESL  566

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPA  118
            YPLVDQLEHE AAKVTGMLLEMDQTEVLHLLESPEALK+KVAEA++VLRNV  QQA  P 
Sbjct  567  YPLVDQLEHEMAAKVTGMLLEMDQTEVLHLLESPEALKSKVAEAMDVLRNVAQQQANSPT  626

Query  117  DQLASLSLNDNLV  79
            +QLASLSLND+LV
Sbjct  627  EQLASLSLNDSLV  639


 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV+M PS+APR+PMYPPGAPG+ QQLFYGQGPPAIIPPQAGFGYQQQLVPGMR
Sbjct  387  AQFSQMRPVSMAPSVAPRMPMYPPGAPGLGQQLFYGQGPPAIIPPQAGFGYQQQLVPGMR  446

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVP+
Sbjct  447  PGGAPMPNFFVPL  459



>gb|KCW66375.1| hypothetical protein EUGRSUZ_F00193 [Eucalyptus grandis]
Length=627

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 110/135 (81%), Gaps = 7/135 (5%)
 Frame = -1

Query  459  NVSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            N+ + PM G GGM  +PY MG M  R+ +   P+PITALA+ALAN+ PEQQRT+LGE+LY
Sbjct  493  NLQEVPMAGSGGMFPVPYGMGDMALREPSVPQPLPITALATALANSSPEQQRTLLGESLY  552

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV----QQAKIP  121
            PLVDQLEH++AAKVTGMLLEMDQTEVLHLLESP+ALKAKV EA++VLR+     QQA  P
Sbjct  553  PLVDQLEHDNAAKVTGMLLEMDQTEVLHLLESPDALKAKVEEAMDVLRSSAPQQQQANNP  612

Query  120  ADQLASLSLNDNLVA  76
             DQLA LSL+DNLV+
Sbjct  613  VDQLAGLSLSDNLVS  627


 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+AM PS+ PR+PMYPPGAPG+ QQ  YGQGPPAIIPPQAGFGY QQLVPGMR
Sbjct  375  AQFSQMRPIAMAPSVGPRMPMYPPGAPGLGQQFLYGQGPPAIIPPQAGFGYHQQLVPGMR  434

Query  636  pgggpmPNFFVPM  598
            PGG PMPN+FVP+
Sbjct  435  PGGAPMPNYFVPL  447



>ref|XP_009415843.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=651

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 109/134 (81%), Gaps = 9/134 (7%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  292
            N+ + PMPG  GGM+S PYDMG +  R+AA   P+P   LASALANA PEQQRTMLGE+L
Sbjct  516  NIPEVPMPGAPGGMLS-PYDMGSLPIREAAISQPIPTGTLASALANANPEQQRTMLGESL  574

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV----QQAKI  124
            YPLVDQLEH+H+AKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRN     Q    
Sbjct  575  YPLVDQLEHDHSAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNASQQHQHVNA  634

Query  123  PADQLASLSLNDNL  82
            PADQLA+LSLND L
Sbjct  635  PADQLAALSLNDGL  648


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            A FS+MRPVAMTP++ PR+PMYPP  PG+ QQ+FYGQ P A+IPPQ GFG+ QQ VPGMR
Sbjct  398  AHFSQMRPVAMTPAIGPRVPMYPPATPGLGQQIFYGQPPHALIPPQPGFGFPQQHVPGMR  457

Query  636  pgggpmPNFFVPM  598
            P G PMPNF++P+
Sbjct  458  PVGAPMPNFYLPL  470



>ref|XP_010059905.1| PREDICTED: polyadenylate-binding protein 2-like [Eucalyptus grandis]
 gb|KCW66374.1| hypothetical protein EUGRSUZ_F00193 [Eucalyptus grandis]
Length=657

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 110/135 (81%), Gaps = 7/135 (5%)
 Frame = -1

Query  459  NVSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            N+ + PM G GGM  +PY MG M  R+ +   P+PITALA+ALAN+ PEQQRT+LGE+LY
Sbjct  523  NLQEVPMAGSGGMFPVPYGMGDMALREPSVPQPLPITALATALANSSPEQQRTLLGESLY  582

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV----QQAKIP  121
            PLVDQLEH++AAKVTGMLLEMDQTEVLHLLESP+ALKAKV EA++VLR+     QQA  P
Sbjct  583  PLVDQLEHDNAAKVTGMLLEMDQTEVLHLLESPDALKAKVEEAMDVLRSSAPQQQQANNP  642

Query  120  ADQLASLSLNDNLVA  76
             DQLA LSL+DNLV+
Sbjct  643  VDQLAGLSLSDNLVS  657


 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+AM PS+ PR+PMYPPGAPG+ QQ  YGQGPPAIIPPQAGFGY QQLVPGMR
Sbjct  405  AQFSQMRPIAMAPSVGPRMPMYPPGAPGLGQQFLYGQGPPAIIPPQAGFGYHQQLVPGMR  464

Query  636  pgggpmPNFFVPM  598
            PGG PMPN+FVP+
Sbjct  465  PGGAPMPNYFVPL  477



>ref|XP_012079276.1| PREDICTED: polyadenylate-binding protein 4-like [Jatropha curcas]
Length=642

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 109/130 (84%), Gaps = 5/130 (4%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D PM G+ GGM+ +PYDMGGM  RD A   PV   ALA+ALANA PEQQRT+LGENLYPL
Sbjct  513  DVPMAGLPGGMLPVPYDMGGMPFRDGAFSQPVQTGALATALANAMPEQQRTLLGENLYPL  572

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQLA  106
            VDQLEHE+AAKV GMLLE+DQTEVLHLLESPE+LKAKVAEA+EVLR V QQ   P D++A
Sbjct  573  VDQLEHENAAKVAGMLLELDQTEVLHLLESPESLKAKVAEAMEVLRTVQQQVNSPTDRMA  632

Query  105  SLSLNDNLVA  76
            +LSLND+LV+
Sbjct  633  TLSLNDSLVS  642


 Score = 90.9 bits (224),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 56/73 (77%), Gaps = 7/73 (10%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQ+S++RP AM P + PR+P+YPPG PG+  QLFYGQGPPAI+PPQ GFGYQQQLV    
Sbjct  398  AQYSQIRP-AMAPPIGPRMPIYPPGTPGIGHQLFYGQGPPAIVPPQPGFGYQQQLV----  452

Query  636  pgggpmPNFFVPM  598
               G  PNFFVPM
Sbjct  453  --PGMRPNFFVPM  463



>ref|XP_003589160.1| Polyadenylate-binding protein [Medicago truncatula]
 gb|AES59411.1| polyadenylate-binding protein [Medicago truncatula]
Length=647

 Score =   148 bits (373),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 107/128 (84%), Gaps = 4/128 (3%)
 Frame = -1

Query  459  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYPL  283
            N+ D P+  +GG + + YDMGG+  RD  P +PI ALA+ALANAPPEQQRTMLGE LYPL
Sbjct  521  NIQDAPVQNIGGGM-MSYDMGGLPLRDVVPPMPIHALATALANAPPEQQRTMLGEALYPL  579

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQL  109
            VDQLEH+ AAKVTGMLLEMDQ EVLHL+ESP+ALKAKVAEA+EVLRNV  QQ   PADQL
Sbjct  580  VDQLEHDSAAKVTGMLLEMDQPEVLHLIESPDALKAKVAEAMEVLRNVSQQQGNSPADQL  639

Query  108  ASLSLNDN  85
            ASLSLND+
Sbjct  640  ASLSLNDS  647


 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRPVA+TPS+APR+P+YPPG PG+ QQ  YGQGPPA++PPQAGFGYQQQLV
Sbjct  402  AQFSQMRPVAITPSVAPRMPLYPPGTPGLGQQFMYGQGPPAMMPPQAGFGYQQQLV  457



>ref|XP_006855143.1| PREDICTED: polyadenylate-binding protein 2 [Amborella trichopoda]
 gb|ERN16610.1| hypothetical protein AMTR_s00051p00026490 [Amborella trichopoda]
Length=654

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 116/137 (85%), Gaps = 9/137 (7%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  292
            N+ D P+PGV GGM+S+PYDMG +  R++    P+PI ALASALANA PEQQRTMLGE+L
Sbjct  518  NMPDVPLPGVAGGMLSVPYDMGSVPLRESGISQPIPIGALASALANATPEQQRTMLGESL  577

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-----QQAK  127
            YPLVDQLEH+HAAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA++VLRNV     QQ  
Sbjct  578  YPLVDQLEHDHAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMDVLRNVAQQQQQQGA  637

Query  126  IPADQLASLSLNDNLVA  76
             PADQLA+LSLND LV+
Sbjct  638  APADQLAALSLNDALVS  654


 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVA+ PS+APR+P+YPPG PGM QQLFYGQGPPA+IPPQ GFGYQQQ+VPGMR
Sbjct  397  AQFSQMRPVALAPSVAPRMPLYPPGNPGMGQQLFYGQGPPALIPPQPGFGYQQQIVPGMR  456

Query  636  pgggpmPNFFVPM  598
            PGG P+PNFFVP+
Sbjct  457  PGGAPIPNFFVPL  469



>ref|XP_010928350.1| PREDICTED: polyadenylate-binding protein 8-like isoform X2 [Elaeis 
guineensis]
Length=633

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 115/136 (85%), Gaps = 8/136 (6%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  292
            N+ D PMPGV GGM+S PYDMG M  RDA    P+PI ALASALANA PEQQRTMLGE+L
Sbjct  498  NMPDVPMPGVAGGMLSAPYDMGVMPMRDAGMSQPIPIGALASALANASPEQQRTMLGESL  557

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV----QQAKI  124
            YPLVDQLEHEHAAKVTGMLLEMDQ EVLHLLESPEALKAKVAEA+EVLRNV    QQA  
Sbjct  558  YPLVDQLEHEHAAKVTGMLLEMDQPEVLHLLESPEALKAKVAEAMEVLRNVAQQQQQAST  617

Query  123  PADQLASLSLNDNLVA  76
            PADQLA+LSLND +++
Sbjct  618  PADQLAALSLNDGIIS  633


 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = -1

Query  816  AQFSE-MRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgm  640
            AQFS+ MRPVAM PS+APR+PMYPPGAPGM QQLFYGQ PPA+IPPQ GFG+QQ LVPGM
Sbjct  377  AQFSQIMRPVAMPPSVAPRVPMYPPGAPGMGQQLFYGQPPPALIPPQPGFGFQQPLVPGM  436

Query  639  rpgggpmPNFFVPM  598
            RPG   MPNF++P+
Sbjct  437  RPGVAAMPNFYMPL  450



>gb|KDO84108.1| hypothetical protein CISIN_1g006282mg [Citrus sinensis]
Length=593

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 111/135 (82%), Gaps = 7/135 (5%)
 Frame = -1

Query  459  NVSDGPMP-GVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  295
            N+ D P   G G M+ +P DMG  +PR  A    P+PITAL++ALANA PEQQRT+LGE+
Sbjct  459  NMQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGES  518

Query  294  LYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIP  121
            LYPLV+QLE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V  QQA  P
Sbjct  519  LYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAQQQANNP  578

Query  120  ADQLASLSLNDNLVA  76
            ADQLASLSLN+NLV+
Sbjct  579  ADQLASLSLNENLVS  593


 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQ  679
            AQFS+MRPVAM PS+ PR+PMYPPG  G+ QQ  YGQ PPAIIPPQ
Sbjct  399  AQFSQMRPVAMGPSVPPRMPMYPPGPSGLGQQFLYGQAPPAIIPPQ  444



>ref|XP_010928349.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Elaeis 
guineensis]
Length=658

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 115/136 (85%), Gaps = 8/136 (6%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  292
            N+ D PMPGV GGM+S PYDMG M  RDA    P+PI ALASALANA PEQQRTMLGE+L
Sbjct  523  NMPDVPMPGVAGGMLSAPYDMGVMPMRDAGMSQPIPIGALASALANASPEQQRTMLGESL  582

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV----QQAKI  124
            YPLVDQLEHEHAAKVTGMLLEMDQ EVLHLLESPEALKAKVAEA+EVLRNV    QQA  
Sbjct  583  YPLVDQLEHEHAAKVTGMLLEMDQPEVLHLLESPEALKAKVAEAMEVLRNVAQQQQQAST  642

Query  123  PADQLASLSLNDNLVA  76
            PADQLA+LSLND +++
Sbjct  643  PADQLAALSLNDGIIS  658


 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = -1

Query  816  AQFSE-MRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgm  640
            AQFS+ MRPVAM PS+APR+PMYPPGAPGM QQLFYGQ PPA+IPPQ GFG+QQ LVPGM
Sbjct  402  AQFSQIMRPVAMPPSVAPRVPMYPPGAPGMGQQLFYGQPPPALIPPQPGFGFQQPLVPGM  461

Query  639  rpgggpmPNFFVPM  598
            RPG   MPNF++P+
Sbjct  462  RPGVAAMPNFYMPL  475



>gb|AAQ56324.1| putative poly(A)-binding protein [Oryza sativa Japonica Group]
Length=266

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 105/130 (81%), Gaps = 5/130 (4%)
 Frame = -1

Query  450  DGPMPGVGGMVSLPYDMGGMLPRDAAP---VPITALASALANAPPEQQRTMLGENLYPLV  280
            D    GVGG+V  PY+MG M   DA     VPI ALASALAN+PP+QQR MLGE+LYPLV
Sbjct  137  DNAFRGVGGLVPSPYEMGRMPLSDAGAPPQVPIGALASALANSPPDQQRLMLGESLYPLV  196

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQLA  106
            DQLEH+ AAKVTGMLLEMDQTEVLHL+ESP+ALKAKVAEA+EVLRN   QQA  P DQLA
Sbjct  197  DQLEHDQAAKVTGMLLEMDQTEVLHLIESPDALKAKVAEAMEVLRNAQQQQANTPTDQLA  256

Query  105  SLSLNDNLVA  76
            +L+L+D +V+
Sbjct  257  ALTLSDGVVS  266



>gb|EEC83349.1| hypothetical protein OsI_28748 [Oryza sativa Indica Group]
Length=252

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 105/130 (81%), Gaps = 5/130 (4%)
 Frame = -1

Query  450  DGPMPGVGGMVSLPYDMGGMLPRDAAP---VPITALASALANAPPEQQRTMLGENLYPLV  280
            D    GVGG+V  PY+MG M   DA     VPI ALASALAN+PP+QQR MLGE+LYPLV
Sbjct  123  DNAFRGVGGLVPSPYEMGRMPLSDAGAPPQVPIGALASALANSPPDQQRLMLGESLYPLV  182

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQLA  106
            DQLEH+ AAKVTGMLLEMDQTEVLHL+ESP+ALKAKVAEA+EVLRN   QQA  P DQLA
Sbjct  183  DQLEHDQAAKVTGMLLEMDQTEVLHLIESPDALKAKVAEAMEVLRNAQQQQANTPTDQLA  242

Query  105  SLSLNDNLVA  76
            +L+L+D +V+
Sbjct  243  ALTLSDGVVS  252



>gb|EEE68458.1| hypothetical protein OsJ_26852 [Oryza sativa Japonica Group]
Length=252

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 105/130 (81%), Gaps = 5/130 (4%)
 Frame = -1

Query  450  DGPMPGVGGMVSLPYDMGGMLPRDAAP---VPITALASALANAPPEQQRTMLGENLYPLV  280
            D    GVGG+V  PY+MG M   DA     VPI ALASALAN+PP+QQR MLGE+LYPLV
Sbjct  123  DNAFRGVGGLVPSPYEMGRMPLSDAGAPPQVPIGALASALANSPPDQQRLMLGESLYPLV  182

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQLA  106
            DQLEH+ AAKVTGMLLEMDQTEVLHL+ESP+ALKAKVAEA+EVLRN   QQA  P DQLA
Sbjct  183  DQLEHDQAAKVTGMLLEMDQTEVLHLIESPDALKAKVAEAMEVLRNAQQQQANTPTDQLA  242

Query  105  SLSLNDNLVA  76
            +L+L+D +V+
Sbjct  243  ALTLSDGVVS  252



>ref|XP_003573691.1| PREDICTED: polyadenylate-binding protein 2-like [Brachypodium 
distachyon]
Length=663

 Score =   145 bits (366),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 105/129 (81%), Gaps = 4/129 (3%)
 Frame = -1

Query  450  DGPMPGVGGMVSLPYDMGGM-LPRDAAP--VPITALASALANAPPEQQRTMLGENLYPLV  280
            D P  GVGGMV  PY+MG M L  + AP  VP   LASALAN+PPEQQR MLGE+LYPLV
Sbjct  534  DSPFRGVGGMVPSPYEMGRMTLNDNGAPQQVPSGTLASALANSPPEQQRLMLGESLYPLV  593

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQLAS  103
            DQLEH+ AAKVTGMLLEMDQTEVLHL+ESP+ALK+KVAEA++VLR+  QQ   PADQLA+
Sbjct  594  DQLEHDQAAKVTGMLLEMDQTEVLHLIESPDALKSKVAEAMDVLRSAQQQTSAPADQLAA  653

Query  102  LSLNDNLVA  76
            LSL+D  VA
Sbjct  654  LSLSDGFVA  662


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV M P +APR+PMYPPG PGM QQ+FYGQ PP  + PQ GFG+QQ ++PGMR
Sbjct  412  AQFSQMRPVVMPPPVAPRMPMYPPGVPGMGQQMFYGQPPPPFVNPQPGFGFQQHMIPGMR  471

Query  636  pgggpmPNFFVPM  598
            PG  PMPNF +PM
Sbjct  472  PGVAPMPNFVMPM  484



>gb|KJB32340.1| hypothetical protein B456_005G236500 [Gossypium raimondii]
Length=647

 Score =   145 bits (365),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 109/130 (84%), Gaps = 8/130 (6%)
 Frame = -1

Query  441  MPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENLYPLVDQ  274
            MP V GGM+S+PYDMG M  RDA    P+PI ALASALANA PEQQRTMLGENLYPLV+Q
Sbjct  518  MPNVPGGMLSVPYDMGSMPMRDAPLSQPIPIGALASALANATPEQQRTMLGENLYPLVEQ  577

Query  273  LEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV----QQAKIPADQLA  106
            LE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR V    QQA   ADQLA
Sbjct  578  LEPDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRTVAQQQQQAGGAADQLA  637

Query  105  SLSLNDNLVA  76
            SLSLNDNLV+
Sbjct  638  SLSLNDNLVS  647


 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+ M  S+APR+PMYPPG PG+ QQ+FYGQ PP I PPQ GFGYQQQLVPGMR
Sbjct  395  AQFSQMRPLTMASSVAPRMPMYPPGGPGLGQQIFYGQAPP-IFPPQPGFGYQQQLVPGMR  453

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVPM
Sbjct  454  PGGAPMPNFFVPM  466



>gb|KHG19377.1| Polyadenylate-binding protein 1-like 2 [Gossypium arboreum]
Length=647

 Score =   145 bits (365),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 109/130 (84%), Gaps = 8/130 (6%)
 Frame = -1

Query  441  MPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENLYPLVDQ  274
            MP V GGM+S+PYDMG M  RDA    P+PI ALASALANA PEQQRTMLGENLYPLV+Q
Sbjct  518  MPNVPGGMLSVPYDMGSMPMRDAPLAQPIPIGALASALANATPEQQRTMLGENLYPLVEQ  577

Query  273  LEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV----QQAKIPADQLA  106
            LE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR V    QQA   ADQLA
Sbjct  578  LEPDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRTVAQQQQQAGGAADQLA  637

Query  105  SLSLNDNLVA  76
            SLSLNDNLV+
Sbjct  638  SLSLNDNLVS  647


 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+ M PS+APR+PMYPPG PG+ QQ+FYGQ PP I PPQ GFGYQQQLVPGMR
Sbjct  395  AQFSQMRPLTMAPSVAPRMPMYPPGGPGLGQQIFYGQAPP-IFPPQPGFGYQQQLVPGMR  453

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVPM
Sbjct  454  PGGAPMPNFFVPM  466



>gb|EYU36334.1| hypothetical protein MIMGU_mgv1a002624mg [Erythranthe guttata]
Length=653

 Score =   144 bits (364),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 109/123 (89%), Gaps = 8/123 (7%)
 Frame = -1

Query  420  VSLPYDMG-GMLPRDAAPV------PITALASALANAPPEQQRTMLGENLYPLVDQLEHE  262
            +S+PYDMG GMLPRD+AP+      PITALA+ALANA  +QQRTMLGENLYPLVDQLEHE
Sbjct  531  LSVPYDMGSGMLPRDSAPIQQQQPMPITALATALANATSDQQRTMLGENLYPLVDQLEHE  590

Query  261  HAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQLASLSLNDN  85
            HAAKVTGMLLEMDQTEVLHLLESP+ALKAKV EA++VLRNV QQA  PADQLASLSLND 
Sbjct  591  HAAKVTGMLLEMDQTEVLHLLESPDALKAKVNEAMDVLRNVQQQANGPADQLASLSLNDT  650

Query  84   LVA  76
            LV+
Sbjct  651  LVS  653


 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 70/73 (96%), Gaps = 1/73 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+AM PS+APR+PMYPPGAPG+ QQ+FYGQG PA+IPPQAGFGYQQQLVPGMR
Sbjct  402  AQFSQMRPIAMAPSIAPRMPMYPPGAPGIGQQMFYGQG-PAMIPPQAGFGYQQQLVPGMR  460

Query  636  pgggpmPNFFVPM  598
            PGGGP+PNFF+PM
Sbjct  461  PGGGPLPNFFMPM  473



>ref|XP_004956317.1| PREDICTED: polyadenylate-binding protein 2-like [Setaria italica]
Length=664

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 105/129 (81%), Gaps = 7/129 (5%)
 Frame = -1

Query  441  MPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQL  271
            M GVG ++  PY+MGGM  RDA    PVPI ALA+ALANAPP+QQR MLGENLYPLVDQL
Sbjct  535  MHGVGAVMPSPYEMGGMPIRDAGVSQPVPIGALATALANAPPDQQRLMLGENLYPLVDQL  594

Query  270  EHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAK----IPADQLAS  103
            EHE AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVLR+ Q  +     P  QLA+
Sbjct  595  EHEQAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLRSAQHLQQTNASPEQQLAN  654

Query  102  LSLNDNLVA  76
            LSLND +V+
Sbjct  655  LSLNDGVVS  663


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRPVAM PS+ PR+PM+PPG PG+ QQLFYGQ PPA I PQAGF +QQ L+
Sbjct  411  AQFSQMRPVAMAPSVGPRMPMFPPGVPGVGQQLFYGQPPPAFINPQAGFAFQQPLM  466



>emb|CDP01307.1| unnamed protein product [Coffea canephora]
Length=658

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 112/131 (85%), Gaps = 3/131 (2%)
 Frame = -1

Query  459  NVSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            +V D  MPGV G V  PYDMGG LPR+     P+P TALASALANA PEQQRTMLGENLY
Sbjct  528  SVPDVRMPGVAGGVLSPYDMGGTLPREGTIGQPMPTTALASALANASPEQQRTMLGENLY  587

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQL  109
            PLVDQLE ++AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVL+NVQQ   PADQL
Sbjct  588  PLVDQLEPDYAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLQNVQQGSGPADQL  647

Query  108  ASLSLNDNLVA  76
            ASLSL+D++V+
Sbjct  648  ASLSLSDSIVS  658


 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQF++MRPVA+ P++APR+P+YPPG P + Q L+YGQ PP IIPPQAGFGYQQQLVPGMR
Sbjct  412  AQFAQMRPVAIGPTIAPRMPLYPPGGPAIGQHLYYGQAPPTIIPPQAGFGYQQQLVPGMR  471

Query  636  pgggpmPNFFVPM  598
            PGG P+PNFFVP+
Sbjct  472  PGGAPLPNFFVPL  484



>ref|XP_003576878.1| PREDICTED: polyadenylate-binding protein 2-like [Brachypodium 
distachyon]
Length=653

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 104/128 (81%), Gaps = 4/128 (3%)
 Frame = -1

Query  450  DGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  280
            D  M GVGG +  PY++GGM  RDA    PVPI ALA+ALANAPP+QQR MLGENLYPLV
Sbjct  523  DPAMHGVGGGMPSPYEIGGMPMRDAGASQPVPIGALATALANAPPDQQRMMLGENLYPLV  582

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAK-IPADQLAS  103
            DQLEH+ AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVLR+ Q     P  QLAS
Sbjct  583  DQLEHDQAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLRSAQHTNPSPEQQLAS  642

Query  102  LSLNDNLV  79
            LSLND+ V
Sbjct  643  LSLNDHGV  650


 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS++RPV M P++ PR+ M+PPG PG+ QQLFYGQ PPA I PQ GFG+QQ L+
Sbjct  403  AQFSQLRPVPMAPTVGPRMAMFPPGVPGVGQQLFYGQPPPAFINPQPGFGFQQPLM  458



>ref|XP_010107907.1| Polyadenylate-binding protein 2 [Morus notabilis]
 gb|EXC17307.1| Polyadenylate-binding protein 2 [Morus notabilis]
Length=651

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 112/132 (85%), Gaps = 7/132 (5%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D PMPGV GGM S+P+DMGGM  RDA    P+PI A+A+ALANA PEQQRTMLGENLYPL
Sbjct  520  DVPMPGVAGGMFSVPFDMGGMPLRDAGMSQPIPIGAMATALANATPEQQRTMLGENLYPL  579

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPADQ  112
            V+QLE ++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR V   QQA   ADQ
Sbjct  580  VEQLEPDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRTVAQQQQAGNAADQ  639

Query  111  LASLSLNDNLVA  76
            LASLSL DN+V+
Sbjct  640  LASLSLTDNIVS  651


 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+ PR+P+YPPG PG+ QQ+FYGQ PPAIIP Q GFGYQQQLVPGMR
Sbjct  399  AQFSQMRPVAMAPSVVPRMPVYPPGGPGLGQQIFYGQAPPAIIPSQPGFGYQQQLVPGMR  458

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFF+PM
Sbjct  459  PGGAPMPNFFMPM  471



>ref|XP_008795896.1| PREDICTED: polyadenylate-binding protein 2-like [Phoenix dactylifera]
Length=660

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 114/135 (84%), Gaps = 10/135 (7%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRD---AAPVPITALASALANAPPEQQRTMLGENLYPL  283
            D P+PGV GGM+S PYD+GGM  RD   + P+PI ALASALANA PEQQRTMLGE+LYPL
Sbjct  526  DVPVPGVAGGMLSAPYDIGGMPLRDPGMSQPIPIGALASALANASPEQQRTMLGESLYPL  585

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV------QQAKIP  121
            VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPE+LKAKVAEA+EVLRNV      QQA  P
Sbjct  586  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPESLKAKVAEAMEVLRNVAQQQQQQQASTP  645

Query  120  ADQLASLSLNDNLVA  76
             DQLA+LSLND LV+
Sbjct  646  TDQLAALSLNDGLVS  660


 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVA+ PS+APR+PMYPPGAPGM QQLFYGQ PP ++PPQ GFG+QQ LVPGMR
Sbjct  401  AQFSQMRPVAIPPSVAPRVPMYPPGAPGMGQQLFYGQPPPTLLPPQPGFGFQQPLVPGMR  460

Query  636  pgggpmPNFFVPM  598
            PG  PMPNFF+PM
Sbjct  461  PGAAPMPNFFMPM  473



>gb|AAB61594.1| poly(A)-binding protein, partial [Mesembryanthemum crystallinum]
Length=176

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 105/134 (78%), Gaps = 11/134 (8%)
 Frame = -1

Query  450  DGPMPGVGGMV--SLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYPLV  280
            D P+PGV G V   + YDMGGM  RD +P VP+  LA+ LANA PEQQR +LGENLYPLV
Sbjct  42   DAPLPGVTGGVLPGVQYDMGGMPIRDLSPTVPVGTLATLLANATPEQQRLLLGENLYPLV  101

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ--------AKI  124
            +QLE E AAKVTGMLLEMDQTEVLHLLESPEALK+KVAEA+EVLRNV Q        +  
Sbjct  102  EQLEPEMAAKVTGMLLEMDQTEVLHLLESPEALKSKVAEAMEVLRNVAQQQQQQQQPSSN  161

Query  123  PADQLASLSLNDNL  82
            PADQLA+LSLNDNL
Sbjct  162  PADQLAALSLNDNL  175



>ref|XP_008788846.1| PREDICTED: polyadenylate-binding protein 2-like [Phoenix dactylifera]
Length=665

 Score =   142 bits (358),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 114/136 (84%), Gaps = 8/136 (6%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  292
            N+ + PMPG  GGM+S PYDMG M  RDA    P+PI ALASALANA PEQQRTMLGE+L
Sbjct  530  NMPEVPMPGAAGGMLSAPYDMGVMPMRDAGMSQPIPIGALASALANASPEQQRTMLGESL  589

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV----QQAKI  124
            YPLVDQLEH+HAAKVTGMLLEMDQ EVLHLLESPEALKAKVAEA+EVLRNV    QQA  
Sbjct  590  YPLVDQLEHDHAAKVTGMLLEMDQPEVLHLLESPEALKAKVAEAMEVLRNVAQQQQQAST  649

Query  123  PADQLASLSLNDNLVA  76
            PADQLA+LSLND +++
Sbjct  650  PADQLAALSLNDGIIS  665


 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVA+ PS+APR+PMYPPGAPGM QQLFYGQ PP +IPPQ GFG+QQ LVPGMR
Sbjct  408  AQFSQMRPVAIPPSVAPRVPMYPPGAPGMGQQLFYGQPPPTLIPPQPGFGFQQPLVPGMR  467

Query  636  pgggpmPNFFVPM  598
            PG  PMPNF++P 
Sbjct  468  PGVAPMPNFYMPF  480



>ref|XP_004499046.1| PREDICTED: polyadenylate-binding protein 2-like isoform X3 [Cicer 
arietinum]
Length=588

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 158/186 (85%), Gaps = 5/186 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVA+TPS+APR+P+YPPGAPG+ QQ  YGQGPPA+IPPQAGFGYQQQLVPGMR
Sbjct  401  AQFSQMRPVAITPSVAPRMPLYPPGAPGLGQQFMYGQGPPAMIPPQAGFGYQQQLVPGMR  460

Query  636  pgggpmPNFFVPMvqqgqqaprpggrrgagpvqqtqqpiplmqqqmlprgrmyrypggRN  457
            PGGGPMP+FFVPMV+QGQQ PRPGGRRGAGP QQ Q   P+MQQQM+PR R+YRYP GRN
Sbjct  461  PGGGPMPSFFVPMVKQGQQGPRPGGRRGAGPGQQPQPQGPMMQQQMIPRQRIYRYPPGRN  520

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTM--LGENL  292
            + D P+ GV GGM+S+PYDMGG+  RDA   P+PI ALA+ALANAP EQQRT+  + E+ 
Sbjct  521  MQDVPLQGVAGGMMSVPYDMGGLPIRDAVGQPMPIQALATALANAPSEQQRTVSPVSEHC  580

Query  291  YPLVDQ  274
            + ++ Q
Sbjct  581  FSVLIQ  586



>gb|ABK94932.1| unknown [Populus trichocarpa]
Length=408

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 110/128 (86%), Gaps = 5/128 (4%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D PM GV GGM+S+PYDMGGM  RDAA   P+PI ALA+ALANA P+QQRTMLGENLYPL
Sbjct  279  DVPMTGVAGGMLSVPYDMGGMPMRDAALSQPIPIGALATALANATPDQQRTMLGENLYPL  338

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQLA  106
            V+QLE E AAKVTGMLLEMDQTEVLHLLESPEALK+KV EA+EVLR V QQA   ADQLA
Sbjct  339  VEQLEPEAAAKVTGMLLEMDQTEVLHLLESPEALKSKVNEAMEVLRTVQQQATGTADQLA  398

Query  105  SLSLNDNL  82
            SLSLNDNL
Sbjct  399  SLSLNDNL  406


 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+  R+PMYPP  PG+ QQ+FYGQGPPAI+PPQ GFGYQQQLVPGMR
Sbjct  159  AQFSQMRPVAMAPSVG-RMPMYPPTGPGLGQQIFYGQGPPAIMPPQPGFGYQQQLVPGMR  217

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVPM
Sbjct  218  PGGAPMPNFFVPM  230



>ref|XP_002313862.1| polyadenylate-binding family protein [Populus trichocarpa]
 gb|EEE87817.1| polyadenylate-binding family protein [Populus trichocarpa]
Length=642

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 110/128 (86%), Gaps = 5/128 (4%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D PM GV GGM+S+PYDMGGM  RDAA   P+PI ALA+ALANA P+QQRTMLGENLYPL
Sbjct  513  DVPMTGVAGGMLSVPYDMGGMPMRDAALSQPIPIGALATALANATPDQQRTMLGENLYPL  572

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQLA  106
            V+QLE E AAKVTGMLLEMDQTEVLHLLESPEALK+KV EA+EVLR V QQA   ADQLA
Sbjct  573  VEQLEPEAAAKVTGMLLEMDQTEVLHLLESPEALKSKVNEAMEVLRTVQQQATGTADQLA  632

Query  105  SLSLNDNL  82
            SLSLNDNL
Sbjct  633  SLSLNDNL  640



>gb|EMT11581.1| Polyadenylate-binding protein 2 [Aegilops tauschii]
Length=195

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 102/130 (78%), Gaps = 5/130 (4%)
 Frame = -1

Query  450  DGPMPGVGGMVSLPYDMGGMLPRD-AAPVPIT--ALASALANAPPEQQRTMLGENLYPLV  280
            D    GVG MV   Y+MG   P D  AP  ++  ALASAL N+PPEQQR MLGE+LYPLV
Sbjct  65   DAAFRGVGAMVPSLYEMGRTTPGDTGAPQQVSSGALASALVNSPPEQQRLMLGESLYPLV  124

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQLA  106
            DQLEH+ AAKVTGMLLEMDQTEVLHL+ESP+ALK+KVAEA+EVLR+   QQ  +PADQLA
Sbjct  125  DQLEHDQAAKVTGMLLEMDQTEVLHLIESPDALKSKVAEAMEVLRSAQQQQTNVPADQLA  184

Query  105  SLSLNDNLVA  76
            +LSL+D  VA
Sbjct  185  ALSLSDGFVA  194



>ref|XP_003607922.1| Poly(A)-binding protein [Medicago truncatula]
 gb|AES90119.1| polyadenylate-binding protein [Medicago truncatula]
Length=654

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 102/119 (86%), Gaps = 6/119 (5%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            DGPMPGV GGM S+PYD+GGM  RDA+    +PI ALAS LANA PEQQRTMLGENLYPL
Sbjct  524  DGPMPGVAGGMYSVPYDVGGMPIRDASLSQQIPIGALASHLANASPEQQRTMLGENLYPL  583

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQ  112
            V+QLE ++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLRNV  QQA   ADQ
Sbjct  584  VEQLEPDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRNVAQQQAGGAADQ  642


 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQF++MRPV+M PS+APR+PMYPPG PGM QQ+FYGQGPPAIIP Q GFGYQQQLVPGMR
Sbjct  403  AQFAQMRPVSMPPSVAPRMPMYPPGGPGMGQQIFYGQGPPAIIPSQPGFGYQQQLVPGMR  462

Query  636  pgggpmPNFFVPM  598
            PGG P+PNFFVPM
Sbjct  463  PGGAPVPNFFVPM  475



>ref|XP_002518733.1| polyadenylate-binding protein, putative [Ricinus communis]
 gb|EEF43658.1| polyadenylate-binding protein, putative [Ricinus communis]
Length=644

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 113/131 (86%), Gaps = 6/131 (5%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D PM GV GGM+S+PYDM GM  RDAA   P+PI ALASALANA PEQQRTMLGENLYPL
Sbjct  514  DVPMTGVAGGMLSVPYDMSGMPMRDAALSQPIPIGALASALANASPEQQRTMLGENLYPL  573

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQL  109
            V+QLE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V  QQA   ADQL
Sbjct  574  VEQLEPDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVQQQQAGGAADQL  633

Query  108  ASLSLNDNLVA  76
            ASLSLNDNLV+
Sbjct  634  ASLSLNDNLVS  644


 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM PS+APR+PMYPPG PG+ QQ+FYGQ PPAIIPPQ GFGYQQQLVPGMR
Sbjct  393  AQFSQIRPVAMAPSVAPRMPMYPPGGPGLGQQIFYGQAPPAIIPPQPGFGYQQQLVPGMR  452

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVPM
Sbjct  453  PGGAPMPNFFVPM  465



>emb|CDO97198.1| unnamed protein product [Coffea canephora]
Length=653

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 111/131 (85%), Gaps = 6/131 (5%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRD--AAPVPITALASALANAPPEQQRTMLGENLYPLV  280
            D  MPGV GGM+S+PYDMGGM  RD  + PVPI ALASALANA P  QRTMLGENLYPLV
Sbjct  523  DVSMPGVVGGMLSVPYDMGGMPLRDVVSQPVPIGALASALANASPADQRTMLGENLYPLV  582

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPADQL  109
            +QLE E AAKVTGMLLEMDQTEVLHLLESPEALK+KVAEA+EVLRNV   QQA  PADQL
Sbjct  583  EQLEPETAAKVTGMLLEMDQTEVLHLLESPEALKSKVAEAMEVLRNVSQQQQATNPADQL  642

Query  108  ASLSLNDNLVA  76
            ASLSLND LV+
Sbjct  643  ASLSLNDGLVS  653


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RP+AM PS+APR+PMYPPG PG+ QQ+FYGQ PPAIIPPQ GFGYQQQLVPGMR
Sbjct  400  AQFSQLRPIAMGPSVAPRMPMYPPGGPGLGQQIFYGQPPPAIIPPQPGFGYQQQLVPGMR  459

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVPM
Sbjct  460  PGGAPMPNFFVPM  472



>emb|CDO97200.1| unnamed protein product [Coffea canephora]
Length=654

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 111/131 (85%), Gaps = 6/131 (5%)
 Frame = -1

Query  450  DGPMPGVGG-MVSLPYDMGGMLPRD--AAPVPITALASALANAPPEQQRTMLGENLYPLV  280
            D  MPGVGG M+S+PYDMGGM  RD  + PVPI ALASALANA P  QRTMLGENLYPLV
Sbjct  524  DVSMPGVGGGMLSVPYDMGGMPLRDVVSQPVPIGALASALANASPADQRTMLGENLYPLV  583

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPADQL  109
            +QLE E AAKVTGMLLEMDQTEVLHLLESPEALK+KVAEA+EVLRNV   QQA  PADQL
Sbjct  584  EQLEPETAAKVTGMLLEMDQTEVLHLLESPEALKSKVAEAMEVLRNVSQQQQAANPADQL  643

Query  108  ASLSLNDNLVA  76
            ASLSLND LV+
Sbjct  644  ASLSLNDGLVS  654


 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RP+AM PS+APR+PMY PG PG+ QQ+FYGQ PPAI+PPQ GFGYQQQLVPGMR
Sbjct  401  AQFSQLRPIAMGPSVAPRMPMYSPGGPGLGQQIFYGQPPPAIMPPQPGFGYQQQLVPGMR  460

Query  636  pgggpmPNFFVPM  598
            PG GPMPNFFVP+
Sbjct  461  PGAGPMPNFFVPL  473



>ref|XP_007017178.1| Poly(A) binding protein 8 isoform 1 [Theobroma cacao]
 gb|EOY14403.1| Poly(A) binding protein 8 isoform 1 [Theobroma cacao]
Length=648

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 115/135 (85%), Gaps = 7/135 (5%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  292
            N+ D PM  V GGM+S+PYD+GGM  RDA    P+PI ALA+ALANA PEQQRTMLGE+L
Sbjct  514  NMPDVPMSSVAGGMLSVPYDLGGMPLRDAGVGQPMPIPALATALANATPEQQRTMLGESL  573

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIP  121
            YPLV++LE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEALEVLR+V   QQA  P
Sbjct  574  YPLVERLERDSAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEALEVLRSVAAQQQANSP  633

Query  120  ADQLASLSLNDNLVA  76
            ADQLASLSLNDNLV+
Sbjct  634  ADQLASLSLNDNLVS  648


 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRP+A+ PS+APR+PMYP GAPG+ QQ  YGQ PPAIIPPQAGFGYQQQLV
Sbjct  399  AQFSQMRPLAI-PSVAPRMPMYPSGAPGLGQQFLYGQAPPAIIPPQAGFGYQQQLV  453



>gb|KJB40266.1| hypothetical protein B456_007G054700 [Gossypium raimondii]
Length=607

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 106/130 (82%), Gaps = 8/130 (6%)
 Frame = -1

Query  441  MPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQ  274
            MP V G ++ +PY++GGM  RDAA   P+   ALASALANA   QQRT+LGENLYPLVDQ
Sbjct  478  MPDVPGRVLPVPYNVGGMPFRDAAFSQPMATGALASALANATTVQQRTLLGENLYPLVDQ  537

Query  273  LEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV----QQAKIPADQLA  106
            LEH++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRN+    QQA    D+L 
Sbjct  538  LEHDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNIGPKPQQANSATDRLT  597

Query  105  SLSLNDNLVA  76
            SLSLN+NLV+
Sbjct  598  SLSLNENLVS  607



>ref|XP_006422975.1| hypothetical protein CICLE_v10027999mg [Citrus clementina]
 ref|XP_006487035.1| PREDICTED: polyadenylate-binding protein 2-like [Citrus sinensis]
 gb|ESR36215.1| hypothetical protein CICLE_v10027999mg [Citrus clementina]
Length=645

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 111/132 (84%), Gaps = 7/132 (5%)
 Frame = -1

Query  450  DGPMPGVGGMVSLPY-DMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENLYPL  283
            D  MPGVGGM+ +PY DM  M  RDA    PVPI ALASALANA PEQQRTMLGENLYPL
Sbjct  514  DVSMPGVGGMLPIPYGDMAAMPLRDAPISQPVPIGALASALANASPEQQRTMLGENLYPL  573

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPADQ  112
            V+QLE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV   QQA  PADQ
Sbjct  574  VEQLEPDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAQQQQAGNPADQ  633

Query  111  LASLSLNDNLVA  76
            LASLSLNDNLV+
Sbjct  634  LASLSLNDNLVS  645


 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQF++MRPVAM  ++APR+PMYPPG PG+ QQ+FYGQGPPA+IPPQ GFGYQQQLVPGMR
Sbjct  393  AQFAQMRPVAMASTVAPRMPMYPPGGPGIGQQIFYGQGPPAMIPPQPGFGYQQQLVPGMR  452

Query  636  pgggpmPNFFVPM  598
            PGGGPM NFFVP+
Sbjct  453  PGGGPMQNFFVPI  465



>ref|NP_001168063.1| uncharacterized protein LOC100381794 [Zea mays]
 gb|ACN26977.1| unknown [Zea mays]
Length=183

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 106/128 (83%), Gaps = 6/128 (5%)
 Frame = -1

Query  441  MPGVGGMVSLPYDMGGMLPRDAAP--VPITALASALANAPPEQQRTMLGENLYPLVDQLE  268
            M  VG ++   Y+MGGM  R+AAP  VPI ALA+ALANAPP+QQR MLGENLYPLV+QLE
Sbjct  55   MHSVGAVMPPSYEMGGMPMREAAPQPVPIGALATALANAPPDQQRLMLGENLYPLVEQLE  114

Query  267  HEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLR---NVQQAKIPAD-QLASL  100
             E AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVLR   ++QQ+ +  + QLA+L
Sbjct  115  REQAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLRSAQHLQQSNVSTEQQLANL  174

Query  99   SLNDNLVA  76
            SLND +V+
Sbjct  175  SLNDGVVS  182



>gb|EEE61291.1| hypothetical protein OsJ_15377 [Oryza sativa Japonica Group]
Length=613

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 100/128 (78%), Gaps = 5/128 (4%)
 Frame = -1

Query  444  PMPGVGGMVSLPYDMGGMLPRDA--APVPITALASALANAPPEQQRTMLGENLYPLVDQL  271
            PMPGV G +   YDMGG   RDA  +P PI  L SALANA PEQQRT+LGE+LYPLV+ L
Sbjct  486  PMPGVAGGMIQSYDMGGFPVRDAGLSPAPIGTLTSALANANPEQQRTILGESLYPLVELL  545

Query  270  EHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ---AKIPADQLASL  100
            E  HAAKVTGMLLEMDQTEVLHLLESPEALK+KVAEA++VLRNV Q   A  P  QLA+L
Sbjct  546  EQNHAAKVTGMLLEMDQTEVLHLLESPEALKSKVAEAMDVLRNVAQQHNANTPTSQLAAL  605

Query  99   SLNDNLVA  76
            SL D +++
Sbjct  606  SLGDAIIS  613



>ref|NP_564554.1| poly(A) binding protein 8 [Arabidopsis thaliana]
 ref|NP_001185184.1| poly(A) binding protein 8 [Arabidopsis thaliana]
 sp|Q9FXA2.1|PABP8_ARATH RecName: Full=Polyadenylate-binding protein 8; Short=PABP-8; 
Short=Poly(A)-binding protein 8 [Arabidopsis thaliana]
 gb|AAG13056.1|AC011807_15 Putative Poly-A Binding Protein [Arabidopsis thaliana]
 gb|AAK43894.1|AF370517_1 Putative Poly-A Binding Protein [Arabidopsis thaliana]
 gb|AAL47336.1| putative Poly-A Binding Protein [Arabidopsis thaliana]
 gb|AEE32472.1| poly(A) binding protein 8 [Arabidopsis thaliana]
 gb|AEE32473.1| poly(A) binding protein 8 [Arabidopsis thaliana]
Length=671

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 105/130 (81%), Gaps = 9/130 (7%)
 Frame = -1

Query  441  MPG-VGGMVSLPYDM---GGMLPRDA---APVPITALASALANAPPEQQRTMLGENLYPL  283
            MPG    M+S+PYD+   GG+  RD+    PVPI ALA+ LANA PEQQRTMLGENLYPL
Sbjct  541  MPGPTQNMLSVPYDVSSGGGVHHRDSPTSQPVPIVALATRLANAAPEQQRTMLGENLYPL  600

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQL  109
            V+QLE E AAKVTGMLLEMDQTEVLHLLESPEALKAKV EA++VLR+V  QQA   ADQL
Sbjct  601  VEQLEPESAAKVTGMLLEMDQTEVLHLLESPEALKAKVTEAMDVLRSVAQQQAGGAADQL  660

Query  108  ASLSLNDNLV  79
            ASLSL DN+V
Sbjct  661  ASLSLGDNIV  670


 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV M P++ PR+ MYPPG P M QQLFYGQGPPA+I PQ GFGYQQQLVPGMR
Sbjct  414  AQFSQMRPVNMPPAVGPRMQMYPPGGPPMGQQLFYGQGPPAMI-PQPGFGYQQQLVPGMR  472

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFF+PM
Sbjct  473  PGGSPMPNFFMPM  485



>gb|KHG25571.1| Polyadenylate-binding protein 1-like 2 [Gossypium arboreum]
Length=653

 Score =   138 bits (347),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 107/130 (82%), Gaps = 8/130 (6%)
 Frame = -1

Query  441  MPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQ  274
            MP V G ++ +PY++GGM  RDAA   P+   ALASALANA P QQRT+LGENLYPLV Q
Sbjct  524  MPDVPGRVLPVPYNVGGMPFRDAAFSQPMATGALASALANATPVQQRTLLGENLYPLVGQ  583

Query  273  LEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV----QQAKIPADQLA  106
            LEH++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRN+    QQA    D+LA
Sbjct  584  LEHDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNIGPKPQQANSATDRLA  643

Query  105  SLSLNDNLVA  76
            SLSLN+NLV+
Sbjct  644  SLSLNENLVS  653


 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 56/72 (78%), Gaps = 6/72 (8%)
 Frame = -1

Query  813  QFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmrp  634
            QFS+MRP AM P++ P++PMYPPGA    QQLFYGQGPPA+IPPQ GFGYQQQLV     
Sbjct  410  QFSQMRPGAMGPTVGPQVPMYPPGAAHFGQQLFYGQGPPAMIPPQPGFGYQQQLV-----  464

Query  633  gggpmPNFFVPM  598
              G MPNFF+PM
Sbjct  465  -PGMMPNFFMPM  475



>ref|XP_007047341.1| Poly(A) binding protein 8 [Theobroma cacao]
 gb|EOX91498.1| Poly(A) binding protein 8 [Theobroma cacao]
Length=659

 Score =   137 bits (346),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 114/135 (84%), Gaps = 8/135 (6%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  292
            N++D P+ GV GGM+ +PY++GGM  RDAA   P+   ALA+ALANA PEQQRT+LGENL
Sbjct  525  NMTDVPISGVPGGMLPVPYEVGGMPFRDAAFSQPMTTGALATALANATPEQQRTLLGENL  584

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV----QQAKI  124
            YPLVDQLEHE+AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV    Q+A  
Sbjct  585  YPLVDQLEHENAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVGPPQQKANS  644

Query  123  PADQLASLSLNDNLV  79
              D++ASLSLNDNLV
Sbjct  645  TTDRMASLSLNDNLV  659


 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 56/73 (77%), Gaps = 6/73 (8%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP AM P + PR+PMYPPGA G+ QQLFYGQGPPAII PQ GFGYQQQLV    
Sbjct  411  AQFSQMRPGAMAPGVGPRMPMYPPGAAGLGQQLFYGQGPPAIITPQPGFGYQQQLV----  466

Query  636  pgggpmPNFFVPM  598
               G  PNFF+PM
Sbjct  467  --PGMRPNFFMPM  477



>ref|XP_002285190.1| PREDICTED: polyadenylate-binding protein 2 [Vitis vinifera]
 emb|CAN65906.1| hypothetical protein VITISV_004873 [Vitis vinifera]
Length=648

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 97/110 (88%), Gaps = 4/110 (4%)
 Frame = -1

Query  456  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  289
            +SD PMPGV GGMVS+PYDMGGM   DAA    +P+ ALA+ALANAPP +QRTMLGENLY
Sbjct  520  LSDVPMPGVAGGMVSVPYDMGGMPLHDAAISQSIPVGALATALANAPPAEQRTMLGENLY  579

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV  139
            PLV+QLE E AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVLRNV
Sbjct  580  PLVEQLEPEMAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLRNV  629


 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV M PS+ PR+PMYPP  PG+ QQ+FYGQ PPAIIPPQ GFGYQQQLVPGMR
Sbjct  399  AQFSQMRPVPMPPSVVPRLPMYPPSGPGLGQQMFYGQAPPAIIPPQPGFGYQQQLVPGMR  458

Query  636  pgggpmPNFFVPM  598
            P G PMPNFFVP+
Sbjct  459  PAGPPMPNFFVPI  471



>ref|XP_008364810.1| PREDICTED: polyadenylate-binding protein 8-like [Malus domestica]
Length=652

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 112/136 (82%), Gaps = 11/136 (8%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGG---MLPRDAA----PVPITALASALANAPPEQQRTMLGEN  295
            DGPMPGV GGM S+PYDMGG   M  RDAA     VPI ALA+ALANA PEQQRTMLGEN
Sbjct  517  DGPMPGVAGGMFSVPYDMGGGGSMPIRDAAVSQPTVPIGALATALANATPEQQRTMLGEN  576

Query  294  LYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKI  124
            LYPLV+QLE ++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLRNV   QQ   
Sbjct  577  LYPLVEQLEPDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRNVAQQQQVGN  636

Query  123  PADQLASLSLNDNLVA  76
             ADQL SLSLN NLV+
Sbjct  637  AADQLGSLSLNGNLVS  652


 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 64/73 (88%), Gaps = 3/73 (4%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS   R+PMYPPG PG+ QQ+FYGQGPPAIIP Q GFGYQQQLVPGMR
Sbjct  399  AQFSQMRPVAMAPS---RMPMYPPGGPGLGQQIFYGQGPPAIIPSQPGFGYQQQLVPGMR  455

Query  636  pgggpmPNFFVPM  598
            PGG P+PNFFVPM
Sbjct  456  PGGAPLPNFFVPM  468



>gb|KJB40264.1| hypothetical protein B456_007G054700 [Gossypium raimondii]
Length=651

 Score =   137 bits (345),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 106/130 (82%), Gaps = 8/130 (6%)
 Frame = -1

Query  441  MPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQ  274
            MP V G ++ +PY++GGM  RDAA   P+   ALASALANA   QQRT+LGENLYPLVDQ
Sbjct  522  MPDVPGRVLPVPYNVGGMPFRDAAFSQPMATGALASALANATTVQQRTLLGENLYPLVDQ  581

Query  273  LEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV----QQAKIPADQLA  106
            LEH++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRN+    QQA    D+L 
Sbjct  582  LEHDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNIGPKPQQANSATDRLT  641

Query  105  SLSLNDNLVA  76
            SLSLN+NLV+
Sbjct  642  SLSLNENLVS  651


 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 56/72 (78%), Gaps = 6/72 (8%)
 Frame = -1

Query  813  QFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmrp  634
            QFS+MRP AM P++ P++PMYPPGAP   QQLFYGQGPPA+I PQ GFGYQQQLV     
Sbjct  408  QFSQMRPGAMGPTVGPQVPMYPPGAPHFGQQLFYGQGPPAMISPQPGFGYQQQLV-----  462

Query  633  gggpmPNFFVPM  598
              G MPNFF+PM
Sbjct  463  -PGMMPNFFMPM  473



>ref|XP_008393785.1| PREDICTED: polyadenylate-binding protein 2-like [Malus domestica]
 ref|XP_008351992.1| PREDICTED: polyadenylate-binding protein 2-like [Malus domestica]
Length=649

 Score =   137 bits (345),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 103/126 (82%), Gaps = 4/126 (3%)
 Frame = -1

Query  459  NVSDGPMPGVG-GMVSLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYP  286
            N+ + P  GVG GM+ +PYDMG +  RDAA    + ALA+ALANA  EQQRTMLGE LYP
Sbjct  523  NMQEVPFSGVGSGMLPVPYDMGAIPMRDAAGGQGVPALATALANASTEQQRTMLGEALYP  582

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQ  112
            LVDQLEHE AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLRNV  QQA   ADQ
Sbjct  583  LVDQLEHESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRNVAQQQANSSADQ  642

Query  111  LASLSL  94
            L+SLSL
Sbjct  643  LSSLSL  648


 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 68/74 (92%), Gaps = 1/74 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPR-IPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgm  640
            AQFS+MRPVAM PS+APR +PMYPPGAPG+ QQ  YGQ PPAIIPPQAGFGYQQQLVPG+
Sbjct  403  AQFSQMRPVAMAPSVAPRGMPMYPPGAPGLGQQFMYGQAPPAIIPPQAGFGYQQQLVPGL  462

Query  639  rpgggpmPNFFVPM  598
            RPGGGPMPNFFVPM
Sbjct  463  RPGGGPMPNFFVPM  476



>ref|XP_009359888.1| PREDICTED: polyadenylate-binding protein 2-like [Pyrus x bretschneideri]
 ref|XP_009359896.1| PREDICTED: polyadenylate-binding protein 2-like [Pyrus x bretschneideri]
Length=650

 Score =   137 bits (345),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 103/126 (82%), Gaps = 4/126 (3%)
 Frame = -1

Query  459  NVSDGPMPGVG-GMVSLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYP  286
            N+ + P  GVG GM+ +PYDMG +  RDAA    + ALA+ALANA  EQQRTMLGE LYP
Sbjct  524  NMQEVPFSGVGSGMLPVPYDMGAIPMRDAAGGQGVPALATALANASTEQQRTMLGEALYP  583

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQ  112
            LVDQLEHE AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLRNV  QQA   ADQ
Sbjct  584  LVDQLEHESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRNVAQQQANSSADQ  643

Query  111  LASLSL  94
            L+SLSL
Sbjct  644  LSSLSL  649


 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 68/74 (92%), Gaps = 1/74 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPR-IPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgm  640
            AQFS+MRPVAM PS+APR +PMYPPGAPG+ QQ  YGQ PPAIIPPQAGFGYQQQLVPG+
Sbjct  404  AQFSQMRPVAMAPSVAPRGMPMYPPGAPGLGQQFMYGQAPPAIIPPQAGFGYQQQLVPGL  463

Query  639  rpgggpmPNFFVPM  598
            RPGGGPMPNFFVPM
Sbjct  464  RPGGGPMPNFFVPM  477



>gb|KJB40263.1| hypothetical protein B456_007G054700 [Gossypium raimondii]
Length=653

 Score =   137 bits (345),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 106/130 (82%), Gaps = 8/130 (6%)
 Frame = -1

Query  441  MPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQ  274
            MP V G ++ +PY++GGM  RDAA   P+   ALASALANA   QQRT+LGENLYPLVDQ
Sbjct  524  MPDVPGRVLPVPYNVGGMPFRDAAFSQPMATGALASALANATTVQQRTLLGENLYPLVDQ  583

Query  273  LEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV----QQAKIPADQLA  106
            LEH++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRN+    QQA    D+L 
Sbjct  584  LEHDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNIGPKPQQANSATDRLT  643

Query  105  SLSLNDNLVA  76
            SLSLN+NLV+
Sbjct  644  SLSLNENLVS  653


 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 56/72 (78%), Gaps = 6/72 (8%)
 Frame = -1

Query  813  QFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmrp  634
            QFS+MRP AM P++ P++PMYPPGAP   QQLFYGQGPPA+I PQ GFGYQQQLV     
Sbjct  410  QFSQMRPGAMGPTVGPQVPMYPPGAPHFGQQLFYGQGPPAMISPQPGFGYQQQLV-----  464

Query  633  gggpmPNFFVPM  598
              G MPNFF+PM
Sbjct  465  -PGMMPNFFMPM  475



>ref|XP_008378021.1| PREDICTED: polyadenylate-binding protein 2-like [Malus domestica]
Length=648

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 104/128 (81%), Gaps = 8/128 (6%)
 Frame = -1

Query  459  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAAP---VPITALASALANAPPEQQRTMLGENL  292
            N+ + P  GVGG M S+PYDMG +  RDAA    VP  ALA+ALANA  EQQRTMLGE L
Sbjct  522  NMQEVPFSGVGGGMHSVPYDMGPIPIRDAAGGQGVP--ALATALANASTEQQRTMLGEAL  579

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPA  118
            YPLVDQLEHE AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLRNV  QQA   A
Sbjct  580  YPLVDQLEHESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRNVAQQQANSSA  639

Query  117  DQLASLSL  94
            DQLASL+L
Sbjct  640  DQLASLTL  647


 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+APR+PMYPPGAPG+ QQ  YGQ PPAIIPPQAGFGYQQQLVPG+R
Sbjct  403  AQFSQMRPVAMAPSVAPRMPMYPPGAPGLGQQFMYGQAPPAIIPPQAGFGYQQQLVPGLR  462

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVPM
Sbjct  463  PGGAPMPNFFVPM  475



>ref|XP_002300227.1| polyadenylate-binding family protein [Populus trichocarpa]
 gb|EEE85032.1| polyadenylate-binding family protein [Populus trichocarpa]
Length=644

 Score =   137 bits (344),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 109/129 (84%), Gaps = 5/129 (4%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D PM GV GGM+ +PYDMGGM  RDAA    +P+ ALA+ALANA P+QQRTMLGENLYPL
Sbjct  515  DVPMTGVAGGMLPVPYDMGGMPMRDAALSQSIPVGALATALANATPDQQRTMLGENLYPL  574

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQLA  106
            V+QLE E AAKVTGMLLEMDQTEVLHLLESPEALKAKV EA+EVLR V QQA   ADQLA
Sbjct  575  VEQLEPEAAAKVTGMLLEMDQTEVLHLLESPEALKAKVNEAMEVLRTVQQQATGTADQLA  634

Query  105  SLSLNDNLV  79
            SLSLNDNLV
Sbjct  635  SLSLNDNLV  643


 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+ PR+PMYPP  PG+ QQ+FYGQ PPAIIPPQ GFGYQQQLVPGMR
Sbjct  394  AQFSQMRPVAMAPSVGPRMPMYPPAGPGLGQQIFYGQAPPAIIPPQPGFGYQQQLVPGMR  453

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVPM
Sbjct  454  PGGAPMPNFFVPM  466



>ref|XP_011000130.1| PREDICTED: polyadenylate-binding protein 8-like [Populus euphratica]
Length=644

 Score =   136 bits (343),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 109/129 (84%), Gaps = 5/129 (4%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D PM GV GGM+ +PYDMGGM  RDAA    +P+ ALA+ALANA P+QQRTMLGENLYPL
Sbjct  515  DVPMTGVAGGMLPVPYDMGGMPMRDAALSQSIPVGALATALANATPDQQRTMLGENLYPL  574

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQLA  106
            V+QLE E AAKVTGMLLEMDQTEVLHLLESPEALK+KV EA++VLR V QQA   ADQLA
Sbjct  575  VEQLEPEAAAKVTGMLLEMDQTEVLHLLESPEALKSKVNEAMDVLRTVQQQATGTADQLA  634

Query  105  SLSLNDNLV  79
            SLSLNDNLV
Sbjct  635  SLSLNDNLV  643


 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+ PR+PMYPP  PG+ QQ+FYGQ PPAIIPPQ GFGYQQQLVPGMR
Sbjct  394  AQFSQMRPVAMAPSVGPRMPMYPPAGPGLGQQIFYGQAPPAIIPPQPGFGYQQQLVPGMR  453

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVPM
Sbjct  454  PGGAPMPNFFVPM  466



>ref|XP_006404818.1| hypothetical protein EUTSA_v10000075mg [Eutrema salsugineum]
 gb|ESQ46271.1| hypothetical protein EUTSA_v10000075mg [Eutrema salsugineum]
Length=652

 Score =   136 bits (343),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 108/136 (79%), Gaps = 15/136 (11%)
 Frame = -1

Query  459  NVSDGPMPGVGGMVSLPYDMGGM-LPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  283
            N+ DG MPG  GMV + YDM GM  P+   P+P  ALAS+LA A P QQRT+LGENLYPL
Sbjct  522  NMQDGSMPG--GMVPVAYDMNGMPFPQ---PMPAGALASSLAQASPAQQRTLLGENLYPL  576

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKI-----  124
            VDQ+EHE+AAKVTGMLLEMDQTEVLHLLESPEAL AKV+EAL+VLRNV  QQ+++     
Sbjct  577  VDQIEHENAAKVTGMLLEMDQTEVLHLLESPEALNAKVSEALDVLRNVNQQQSQVSEGKS  636

Query  123  --PADQLASLSLNDNL  82
              P+D LASL++ND+L
Sbjct  637  GSPSDLLASLTINDHL  652


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRP A  P + PR+P++P G PG+ QQ+FYGQGPP IIP QAGFGYQ Q+V
Sbjct  408  AQFSQMRP-AFIPGMGPRMPIFPGGGPGIGQQIFYGQGPPPIIPHQAGFGYQPQMV  462



>ref|XP_009408013.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=645

 Score =   136 bits (343),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 102/124 (82%), Gaps = 7/124 (6%)
 Frame = -1

Query  444  PMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  268
            P+ G+ GGM SLPYDMGG +P+    VPI  L SALANA  EQQRTMLGE+LYPLVDQLE
Sbjct  521  PVSGIHGGMFSLPYDMGGGMPQ--PTVPIGELTSALANATLEQQRTMLGESLYPLVDQLE  578

Query  267  HEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV----QQAKIPADQLASL  100
            H+++AKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V     Q   P D+LA+L
Sbjct  579  HDYSAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAQQHHQVVSPTDRLAAL  638

Query  99   SLND  88
            +LND
Sbjct  639  TLND  642


 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRPVAM PS+APR+P+YPPG PG+ Q LFYGQ PPA++PPQ  FG+QQ LV
Sbjct  395  AQFSQMRPVAMPPSVAPRVPLYPPGGPGLGQPLFYGQ-PPALVPPQPAFGFQQPLV  449



>ref|XP_002891531.1| PAB8 binding protein 8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67790.1| PAB8 binding protein 8 [Arabidopsis lyrata subsp. lyrata]
Length=669

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 105/130 (81%), Gaps = 9/130 (7%)
 Frame = -1

Query  441  MPGVG-GMVSLPYDM---GGMLPRDA---APVPITALASALANAPPEQQRTMLGENLYPL  283
            MPG+   M+S+PYD+   GG+  RD+     VPI ALA+ LANA PEQQRTMLGENLYPL
Sbjct  539  MPGLTPNMLSVPYDVSSGGGVHHRDSPASQSVPIGALATQLANAAPEQQRTMLGENLYPL  598

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQL  109
            V+QLE E AAKVTGMLLEMDQTEVLHLLESPEALKAKV EA++VLR+V  QQA   ADQL
Sbjct  599  VEQLEPESAAKVTGMLLEMDQTEVLHLLESPEALKAKVTEAMDVLRSVAQQQAGGAADQL  658

Query  108  ASLSLNDNLV  79
            ASLSL DN+V
Sbjct  659  ASLSLGDNIV  668


 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV M P++ PR+ MYPPG P M QQLFYGQGPPA+IPPQ GFGYQQQLVPGMR
Sbjct  408  AQFSQMRPVNMPPAVGPRMQMYPPGGPPMGQQLFYGQGPPAMIPPQPGFGYQQQLVPGMR  467

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFF+PM
Sbjct  468  PGGSPMPNFFMPM  480



>gb|KHG04776.1| Polyadenylate-binding 2 -like protein [Gossypium arboreum]
Length=622

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 114/132 (86%), Gaps = 7/132 (5%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            +GPM  V GG++S+PY+MGGM  RDA    P+P+ ALA+ALANA PEQQRTMLGE+LYPL
Sbjct  491  EGPMSNVPGGILSVPYEMGGMPMRDAGVGQPMPVPALATALANATPEQQRTMLGESLYPL  550

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPADQ  112
            V++LE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V   QQA  PAD+
Sbjct  551  VERLERDSAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAAQQQANNPADR  610

Query  111  LASLSLNDNLVA  76
            LASLSLNDNLV+
Sbjct  611  LASLSLNDNLVS  622


 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 67/73 (92%), Gaps = 1/73 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+A++ S++PRIPMYP GAPG+ QQ  YGQGPPAIIPPQAGFGYQQQLVPGMR
Sbjct  373  AQFSQMRPLAIS-SVSPRIPMYPSGAPGLGQQFLYGQGPPAIIPPQAGFGYQQQLVPGMR  431

Query  636  pgggpmPNFFVPM  598
            PGG P+PNFFVPM
Sbjct  432  PGGPPVPNFFVPM  444



>ref|XP_004304018.1| PREDICTED: polyadenylate-binding protein 8-like [Fragaria vesca 
subsp. vesca]
Length=651

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 103/120 (86%), Gaps = 6/120 (5%)
 Frame = -1

Query  417  SLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKV  247
            S+PYD+ GM  RD A   P+PI  LASALANA PEQQRTMLGE+LYPLVDQLE ++AAKV
Sbjct  532  SVPYDLSGMPLRDPALSQPLPIGTLASALANATPEQQRTMLGESLYPLVDQLEPDNAAKV  591

Query  246  TGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPADQLASLSLNDNLVA  76
            TGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV   QQA   ADQLAS+SLNDNLV+
Sbjct  592  TGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAQQQQAGGAADQLASMSLNDNLVS  651


 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAMTPS+APR+PMYPPG PG+ QQ+FYGQ PPAIIP Q GFGYQQQLVPGMR
Sbjct  399  AQFSQMRPVAMTPSVAPRMPMYPPGGPGIGQQIFYGQAPPAIIPSQPGFGYQQQLVPGMR  458

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVPM
Sbjct  459  PGGAPMPNFFVPM  471



>ref|XP_010906557.1| PREDICTED: polyadenylate-binding protein 8-like isoform X2 [Elaeis 
guineensis]
Length=549

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 109/131 (83%), Gaps = 8/131 (6%)
 Frame = -1

Query  450  DGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  280
            D P+PG  GM+S  YD+G M  RD+    P+PI ALASALANA PE QRTMLGE+LYPLV
Sbjct  421  DVPVPG--GMLSATYDVGVMPIRDSGMSQPIPIGALASALANASPEHQRTMLGESLYPLV  478

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPADQL  109
            DQLEH+HAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV   QQA  P DQL
Sbjct  479  DQLEHDHAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAQQQQASTPTDQL  538

Query  108  ASLSLNDNLVA  76
            A+LSLND +V+
Sbjct  539  AALSLNDGVVS  549


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVA+ PS+APR+P+YPPGAPGM QQLFYGQ PP +IPPQ GFG+QQ LVPGMR
Sbjct  296  AQFSQMRPVAIPPSVAPRVPVYPPGAPGMGQQLFYGQPPPTLIPPQPGFGFQQPLVPGMR  355

Query  636  pgggpmPNFFVPM  598
            PG  PMPN F+P+
Sbjct  356  PGAAPMPNIFMPL  368



>ref|XP_007042478.1| Poly(A) binding protein 8 [Theobroma cacao]
 gb|EOX98309.1| Poly(A) binding protein 8 [Theobroma cacao]
Length=645

 Score =   134 bits (338),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 110/129 (85%), Gaps = 4/129 (3%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRD---AAPVPITALASALANAPPEQQRTMLGENLYPL  283
            D  MP V GGM+S+PYDMGGM  RD   + P+PI ALASALANA P+QQRTMLGENLYPL
Sbjct  517  DVSMPNVAGGMLSVPYDMGGMPMRDVPLSQPIPIGALASALANASPDQQRTMLGENLYPL  576

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLAS  103
            V+QLE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V Q +   +QLAS
Sbjct  577  VEQLEPDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAQQQQTGEQLAS  636

Query  102  LSLNDNLVA  76
            LSLNDNLV+
Sbjct  637  LSLNDNLVS  645


 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+APR+PMYPPG PG+ QQ+FYGQ PPAI PPQ GFGYQQQLVPGMR
Sbjct  396  AQFSQMRPVAMPPSVAPRMPMYPPGGPGLGQQIFYGQAPPAIFPPQPGFGYQQQLVPGMR  455

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVPM
Sbjct  456  PGGAPMPNFFVPM  468



>ref|XP_007201197.1| hypothetical protein PRUPE_ppa002607mg [Prunus persica]
 gb|EMJ02396.1| hypothetical protein PRUPE_ppa002607mg [Prunus persica]
Length=653

 Score =   134 bits (338),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 115/132 (87%), Gaps = 7/132 (5%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D PMPGV GGM S+PYDMGGM  RDAA   P+PI ALA+ALANA PEQQRTMLGENLYPL
Sbjct  522  DVPMPGVAGGMFSVPYDMGGMPMRDAALSQPIPIGALATALANATPEQQRTMLGENLYPL  581

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPADQ  112
            V+QLE E+AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV   QQA   ADQ
Sbjct  582  VEQLEPENAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAQQQQAGNAADQ  641

Query  111  LASLSLNDNLVA  76
            LASLSLN+NLV+
Sbjct  642  LASLSLNENLVS  653


 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+APR+PMYPPG PG+ QQ+FYGQGPPAIIP Q GFGYQQQLVPGMR
Sbjct  401  AQFSQMRPVAMAPSVAPRMPMYPPGGPGLGQQIFYGQGPPAIIPSQPGFGYQQQLVPGMR  460

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVPM
Sbjct  461  PGGAPMPNFFVPM  473



>ref|XP_008236485.1| PREDICTED: polyadenylate-binding protein 8 [Prunus mume]
Length=653

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 115/132 (87%), Gaps = 7/132 (5%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D PMPGV GGM S+PYDMGGM  RDAA   P+PI ALA+ALANA PEQQRTMLGENLYPL
Sbjct  522  DVPMPGVAGGMFSVPYDMGGMPMRDAALSQPIPIGALATALANATPEQQRTMLGENLYPL  581

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPADQ  112
            V+QLE E+AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV   QQA   ADQ
Sbjct  582  VEQLEPENAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAQQQQAGNAADQ  641

Query  111  LASLSLNDNLVA  76
            LASLSLN+NLV+
Sbjct  642  LASLSLNENLVS  653


 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRPVAM PS+APR+PMYPPG PG+ QQ+FYGQGPPAIIP Q GFGYQQQLV
Sbjct  401  AQFSQMRPVAMAPSVAPRMPMYPPGGPGLGQQIFYGQGPPAIIPSQPGFGYQQQLV  456



>ref|XP_009398670.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=643

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 97/124 (78%), Gaps = 6/124 (5%)
 Frame = -1

Query  441  MPGVG---GMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  280
            MP VG   GM S PYDMGGM  R A    PVP+  L SALANA PEQQR MLGE+LYPLV
Sbjct  518  MPEVGNPEGMFSPPYDMGGMPARHAGMSQPVPVGELTSALANATPEQQRLMLGESLYPLV  577

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASL  100
            DQLEH +AAKVTGMLLEMDQ EVLHLLESPEAL+AKV EA+ VLR+V Q +  A++LA L
Sbjct  578  DQLEHGYAAKVTGMLLEMDQNEVLHLLESPEALQAKVVEAMGVLRSVVQQQQVANRLAGL  637

Query  99   SLND  88
            SLND
Sbjct  638  SLND  641


 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV + PS+APR+P+YPPGAPG+ Q LFYGQ PPA++PPQ GFG+   LV GMR
Sbjct  396  AQFSQMRPVVIPPSVAPRVPLYPPGAPGLGQPLFYGQ-PPALVPPQPGFGFPHPLVTGMR  454

Query  636  pgggpmPNFFVPM  598
            PG  P PNFF+PM
Sbjct  455  PGAAPFPNFFIPM  467



>ref|NP_001275799.1| poly A-binding protein 2 [Citrus sinensis]
 gb|AEV43365.1| poly A-binding protein 2 [Citrus sinensis]
 gb|KDO79128.1| hypothetical protein CISIN_1g006290mg [Citrus sinensis]
Length=652

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 113/136 (83%), Gaps = 8/136 (6%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  292
            N+ D P+ GV GGM+  PYD+GGM  RDAA   P+   ALASALANA PEQQRT+LGENL
Sbjct  517  NIPDVPVAGVPGGMLPGPYDIGGMPFRDAAFSQPMQTGALASALANASPEQQRTLLGENL  576

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKI----  124
            YPLVDQLEH++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV Q +     
Sbjct  577  YPLVDQLEHDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAQQQATGPS  636

Query  123  PADQLASLSLNDNLVA  76
            P D++ASLSLNDN+V+
Sbjct  637  PTDRVASLSLNDNIVS  652


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 51/73 (70%), Gaps = 12/73 (16%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP      + PR+PMYPP APG+ QQLFYGQ  P IIPPQ GFGYQQQLV    
Sbjct  409  AQFSQMRP-----PVGPRMPMYPPVAPGLGQQLFYGQ-GPPIIPPQPGFGYQQQLV----  458

Query  636  pgggpmPNFFVPM  598
               G  PN+FVPM
Sbjct  459  --PGMRPNYFVPM  469



>dbj|BAJ53194.1| JHL03K20.3 [Jatropha curcas]
Length=642

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 111/130 (85%), Gaps = 5/130 (4%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D PM G+ GGM+ +PYDMGGM  RD A   P+   ALA+ALANA PEQQRT+LGENLYPL
Sbjct  513  DVPMAGLPGGMLPVPYDMGGMPFRDGAFSQPMQTGALATALANATPEQQRTLLGENLYPL  572

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQLA  106
            VDQLEHE+AAKVTGMLLEMDQTEVLHLLESPE+L+AKVAEA+EVLR V QQA  P +++A
Sbjct  573  VDQLEHENAAKVTGMLLEMDQTEVLHLLESPESLEAKVAEAMEVLRTVQQQANSPTNRMA  632

Query  105  SLSLNDNLVA  76
            +LSLN+NLV+
Sbjct  633  TLSLNENLVS  642


 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 57/73 (78%), Gaps = 7/73 (10%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP AM P++ PR+PMYP G PG+ QQLFYGQGPPAI+PPQ GFGYQQQLV    
Sbjct  398  AQFSQMRP-AMAPAVGPRMPMYPHGTPGIGQQLFYGQGPPAIVPPQPGFGYQQQLV----  452

Query  636  pgggpmPNFFVPM  598
               G  PNFFVPM
Sbjct  453  --PGMRPNFFVPM  463



>ref|XP_010906556.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Elaeis 
guineensis]
Length=654

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 109/131 (83%), Gaps = 8/131 (6%)
 Frame = -1

Query  450  DGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  280
            D P+PG  GM+S  YD+G M  RD+    P+PI ALASALANA PE QRTMLGE+LYPLV
Sbjct  526  DVPVPG--GMLSATYDVGVMPIRDSGMSQPIPIGALASALANASPEHQRTMLGESLYPLV  583

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPADQL  109
            DQLEH+HAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV   QQA  P DQL
Sbjct  584  DQLEHDHAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAQQQQASTPTDQL  643

Query  108  ASLSLNDNLVA  76
            A+LSLND +V+
Sbjct  644  AALSLNDGVVS  654


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVA+ PS+APR+P+YPPGAPGM QQLFYGQ PP +IPPQ GFG+QQ LVPGMR
Sbjct  401  AQFSQMRPVAIPPSVAPRVPVYPPGAPGMGQQLFYGQPPPTLIPPQPGFGFQQPLVPGMR  460

Query  636  pgggpmPNFFVPM  598
            PG  PMPN F+P+
Sbjct  461  PGAAPMPNIFMPL  473



>gb|KDO79129.1| hypothetical protein CISIN_1g006290mg [Citrus sinensis]
Length=650

 Score =   134 bits (337),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 113/136 (83%), Gaps = 8/136 (6%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  292
            N+ D P+ GV GGM+  PYD+GGM  RDAA   P+   ALASALANA PEQQRT+LGENL
Sbjct  515  NIPDVPVAGVPGGMLPGPYDIGGMPFRDAAFSQPMQTGALASALANASPEQQRTLLGENL  574

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKI----  124
            YPLVDQLEH++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV Q +     
Sbjct  575  YPLVDQLEHDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAQQQATGPS  634

Query  123  PADQLASLSLNDNLVA  76
            P D++ASLSLNDN+V+
Sbjct  635  PTDRVASLSLNDNIVS  650


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 50/72 (69%), Gaps = 12/72 (17%)
 Frame = -1

Query  813  QFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmrp  634
            QFS+MRP      + PR+PMYPP APG+ QQLFYGQ  P IIPPQ GFGYQQQLV     
Sbjct  408  QFSQMRP-----PVGPRMPMYPPVAPGLGQQLFYGQ-GPPIIPPQPGFGYQQQLV-----  456

Query  633  gggpmPNFFVPM  598
              G  PN+FVPM
Sbjct  457  -PGMRPNYFVPM  467



>ref|XP_006425947.1| hypothetical protein CICLE_v10025109mg [Citrus clementina]
 gb|ESR39187.1| hypothetical protein CICLE_v10025109mg [Citrus clementina]
Length=650

 Score =   134 bits (337),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 113/136 (83%), Gaps = 8/136 (6%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  292
            N+ D P+ GV GGM+  PYD+GGM  RDAA   P+   ALASALANA PEQQRT+LGENL
Sbjct  515  NIPDVPVAGVPGGMLPGPYDIGGMPFRDAAFSQPMQTGALASALANASPEQQRTLLGENL  574

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKI----  124
            YPLVDQLEH++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV Q +     
Sbjct  575  YPLVDQLEHDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAQQQATGPS  634

Query  123  PADQLASLSLNDNLVA  76
            P D++ASLSLNDN+V+
Sbjct  635  PTDRVASLSLNDNIVS  650


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 50/72 (69%), Gaps = 12/72 (17%)
 Frame = -1

Query  813  QFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmrp  634
            QFS+MRP      + PR+PMYPP APG+ QQLFYGQ  P IIPPQ GFGYQQQLV     
Sbjct  408  QFSQMRP-----PVGPRMPMYPPVAPGLGQQLFYGQ-GPPIIPPQPGFGYQQQLV-----  456

Query  633  gggpmPNFFVPM  598
              G  PN+FVPM
Sbjct  457  -PGMRPNYFVPM  467



>ref|XP_006494495.1| PREDICTED: polyadenylate-binding protein 4 [Citrus sinensis]
Length=663

 Score =   134 bits (337),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 113/136 (83%), Gaps = 8/136 (6%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  292
            N+ D P+ GV GGM+  PYD+GGM  RDAA   P+   ALASALANA PEQQRT+LGENL
Sbjct  528  NIPDVPVAGVPGGMLPGPYDIGGMPFRDAAFSQPMQTGALASALANASPEQQRTLLGENL  587

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKI----  124
            YPLVDQLEH++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV Q +     
Sbjct  588  YPLVDQLEHDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAQQQATGPS  647

Query  123  PADQLASLSLNDNLVA  76
            P D++ASLSLNDN+V+
Sbjct  648  PTDRVASLSLNDNIVS  663


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 51/73 (70%), Gaps = 12/73 (16%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP      + PR+PMYPP APG+ QQLFYGQ  P IIPPQ GFGYQQQLV    
Sbjct  418  AQFSQMRP-----PVGPRMPMYPPVAPGLGQQLFYGQ-GPPIIPPQPGFGYQQQLV----  467

Query  636  pgggpmPNFFVPM  598
               G  PN+FVPM
Sbjct  468  --PGMRPNYFVPM  478



>ref|XP_006425948.1| hypothetical protein CICLE_v10025109mg [Citrus clementina]
 gb|ESR39188.1| hypothetical protein CICLE_v10025109mg [Citrus clementina]
Length=652

 Score =   134 bits (337),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 113/136 (83%), Gaps = 8/136 (6%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  292
            N+ D P+ GV GGM+  PYD+GGM  RDAA   P+   ALASALANA PEQQRT+LGENL
Sbjct  517  NIPDVPVAGVPGGMLPGPYDIGGMPFRDAAFSQPMQTGALASALANASPEQQRTLLGENL  576

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKI----  124
            YPLVDQLEH++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV Q +     
Sbjct  577  YPLVDQLEHDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAQQQATGPS  636

Query  123  PADQLASLSLNDNLVA  76
            P D++ASLSLNDN+V+
Sbjct  637  PTDRVASLSLNDNIVS  652


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 51/73 (70%), Gaps = 12/73 (16%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP      + PR+PMYPP APG+ QQLFYGQ  P IIPPQ GFGYQQQLV    
Sbjct  409  AQFSQMRP-----PVGPRMPMYPPVAPGLGQQLFYGQ-GPPIIPPQPGFGYQQQLV----  458

Query  636  pgggpmPNFFVPM  598
               G  PN+FVPM
Sbjct  459  --PGMRPNYFVPM  469



>ref|XP_010691731.1| PREDICTED: polyadenylate-binding protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=667

 Score =   134 bits (337),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 107/139 (77%), Gaps = 16/139 (12%)
 Frame = -1

Query  450  DGPMPGV-GGMV-SLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYP  286
            DGP+PGV GGM+  + +DMGGM  RDAA    VP+  LA+ LANA PE QR +LGENLYP
Sbjct  528  DGPIPGVTGGMLPGVQFDMGGMPVRDAALSPTVPVGTLATLLANATPEHQRLLLGENLYP  587

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ---------  133
            LV+QLE E AAKVTGMLLEMDQTEVLHLLESP+ALKAKV+EA+EVLRNV Q         
Sbjct  588  LVEQLEPEMAAKVTGMLLEMDQTEVLHLLESPDALKAKVSEAMEVLRNVAQQQQQQQQQQ  647

Query  132  --AKIPADQLASLSLNDNL  82
              +  PADQL++LSLNDNL
Sbjct  648  QPSSNPADQLSALSLNDNL  666


 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+AM PS+ PR+P+YPP  PG+ QQ++YGQGPPA+IPPQ  FGYQ QL+    
Sbjct  407  AQFSQMRPLAMPPSVGPRMPIYPPAGPGLGQQIYYGQGPPAMIPPQPTFGYQHQLM-PGI  465

Query  636  pgggpmPNFFVPM  598
             GG P+PNFF+PM
Sbjct  466  RGGAPVPNFFMPM  478



>dbj|BAD94406.1| putative poly(A) binding protein [Arabidopsis thaliana]
Length=154

 Score =   125 bits (315),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 104/136 (76%), Gaps = 14/136 (10%)
 Frame = -1

Query  459  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  280
            N+ DGPMPG  GMV + YDM  ++P  + P+    LA++LANA P QQRT+LGE+LYPLV
Sbjct  23   NMPDGPMPG--GMVPVAYDMN-VMPY-SQPMSAGQLATSLANATPAQQRTLLGESLYPLV  78

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ----------A  130
            DQ+E EHAAKVTGMLLEMDQTEVLHLLESPEAL AKV+EAL+VLRNV Q          +
Sbjct  79   DQIESEHAAKVTGMLLEMDQTEVLHLLESPEALNAKVSEALDVLRNVNQPSSQGSEGNKS  138

Query  129  KIPADQLASLSLNDNL  82
              P+D LASLS+ND+L
Sbjct  139  GSPSDLLASLSINDHL  154



>ref|XP_010110808.1| Polyadenylate-binding protein 2 [Morus notabilis]
 gb|EXC28180.1| Polyadenylate-binding protein 2 [Morus notabilis]
Length=639

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 109/126 (87%), Gaps = 4/126 (3%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTMLGENLY  289
            N+ +  +PGV GGM+ +PYD+GG+  RD A   +PITALA+ALANAPPEQQRTMLGE LY
Sbjct  513  NIQEVQIPGVAGGMLPVPYDVGGLPIRDGAGQAMPITALATALANAPPEQQRTMLGEALY  572

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQ  112
            PLVDQLEHE AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV QQA   ADQ
Sbjct  573  PLVDQLEHESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVAQQANSSADQ  632

Query  111  LASLSL  94
            LASLSL
Sbjct  633  LASLSL  638


 Score =   102 bits (253),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM  S+APR+PM+PPGAPG+ QQ  YGQ PPAIIPPQAGFGYQQQLVPGMR
Sbjct  397  AQFSQMRPVAMATSVAPRMPMFPPGAPGLGQQFLYGQAPPAIIPPQAGFGYQQQLVPGMR  456

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVP+
Sbjct  457  PGGAPMPNFFVPV  469



>tpg|DAA39541.1| TPA: hypothetical protein ZEAMMB73_983793 [Zea mays]
Length=654

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 106/128 (83%), Gaps = 6/128 (5%)
 Frame = -1

Query  441  MPGVGGMVSLPYDMGGMLPRDAAP--VPITALASALANAPPEQQRTMLGENLYPLVDQLE  268
            M  VG ++   Y+MGGM  R+AAP  VPI ALA+ALANAPP+QQR MLGENLYPLV+QLE
Sbjct  526  MHSVGAVMPPSYEMGGMPMREAAPQPVPIGALATALANAPPDQQRLMLGENLYPLVEQLE  585

Query  267  HEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLR---NVQQAKIPAD-QLASL  100
             E AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVLR   ++QQ+ +  + QLA+L
Sbjct  586  REQAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLRSAQHLQQSNVSTEQQLANL  645

Query  99   SLNDNLVA  76
            SLND +V+
Sbjct  646  SLNDGVVS  653


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRPVAM PS+ PR+PM+PPG PG+ QQLFYGQ PPA I PQAGF +QQ L+
Sbjct  404  AQFSQMRPVAMAPSVGPRMPMFPPGVPGVGQQLFYGQPPPAFINPQAGFAFQQPLM  459



>tpg|DAA39542.1| TPA: hypothetical protein ZEAMMB73_983793 [Zea mays]
Length=648

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 106/128 (83%), Gaps = 6/128 (5%)
 Frame = -1

Query  441  MPGVGGMVSLPYDMGGMLPRDAAP--VPITALASALANAPPEQQRTMLGENLYPLVDQLE  268
            M  VG ++   Y+MGGM  R+AAP  VPI ALA+ALANAPP+QQR MLGENLYPLV+QLE
Sbjct  520  MHSVGAVMPPSYEMGGMPMREAAPQPVPIGALATALANAPPDQQRLMLGENLYPLVEQLE  579

Query  267  HEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLR---NVQQAKIPAD-QLASL  100
             E AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVLR   ++QQ+ +  + QLA+L
Sbjct  580  REQAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLRSAQHLQQSNVSTEQQLANL  639

Query  99   SLNDNLVA  76
            SLND +V+
Sbjct  640  SLNDGVVS  647


 Score = 75.1 bits (183),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQ  679
            AQFS+MRPVAM PS+ PR+PM+PPG PG+ QQLFYGQ PPA I PQ
Sbjct  404  AQFSQMRPVAMAPSVGPRMPMFPPGVPGVGQQLFYGQPPPAFINPQ  449



>ref|XP_008651618.1| PREDICTED: uncharacterized protein LOC100381531 isoform X1 [Zea 
mays]
Length=656

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 104/129 (81%), Gaps = 7/129 (5%)
 Frame = -1

Query  441  MPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQL  271
            M  VG ++  PY+MGGM  RDA    PVPI ALA+ALANA P+QQR MLGENLYPLV+QL
Sbjct  527  MHNVGAVMPSPYEMGGMAMRDAGVSQPVPIGALATALANASPDQQRLMLGENLYPLVEQL  586

Query  270  EHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLR---NVQQAKIPAD-QLAS  103
            E E AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVLR   ++QQ+    + QLA+
Sbjct  587  EREQAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLRSAQHLQQSNASTEQQLAN  646

Query  102  LSLNDNLVA  76
            LSLND +++
Sbjct  647  LSLNDGVLS  655


 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQ  658
            AQFS+MRPVAM PS+ PR+PM+PP  PG+ QQLFYGQ PPA I PQAGF +QQ
Sbjct  403  AQFSQMRPVAMAPSVGPRMPMFPPSVPGVGQQLFYGQPPPAFINPQAGFAFQQ  455



>gb|AFK34295.1| unknown [Medicago truncatula]
Length=107

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 89/105 (85%), Gaps = 2/105 (2%)
 Frame = -1

Query  390  LPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEV  211
            +P  A   P+ ALA+ALANAPPEQQRTMLGE LYPLV+++EH  AAKVTGMLLEMDQ EV
Sbjct  1    MPGVAGGTPMQALATALANAPPEQQRTMLGEVLYPLVEKIEHAGAAKVTGMLLEMDQPEV  60

Query  210  LHLLESPealkakvaealevLRNV--QQAKIPADQLASLSLNDNL  82
            LHL+ESPEALK KVAEA++VLRNV  QQ+  P DQLASLSLNDNL
Sbjct  61   LHLIESPEALKTKVAEAVDVLRNVAQQQSNSPTDQLASLSLNDNL  105



>gb|AFW58788.1| hypothetical protein ZEAMMB73_448418 [Zea mays]
Length=212

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 98/128 (77%), Gaps = 6/128 (5%)
 Frame = -1

Query  441  MPGVGGMVSLPYDMGGMLPRDAAPVP---ITALASALANAPPEQQRTMLGENLYPLVDQL  271
            MPGV G +   YDMGG   RDAA  P   I  L SALANA PEQQRT+LGENLYPLV+QL
Sbjct  85   MPGVAGGMIQAYDMGGFPVRDAALSPAAQIGTLTSALANANPEQQRTILGENLYPLVEQL  144

Query  270  EHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPADQLASL  100
            E   AAKVTGMLLEMDQTEVLHLLESP+ALK+KVAEA++VLRNV   Q   +P  QLA+L
Sbjct  145  EPNQAAKVTGMLLEMDQTEVLHLLESPDALKSKVAEAMDVLRNVAHQQNPNLPTSQLAAL  204

Query  99   SLNDNLVA  76
            SL + +++
Sbjct  205  SLTEGIMS  212



>ref|XP_010555994.1| PREDICTED: polyadenylate-binding protein 8 [Tarenaya hassleriana]
Length=646

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 109/128 (85%), Gaps = 5/128 (4%)
 Frame = -1

Query  444  PMPGVG-GMVSLPYDMGGMLP-RDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  280
            PMPGV   M+S+PYDM G +P RD++   PVPI ALASALANA PEQQRTMLGENLYPLV
Sbjct  519  PMPGVAPSMLSVPYDMAGAVPLRDSSVSQPVPIGALASALANASPEQQRTMLGENLYPLV  578

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASL  100
            +QLE + AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR+V Q    ADQLASL
Sbjct  579  EQLEPDSAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVHQPAGAADQLASL  638

Query  99   SLNDNLVA  76
            SLN N+V+
Sbjct  639  SLNGNIVS  646


 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQF+++RPV M P ++PR+PMYPPG PG+ QQLFYGQGPPA+IPPQ GFG+QQQLVPGMR
Sbjct  397  AQFAQLRPVNMPPVVSPRMPMYPPGGPGIGQQLFYGQGPPAMIPPQPGFGFQQQLVPGMR  456

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFF+PM
Sbjct  457  PGGAPMPNFFMPM  469



>ref|XP_010530761.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
2 [Tarenaya hassleriana]
Length=649

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 103/132 (78%), Gaps = 12/132 (9%)
 Frame = -1

Query  450  DGP-MPGVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGENLYP  286
            D P MPG+     LPY+M  M  R+       VPI ALASALANA PEQQRTMLGENLYP
Sbjct  523  DAPTMPGM-----LPYEMANMSMREPVMSQPAVPIGALASALANATPEQQRTMLGENLYP  577

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLA  106
            LV+++E E AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+ VLR+V  + + ADQLA
Sbjct  578  LVERVEGEAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMAVLRSVSSSIVAADQLA  637

Query  105  SLSLND--NLVA  76
            SLS+ND  N+V+
Sbjct  638  SLSINDSNNIVS  649


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 66/73 (90%), Gaps = 1/73 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQF+++RPV M PS++PR+PMYPP  PG+ QQ+FYGQ PPA+IPPQ GFG+QQQLVPGMR
Sbjct  399  AQFAQLRPV-MPPSVSPRMPMYPPTGPGIGQQIFYGQAPPAMIPPQPGFGFQQQLVPGMR  457

Query  636  pgggpmPNFFVPM  598
            PGGGP+PNFF+PM
Sbjct  458  PGGGPVPNFFMPM  470



>ref|XP_007153579.1| hypothetical protein PHAVU_003G0475001g, partial [Phaseolus vulgaris]
 gb|ESW25573.1| hypothetical protein PHAVU_003G0475001g, partial [Phaseolus vulgaris]
Length=561

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 111/129 (86%), Gaps = 7/129 (5%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D PMPGV GGM S+PYD+GGM  RDA+    +PI ALASALANA PEQQRTMLGENLYPL
Sbjct  432  DVPMPGVAGGMFSVPYDVGGMPLRDASHSQQIPIGALASALANASPEQQRTMLGENLYPL  491

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPADQ  112
            V+QLE ++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLRNV   QQA   ADQ
Sbjct  492  VEQLEPDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRNVAQQQQAGGAADQ  551

Query  111  LASLSLNDN  85
            LASLSLNDN
Sbjct  552  LASLSLNDN  560


 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQF++MRPV M PS+ PR+PMYPPG PG+ QQ+FY QGPPAIIP Q GFGYQQQLVPGMR
Sbjct  314  AQFAQMRPVGMPPSVGPRVPMYPPGGPGIGQQIFY-QGPPAIIPSQPGFGYQQQLVPGMR  372

Query  636  pgggpmPNFFVPM  598
            PG  P+PNFFVPM
Sbjct  373  PGAAPVPNFFVPM  385



>dbj|BAJ86310.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=746

 Score =   132 bits (332),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 102/130 (78%), Gaps = 9/130 (7%)
 Frame = -1

Query  444  PMPGVGGMVSLPYDMGGMLPRDA----APVPITALASALANAPPEQQRTMLGENLYPLVD  277
            P  GVGGMV  PYDMG    RDA    AP PI  L SALANA PEQQRT+LGE+LYPLV+
Sbjct  619  PGVGVGGMVQ-PYDMGSFPVRDAGVSPAP-PIGTLTSALANATPEQQRTILGESLYPLVE  676

Query  276  QLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAK---IPADQLA  106
            +LEH+ AAKVTGMLLEMDQTEVLHLLESPEALK+KVAEA++VLRNV Q +    P  QLA
Sbjct  677  KLEHQQAAKVTGMLLEMDQTEVLHLLESPEALKSKVAEAMDVLRNVAQQQNPNAPTSQLA  736

Query  105  SLSLNDNLVA  76
             LSL+D +++
Sbjct  737  GLSLSDGIIS  746


 Score = 65.9 bits (159),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRPV MTPS+ PR+PMYPP  P + QQLFYGQ PPA++PPQ G+G+QQQLV
Sbjct  491  AQFSQMRPVPMTPSMTPRLPMYPP-MPTLGQQLFYGQAPPAMMPPQPGYGFQQQLV  545



>gb|KFK32750.1| poly binding protein [Arabis alpina]
Length=646

 Score =   131 bits (330),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 105/134 (78%), Gaps = 12/134 (9%)
 Frame = -1

Query  459  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  280
            N+ DGPMPG  GMV + YDM GM P    P+P  ALAS+LA+A P QQRT+LGE+LYPLV
Sbjct  517  NMPDGPMPG--GMVPVAYDMNGM-PF-GQPMPTGALASSLASATPAQQRTILGESLYPLV  572

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ--------AKI  124
            DQ+EHE+AAKVTGMLLEMD+TEVLHLLESPEAL AKV+EAL+VLR V Q        +  
Sbjct  573  DQIEHENAAKVTGMLLEMDKTEVLHLLESPEALNAKVSEALDVLRKVNQPTQVSEGKSGS  632

Query  123  PADQLASLSLNDNL  82
            P+D LASLS+ND+L
Sbjct  633  PSDLLASLSINDHL  646


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 43/56 (77%), Gaps = 2/56 (4%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRP  M   + PR+P++P GAPG+ QQ FYGQGPP IIP Q GFGYQ QLV
Sbjct  404  AQFSQMRPGFMA-GVGPRMPIFPGGAPGLGQQFFYGQGPP-IIPHQPGFGYQPQLV  457



>gb|KHN22334.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=592

 Score =   130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 101/129 (78%), Gaps = 12/129 (9%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  283
            N+ +  + GV GGMVS  Y +G        P+P  ALASALANA PEQQRTMLGE LYPL
Sbjct  471  NMQNIQLAGVPGGMVS--YGIG-------QPMPTQALASALANATPEQQRTMLGEALYPL  521

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQL  109
            VD+LEHE AAKVTGMLLEMDQ EVLHL+ESP+ALKAKV EA++VLR V  QQ+  PADQL
Sbjct  522  VDKLEHETAAKVTGMLLEMDQPEVLHLIESPDALKAKVVEAMDVLRKVTQQQSNSPADQL  581

Query  108  ASLSLNDNL  82
            ASLSLNDN+
Sbjct  582  ASLSLNDNV  590


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+ RPVA+TP+++PR+P+YP GAPG+ QQL YGQ  P++I PQA FGYQQ  V
Sbjct  355  AQFSQARPVAITPNVSPRMPLYPLGAPGIGQQLLYGQAAPSMI-PQAAFGYQQHFV  409



>gb|EMT03423.1| Polyadenylate-binding protein 2 [Aegilops tauschii]
Length=566

 Score =   130 bits (326),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 10/130 (8%)
 Frame = -1

Query  441  MPGVG-GMVSLPYDMGGMLPRDA----APVPITALASALANAPPEQQRTMLGENLYPLVD  277
            MPGVG GMV  PYDMG    RDA    AP PI  L SALANA PEQQRT+LGE+LYPLV+
Sbjct  439  MPGVGVGMVQ-PYDMGSFPVRDAGVSPAP-PIGTLTSALANATPEQQRTILGESLYPLVE  496

Query  276  QLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAK---IPADQLA  106
            +LEH+ AAKVTGMLLEMDQTEVLHLLESPEALK+KVAEA++VLRNV Q +    P  QLA
Sbjct  497  KLEHQQAAKVTGMLLEMDQTEVLHLLESPEALKSKVAEAMDVLRNVAQQQNPNAPTSQLA  556

Query  105  SLSLNDNLVA  76
             L+L+D +++
Sbjct  557  GLTLSDGIIS  566


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRPV MTPS+ PR+PMYPP  P + QQLFYGQ PPA+IPPQ G+G+QQQLV
Sbjct  312  AQFSQMRPVPMTPSMTPRLPMYPP-MPTLGQQLFYGQAPPAMIPPQPGYGFQQQLV  366



>ref|XP_003525892.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
Length=630

 Score =   130 bits (328),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 101/129 (78%), Gaps = 12/129 (9%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  283
            N+ +  + GV GGMVS  Y +G        P+P  ALASALANA PEQQRTMLGE LYPL
Sbjct  509  NMQNIQLAGVPGGMVS--YGIG-------QPMPTQALASALANATPEQQRTMLGEALYPL  559

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQL  109
            VD+LEHE AAKVTGMLLEMDQ EVLHL+ESP+ALKAKV EA++VLR V  QQ+  PADQL
Sbjct  560  VDKLEHETAAKVTGMLLEMDQPEVLHLIESPDALKAKVVEAMDVLRKVTQQQSNSPADQL  619

Query  108  ASLSLNDNL  82
            ASLSLNDN+
Sbjct  620  ASLSLNDNV  628


 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+ RPVA+TP+++PR+P+YP GAPG+ QQL YGQ  P++I PQA FGYQQ  V
Sbjct  393  AQFSQARPVAITPNVSPRMPLYPLGAPGIGQQLLYGQAAPSMI-PQAAFGYQQHFV  447



>gb|EMS47633.1| Polyadenylate-binding protein 2 [Triticum urartu]
Length=567

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 102/130 (78%), Gaps = 9/130 (7%)
 Frame = -1

Query  444  PMPGVGGMVSLPYDMGGMLPRDA----APVPITALASALANAPPEQQRTMLGENLYPLVD  277
            P  GVGGMV  PYDMG    RDA    AP PI  L SALANA PEQQRT+LGE+LYPLV+
Sbjct  440  PGVGVGGMVQ-PYDMGSFPVRDAGVSPAP-PIGTLTSALANATPEQQRTILGESLYPLVE  497

Query  276  QLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAK---IPADQLA  106
            +LEH+ AAKVTGMLLEMDQTEVLHLLESPEALK+KVAEA++VLRNV Q +    P  QLA
Sbjct  498  KLEHQQAAKVTGMLLEMDQTEVLHLLESPEALKSKVAEAMDVLRNVAQQQNPNAPTSQLA  557

Query  105  SLSLNDNLVA  76
             L+L+D +++
Sbjct  558  GLTLSDVIIS  567


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRPV MTPS+ PR+PMYPP  P + QQLFYGQ PPA+IPPQ G+G+QQQLV
Sbjct  312  AQFSQMRPVPMTPSMTPRLPMYPP-MPTLGQQLFYGQAPPAMIPPQPGYGFQQQLV  366



>ref|XP_009147891.1| PREDICTED: polyadenylate-binding protein 8 [Brassica rapa]
 emb|CDY51045.1| BnaA06g03080D [Brassica napus]
Length=653

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 107/132 (81%), Gaps = 10/132 (8%)
 Frame = -1

Query  444  PMPGVG-GMVSLPYDM--GGMLPRDA----APVPITALASALANAPPEQQRTMLGENLYP  286
            PMPG+   M+S+PYD+  GG   RD+     PVPI ALA++LANA PE QRTMLGENLYP
Sbjct  521  PMPGLTPNMLSVPYDVSGGGAHLRDSPAASQPVPIGALATSLANAAPEHQRTMLGENLYP  580

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPAD  115
            LV+QLE E AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA++VLR+V   QQA   AD
Sbjct  581  LVEQLEPESAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMDVLRSVAQQQQAGGAAD  640

Query  114  QLASLSLNDNLV  79
            QLASLSL DN+V
Sbjct  641  QLASLSLGDNIV  652


 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 3/73 (4%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV   P++ PR+PMYPPG P M QQLFYGQGPP +IPPQ G+GYQQQLVPGMR
Sbjct  400  AQFSQMRPV---PAVGPRMPMYPPGGPPMGQQLFYGQGPPGMIPPQPGYGYQQQLVPGMR  456

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFF+PM
Sbjct  457  PGGSPMPNFFMPM  469



>ref|XP_006295403.1| hypothetical protein CARUB_v10024499mg [Capsella rubella]
 gb|EOA28301.1| hypothetical protein CARUB_v10024499mg [Capsella rubella]
Length=658

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 104/137 (76%), Gaps = 15/137 (11%)
 Frame = -1

Query  459  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  280
            N+ DGPM G  GMV + YDM GM P    P+  + LAS+LAN+ P QQRT+LGE+LYPLV
Sbjct  526  NMPDGPMQG--GMVQVAYDMNGM-PF-GQPLSASQLASSLANSSPAQQRTLLGESLYPLV  581

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ-----------  133
            DQ+EHE+AAKVTGMLLEMDQTEVLHLLESPEAL AKV+EAL+VLRNV Q           
Sbjct  582  DQIEHENAAKVTGMLLEMDQTEVLHLLESPEALNAKVSEALDVLRNVNQPPSTQVSEGSK  641

Query  132  AKIPADQLASLSLNDNL  82
            +  P+D LASLS+ND+L
Sbjct  642  SGSPSDLLASLSINDHL  658


 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRP A  P + PR+P++P GAPG+ QQ+FYGQGPP IIP Q GFGYQ QLV
Sbjct  411  AQFSQMRP-AFIPGVGPRMPIFPGGAPGLGQQIFYGQGPPPIIPHQPGFGYQPQLV  465



>emb|CDY54068.1| BnaCnng26160D [Brassica napus]
Length=653

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 107/132 (81%), Gaps = 10/132 (8%)
 Frame = -1

Query  444  PMPGVG-GMVSLPYDM--GGMLPRDA----APVPITALASALANAPPEQQRTMLGENLYP  286
            PMPG+   M+S+PYD+  GG   RD+     PVPI ALA++LANA PE QRTMLGENLYP
Sbjct  521  PMPGLTPNMLSVPYDVSGGGAHLRDSPAASQPVPIGALATSLANAAPEHQRTMLGENLYP  580

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPAD  115
            LV+QLE E AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA++VLR+V   QQA   AD
Sbjct  581  LVEQLEPESAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMDVLRSVAQQQQAGGAAD  640

Query  114  QLASLSLNDNLV  79
            QLASLSL DN+V
Sbjct  641  QLASLSLGDNIV  652


 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 3/73 (4%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV   P++ PR+PMYPPG P M QQLFYGQGPP +IPPQ G+GYQQQLVPGMR
Sbjct  398  AQFSQMRPV---PAVGPRMPMYPPGGPPMGQQLFYGQGPPGMIPPQPGYGYQQQLVPGMR  454

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFF+PM
Sbjct  455  PGGAPMPNFFMPM  467



>emb|CDX89562.1| BnaC04g35810D [Brassica napus]
Length=645

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 102/134 (76%), Gaps = 12/134 (9%)
 Frame = -1

Query  459  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  280
            N+ DGPM   GGMV  PYD+ GM      P+P  ALAS+LA A P QQRT+LGE LYPLV
Sbjct  516  NMPDGPM--AGGMVPFPYDINGMPL--GQPMPAGALASSLAQASPAQQRTILGETLYPLV  571

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ--------AKI  124
            +++EHE+AAKVTGMLLEMDQTEVLHL+ESPEAL AKV+EAL+VLRNV Q        +  
Sbjct  572  NKIEHENAAKVTGMLLEMDQTEVLHLIESPEALNAKVSEALDVLRNVNQPAQGSEGKSGS  631

Query  123  PADQLASLSLNDNL  82
            P+D LASLS+ND+L
Sbjct  632  PSDMLASLSINDHL  645


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 43/56 (77%), Gaps = 3/56 (5%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRP A  P + PR+PM+  GAPG  QQ FYGQGPP +IP QAGFGYQ Q+V
Sbjct  403  AQFSQMRP-AFIPGMGPRMPMFAGGAPG--QQFFYGQGPPQMIPHQAGFGYQPQMV  455



>ref|XP_011000826.1| PREDICTED: polyadenylate-binding protein 8-like [Populus euphratica]
Length=643

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 106/128 (83%), Gaps = 5/128 (4%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D PM GV GGM+ +PYDMGGM  RDAA    +P+ ALA+ALANA P+QQRTMLGENLYPL
Sbjct  514  DVPMTGVAGGMLPVPYDMGGMPMRDAALSQSIPVGALATALANATPDQQRTMLGENLYPL  573

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQLA  106
            V+QLE E AAKVTGMLLEMDQTEVL LLESPEALK KV EA+EVLR V QQA   ADQLA
Sbjct  574  VEQLEPEAAAKVTGMLLEMDQTEVLLLLESPEALKLKVNEAMEVLRTVQQQATGTADQLA  633

Query  105  SLSLNDNL  82
            SLSLNDNL
Sbjct  634  SLSLNDNL  641


 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+  R+PMYPP  PG+ QQ+FYGQGPPAI+PPQ GFGYQQQLVPGMR
Sbjct  394  AQFSQMRPVAMAPSVG-RMPMYPPTGPGLGQQIFYGQGPPAIMPPQPGFGYQQQLVPGMR  452

Query  636  pgggpmPNFFVPM  598
            PGG P+PNFFVPM
Sbjct  453  PGGSPIPNFFVPM  465



>ref|XP_003580095.1| PREDICTED: polyadenylate-binding protein 2-like [Brachypodium 
distachyon]
Length=661

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 100/131 (76%), Gaps = 9/131 (7%)
 Frame = -1

Query  444  PMPGVG--GMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  280
            PM GVG  GM+  PYDMGG   RDA      PI  L SALANA P+QQRT+LGE+LYPLV
Sbjct  532  PMAGVGAGGMIQ-PYDMGGFPVRDAGLSPAAPIGTLTSALANATPDQQRTLLGESLYPLV  590

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAK---IPADQL  109
            + LEH  AAKVTGMLLEMDQTEVLHLLESPEALK+KVAEA++VLRNV Q +    P  QL
Sbjct  591  ELLEHNQAAKVTGMLLEMDQTEVLHLLESPEALKSKVAEAMDVLRNVAQQQNPNAPTSQL  650

Query  108  ASLSLNDNLVA  76
            A LS+ D++++
Sbjct  651  AGLSMTDSIIS  661


 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV +TPS+ PR+PMYPP AP + QQLFYGQ PP ++PPQ GFG+QQQLVPGMR
Sbjct  406  AQFSQMRPVPITPSMTPRLPMYPPMAP-LGQQLFYGQAPPPMMPPQPGFGFQQQLVPGMR  464

Query  636  pgggpmPNFFVPM  598
            P G  MPN+FVP+
Sbjct  465  PSGAHMPNYFVPV  477



>ref|XP_002448132.1| hypothetical protein SORBIDRAFT_06g021850 [Sorghum bicolor]
 gb|EES12460.1| hypothetical protein SORBIDRAFT_06g021850 [Sorghum bicolor]
Length=664

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 98/128 (77%), Gaps = 6/128 (5%)
 Frame = -1

Query  441  MPGVGGMVSLPYDMGGMLPRDAAPVP---ITALASALANAPPEQQRTMLGENLYPLVDQL  271
            MPGV G +   YDMGG   RDAA  P   I  L SALANA PEQQRT+LGENLYPLV+QL
Sbjct  537  MPGVAGGMIQAYDMGGFPVRDAAVSPAAQIGTLTSALANANPEQQRTILGENLYPLVEQL  596

Query  270  EHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPADQLASL  100
            E   AAKVTGMLLEMDQTEVLHLLESP+ALK+KVAEA++VLRNV   Q    P +QLA+L
Sbjct  597  EPNQAAKVTGMLLEMDQTEVLHLLESPDALKSKVAEAMDVLRNVAHQQNPNTPTNQLAAL  656

Query  99   SLNDNLVA  76
            SL + +++
Sbjct  657  SLTEGIIS  664


 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 4/74 (5%)
 Frame = -1

Query  816  AQFSEMRP-VAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgm  640
            AQFS+MRP V MTP+LAPR+PMYPP AP   QQLFYGQ PPA+IPPQ GFG+QQQLVPGM
Sbjct  415  AQFSQMRPAVPMTPTLAPRLPMYPPMAP---QQLFYGQAPPAMIPPQPGFGFQQQLVPGM  471

Query  639  rpgggpmPNFFVPM  598
            RPGG  MPN+FVP+
Sbjct  472  RPGGPHMPNYFVPV  485



>ref|XP_012079275.1| PREDICTED: polyadenylate-binding protein 4-like [Jatropha curcas]
 gb|KDP31970.1| hypothetical protein JCGZ_12431 [Jatropha curcas]
Length=642

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 110/130 (85%), Gaps = 5/130 (4%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D PM G+ GGM+ +PYDMGGM  RD A   P+   ALA+ALANA PEQQRT+LGENLYPL
Sbjct  513  DVPMAGLPGGMLPVPYDMGGMPFRDGAFSQPMQTGALATALANATPEQQRTLLGENLYPL  572

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQLA  106
            VDQL HE+AAKVTGMLLE+DQTEVLHLLESPE+L+AKVAEA+EVLR V QQA  P +++A
Sbjct  573  VDQLVHENAAKVTGMLLEVDQTEVLHLLESPESLEAKVAEAMEVLRTVQQQANSPTNRMA  632

Query  105  SLSLNDNLVA  76
            +LSLN+NLV+
Sbjct  633  TLSLNENLVS  642


 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 57/73 (78%), Gaps = 7/73 (10%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP AM P++ PR+PMYP G PG+ QQLFYGQGPPAI+PPQ GFGYQQQLV    
Sbjct  398  AQFSQMRP-AMAPAVGPRMPMYPHGTPGIGQQLFYGQGPPAIVPPQPGFGYQQQLV----  452

Query  636  pgggpmPNFFVPM  598
               G  PNFFVPM
Sbjct  453  --PGMRPNFFVPM  463



>ref|XP_010417088.1| PREDICTED: polyadenylate-binding protein 4-like [Camelina sativa]
Length=660

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 104/137 (76%), Gaps = 15/137 (11%)
 Frame = -1

Query  459  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  280
            N+ DGPM G  GMV + YDM GM P  A P+    LA++LANA P QQRT+LGE+LYPLV
Sbjct  528  NMPDGPMQG--GMVPVAYDMNGM-PF-AQPMSAGQLATSLANATPAQQRTLLGESLYPLV  583

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ-----------  133
            DQ+EHE+AAKVTGMLLEMDQTEVLHLLESPEAL AKV+EAL+VLRNV Q           
Sbjct  584  DQIEHENAAKVTGMLLEMDQTEVLHLLESPEALNAKVSEALDVLRNVNQPPSTQGSDGNK  643

Query  132  AKIPADQLASLSLNDNL  82
            +  P+D LASLS+ND+L
Sbjct  644  SGSPSDLLASLSINDHL  660


 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRP A  P + PR+P++P GAPG+ QQ+FYGQGPP IIP Q GFGYQ Q+V
Sbjct  413  AQFSQMRP-AFIPGVGPRMPIFPGGAPGLGQQIFYGQGPPPIIPHQPGFGYQPQMV  467



>ref|NP_001062583.1| Os09g0115400 [Oryza sativa Japonica Group]
 dbj|BAD16229.1| putative poly(A)-binding protein [Oryza sativa Japonica Group]
 dbj|BAF24497.1| Os09g0115400 [Oryza sativa Japonica Group]
 gb|EAZ08133.1| hypothetical protein OsI_30396 [Oryza sativa Indica Group]
 gb|EAZ43770.1| hypothetical protein OsJ_28392 [Oryza sativa Japonica Group]
 gb|ACA50516.1| poly(A)-binding protein [Oryza sativa Japonica Group]
 dbj|BAG90618.1| unnamed protein product [Oryza sativa Japonica Group]
Length=662

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 106/132 (80%), Gaps = 7/132 (5%)
 Frame = -1

Query  450  DGPMPGVGGMVS-LPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D  M GVGG V   PY+MGGM  RDAA   PVPI ALA+ALANA P+QQR MLGENLYPL
Sbjct  530  DPAMHGVGGGVMPSPYEMGGMPMRDAAASQPVPIGALATALANAAPDQQRMMLGENLYPL  589

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAK---IPADQ  112
            VDQLEHE AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR  QQ +    P  Q
Sbjct  590  VDQLEHEQAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRTAQQIQTNATPEQQ  649

Query  111  LASLSLNDNLVA  76
            LASLSLND +V+
Sbjct  650  LASLSLNDGVVS  661


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPV + PS+ PR+PM+PPG PG+ QQLFYGQ PPA I  Q GFG+QQ L+PGMR
Sbjct  409  AQFSQLRPVPLAPSVGPRMPMFPPGVPGVGQQLFYGQPPPAFINTQPGFGFQQPLMPGMR  468

Query  636  pgggpmPNFFVPM  598
            PG GPMPNF +PM
Sbjct  469  PGAGPMPNFIMPM  481



>ref|XP_002878680.1| PAB4 binding protein 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54939.1| PAB4 binding protein 4 [Arabidopsis lyrata subsp. lyrata]
Length=655

 Score =   129 bits (323),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 103/136 (76%), Gaps = 14/136 (10%)
 Frame = -1

Query  459  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  280
            N+ DGPM  +GGMV + YDM GM    A P+    LA++LANA P QQRT+LGE+LYPLV
Sbjct  524  NMPDGPM--LGGMVPVAYDMNGMPI--AQPMSAGQLATSLANATPAQQRTLLGESLYPLV  579

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ----------A  130
            DQ+EHE+AAKVTGMLLEMDQTEVLHLLESPEAL AKV+EAL+VLRNV Q          +
Sbjct  580  DQIEHENAAKVTGMLLEMDQTEVLHLLESPEALNAKVSEALDVLRNVNQPSTQVSEGNKS  639

Query  129  KIPADQLASLSLNDNL  82
              P+D +ASLS+ND+ 
Sbjct  640  GSPSDLMASLSINDHF  655


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRP A  P + PR+P++P GAPG+ QQ+FYGQG P IIP Q GFGYQ QLV
Sbjct  410  AQFSQMRP-AFIPGVGPRMPIFPGGAPGLGQQIFYGQGSPPIIPHQPGFGYQPQLV  464



>ref|NP_001151785.1| LOC100285420 [Zea mays]
 gb|ACG44303.1| polyadenylate-binding protein 2 [Zea mays]
 tpg|DAA37055.1| TPA: polyadenylate-binding protein 2 [Zea mays]
Length=660

 Score =   129 bits (323),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 97/128 (76%), Gaps = 6/128 (5%)
 Frame = -1

Query  441  MPGVGGMVSLPYDMGGMLPRDAAPVP---ITALASALANAPPEQQRTMLGENLYPLVDQL  271
            MPGV G +   YDMGG   RDAA  P   I  L SALANA PEQQRT+LGENLYPLV+QL
Sbjct  533  MPGVAGGMMQAYDMGGFPVRDAALSPAAQIGTLTSALANANPEQQRTILGENLYPLVEQL  592

Query  270  EHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPADQLASL  100
            E   AAKVTGMLLEMDQTEVLHLLESP+ALK+KVAEA++VL NV   Q A  P  QLA+L
Sbjct  593  EPNQAAKVTGMLLEMDQTEVLHLLESPDALKSKVAEAMDVLHNVAHQQNANTPTSQLAAL  652

Query  99   SLNDNLVA  76
            SL + +++
Sbjct  653  SLTEGIIS  660


 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 4/57 (7%)
 Frame = -1

Query  816  AQFSEMRP-VAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRP V MTP+LAPR+PMYPP AP   QQLFYGQ PPA+IPPQ GFG+QQQLV
Sbjct  409  AQFSQMRPAVPMTPTLAPRLPMYPPMAP---QQLFYGQAPPAMIPPQPGFGFQQQLV  462



>ref|NP_179916.1| poly(A) binding protein 4 [Arabidopsis thaliana]
 sp|O22173.1|PABP4_ARATH RecName: Full=Polyadenylate-binding protein 4; Short=PABP-4; 
Short=Poly(A)-binding protein 4 [Arabidopsis thaliana]
 gb|AAB87097.1| putative poly(A) binding protein [Arabidopsis thaliana]
 gb|AAK92796.1| putative poly(A) binding protein [Arabidopsis thaliana]
 gb|AAL85120.1| putative poly(A) binding protein [Arabidopsis thaliana]
 gb|AEC07446.1| poly(A) binding protein 4 [Arabidopsis thaliana]
Length=662

 Score =   128 bits (322),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 104/136 (76%), Gaps = 14/136 (10%)
 Frame = -1

Query  459  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  280
            N+ DGPMPG  GMV + YDM  ++P  + P+    LA++LANA P QQRT+LGE+LYPLV
Sbjct  531  NMPDGPMPG--GMVPVAYDMN-VMPY-SQPMSAGQLATSLANATPAQQRTLLGESLYPLV  586

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ----------A  130
            DQ+E EHAAKVTGMLLEMDQTEVLHLLESPEAL AKV+EAL+VLRNV Q          +
Sbjct  587  DQIESEHAAKVTGMLLEMDQTEVLHLLESPEALNAKVSEALDVLRNVNQPSSQGSEGNKS  646

Query  129  KIPADQLASLSLNDNL  82
              P+D LASLS+ND+L
Sbjct  647  GSPSDLLASLSINDHL  662


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRP A  P + PR+P++  GAPG+ QQ+FYGQGPP IIP Q GFGYQ QLV
Sbjct  415  AQFSQMRP-AFIPGVGPRMPIFTGGAPGLGQQIFYGQGPPPIIPHQPGFGYQPQLV  469



>ref|XP_008663371.1| PREDICTED: polyadenylate-binding protein 2-like [Zea mays]
Length=652

 Score =   128 bits (322),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 98/128 (77%), Gaps = 6/128 (5%)
 Frame = -1

Query  441  MPGVGGMVSLPYDMGGMLPRDAAPVP---ITALASALANAPPEQQRTMLGENLYPLVDQL  271
            MPGV G +   YDMGG   RDAA  P   I  L SALANA PEQQRT+LGENLYPLV+QL
Sbjct  525  MPGVAGGMIQAYDMGGFPVRDAALSPAAQIGTLTSALANANPEQQRTILGENLYPLVEQL  584

Query  270  EHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPADQLASL  100
            E   AAKVTGMLLEMDQTEVLHLLESP+ALK+KVAEA++VLRNV   Q   +P  QLA+L
Sbjct  585  EPNQAAKVTGMLLEMDQTEVLHLLESPDALKSKVAEAMDVLRNVAHQQNPNLPTSQLAAL  644

Query  99   SLNDNLVA  76
            SL + +++
Sbjct  645  SLTEGIMS  652


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 62/74 (84%), Gaps = 4/74 (5%)
 Frame = -1

Query  816  AQFSEMRP-VAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgm  640
            AQFS+MRP V MTP+LAPR+PMY P AP   QQLFYGQ PPA++PPQ GF +QQQLVPGM
Sbjct  403  AQFSQMRPAVPMTPTLAPRLPMYSPMAP---QQLFYGQAPPAMMPPQPGFAFQQQLVPGM  459

Query  639  rpgggpmPNFFVPM  598
            RPGG  MPN++VP+
Sbjct  460  RPGGPHMPNYYVPV  473



>gb|AAK25927.1|AF360217_1 putative poly(A) binding protein [Arabidopsis thaliana]
Length=662

 Score =   128 bits (322),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 104/136 (76%), Gaps = 14/136 (10%)
 Frame = -1

Query  459  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  280
            N+ DGPMPG  GMV + YDM  ++P  + P+    LA++LANA P QQRT+LGE+LYPLV
Sbjct  531  NMPDGPMPG--GMVPVAYDMN-VMPY-SQPMSAGQLATSLANATPAQQRTLLGESLYPLV  586

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ----------A  130
            DQ+E EHAAKVTGMLLEMDQTEVLHLLESPEAL AKV+EAL+VLRNV Q          +
Sbjct  587  DQIESEHAAKVTGMLLEMDQTEVLHLLESPEALNAKVSEALDVLRNVNQPSSQGSDGNKS  646

Query  129  KIPADQLASLSLNDNL  82
              P+D LASLS+ND+L
Sbjct  647  GSPSDLLASLSINDHL  662


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRP A  P + PR+P++  GAPG+ QQ+FYGQGPP IIP Q GFGYQ QLV
Sbjct  415  AQFSQMRP-AFIPGVGPRMPIFTGGAPGLGQQIFYGQGPPPIIPHQPGFGYQPQLV  469



>ref|XP_010526963.1| PREDICTED: polyadenylate-binding protein 2-like [Tarenaya hassleriana]
Length=638

 Score =   128 bits (321),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 102/126 (81%), Gaps = 7/126 (6%)
 Frame = -1

Query  438  PGVGGMVSLPYDMGGMLPRD----AAPVPITALASALANAPPEQQRTMLGENLYPLVDQL  271
            P + GM  LPY+M  M  R+      PVPI ALASALANA PEQQRTMLGENLYP+V+Q+
Sbjct  515  PAMSGM--LPYEMTNMPLREPVLSHQPVPIGALASALANATPEQQRTMLGENLYPMVEQV  572

Query  270  EHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ-AKIPADQLASLSL  94
            E E AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLR+V     + A+QLASLSL
Sbjct  573  EPEAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRSVSSGGAVAAEQLASLSL  632

Query  93   NDNLVA  76
            +DN+++
Sbjct  633  SDNILS  638


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 2/74 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPA-IIPPQAGFGYQQQLVpgm  640
            AQF+++RPV M PS  PR+PMYPP  PG+ QQ+FYGQ PP+ +IPPQ GFGYQQQLVPGM
Sbjct  398  AQFAQLRPV-MPPSAGPRMPMYPPAGPGIGQQIFYGQAPPSTMIPPQPGFGYQQQLVPGM  456

Query  639  rpgggpmPNFFVPM  598
            RPGG P+PNFF+PM
Sbjct  457  RPGGSPVPNFFMPM  470



>ref|XP_006661030.1| PREDICTED: polyadenylate-binding protein 8-like, partial [Oryza 
brachyantha]
Length=627

 Score =   127 bits (320),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 106/132 (80%), Gaps = 7/132 (5%)
 Frame = -1

Query  450  DGPMPGVGGMVS-LPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D  M GVGG V   PY+MGGM  RDAA   P+PI ALA+ALANA P+QQR MLGENLYPL
Sbjct  495  DPAMHGVGGGVMPSPYEMGGMPMRDAAASQPIPIGALATALANAAPDQQRMMLGENLYPL  554

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAK---IPADQ  112
            VDQLEHE AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLR  QQ +    P  Q
Sbjct  555  VDQLEHEQAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRTAQQIQTNATPEQQ  614

Query  111  LASLSLNDNLVA  76
            LASL+LND +V+
Sbjct  615  LASLTLNDGVVS  626


 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPV + PS+ PR+PM+PPG PG+ QQLFYGQ PPA I PQ GFG+QQ L+PGMR
Sbjct  374  AQFSQLRPVPLAPSVGPRMPMFPPGVPGVGQQLFYGQPPPAFINPQPGFGFQQPLMPGMR  433

Query  636  pgggpmPNFFVPM  598
            PGGGPMPNF +PM
Sbjct  434  PGGGPMPNFIMPM  446



>ref|XP_011092553.1| PREDICTED: polyadenylate-binding protein 2-like [Sesamum indicum]
Length=644

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 107/127 (84%), Gaps = 6/127 (5%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  283
            D  + GV GGM+S+PY+MGG+  RD     P+PI ALASALANA P +QRTMLGENLYPL
Sbjct  518  DVSLQGVAGGMISVPYEMGGLPLRDVGMPQPIPIGALASALANASPSEQRTMLGENLYPL  577

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQL  109
            V+QLE E AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLRNV  QQA  PA+QL
Sbjct  578  VEQLEPETAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRNVSQQQASNPAEQL  637

Query  108  ASLSLND  88
            ASLSLN+
Sbjct  638  ASLSLNE  644


 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQF++MRP+ + P++APRIPMY PG PG+ QQ+FYGQ PPAIIPPQ GFGYQQQLVPGMR
Sbjct  395  AQFAQMRPITVAPTVAPRIPMYAPGGPGLGQQIFYGQPPPAIIPPQPGFGYQQQLVPGMR  454

Query  636  pgggpmPNFFVPM  598
            P G  MPN FVPM
Sbjct  455  PAGPLMPNMFVPM  467



>emb|CDX71223.1| BnaC07g05020D [Brassica napus]
Length=638

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 105/130 (81%), Gaps = 8/130 (6%)
 Frame = -1

Query  453  SDGPMPGVGGMVSLPYDMGGMLP-RD---AAPVPITALASALANAPPEQQRTMLGENLYP  286
            S GP P V GM  LPY+M   +P RD   +  VPI ALA++LANA PE QRTMLGENLYP
Sbjct  513  SGGP-PDVPGM--LPYEMPSNMPLRDPVLSQHVPIGALATSLANASPEHQRTMLGENLYP  569

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLA  106
            LV+QLE E AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLR+V  A   A+QLA
Sbjct  570  LVEQLEAESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRSV-AAGGAAEQLA  628

Query  105  SLSLNDNLVA  76
            SL+LNDNLV+
Sbjct  629  SLNLNDNLVS  638


 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP AM PS+ PR+ +Y PG PG+ QQ+FYGQ PP +IPPQ+GFGYQQQ+VPGMR
Sbjct  390  AQFSQMRPGAMPPSVGPRMQIYSPGGPGIGQQVFYGQAPPPMIPPQSGFGYQQQMVPGMR  449

Query  636  pgggpmPNFFVPM  598
            PGGGPM NFF+PM
Sbjct  450  PGGGPMHNFFMPM  462



>gb|KHN04485.1| Polyadenylate-binding protein 2, partial [Glycine soja]
Length=606

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 100/129 (78%), Gaps = 12/129 (9%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  283
            N+ +  + GV GGMV+  Y +G  +P         ALASALANA PEQQRTMLGE LYPL
Sbjct  485  NMQNIQLAGVPGGMVT--YGIGQQMP-------TQALASALANATPEQQRTMLGEALYPL  535

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQL  109
            VD+LEHE AAKVTGMLLEMDQ EVLHL+ESP+ALKAKV EA++VL+ V  QQ+  PADQL
Sbjct  536  VDKLEHEAAAKVTGMLLEMDQPEVLHLIESPDALKAKVVEAMDVLKKVTQQQSNSPADQL  595

Query  108  ASLSLNDNL  82
            ASLSLNDN+
Sbjct  596  ASLSLNDNV  604


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+ RP A+TP+++PR+P+YP GAP + QQ  YGQ  PA I PQA FGYQQ  V
Sbjct  369  AQFSQSRPAAITPNVSPRMPLYPLGAPAIGQQFLYGQAAPATI-PQAAFGYQQHFV  423



>ref|XP_006393217.1| hypothetical protein EUTSA_v10011289mg [Eutrema salsugineum]
 gb|ESQ30503.1| hypothetical protein EUTSA_v10011289mg [Eutrema salsugineum]
Length=669

 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 106/132 (80%), Gaps = 11/132 (8%)
 Frame = -1

Query  441  MPGVG-GMVSLPYDM----GGMLPRDA---APVPITALASALANAPPEQQRTMLGENLYP  286
            MPG+   M+S+PYD+    GG   RD+    PVPI ALA++LANA PE QRTMLGENLYP
Sbjct  537  MPGLTPNMLSVPYDVSGGAGGGHLRDSPAGQPVPIGALATSLANAAPEHQRTMLGENLYP  596

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPAD  115
            LV+QLE E AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA++VLR+V   QQA   AD
Sbjct  597  LVEQLEPESAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMDVLRSVAQQQQAGGAAD  656

Query  114  QLASLSLNDNLV  79
            QL+SLSL DN+V
Sbjct  657  QLSSLSLGDNIV  668


 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV M P++ PR+PMYPPGAP M QQLFYGQGPPA+IPPQ G+GYQQQLVPGMR
Sbjct  406  AQFSQMRPVNMPPAVGPRMPMYPPGAPPMGQQLFYGQGPPAMIPPQPGYGYQQQLVPGMR  465

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFF+PM
Sbjct  466  PGGSPMPNFFMPM  478



>ref|XP_003523956.1| PREDICTED: polyadenylate-binding protein 8 isoform X1 [Glycine 
max]
 gb|ABC47841.1| poly(A)-binding protein [Glycine max]
Length=630

 Score =   125 bits (315),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 100/129 (78%), Gaps = 12/129 (9%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  283
            N+ +  + GV GGMV+  Y +G  +P         ALASALANA PEQQRTMLGE LYPL
Sbjct  509  NMQNIQLAGVPGGMVT--YGIGQQMP-------TQALASALANATPEQQRTMLGEALYPL  559

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQL  109
            VD+LEHE AAKVTGMLLEMDQ EVLHL+ESP+ALKAKV EA++VL+ V  QQ+  PADQL
Sbjct  560  VDKLEHEAAAKVTGMLLEMDQPEVLHLIESPDALKAKVVEAMDVLKKVTQQQSNSPADQL  619

Query  108  ASLSLNDNL  82
            ASLSLNDN+
Sbjct  620  ASLSLNDNV  628


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+ RP A+TP+++PR+P+YP GAP + QQ  YGQ  PA I PQA FGYQQ  V
Sbjct  393  AQFSQSRPAAITPNVSPRMPLYPLGAPAIGQQFLYGQAAPATI-PQAAFGYQQHFV  447



>ref|XP_006578033.1| PREDICTED: polyadenylate-binding protein 8 isoform X2 [Glycine 
max]
Length=624

 Score =   125 bits (315),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 100/129 (78%), Gaps = 12/129 (9%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  283
            N+ +  + GV GGMV+  Y +G  +P         ALASALANA PEQQRTMLGE LYPL
Sbjct  503  NMQNIQLAGVPGGMVT--YGIGQQMP-------TQALASALANATPEQQRTMLGEALYPL  553

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQL  109
            VD+LEHE AAKVTGMLLEMDQ EVLHL+ESP+ALKAKV EA++VL+ V  QQ+  PADQL
Sbjct  554  VDKLEHEAAAKVTGMLLEMDQPEVLHLIESPDALKAKVVEAMDVLKKVTQQQSNSPADQL  613

Query  108  ASLSLNDNL  82
            ASLSLNDN+
Sbjct  614  ASLSLNDNV  622


 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQ  679
            AQFS+ RP A+TP+++PR+P+YP GAP + QQ  YGQ  PA IP Q
Sbjct  393  AQFSQSRPAAITPNVSPRMPLYPLGAPAIGQQFLYGQAAPATIPQQ  438



>ref|XP_006578034.1| PREDICTED: polyadenylate-binding protein 8 isoform X3 [Glycine 
max]
Length=623

 Score =   125 bits (315),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 100/129 (78%), Gaps = 12/129 (9%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  283
            N+ +  + GV GGMV+  Y +G  +P         ALASALANA PEQQRTMLGE LYPL
Sbjct  502  NMQNIQLAGVPGGMVT--YGIGQQMP-------TQALASALANATPEQQRTMLGEALYPL  552

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV--QQAKIPADQL  109
            VD+LEHE AAKVTGMLLEMDQ EVLHL+ESP+ALKAKV EA++VL+ V  QQ+  PADQL
Sbjct  553  VDKLEHEAAAKVTGMLLEMDQPEVLHLIESPDALKAKVVEAMDVLKKVTQQQSNSPADQL  612

Query  108  ASLSLNDNL  82
            ASLSLNDN+
Sbjct  613  ASLSLNDNV  621


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIP  685
            AQFS+ RP A+TP+++PR+P+YP GAP + QQ  YGQ  PA IP
Sbjct  393  AQFSQSRPAAITPNVSPRMPLYPLGAPAIGQQFLYGQAAPATIP  436



>ref|XP_008373847.1| PREDICTED: polyadenylate-binding protein 8-like [Malus domestica]
 ref|XP_008364535.1| PREDICTED: polyadenylate-binding protein 8-like [Malus domestica]
Length=658

 Score =   125 bits (315),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 114/136 (84%), Gaps = 11/136 (8%)
 Frame = -1

Query  450  DGPMPGV-GGMVSLPYDM---GGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  295
            DGPMPGV GGM S+PYD+   GGM  RDAA     +PI ALA+ALANA PEQQRTMLGEN
Sbjct  523  DGPMPGVAGGMFSVPYDISGGGGMPIRDAALSQPTIPIGALATALANATPEQQRTMLGEN  582

Query  294  LYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKI  124
            LYPLV+QLE ++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLRNV   QQA  
Sbjct  583  LYPLVEQLEPBNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRNVAQQQQAGN  642

Query  123  PADQLASLSLNDNLVA  76
             ADQL SLSLN+NLV+
Sbjct  643  AADQLGSLSLNENLVS  658


 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM P +A R+PMYPPG PG+ QQ+FYGQGPPAIIP Q GFGYQQQLVPGMR
Sbjct  402  AQFSQMRPVAMAPPVASRMPMYPPGGPGLGQQIFYGQGPPAIIPSQPGFGYQQQLVPGMR  461

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVPM
Sbjct  462  PGGAPMPNFFVPM  474



>gb|KFK35979.1| hypothetical protein AALP_AA4G062600 [Arabis alpina]
Length=671

 Score =   125 bits (315),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 106/133 (80%), Gaps = 12/133 (9%)
 Frame = -1

Query  441  MPGVG-GMVSLPYDM-----GGMLPRDA---APVPITALASALANAPPEQQRTMLGENLY  289
            MPG+   M+S+PYD+     G +  RD+    PVPI ALA++LANA PE QRTMLGENLY
Sbjct  538  MPGLTPNMLSVPYDVSGAGGGNVHLRDSPSSQPVPIGALATSLANAAPEHQRTMLGENLY  597

Query  288  PLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV---QQAKIPA  118
            PLV+QLE E AAKVTGMLLEMDQTEVLHLLESP+ALKAKVAEA++VLR+V   QQA   A
Sbjct  598  PLVEQLEPESAAKVTGMLLEMDQTEVLHLLESPDALKAKVAEAMDVLRSVAQQQQAGGAA  657

Query  117  DQLASLSLNDNLV  79
            DQLASLSL DN+V
Sbjct  658  DQLASLSLGDNIV  670


 Score = 90.5 bits (223),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRPV M P++ PR+ MYPPG P + QQLFYGQGPPA+IPPQ GFGYQQQLV
Sbjct  407  AQFSQMRPVNMPPAVGPRMQMYPPGGPPLGQQLFYGQGPPAMIPPQPGFGYQQQLV  462



>ref|XP_010531254.1| PREDICTED: polyadenylate-binding protein 4 [Tarenaya hassleriana]
Length=644

 Score =   125 bits (313),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 103/133 (77%), Gaps = 11/133 (8%)
 Frame = -1

Query  459  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  280
            N+ DGP+PG  G++ + YDM GM P  A P+   ALASALAN  P QQRT+LGE+LYPLV
Sbjct  516  NMLDGPIPG--GILPIAYDMNGM-PF-AQPLSTGALASALANGTPAQQRTLLGEHLYPLV  571

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-------QQAKIP  121
            DQ+E E+AAKVTGMLLEMDQTEVLHL+ESP+ALKAKVAEA++VLRNV         +  P
Sbjct  572  DQMESENAAKVTGMLLEMDQTEVLHLIESPDALKAKVAEAMDVLRNVGPPLVSSSGSNSP  631

Query  120  ADQLASLSLNDNL  82
             D+LASLS++D L
Sbjct  632  IDKLASLSMDDKL  644


 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 45/57 (79%), Gaps = 2/57 (4%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQG-PPAIIPPQAGFGYQQQLV  649
            AQFS+MRP A+ P+++P +P+YP GAPG+ QQL YGQG PP +I  Q GFGYQ QLV
Sbjct  405  AQFSQMRP-ALLPAVSPHMPIYPGGAPGLGQQLLYGQGPPPMMISQQPGFGYQPQLV  460



>gb|KFK40021.1| hypothetical protein AALP_AA3G319900 [Arabis alpina]
Length=651

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 104/130 (80%), Gaps = 8/130 (6%)
 Frame = -1

Query  453  SDGPMPGVGGMVSLPYDMGGMLP-RDAA---PVPITALASALANAPPEQQRTMLGENLYP  286
            S GP P V GM  LPY+M   +P RD+     VPI ALA++LANA PE QRTMLGENLYP
Sbjct  526  SGGP-PDVPGM--LPYEMPSNMPLRDSVLSQHVPIGALATSLANASPEHQRTMLGENLYP  582

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLA  106
            LV+QLE E AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLR+V  A   A+QLA
Sbjct  583  LVEQLEAESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRSV-AAGGAAEQLA  641

Query  105  SLSLNDNLVA  76
            SL+L DNLV+
Sbjct  642  SLNLGDNLVS  651


 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+ PR+ MYPPG PG+ QQ+FYGQGPPA+IPPQ G+GYQQQLVPGMR
Sbjct  403  AQFSQMRPVAMPPSVGPRMQMYPPGGPGIGQQIFYGQGPPAMIPPQPGYGYQQQLVPGMR  462

Query  636  pgggpmPNFFVPM  598
            PGG PM NFF+PM
Sbjct  463  PGGAPMHNFFMPM  475



>ref|XP_010429282.1| PREDICTED: polyadenylate-binding protein 4 [Camelina sativa]
Length=662

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 103/137 (75%), Gaps = 15/137 (11%)
 Frame = -1

Query  459  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  280
            N+ DGPM G  GMV + YDM GM P  + P+    LA++LANA P QQRT+LGE+LYPLV
Sbjct  530  NMPDGPMQG--GMVPVAYDMNGM-PF-SQPMSAGQLATSLANATPAQQRTLLGESLYPLV  585

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ-----------  133
            D +EHE+AAKVTGMLLEMDQTEVLHLLESPEAL AKV+EAL+VLRNV Q           
Sbjct  586  DLIEHENAAKVTGMLLEMDQTEVLHLLESPEALNAKVSEALDVLRNVNQPPSTQGSEGNK  645

Query  132  AKIPADQLASLSLNDNL  82
            +  P+D LASLS+ND+L
Sbjct  646  SGSPSDLLASLSINDHL  662


 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRP A  P + PR+P++P GAPG+ QQ+FYGQGPP IIP Q GFGYQ Q+V
Sbjct  415  AQFSQMRP-AFIPGVGPRMPIFPGGAPGLGQQIFYGQGPPPIIPHQPGFGYQPQMV  469



>gb|EYU37653.1| hypothetical protein MIMGU_mgv1a002809mg [Erythranthe guttata]
Length=635

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 91/117 (78%), Gaps = 4/117 (3%)
 Frame = -1

Query  429  GGMVSLPYDMGGMLPRD---AAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEH  259
            GGM S+PY MG M   D   + P PI AL SALAN+ P +QRTMLGENLYPLV+QLE E 
Sbjct  520  GGMFSVPYQMGNMPSHDGGMSRPTPIGALTSALANSSPTEQRTMLGENLYPLVEQLEPET  579

Query  258  AAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSLND  88
            AAKVTGMLLEMDQTEVLHLLESPEALKAKV EA+EVLRNV   +    QLASLSL +
Sbjct  580  AAKVTGMLLEMDQTEVLHLLESPEALKAKVVEAMEVLRNVSNDQ-ATKQLASLSLKE  635


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 55/73 (75%), Gaps = 4/73 (5%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP AM PS+ PR+PMY   APG+ QQ+FYGQ PP  I PQ GFGYQQQLVPGMR
Sbjct  396  AQFSQMRPTAMVPSVNPRMPMY---APGLGQQIFYGQ-PPPAIIPQPGFGYQQQLVPGMR  451

Query  636  pgggpmPNFFVPM  598
            P G  M N FVP 
Sbjct  452  PAGPFMQNMFVPF  464



>gb|EYU42687.1| hypothetical protein MIMGU_mgv1a002746mg [Erythranthe guttata]
Length=642

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 102/118 (86%), Gaps = 4/118 (3%)
 Frame = -1

Query  429  GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEH  259
            GGM+S+PY+MGG+  RDA    P+PI ALASALANA P +QRTMLGENLYPLV+QLE E 
Sbjct  525  GGMLSVPYEMGGLPLRDARISQPIPIGALASALANASPTEQRTMLGENLYPLVEQLEPET  584

Query  258  AAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNV-QQAKIPADQLASLSLND  88
            AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EVLRNV Q +   ADQLASLSLN+
Sbjct  585  AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRNVSQNSAATADQLASLSLNE  642


 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+AM P++APR+PMY PG PG+ QQ+FYGQ PPA++PPQ GFGYQQQL+PGMR
Sbjct  396  AQFSQMRPIAMAPTVAPRMPMYTPGGPGIGQQIFYGQPPPAMLPPQPGFGYQQQLIPGMR  455

Query  636  pgggpmPNFFVPM  598
            P G  MPN F+PM
Sbjct  456  PAGQFMPNMFMPM  468



>emb|CDY36634.1| BnaA07g04230D [Brassica napus]
Length=649

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 104/130 (80%), Gaps = 8/130 (6%)
 Frame = -1

Query  453  SDGPMPGVGGMVSLPYDMGGMLP-RD---AAPVPITALASALANAPPEQQRTMLGENLYP  286
            S GP P V GM  LPY+M   +P RD   +  VPI ALA++LANA PE QRTMLGENLYP
Sbjct  509  SGGP-PDVPGM--LPYEMPSNMPLRDPVLSQHVPIGALATSLANASPEHQRTMLGENLYP  565

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLA  106
            LV+QLE E AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLR+V  A    +QLA
Sbjct  566  LVEQLEAESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRSV-AAGGAGEQLA  624

Query  105  SLSLNDNLVA  76
            SL+LND+LV+
Sbjct  625  SLNLNDDLVS  634


 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP AM PSL P + MYPPG PG+ QQ+FY Q PP +IP  + FGYQQQ+VPGMR
Sbjct  390  AQFSQMRPGAMPPSLGPCMQMYPPGGPGIGQQVFYAQTPPPMIPSHSAFGYQQQMVPGMR  449

Query  636  pgggpmPNFFVPM  598
            PGGGPM NFF+PM
Sbjct  450  PGGGPMYNFFMPM  462



>ref|XP_006409548.1| hypothetical protein EUTSA_v10022589mg [Eutrema salsugineum]
 gb|ESQ51001.1| hypothetical protein EUTSA_v10022589mg [Eutrema salsugineum]
Length=649

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 98/117 (84%), Gaps = 5/117 (4%)
 Frame = -1

Query  414  LPYDMGGMLP-RDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKV  247
            LPY+M   +P RD+     VPI ALA++LANA PE QRTMLGENLYPLV+QLE E AAKV
Sbjct  534  LPYEMPSNMPLRDSVLSQHVPIGALATSLANASPEHQRTMLGENLYPLVEQLEAESAAKV  593

Query  246  TGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSLNDNLVA  76
            TGMLLEMDQTEVLHLLESP+ALKAKVAEA+EVLR+V  A   A+QLASL+LN+NLV+
Sbjct  594  TGMLLEMDQTEVLHLLESPDALKAKVAEAMEVLRSV-AAGGAAEQLASLNLNENLVS  649


 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM PS+ PR+ MYPPG PG+ QQ+FYGQ PP +IPPQ GFG+QQQ+VPGMR
Sbjct  402  AQFSQMRPVAMPPSVGPRMQMYPPGGPGIGQQMFYGQAPPNMIPPQPGFGFQQQMVPGMR  461

Query  636  pgggpmPNFFVPM  598
            PGG PM NFF+PM
Sbjct  462  PGGAPMHNFFMPM  474



>ref|XP_009140459.1| PREDICTED: polyadenylate-binding protein 4-like [Brassica rapa]
Length=644

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 101/134 (75%), Gaps = 12/134 (9%)
 Frame = -1

Query  459  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  280
            N+ DGPMPG  GMV  PYD+ GM      P+   ALAS+L+ A P QQRT+LGE LYPLV
Sbjct  515  NMPDGPMPG--GMVPFPYDINGMPL--GQPMSAGALASSLSQASPAQQRTILGETLYPLV  570

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ--------AKI  124
            +++EHE+AAKVTGMLLEMDQTEVLHL+ESPEAL AKV+EAL+VLRNV Q        +  
Sbjct  571  NKIEHENAAKVTGMLLEMDQTEVLHLIESPEALNAKVSEALDVLRNVNQPTQGSEGKSGS  630

Query  123  PADQLASLSLNDNL  82
            P+  +A+LS+ND+L
Sbjct  631  PSGMMAALSINDHL  644


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 3/56 (5%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRP A  P + PR+PM+P GAPG  QQ FYGQGPP +IP QAGFGYQ Q+V
Sbjct  402  AQFSQMRP-AFIPGMGPRMPMFPGGAPG--QQFFYGQGPPQMIPHQAGFGYQPQMV  454



>emb|CDY38939.1| BnaA04g13600D [Brassica napus]
Length=644

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 101/134 (75%), Gaps = 12/134 (9%)
 Frame = -1

Query  459  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  280
            N+ DGPMPG  GMV  PYD+ GM      P+   ALAS+L+ A P QQRT+LGE LYPLV
Sbjct  515  NMPDGPMPG--GMVPFPYDINGMPL--GQPMSAGALASSLSQASPAQQRTILGETLYPLV  570

Query  279  DQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQ--------AKI  124
            +++EHE+AAKVTGMLLEMDQTEVLHL+ESPEAL AKV+EAL+VLRNV Q        +  
Sbjct  571  NKIEHENAAKVTGMLLEMDQTEVLHLIESPEALNAKVSEALDVLRNVNQPTQGSEGKSGS  630

Query  123  PADQLASLSLNDNL  82
            P+  +A+LS+ND+L
Sbjct  631  PSGMMAALSINDHL  644


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 3/56 (5%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRP A  P + PR+PM+P GAPG  QQ FYGQGPP +IP QAGFGYQ Q+V
Sbjct  402  AQFSQMRP-AFIPGMGPRMPMFPGGAPG--QQFFYGQGPPQMIPHQAGFGYQPQMV  454



>ref|XP_009119410.1| PREDICTED: polyadenylate-binding protein 2 [Brassica rapa]
Length=634

 Score =   122 bits (307),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 104/130 (80%), Gaps = 8/130 (6%)
 Frame = -1

Query  453  SDGPMPGVGGMVSLPYDMGGMLP-RD---AAPVPITALASALANAPPEQQRTMLGENLYP  286
            S GP P V GM  LPY+M   +P RD   +  VPI ALA++LANA PE QRTMLGENLY 
Sbjct  509  SGGP-PDVLGM--LPYEMPSNMPLRDPVLSQHVPIGALATSLANASPEHQRTMLGENLYQ  565

Query  285  LVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLA  106
            LV+QLE E AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLR+V  A   A+QLA
Sbjct  566  LVEQLEAESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRSV-AAGGAAEQLA  624

Query  105  SLSLNDNLVA  76
            SL+LND+LV+
Sbjct  625  SLNLNDDLVS  634


 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP AM PS+ PR+ MYPPG PG+ QQ+FYGQ PP +IP Q+ FGYQQQ+VP MR
Sbjct  390  AQFSQMRPGAMPPSVGPRMQMYPPGGPGIGQQVFYGQAPPPMIPSQSVFGYQQQMVPEMR  449

Query  636  pgggpmPNFFVPM  598
            PGGGPM NFF+PM
Sbjct  450  PGGGPMHNFFMPM  462



>ref|XP_010447142.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=632

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 94/116 (81%), Gaps = 7/116 (6%)
 Frame = -1

Query  435  GVGGMVSLP-YDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEH  259
            G GG   +P YDMG  +P     +PI ALAS LANA PEQQRTMLGENLYPLV+QLE E 
Sbjct  523  GRGGSGDMPSYDMGNNMP-----LPIGALASNLANASPEQQRTMLGENLYPLVEQLEAES  577

Query  258  AAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSLN  91
            AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLR+V  A   A+QLASL+L+
Sbjct  578  AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRSV-AAGGAAEQLASLNLS  632


 Score = 96.7 bits (239),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM PS+ PR+PMYPPG PG+ QQ+FYGQ PP +IPPQ GFGYQQQLVPGMR
Sbjct  406  AQFSQVRPVAMPPSVGPRMPMYPPGGPGIGQQMFYGQAPPNMIPPQPGFGYQQQLVPGMR  465

Query  636  pgggpmPNFFVPM  598
            PGGGP+PNFF+PM
Sbjct  466  PGGGPVPNFFMPM  478



>ref|XP_010432464.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=632

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 94/116 (81%), Gaps = 7/116 (6%)
 Frame = -1

Query  435  GVGGMVSLP-YDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEH  259
            G GG   +P YDMG  +P     +PI ALAS LANA PEQQRTMLGENLYPLV+QLE E 
Sbjct  523  GRGGSGDMPSYDMGNNMP-----LPIGALASNLANASPEQQRTMLGENLYPLVEQLETES  577

Query  258  AAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSLN  91
            AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLR+V  A   A+QLASL+L+
Sbjct  578  AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRSV-AAGGAAEQLASLNLS  632


 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++ PVAM PS+ PR+PMYPPG PG+ QQ+FYGQ PP +IPPQ GFGYQQQLVPGMR
Sbjct  406  AQFSQVTPVAMPPSVGPRMPMYPPGGPGIGQQMFYGQAPPNMIPPQPGFGYQQQLVPGMR  465

Query  636  pgggpmPNFFVPM  598
            PGGGP+PNFF+PM
Sbjct  466  PGGGPVPNFFMPM  478



>ref|XP_010437669.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=633

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 94/116 (81%), Gaps = 7/116 (6%)
 Frame = -1

Query  435  GVGGMVSLP-YDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEH  259
            G GG   +P YDMG  +P     +PI ALAS LANA PEQQRTMLGENLYPLV+QLE E 
Sbjct  524  GRGGSGDMPSYDMGNNMP-----LPIGALASNLANATPEQQRTMLGENLYPLVEQLEAES  578

Query  258  AAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSLN  91
            AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLR+V  A   A+QLASL+L+
Sbjct  579  AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRSV-AAGGAAEQLASLNLS  633


 Score = 96.7 bits (239),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM PS+ PR+PMYPPG PG+ QQ+FYGQ PP +IPPQ GFGYQQQLVPGMR
Sbjct  407  AQFSQVRPVAMPPSVGPRMPMYPPGGPGIGQQMFYGQAPPNMIPPQPGFGYQQQLVPGMR  466

Query  636  pgggpmPNFFVPM  598
            PGGGP+PNFF+PM
Sbjct  467  PGGGPVPNFFMPM  479



>ref|XP_010432462.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010432463.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Camelina 
sativa]
Length=632

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 92/115 (80%), Gaps = 7/115 (6%)
 Frame = -1

Query  435  GVGGMVSLP-YDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEH  259
            G GG   +P YDMG  +P     +PI ALAS LANA PEQQRTMLGENLYPLV+QLE E 
Sbjct  523  GRGGSGDVPSYDMGNNMP-----LPIGALASNLANASPEQQRTMLGENLYPLVEQLEAES  577

Query  258  AAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSL  94
            AAKVTGMLLEMDQTEVLHLLESPEALK KVAEA++VLR+V  A   A+QLASL+L
Sbjct  578  AAKVTGMLLEMDQTEVLHLLESPEALKTKVAEAMDVLRSV-AAGGAAEQLASLNL  631


 Score = 96.7 bits (239),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM PS+ PR+PMYPPG PG+ QQ+FYGQ PP +IPPQ GFGYQQQLVPGMR
Sbjct  406  AQFSQVRPVAMPPSVGPRMPMYPPGGPGIGQQMFYGQAPPNMIPPQPGFGYQQQLVPGMR  465

Query  636  pgggpmPNFFVPM  598
            PGGGP+PNFF+PM
Sbjct  466  PGGGPVPNFFMPM  478



>emb|CDX75397.1| BnaA01g03050D [Brassica napus]
Length=616

 Score =   119 bits (299),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 93/115 (81%), Gaps = 6/115 (5%)
 Frame = -1

Query  435  GVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHA  256
            G GG V+ PYDMG     +   +PI ALAS LANA PEQQRTMLGENLYPLV+QLE E A
Sbjct  508  GSGGDVA-PYDMGN----NNITMPIGALASNLANASPEQQRTMLGENLYPLVEQLEAESA  562

Query  255  AKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSLN  91
            AKVTGMLLEMDQTEVLHLLESPEALK KVAEA++VLR+V  A   A+QLASL+L+
Sbjct  563  AKVTGMLLEMDQTEVLHLLESPEALKDKVAEAMDVLRSV-AAGGAAEQLASLNLS  616


 Score = 87.0 bits (214),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS++RPVAM  S  PR+PM+PPG PG+ QQ+FYGQ PP +IPPQ G+GYQQQLV
Sbjct  387  AQFSQVRPVAMPSSAGPRMPMFPPGGPGIGQQMFYGQAPPNMIPPQPGYGYQQQLV  442



>gb|AID60122.1| poly(A) binding protein 8 [Brassica napus]
 gb|AID60165.1| polyA binding protein 8 [Brassica napus]
Length=606

 Score =   119 bits (299),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 93/115 (81%), Gaps = 6/115 (5%)
 Frame = -1

Query  435  GVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHA  256
            G GG V+ PYDMG     +   +PI ALAS LANA PEQQRTMLGENLYPLV+QLE E A
Sbjct  498  GSGGDVA-PYDMGN----NNITMPIGALASNLANASPEQQRTMLGENLYPLVEQLEAESA  552

Query  255  AKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSLN  91
            AKVTGMLLEMDQTEVLHLLESPEALK KVAEA++VLR+V  A   A+QLASL+L+
Sbjct  553  AKVTGMLLEMDQTEVLHLLESPEALKDKVAEAMDVLRSV-AAGGAAEQLASLNLS  606


 Score = 87.0 bits (214),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS++RPVAM  S  PR+PM+PPG PG+ QQ+FYGQ PP +IPPQ G+GYQQQLV
Sbjct  387  AQFSQVRPVAMPSSAGPRMPMFPPGGPGIGQQMFYGQAPPNMIPPQPGYGYQQQLV  442



>ref|XP_006283328.1| hypothetical protein CARUB_v10004368mg [Capsella rubella]
 gb|EOA16226.1| hypothetical protein CARUB_v10004368mg [Capsella rubella]
Length=629

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 94/116 (81%), Gaps = 7/116 (6%)
 Frame = -1

Query  435  GVGGMVSLP-YDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEH  259
            G GG   +P YDMG  +P     +PI ALAS LANA PEQQRTMLGENLYPLV+Q+E E 
Sbjct  520  GRGGSGDVPPYDMGNNMP-----LPIGALASNLANASPEQQRTMLGENLYPLVEQIEAES  574

Query  258  AAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSLN  91
            AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLR+V  A   A+QLASL+L+
Sbjct  575  AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRSV-AAGGAAEQLASLNLS  629


 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM PS+ PR+PMYPPG PG+ QQ+FYGQ PP++IPPQ G+G+QQQLV    
Sbjct  403  AQFSQVRPVAMPPSVGPRMPMYPPGGPGIGQQMFYGQAPPSMIPPQPGYGFQQQLV-PGM  461

Query  636  pgggpmPNFFVPM  598
              GG  PNFF+PM
Sbjct  462  RPGGGPPNFFMPM  474



>ref|XP_010447143.1| PREDICTED: polyadenylate-binding protein 2 [Camelina sativa]
Length=632

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 94/116 (81%), Gaps = 7/116 (6%)
 Frame = -1

Query  435  GVGGMVSLP-YDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEH  259
            G GG   +P YDMG  +P     +PI ALAS LANA PEQQRTMLGENLYPLV+Q+E E 
Sbjct  523  GRGGSGDVPSYDMGNNMP-----LPIGALASNLANASPEQQRTMLGENLYPLVEQVEAES  577

Query  258  AAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSLN  91
            AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLR+V  A   A+QLASL+L+
Sbjct  578  AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRSV-AAGGAAEQLASLNLS  632


 Score = 96.7 bits (239),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM PS+ PR+PMYPPG PG+ QQ+FYGQ PP +IPPQ GFGYQQQLVPGMR
Sbjct  406  AQFSQVRPVAMPPSVGPRMPMYPPGGPGIGQQMFYGQAPPNMIPPQPGFGYQQQLVPGMR  465

Query  636  pgggpmPNFFVPM  598
            PGGGP+PNFF+PM
Sbjct  466  PGGGPVPNFFMPM  478



>emb|CDX79295.1| BnaC06g20080D [Brassica napus]
Length=100

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = -1

Query  372  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  193
             +PI ALAS LANA PEQQRTMLGENLYPLV++LE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  8    TMPIGALASNLANASPEQQRTMLGENLYPLVEKLEAESAAKVTGMLLEMDQTEVLHLLES  67

Query  192  PealkakvaealevLRNVQQAKIPADQLASLSL  94
            PEAL+AKVAEA++VLR+V  A   A+QLASL+L
Sbjct  68   PEALEAKVAEAMDVLRSV-AAGGAAEQLASLNL  99



>emb|CDX69025.1| BnaC01g04280D [Brassica napus]
Length=611

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 93/115 (81%), Gaps = 4/115 (3%)
 Frame = -1

Query  435  GVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHA  256
            G GG V+ PYDMG     +   +PI ALAS LANA PEQQRTMLGENLYPLV+QLE + A
Sbjct  501  GSGGDVA-PYDMGN--NNNNITMPIGALASNLANASPEQQRTMLGENLYPLVEQLEADSA  557

Query  255  AKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSLN  91
            AKVTGMLLEMDQTEVLHLLESPEALK KVAEA++VLR+V  A   A+QLASL+L+
Sbjct  558  AKVTGMLLEMDQTEVLHLLESPEALKDKVAEAMDVLRSV-AAGGAAEQLASLNLS  611


 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS++RPVAM PS  PR+P +PPG PG+ QQ+FYGQ PP +IPPQ G+GYQQQLV
Sbjct  387  AQFSQVRPVAMPPSAGPRMPTFPPGGPGIGQQMFYGQAPPNMIPPQPGYGYQQQLV  442



>emb|CBI19489.3| unnamed protein product [Vitis vinifera]
Length=621

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 96/106 (91%), Gaps = 5/106 (5%)
 Frame = -1

Query  381  DAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEV  211
            DAA   P+PI+ALASALANA P+QQRTMLGE+LYPLVDQLEHE AAKVTGMLLEMDQTEV
Sbjct  515  DAAIGQPMPISALASALANATPDQQRTMLGESLYPLVDQLEHEMAAKVTGMLLEMDQTEV  574

Query  210  LHLLESPealkakvaealevLRNV--QQAKIPADQLASLSLNDNLV  79
            LHLLESPEALK+KVAEA++VLRNV  QQA  P +QLASLSLND+LV
Sbjct  575  LHLLESPEALKSKVAEAMDVLRNVAQQQANSPTEQLASLSLNDSLV  620


 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPV+M PS+APR+PMYPPGAPG+ QQLFYGQGPPAIIPPQAGFGYQQQLVPGMR
Sbjct  387  AQFSQMRPVSMAPSVAPRMPMYPPGAPGLGQQLFYGQGPPAIIPPQAGFGYQQQLVPGMR  446

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVP+
Sbjct  447  PGGAPMPNFFVPL  459



>pdb|2DYD|A Chain A, Solution Structure Of The Pabc Domain From Triticum 
Aevestium Poly(A)-Binding Protein
Length=85

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = -1

Query  366  PITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPe  187
            PI ALASALAN+PPE QR MLGENLYPLVDQLEH+ AAKVTGMLLEMDQTEVLHLLESP+
Sbjct  6    PIGALASALANSPPETQRMMLGENLYPLVDQLEHDQAAKVTGMLLEMDQTEVLHLLESPD  65

Query  186  alkakvaealevLRNVQQ  133
            ALKAKVAEA+EVLR+ QQ
Sbjct  66   ALKAKVAEAMEVLRSAQQ  83



>ref|XP_002869174.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45433.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=625

 Score =   117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 90/107 (84%), Gaps = 6/107 (6%)
 Frame = -1

Query  411  PYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLL  232
            PYDMG  +P     +PI ALAS LANA PEQQRTMLGE+LYPLV+QLE E AAKVTGMLL
Sbjct  525  PYDMGNNMP-----LPIGALASHLANASPEQQRTMLGESLYPLVEQLEAESAAKVTGMLL  579

Query  231  EMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSLN  91
            EMDQTEVLHLLESPEALKAKVAEA++VLR+V  A   A+QLASL+L+
Sbjct  580  EMDQTEVLHLLESPEALKAKVAEAMDVLRSV-AAGGAAEQLASLNLS  625


 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS++RPVAM PS+ PR+P+YPPG PG+ QQ+FYGQGPP +IPPQ GFGYQQQLVPGMR
Sbjct  401  AQFSQVRPVAMQPSVGPRMPVYPPGGPGIGQQMFYGQGPPTMIPPQPGFGYQQQLVPGMR  460

Query  636  pgggpmPNFFVPM  598
            PGGGP PNFF+PM
Sbjct  461  PGGGPGPNFFMPM  473



>ref|XP_010527159.1| PREDICTED: polyadenylate-binding protein 4-like, partial [Tarenaya 
hassleriana]
Length=636

 Score =   117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 95/121 (79%), Gaps = 6/121 (5%)
 Frame = -1

Query  459  NVSDGPMPGVGGMVSLPYDMGGM-LPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  283
            N+ DGP+PG  G++ + YDM GM  P+   P+   ALASALANA P QQRT+LGE+LYPL
Sbjct  517  NMPDGPIPG--GILPVAYDMTGMPFPQ---PLSTGALASALANATPAQQRTLLGEHLYPL  571

Query  282  VDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLAS  103
            VDQLE ++AAKVTGMLLEMDQTEVLHLLESPEAL AKVAEA++VLRNV Q    +D  + 
Sbjct  572  VDQLERDNAAKVTGMLLEMDQTEVLHLLESPEALTAKVAEAMDVLRNVGQQPEASDSGSG  631

Query  102  L  100
            L
Sbjct  632  L  632


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS+MRP  +     PR+P+YP GAPG+ QQLF+GQGPP +IP Q GFGYQ QLV
Sbjct  407  AQFSQMRPALLPAVGGPRMPIYPAGAPGLGQQLFFGQGPP-MIPHQPGFGYQPQLV  461



>ref|XP_009117148.1| PREDICTED: polyadenylate-binding protein 2 [Brassica rapa]
Length=613

 Score =   116 bits (291),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 92/115 (80%), Gaps = 7/115 (6%)
 Frame = -1

Query  435  GVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHA  256
            G GG V+ PYDMG     +   +PI ALAS LANA PEQQR MLGENLYPLV+QLE E A
Sbjct  506  GSGGDVA-PYDMG-----NNNTMPIGALASNLANASPEQQRMMLGENLYPLVEQLEAESA  559

Query  255  AKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSLN  91
            AKVTGMLLEMDQTEVLHLLESPEALK KVAEA++VLR+V  A   A+QLASL+L+
Sbjct  560  AKVTGMLLEMDQTEVLHLLESPEALKDKVAEAMDVLRSV-AAGGAAEQLASLNLS  613


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            AQFS++RPVAM PS  PR+PM+PPG PG+ QQ+FYGQ PP +IPPQ G+G+QQQLV
Sbjct  387  AQFSQVRPVAMPPSAGPRMPMFPPGGPGIGQQMFYGQAPPNMIPPQPGYGFQQQLV  442



>gb|KJB63885.1| hypothetical protein B456_010G021800 [Gossypium raimondii]
Length=579

 Score =   116 bits (290),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 88/102 (86%), Gaps = 3/102 (3%)
 Frame = -1

Query  372  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  193
            P+P+  LA+ALAN+ PEQQRTMLGE+LYPLV+ LE + AAKVTGMLLEMDQTEVLHL+ES
Sbjct  478  PMPLQPLATALANSTPEQQRTMLGESLYPLVEHLECDAAAKVTGMLLEMDQTEVLHLIES  537

Query  192  PealkakvaealevLRNVQ---QAKIPADQLASLSLNDNLVA  76
            PEALKAKVAEALEVL++V    Q   PADQLASLSLNDN V+
Sbjct  538  PEALKAKVAEALEVLKSVAAKPQVNNPADQLASLSLNDNHVS  579


 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 2/73 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+A+ PS+APR+PMYP GAPG+ QQ  YGQ PPAII PQAGFGYQQQLVPG+R
Sbjct  358  AQFSQMRPLAI-PSVAPRMPMYPSGAPGLGQQFLYGQAPPAII-PQAGFGYQQQLVPGVR  415

Query  636  pgggpmPNFFVPM  598
            PGG P+PNFFVPM
Sbjct  416  PGGPPVPNFFVPM  428



>dbj|BAD94856.1| poly(A)-binding protein [Arabidopsis thaliana]
Length=126

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 87/107 (81%), Gaps = 6/107 (6%)
 Frame = -1

Query  411  PYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLL  232
            PYDMG  +P     + I ALAS L+NA PEQQRTMLGE LYPLV+Q+E E AAKVTGMLL
Sbjct  26   PYDMGNNMP-----LTIGALASNLSNATPEQQRTMLGEVLYPLVEQVEAESAAKVTGMLL  80

Query  231  EMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSLN  91
            EMDQTEVLHLLESPEALKAKVAEA++VLR+V  A    +QLASL+L+
Sbjct  81   EMDQTEVLHLLESPEALKAKVAEAMDVLRSV-AAGGATEQLASLNLS  126



>gb|KJB63886.1| hypothetical protein B456_010G021800 [Gossypium raimondii]
Length=620

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 88/102 (86%), Gaps = 3/102 (3%)
 Frame = -1

Query  372  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  193
            P+P+  LA+ALAN+ PEQQRTMLGE+LYPLV+ LE + AAKVTGMLLEMDQTEVLHL+ES
Sbjct  519  PMPLQPLATALANSTPEQQRTMLGESLYPLVEHLECDAAAKVTGMLLEMDQTEVLHLIES  578

Query  192  PealkakvaealevLRNVQ---QAKIPADQLASLSLNDNLVA  76
            PEALKAKVAEALEVL++V    Q   PADQLASLSLNDN V+
Sbjct  579  PEALKAKVAEALEVLKSVAAKPQVNNPADQLASLSLNDNHVS  620


 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 2/73 (3%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+A+ PS+APR+PMYP GAPG+ QQ  YGQ PPAII PQAGFGYQQQLVPG+R
Sbjct  399  AQFSQMRPLAI-PSVAPRMPMYPSGAPGLGQQFLYGQAPPAII-PQAGFGYQQQLVPGVR  456

Query  636  pgggpmPNFFVPM  598
            PGG P+PNFFVPM
Sbjct  457  PGGPPVPNFFVPM  469



>ref|XP_006412276.1| hypothetical protein EUTSA_v10024683mg [Eutrema salsugineum]
 gb|ESQ53729.1| hypothetical protein EUTSA_v10024683mg [Eutrema salsugineum]
Length=599

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 87/102 (85%), Gaps = 1/102 (1%)
 Frame = -1

Query  399  GGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQ  220
            GG +P    P+PI ALAS LANA PEQQRTMLGENLYPLV+QLE E AAKVTGMLLEMDQ
Sbjct  499  GGDVPPYDVPLPIGALASNLANASPEQQRTMLGENLYPLVEQLEAESAAKVTGMLLEMDQ  558

Query  219  TEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSL  94
            TEVLHLLESPEALKAKVAEA++VLR+V  A   A+QLASL+L
Sbjct  559  TEVLHLLESPEALKAKVAEAMDVLRSV-AAGGAAEQLASLNL  599


 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQF+++RPVAM PS  PR+P++PPG PG+ QQ+FYGQ PP +IPPQ G+GYQQQLVPGMR
Sbjct  380  AQFAQVRPVAMPPSAGPRMPIFPPGGPGVGQQMFYGQAPPNMIPPQPGYGYQQQLVPGMR  439

Query  636  pgggpmPNFFVPM  598
            PGGGP+PNFF+PM
Sbjct  440  PGGGPVPNFFMPM  452



>ref|XP_006412275.1| hypothetical protein EUTSA_v10024683mg [Eutrema salsugineum]
 gb|ESQ53728.1| hypothetical protein EUTSA_v10024683mg [Eutrema salsugineum]
Length=624

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 87/102 (85%), Gaps = 1/102 (1%)
 Frame = -1

Query  399  GGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQ  220
            GG +P    P+PI ALAS LANA PEQQRTMLGENLYPLV+QLE E AAKVTGMLLEMDQ
Sbjct  524  GGDVPPYDVPLPIGALASNLANASPEQQRTMLGENLYPLVEQLEAESAAKVTGMLLEMDQ  583

Query  219  TEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSL  94
            TEVLHLLESPEALKAKVAEA++VLR+V  A   A+QLASL+L
Sbjct  584  TEVLHLLESPEALKAKVAEAMDVLRSV-AAGGAAEQLASLNL  624


 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQF+++RPVAM PS  PR+P++PPG PG+ QQ+FYGQ PP +IPPQ G+GYQQQLVPGMR
Sbjct  405  AQFAQVRPVAMPPSAGPRMPIFPPGGPGVGQQMFYGQAPPNMIPPQPGYGYQQQLVPGMR  464

Query  636  pgggpmPNFFVPM  598
            PGGGP+PNFF+PM
Sbjct  465  PGGGPVPNFFMPM  477



>emb|CDX89664.1| BnaC03g45780D [Brassica napus]
Length=614

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 94/119 (79%), Gaps = 13/119 (11%)
 Frame = -1

Query  447  GPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  268
            G +PG      LPY+M    P+    VPI ALA++LANA PE QRTMLGENLYPLV+QLE
Sbjct  509  GDVPG-----RLPYEM----PQH---VPIGALATSLANASPEHQRTMLGENLYPLVEQLE  556

Query  267  HEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSLN  91
             E AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLRNV  A   A+QL+SL+LN
Sbjct  557  AESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRNV-AAGGAAEQLSSLNLN  614


 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV-pgm  640
            AQFS+MRP+AM P++ PR+ MYPPG P + QQ+FYGQGPP +IP Q GFGYQQQLV    
Sbjct  397  AQFSQMRPMAMPPAVGPRVQMYPPGGPRIGQQMFYGQGPPTMIPQQPGFGYQQQLVPGMR  456

Query  639  rpgggpmPNFFVPM  598
              G  PM NFF+PM
Sbjct  457  PGGAPPMQNFFMPM  470



>ref|XP_006842170.1| PREDICTED: polyadenylate-binding protein 5 [Amborella trichopoda]
 gb|ERN03845.1| hypothetical protein AMTR_s00078p00149860 [Amborella trichopoda]
Length=645

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 92/119 (77%), Gaps = 7/119 (6%)
 Frame = -1

Query  423  MVSLPYDMGGML--PRDA---APVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEH  259
            M+ LP D+ GM+  P +A    PVPI  LASALA+A PEQQR MLGE L+PLVD++EH+H
Sbjct  527  MLPLPLDVPGMVMSPMEAPRPQPVPIGTLASALASATPEQQRVMLGEQLFPLVDRMEHDH  586

Query  258  AAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQA--KIPADQLASLSLND  88
            A KVTGMLLEMDQTEVLHL+ESP+ALK KV EALEVLR  Q A      DQLASLSLN+
Sbjct  587  AGKVTGMLLEMDQTEVLHLIESPDALKTKVGEALEVLRMAQAAAPSDHTDQLASLSLNE  645


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 49/75 (65%), Gaps = 3/75 (4%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPR--IPMYPPGAPGMPQQLFYGQGPPAIIPPQ-AGFGYQQQLVp  646
            AQF++MR     P   P    P +P G    PQQLFYGQG P ++PPQ AG+GYQQ L+P
Sbjct  388  AQFAQMRAAVGVPPAMPANMSPFHPAGPRLTPQQLFYGQGAPGLMPPQPAGYGYQQPLLP  447

Query  645  gmrpgggpmPNFFVP  601
            GMRPG   MPNF VP
Sbjct  448  GMRPGVAQMPNFVVP  462



>emb|CBI19492.3| unnamed protein product [Vitis vinifera]
Length=153

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 79/90 (88%), Gaps = 2/90 (2%)
 Frame = -1

Query  375  APVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLE  196
            +P+PI+ LASALANA P+QQRTML E+LYPLVDQLEHE AAK+TGMLLEM QTE LHLLE
Sbjct  52   SPMPISTLASALANATPDQQRTMLSESLYPLVDQLEHEMAAKLTGMLLEMGQTEFLHLLE  111

Query  195  SPealkakvaealevLRNV--QQAKIPADQ  112
            SPEALK+KVAEA++VLRNV  QQA  P +Q
Sbjct  112  SPEALKSKVAEAMDVLRNVAQQQANSPTEQ  141



>ref|XP_009136273.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Brassica 
rapa]
Length=614

 Score =   114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 96/121 (79%), Gaps = 10/121 (8%)
 Frame = -1

Query  453  SDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQ  274
            S GP P V G   LPY+M    P+    VPI ALA++LANA PE QRTMLGENLYPLV+Q
Sbjct  504  SGGPPPDVPG--RLPYEM----PQH---VPIGALATSLANASPEHQRTMLGENLYPLVEQ  554

Query  273  LEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSL  94
            LE E AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLR+V  A   A+QL+SL+L
Sbjct  555  LEAESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRSV-AAGGAAEQLSSLNL  613

Query  93   N  91
            N
Sbjct  614  N  614


 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+AM P++ PR+ MYPPG PGM QQ+FYGQGPP +IP Q GFGYQQQLVPGMR
Sbjct  398  AQFSQMRPMAMPPAVGPRMQMYPPGGPGMGQQMFYGQGPPTMIPQQPGFGYQQQLVPGMR  457

Query  636  pgggpmPNFFVPM  598
            PGG PM NFF+PM
Sbjct  458  PGGAPMHNFFMPM  470



>ref|XP_009136272.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Brassica 
rapa]
Length=616

 Score =   114 bits (286),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 96/121 (79%), Gaps = 10/121 (8%)
 Frame = -1

Query  453  SDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQ  274
            S GP P V G   LPY+M    P+    VPI ALA++LANA PE QRTMLGENLYPLV+Q
Sbjct  506  SGGPPPDVPG--RLPYEM----PQH---VPIGALATSLANASPEHQRTMLGENLYPLVEQ  556

Query  273  LEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSL  94
            LE E AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA++VLR+V  A   A+QL+SL+L
Sbjct  557  LEAESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRSV-AAGGAAEQLSSLNL  615

Query  93   N  91
            N
Sbjct  616  N  616


 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+AM P++ PR+ MYPPG PGM QQ+FYGQGPP +IP Q GFGYQQQLVPGMR
Sbjct  398  AQFSQMRPMAMPPAVGPRMQMYPPGGPGMGQQMFYGQGPPTMIPQQPGFGYQQQLVPGMR  457

Query  636  pgggpmPNFFVPM  598
            PGG PM NFF+PM
Sbjct  458  PGGAPMHNFFMPM  470



>gb|KFK30042.1| hypothetical protein AALP_AA7G209600 [Arabis alpina]
Length=632

 Score =   114 bits (285),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 94/115 (82%), Gaps = 6/115 (5%)
 Frame = -1

Query  435  GVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHA  256
            G GG V  PYDMG     +  P+PI ALAS LA+A PEQQRTMLGE+LYPLV+QLE + A
Sbjct  524  GSGGDVP-PYDMGN----NNMPLPIGALASNLAHASPEQQRTMLGESLYPLVEQLEADSA  578

Query  255  AKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSLN  91
            AKVTGMLLEMDQTEVLHLLESPEALKAKV+EA++VLR+V  A   A+QLASL+L+
Sbjct  579  AKVTGMLLEMDQTEVLHLLESPEALKAKVSEAMDVLRSV-AAGGAAEQLASLNLS  632


 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+ RPVAM PSL PR+P+YPPG PG+ QQ+FYGQ PP +IPPQAGFGYQQQLVPGMR
Sbjct  406  AQFSQPRPVAMQPSLGPRMPIYPPGGPGIGQQMFYGQAPPNMIPPQAGFGYQQQLVPGMR  465

Query  636  pgggpmPNFFVPM  598
            PGGG +PNF++PM
Sbjct  466  PGGGHVPNFYMPM  478



>gb|KHG16756.1| Polyadenylate-binding 2 -like protein [Gossypium arboreum]
Length=514

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 7/105 (7%)
 Frame = -1

Query  384  RDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTE  214
            RDA    P+P+TALA++LANA PEQQRTMLGE+LYPLV++LE + AAKVTGMLLEMDQTE
Sbjct  411  RDAGSGQPMPVTALATSLANAAPEQQRTMLGESLYPLVERLERDAAAKVTGMLLEMDQTE  470

Query  213  VLHLLESPealkakvaealevLRNV---QQAKIPADQLASLSLND  88
            VLHLLESPEALKAKVAEA+EVLR+V   QQ+  PADQL SL++ +
Sbjct  471  VLHLLESPEALKAKVAEAMEVLRSVDAQQQSNNPADQL-SLTVTE  514


 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+A+ PS+APR+P+YP GAPG+ QQ  YGQ PP +IPPQAGFGYQQQLVPGMR
Sbjct  286  AQFSQMRPLAI-PSVAPRMPVYPSGAPGLGQQFLYGQAPPTVIPPQAGFGYQQQLVPGMR  344

Query  636  pgggpmPNFFVPM  598
            P G PMPN FVPM
Sbjct  345  PVGPPMPNCFVPM  357



>emb|CDY08990.1| BnaC01g31010D [Brassica napus]
Length=99

 Score =   105 bits (263),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 81/94 (86%), Gaps = 1/94 (1%)
 Frame = -1

Query  372  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  193
            P+PI ALAS LAN  PEQQRTMLG+NLYPLV++LE E AAKVTGMLLEMDQTEVLHLL S
Sbjct  7    PLPIGALASNLANTSPEQQRTMLGDNLYPLVEKLEVESAAKVTGMLLEMDQTEVLHLLAS  66

Query  192  PealkakvaealevLRNVQQAKIPADQLASLSLN  91
            PEAL+AKV EA++VLR+V  A   A+QLASL+L+
Sbjct  67   PEALEAKVVEAMDVLRSV-AAGGAAEQLASLNLS  99



>ref|XP_010261307.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
2 [Nelumbo nucifera]
Length=829

 Score =   114 bits (286),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 91/120 (76%), Gaps = 5/120 (4%)
 Frame = -1

Query  432  VGGMVSLPYDMGGM--LPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQLE  268
            +G M+ LP D+ GM   P D +   PVPIT LASALA+A PE QR MLGE L+PLV+++E
Sbjct  710  MGPMMPLPLDVSGMPVSPMDVSRPGPVPITTLASALASASPEHQRLMLGEQLFPLVERIE  769

Query  267  HEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSLND  88
            H+ A KVTGMLLEMDQTEVLHL+ESP+ALK KVAEAL+VLR        +DQL SLSLND
Sbjct  770  HDLAGKVTGMLLEMDQTEVLHLIESPDALKKKVAEALDVLRLAATGSDASDQLGSLSLND  829



>emb|CDY67364.1| BnaA03g57630D [Brassica napus]
Length=293

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 88/108 (81%), Gaps = 8/108 (7%)
 Frame = -1

Query  414  LPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGML  235
            LPY+M    P+    VPI ALA++LANA PE QR MLGENLYPLV+QLE E AAKVTGML
Sbjct  194  LPYEM----PQH---VPIGALATSLANASPEHQRAMLGENLYPLVEQLEAESAAKVTGML  246

Query  234  LEMDQTEVLHLLESPealkakvaealevLRNVQQAKIPADQLASLSLN  91
            LEMDQTEVLHLLESPEALKAKVAEA++VLR+V      A+QLASL+LN
Sbjct  247  LEMDQTEVLHLLESPEALKAKVAEAMDVLRSVAGGGA-AEQLASLNLN  293


 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRP+AM P++ PR+ MYPPG PGM QQ+FYGQGPP +I    GFGYQQQLVPGMR
Sbjct  69   AQFSQMRPMAMPPAVGPRMQMYPPGGPGMGQQMFYGQGPPTMITQPPGFGYQQQLVPGMR  128

Query  636  pgggpmPNFFVPM  598
            PGG PM NFF+PM
Sbjct  129  PGGAPMHNFFMPM  141



>ref|XP_004978120.1| PREDICTED: polyadenylate-binding protein 2-like [Setaria italica]
Length=692

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 97/162 (60%), Gaps = 41/162 (25%)
 Frame = -1

Query  441  MPGVGGMVSLPYDMGGMLPRDAAPVP---ITALASALANAPPEQQRT-------------  310
            MPGV G +  PYDMGG   RDAA  P   I  L SALANA PEQQRT             
Sbjct  531  MPGVAGGMIQPYDMGGFPVRDAALSPSAQIGTLTSALANATPEQQRTVCSYLVLINLEMS  590

Query  309  ----------------------MLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLE  196
                                  +LGENLYPLV+QLE   AAKVTGMLLEMDQTEVLHLLE
Sbjct  591  GGICFCKFYGFKGVYSHCILISILGENLYPLVEQLEPNQAAKVTGMLLEMDQTEVLHLLE  650

Query  195  SPealkakvaealevLRNV---QQAKIPADQLASLSLNDNLV  79
            SPEALK+KVAEA++VLRNV   Q    P  QLA+LSL + ++
Sbjct  651  SPEALKSKVAEAMDVLRNVAHQQNPNTPTSQLAALSLTEGII  692


 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 64/74 (86%), Gaps = 4/74 (5%)
 Frame = -1

Query  816  AQFSEMRP-VAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgm  640
            AQFS+MRP V MTP+LAPR+PMYPP AP   QQLFYGQ PPA+IPPQ G+G+QQQLVPGM
Sbjct  409  AQFSQMRPPVPMTPTLAPRLPMYPPMAP---QQLFYGQAPPAMIPPQPGYGFQQQLVPGM  465

Query  639  rpgggpmPNFFVPM  598
            RPGG  MPN+FVP+
Sbjct  466  RPGGPHMPNYFVPV  479



>ref|XP_004291087.1| PREDICTED: polyadenylate-binding protein 2-like [Fragaria vesca 
subsp. vesca]
Length=631

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 90/112 (80%), Gaps = 4/112 (4%)
 Frame = -1

Query  411  PYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLL  232
            PY  GGML      +P+ ALAS+LANA PE+QRTMLGE LYP V+ LE E AAKVTGMLL
Sbjct  522  PYS-GGMLSAGRG-MPVPALASSLANASPEEQRTMLGEALYPQVNALEPESAAKVTGMLL  579

Query  231  EMDQTEVLHLLESPealkakvaealevLRNVQQAKI--PADQLASLSLNDNL  82
            EMDQTEVLHLLESPEALKAKVAEA+EVLRNV Q ++    DQLAS+SL+D L
Sbjct  580  EMDQTEVLHLLESPEALKAKVAEAIEVLRNVTQHQVNNSGDQLASISLSDEL  631


 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLVpgmr  637
            AQFS+MRPVAM P++AP  PMYPPGAPG+ QQ  YGQGPP IIP QAGFGYQQQLVPG+R
Sbjct  398  AQFSQMRPVAMAPAVAPLRPMYPPGAPGLGQQFLYGQGPPTIIPQQAGFGYQQQLVPGLR  457

Query  636  pgggpmPNFFVPM  598
            PGG PMPNFFVPM
Sbjct  458  PGGAPMPNFFVPM  470



>ref|XP_011092554.1| PREDICTED: polyadenylate-binding protein 2-like [Sesamum indicum]
Length=634

 Score =   112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 84/101 (83%), Gaps = 2/101 (2%)
 Frame = -1

Query  384  RDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLH  205
            R   PVP+  LASALANA P +QRTMLGE+LYPLV+QLEHE AAKVTGMLLEMDQTEVLH
Sbjct  534  RPHGPVPVGTLASALANALPSEQRTMLGESLYPLVEQLEHEMAAKVTGMLLEMDQTEVLH  593

Query  204  LLESPealkakvaealevLRNV--QQAKIPADQLASLSLND  88
            LLESPE+L+AKV EA+EVL+N   + A   A+QLASL L++
Sbjct  594  LLESPESLRAKVGEAMEVLKNAPQRHASSTANQLASLVLSE  634


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = -1

Query  816  AQFSEMRPVAMTPSLAPRIPMYPPGAPGMPQQLFYGQGPPAIIPPQAGFGYQQQLV  649
            A FS MRP  + P++   +P+YP G PG+ QQL YG+ P AI+PP  GFGYQQQ +
Sbjct  386  AIFSNMRPNTVVPAVT-HMPIYPLGGPGIGQQLPYGRAPHAILPPVPGFGYQQQFI  440



>emb|CAN61506.1| hypothetical protein VITISV_011738 [Vitis vinifera]
Length=433

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 70/93 (75%), Gaps = 4/93 (4%)
 Frame = -1

Query  459  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  292
            N+ D PMPGV GGM+S+PYDMG ML RDA    P+ I+ LAS  A+   +QQRTMLGE+L
Sbjct  338  NMLDSPMPGVAGGMLSIPYDMGDMLLRDAXFXQPILISXLASTHASVASDQQRTMLGESL  397

Query  291  YPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  193
            YPL+DQLE+E A KV G  LE+DQTE LHL ES
Sbjct  398  YPLLDQLENEMAVKVIGPFLEVDQTEGLHLFES  430



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1724604950500