BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6187

Length=1258
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625446.1|  PREDICTED: sucrose synthase                        575   0.0      Nicotiana tomentosiformis
ref|XP_009792656.1|  PREDICTED: sucrose synthase                        573   0.0      Nicotiana sylvestris
ref|NP_001274911.1|  sucrose synthase 2                                 568   0.0      Solanum tuberosum [potatoes]
sp|P49039.1|SUS2_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    568   0.0      Solanum tuberosum [potatoes]
ref|XP_010323602.1|  PREDICTED: sucrose synthase isoform X1             568   0.0      
ref|NP_001234804.1|  sucrose synthase                                   568   0.0      
gb|AHL84158.1|  sucrose synthase                                        567   0.0      Nicotiana tabacum [American tobacco]
ref|XP_011093886.1|  PREDICTED: sucrose synthase                        567   0.0      Sesamum indicum [beniseed]
ref|XP_006353766.1|  PREDICTED: sucrose synthase 2 isoform X2           567   0.0      
ref|NP_001234655.1|  sucrose synthase                                   566   0.0      
gb|ABV02029.1|  sucrose sythase                                         566   0.0      Nicotiana langsdorffii x Nicotiana sanderae
emb|CAA09681.1|  sucrose synthase                                       565   0.0      Solanum lycopersicum
ref|XP_011078145.1|  PREDICTED: sucrose synthase                        565   0.0      
ref|NP_001275286.1|  sucrose synthase                                   564   0.0      Solanum tuberosum [potatoes]
ref|XP_006345244.1|  PREDICTED: uncharacterized LOC102577594            564   0.0      Solanum tuberosum [potatoes]
ref|XP_009760458.1|  PREDICTED: sucrose synthase                        563   0.0      Nicotiana sylvestris
gb|AAA97571.1|  sucrose synthase                                        563   0.0      Solanum tuberosum [potatoes]
sp|P10691.1|SUS1_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    561   0.0      Solanum tuberosum [potatoes]
ref|XP_009589756.1|  PREDICTED: sucrose synthase                        560   0.0      Nicotiana tomentosiformis
emb|CAJ32596.1|  sucrose synthase                                       556   0.0      Coffea arabica [arabica coffee]
emb|CAI56307.1|  sucrose synthase                                       556   0.0      Coffea canephora [robusta coffee]
gb|ABI17891.1|  sucrose synthase                                        554   0.0      Coffea canephora [robusta coffee]
sp|P49035.1|SUS1_DAUCA  RecName: Full=Sucrose synthase isoform 1;...    546   0.0      Daucus carota [carrots]
emb|CAA09680.1|  sucrose synthase                                       528   0.0      Solanum lycopersicum
gb|AEN79500.1|  sucrose synthase 1                                      542   0.0      Phelipanche ramosa
gb|EYU25805.1|  hypothetical protein MIMGU_mgv1a001207mg                537   2e-180   Erythranthe guttata [common monkey flower]
gb|AJW82916.1|  sucrose synthase                                        534   9e-180   Dimocarpus longan [longan]
gb|AEV40463.1|  sucrose synthase 4                                      534   9e-180   Gossypium arboreum [tree cotton]
dbj|BAA89049.1|  sucrose synthase                                       533   1e-179   Citrus unshiu [satsuma mandarin]
ref|XP_006474580.1|  PREDICTED: sucrose synthase-like isoform X1        533   1e-179   Citrus sinensis [apfelsine]
ref|XP_006452883.1|  hypothetical protein CICLE_v10007483mg             533   2e-179   Citrus clementina [clementine]
gb|KDO73788.1|  hypothetical protein CISIN_1g003661mg                   532   2e-179   Citrus sinensis [apfelsine]
gb|KJB65372.1|  hypothetical protein B456_010G092300                    532   4e-179   Gossypium raimondii
gb|AEV40464.1|  sucrose synthase 5                                      533   6e-179   Gossypium arboreum [tree cotton]
gb|ADR00484.1|  sucrose synthase                                        520   8e-179   Arachis hypogaea var. vulgaris [Spanish peanut]
gb|ADW80556.1|  sucrose synthase 1                                      531   2e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80536.1|  sucrose synthase 1                                      530   2e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80558.1|  sucrose synthase 1                                      530   3e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80565.1|  sucrose synthase 1                                      530   3e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80535.1|  sucrose synthase 1                                      530   3e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80571.1|  sucrose synthase 1                                      530   3e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80546.1|  sucrose synthase 1                                      530   3e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80540.1|  sucrose synthase 1                                      530   3e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80551.1|  sucrose synthase 1                                      530   3e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80559.1|  sucrose synthase 1                                      530   3e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80549.1|  sucrose synthase 1                                      530   4e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80552.1|  sucrose synthase 1                                      530   4e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80562.1|  sucrose synthase 1                                      530   4e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80566.1|  sucrose synthase 1                                      530   4e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80548.1|  sucrose synthase 1                                      530   4e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80534.1|  sucrose synthase 1                                      530   4e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80541.1|  sucrose synthase 1                                      530   5e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80539.1|  sucrose synthase 1                                      530   5e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80570.1|  sucrose synthase 1                                      530   5e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80550.1|  sucrose synthase 1                                      530   5e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80560.1|  sucrose synthase 1                                      530   5e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80563.1|  sucrose synthase 1                                      530   5e-178   Populus tomentosa [Chinese white poplar]
gb|ADV71181.1|  sucrose synthase 1                                      530   5e-178   Populus tomentosa [Chinese white poplar]
gb|ADW80555.1|  sucrose synthase 1                                      529   6e-178   Populus tomentosa [Chinese white poplar]
ref|XP_012077131.1|  PREDICTED: sucrose synthase                        529   6e-178   
dbj|BAM37539.1|  sucrose synthase                                       529   6e-178   Mangifera indica
dbj|BAM68521.1|  sucrose synthase                                       529   8e-178   Mangifera indica
dbj|BAA88905.1|  sucrose synthase                                       528   1e-177   Citrus unshiu [satsuma mandarin]
sp|O49845.1|SUS2_DAUCA  RecName: Full=Sucrose synthase isoform 2;...    528   1e-177   Daucus carota [carrots]
gb|ADW80545.1|  sucrose synthase 1                                      528   2e-177   Populus tomentosa [Chinese white poplar]
gb|ADW80543.1|  sucrose synthase 1                                      528   2e-177   Populus tomentosa [Chinese white poplar]
ref|XP_011010968.1|  PREDICTED: sucrose synthase-like isoform X1        528   3e-177   Populus euphratica
ref|XP_011010969.1|  PREDICTED: sucrose synthase-like isoform X2        527   3e-177   Populus euphratica
ref|XP_008337809.1|  PREDICTED: sucrose synthase                        527   4e-177   Malus domestica [apple tree]
dbj|BAM68520.1|  sucrose synthase                                       527   4e-177   Mangifera indica
dbj|BAM68527.1|  sucrose synthase                                       527   5e-177   Mangifera indica
gb|ADY68846.1|  sucrose synthase                                        527   5e-177   Gossypium herbaceum subsp. africanum
ref|XP_004287669.1|  PREDICTED: sucrose synthase                        526   7e-177   Fragaria vesca subsp. vesca
ref|XP_010535796.1|  PREDICTED: sucrose synthase 4                      526   9e-177   Tarenaya hassleriana [spider flower]
dbj|BAM68526.1|  sucrose synthase                                       526   1e-176   Mangifera indica
gb|AGH29112.1|  sucrose synthase                                        526   1e-176   Jatropha curcas
gb|AGO61958.1|  sucrose synthase                                        513   2e-176   Prunus serrulata
ref|XP_010520519.1|  PREDICTED: sucrose synthase 4-like                 525   2e-176   Tarenaya hassleriana [spider flower]
gb|AEV40462.1|  sucrose synthase 3                                      525   2e-176   Gossypium arboreum [tree cotton]
gb|ADR81996.1|  sucrose synthase 1                                      525   2e-176   Populus trichocarpa [western balsam poplar]
gb|ADY68848.1|  sucrose synthase                                        525   2e-176   Gossypium hirsutum [American cotton]
gb|AEN71067.1|  sucrose synthase Sus1                                   525   2e-176   Gossypium tomentosum
gb|AEN71063.1|  sucrose synthase Sus1                                   525   2e-176   Gossypium mustelinum
ref|XP_002324136.2|  sucrose synthase family protein                    525   2e-176   
gb|AFO84090.1|  sucrose synthase                                        525   3e-176   Actinidia chinensis
emb|CDO97805.1|  unnamed protein product                                522   4e-176   Coffea canephora [robusta coffee]
gb|AHA41509.1|  sucrose synthase                                        525   4e-176   Populus deltoides
gb|AAK59464.1|  putative sucrose synthase                               515   4e-176   Arabidopsis thaliana [mouse-ear cress]
gb|AGM14948.1|  sucrose synthase 3                                      525   5e-176   Hevea brasiliensis [jebe]
gb|AEN71079.1|  sucrose synthase Sus1                                   524   5e-176   Gossypium aridum
gb|AHL29281.1|  sucrose synthase 1                                      524   7e-176   Camellia sinensis [black tea]
gb|ADY68844.1|  sucrose synthase                                        523   1e-175   Gossypium barbadense [Egyptian cotton]
ref|XP_003551045.1|  PREDICTED: sucrose synthase-like isoform X1        523   1e-175   
gb|KHN17754.1|  Sucrose synthase                                        523   1e-175   Glycine soja [wild soybean]
ref|XP_007012547.1|  Sucrose synthase 4 isoform 2                       523   1e-175   
gb|AEK81520.1|  sucrose synthase isoform B                              523   2e-175   Gossypium hirsutum [American cotton]
gb|AFI57908.1|  sucrose synthase 1                                      523   2e-175   Prunus persica
gb|AEN71080.1|  sucrose synthase Sus1                                   523   2e-175   Gossypium gossypioides
gb|AEN71075.1|  sucrose synthase Sus1                                   523   2e-175   Gossypium armourianum
gb|AEN71078.1|  sucrose synthase Sus1                                   523   2e-175   Gossypium klotzschianum
gb|ACV72640.1|  sucrose synthase 1                                      523   2e-175   Gossypium hirsutum [American cotton]
gb|ADY68845.1|  sucrose synthase                                        523   3e-175   Gossypium barbadense [Egyptian cotton]
gb|AEN71061.1|  sucrose synthase Sus1                                   522   3e-175   Gossypium schwendimanii
gb|AEN71066.1|  sucrose synthase Sus1                                   522   3e-175   Gossypium darwinii
ref|XP_004508035.1|  PREDICTED: sucrose synthase-like isoform X3        522   3e-175   Cicer arietinum [garbanzo]
ref|XP_007012546.1|  Sucrose synthase 4 isoform 1                       524   3e-175   Theobroma cacao [chocolate]
gb|AEE60913.1|  nodule-enhanced sucrose synthase                        522   4e-175   Cicer arietinum [garbanzo]
gb|KHG00606.1|  Sucrose synthase                                        522   6e-175   Gossypium arboreum [tree cotton]
ref|XP_010047438.1|  PREDICTED: sucrose synthase                        521   6e-175   Eucalyptus grandis [rose gum]
gb|AEV40460.1|  sucrose synthase 1                                      521   6e-175   Gossypium arboreum [tree cotton]
gb|AIJ28960.1|  sucrose synthase                                        521   6e-175   Manihot esculenta subsp. flabellifolia
ref|XP_010247458.1|  PREDICTED: sucrose synthase                        521   7e-175   Nelumbo nucifera [Indian lotus]
gb|AEN71059.1|  sucrose synthase Sus1                                   521   8e-175   Gossypium thurberi
gb|AEN71068.1|  sucrose synthase Sus1                                   521   1e-174   Gossypium tomentosum
gb|KJB65376.1|  hypothetical protein B456_010G092300                    521   1e-174   Gossypium raimondii
gb|AIJ28961.1|  sucrose synthase                                        521   1e-174   Manihot esculenta [manioc]
ref|XP_007204649.1|  hypothetical protein PRUPE_ppa001535mg             521   2e-174   Prunus persica
gb|AEF56625.1|  sucrose synthase                                        521   2e-174   Arachis hypogaea var. vulgaris [Spanish peanut]
emb|CDX92432.1|  BnaA10g14710D                                          521   2e-174   
gb|ADW80606.1|  sucrose synthase 2                                      520   2e-174   Populus tomentosa [Chinese white poplar]
gb|ADW80591.1|  sucrose synthase 2                                      520   2e-174   Populus tomentosa [Chinese white poplar]
ref|XP_011039917.1|  PREDICTED: sucrose synthase                        520   2e-174   Populus euphratica
gb|ADW80607.1|  sucrose synthase 2                                      520   2e-174   Populus tomentosa [Chinese white poplar]
gb|ADW80587.1|  sucrose synthase 2                                      520   2e-174   Populus tomentosa [Chinese white poplar]
gb|ADW80595.1|  sucrose synthase 2                                      520   2e-174   Populus tomentosa [Chinese white poplar]
emb|CDY16569.1|  BnaC09g37040D                                          520   2e-174   Brassica napus [oilseed rape]
gb|ADV71182.1|  sucrose synthase 2                                      520   2e-174   Populus tomentosa [Chinese white poplar]
gb|AEN71060.1|  sucrose synthase Sus1                                   520   2e-174   Gossypium laxum
gb|ABD96570.1|  sucrose synthase                                        520   2e-174   Manihot esculenta [manioc]
ref|NP_001289655.1|  sucrose synthase                                   520   2e-174   Eucalyptus grandis [rose gum]
gb|KJB82966.1|  hypothetical protein B456_013G222400                    520   2e-174   Gossypium raimondii
gb|KEH37657.1|  sucrose synthase                                        520   2e-174   Medicago truncatula
gb|ADW80600.1|  sucrose synthase 2                                      520   2e-174   Populus tomentosa [Chinese white poplar]
gb|ADW80598.1|  sucrose synthase 2                                      520   3e-174   Populus tomentosa [Chinese white poplar]
ref|XP_006381564.1|  sucrose synthase family protein                    520   3e-174   Populus trichocarpa [western balsam poplar]
gb|ADR81997.1|  sucrose synthase 2                                      520   3e-174   Populus trichocarpa [western balsam poplar]
gb|ADW80610.1|  sucrose synthase 2                                      520   4e-174   Populus tomentosa [Chinese white poplar]
ref|XP_009120766.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    519   5e-174   Brassica rapa
ref|XP_006290612.1|  hypothetical protein CARUB_v10016702mg             519   5e-174   Capsella rubella
gb|AFS17277.1|  sucrose synthase 1                                      519   5e-174   Amaranthus cruentus/Amaranthus hypocondriacus mixed library
gb|ADW80593.1|  sucrose synthase 2                                      519   5e-174   Populus tomentosa [Chinese white poplar]
emb|CDX88838.1|  BnaA03g08110D                                          517   5e-174   
gb|ADW80589.1|  sucrose synthase 2                                      519   5e-174   Populus tomentosa [Chinese white poplar]
gb|ADW80575.1|  sucrose synthase 2                                      519   6e-174   Populus tomentosa [Chinese white poplar]
gb|ADW80586.1|  sucrose synthase 2                                      519   6e-174   Populus tomentosa [Chinese white poplar]
gb|ADW80581.1|  sucrose synthase 2                                      519   6e-174   Populus tomentosa [Chinese white poplar]
ref|XP_003609947.1|  Sucrose synthase                                   509   6e-174   
ref|NP_001237525.1|  sucrose synthase                                   519   7e-174   Glycine max [soybeans]
gb|ADW80585.1|  sucrose synthase 2                                      519   7e-174   Populus tomentosa [Chinese white poplar]
gb|ADW80582.1|  sucrose synthase 2                                      519   7e-174   Populus tomentosa [Chinese white poplar]
gb|AAD28641.1|  sucrose synthase                                        519   7e-174   Gossypium hirsutum [American cotton]
gb|ADW80584.1|  sucrose synthase 2                                      519   8e-174   Populus tomentosa [Chinese white poplar]
gb|ADW80599.1|  sucrose synthase 2                                      519   8e-174   Populus tomentosa [Chinese white poplar]
ref|XP_010107074.1|  Sucrose synthase                                   519   8e-174   Morus notabilis
ref|XP_010420928.1|  PREDICTED: sucrose synthase 1-like                 519   8e-174   Camelina sativa [gold-of-pleasure]
emb|CDX70945.1|  BnaC03g10290D                                          519   8e-174   
ref|XP_009131818.1|  PREDICTED: sucrose synthase 1                      519   9e-174   Brassica rapa
ref|XP_008242292.1|  PREDICTED: sucrose synthase                        519   9e-174   Prunus mume [ume]
ref|XP_010493195.1|  PREDICTED: sucrose synthase 1                      518   1e-173   Camelina sativa [gold-of-pleasure]
gb|ADW80602.1|  sucrose synthase 2                                      518   1e-173   Populus tomentosa [Chinese white poplar]
gb|ADW80574.1|  sucrose synthase 2                                      518   1e-173   Populus tomentosa [Chinese white poplar]
ref|XP_010454391.1|  PREDICTED: sucrose synthase 1-like isoform X2      518   1e-173   Camelina sativa [gold-of-pleasure]
gb|ADW80596.1|  sucrose synthase 2                                      518   2e-173   Populus tomentosa [Chinese white poplar]
gb|AIJ28959.1|  sucrose synthase                                        518   2e-173   Manihot esculenta subsp. flabellifolia
gb|AAR03498.1|  sucrose synthase                                        518   2e-173   Populus tremuloides
ref|XP_010454392.1|  PREDICTED: sucrose synthase 1-like isoform X3      518   2e-173   Camelina sativa [gold-of-pleasure]
gb|ADW80603.1|  sucrose synthase 2                                      517   3e-173   Populus tomentosa [Chinese white poplar]
gb|ADW80608.1|  sucrose synthase 2                                      517   3e-173   Populus tomentosa [Chinese white poplar]
ref|XP_003546526.1|  PREDICTED: sucrose synthase-like isoform X1        517   3e-173   
sp|P31926.1|SUSY_VICFA  RecName: Full=Sucrose synthase; AltName: ...    517   3e-173   Vicia faba [broad bean]
gb|ADW80578.1|  sucrose synthase 2                                      517   3e-173   Populus tomentosa [Chinese white poplar]
gb|ADW80579.1|  sucrose synthase 2                                      517   3e-173   Populus tomentosa [Chinese white poplar]
gb|AGM14949.1|  sucrose synthase 4                                      517   3e-173   Hevea brasiliensis [jebe]
gb|ADW80588.1|  sucrose synthase 2                                      517   3e-173   Populus tomentosa [Chinese white poplar]
gb|KHN49081.1|  Sucrose synthase                                        517   3e-173   Glycine soja [wild soybean]
gb|AIJ28962.1|  sucrose synthase                                        517   3e-173   Manihot esculenta [manioc]
gb|ADW80590.1|  sucrose synthase 2                                      517   3e-173   Populus tomentosa [Chinese white poplar]
gb|ADW80577.1|  sucrose synthase 2                                      517   3e-173   Populus tomentosa [Chinese white poplar]
gb|ADW80592.1|  sucrose synthase 2                                      517   3e-173   Populus tomentosa [Chinese white poplar]
gb|ADW80605.1|  sucrose synthase 2                                      517   4e-173   Populus tomentosa [Chinese white poplar]
ref|XP_006400648.1|  hypothetical protein EUTSA_v10012719mg             517   4e-173   Eutrema salsugineum [saltwater cress]
gb|ADW80611.1|  sucrose synthase 2                                      517   4e-173   Populus tomentosa [Chinese white poplar]
gb|ADW80597.1|  sucrose synthase 2                                      517   4e-173   Populus tomentosa [Chinese white poplar]
ref|XP_007138617.1|  hypothetical protein PHAVU_009G223800g             517   5e-173   Phaseolus vulgaris [French bean]
gb|ADW80609.1|  sucrose synthase 2                                      516   5e-173   Populus tomentosa [Chinese white poplar]
ref|XP_010271909.1|  PREDICTED: sucrose synthase                        516   6e-173   Nelumbo nucifera [Indian lotus]
gb|ADW80601.1|  sucrose synthase 2                                      516   6e-173   Populus tomentosa [Chinese white poplar]
gb|ADW80580.1|  sucrose synthase 2                                      516   6e-173   Populus tomentosa [Chinese white poplar]
gb|KGN66333.1|  hypothetical protein Csa_1G597800                       516   7e-173   Cucumis sativus [cucumbers]
ref|XP_010454390.1|  PREDICTED: sucrose synthase 1-like isoform X1      518   8e-173   Camelina sativa [gold-of-pleasure]
ref|XP_004488146.1|  PREDICTED: sucrose synthase-like isoform X6        516   8e-173   
ref|NP_001292638.1|  sucrose synthase                                   516   9e-173   Cucumis sativus [cucumbers]
gb|AGQ57012.1|  sucrose synthase 1                                      516   9e-173   Hevea brasiliensis [jebe]
gb|ADW80604.1|  sucrose synthase 2                                      516   1e-172   Populus tomentosa [Chinese white poplar]
ref|XP_004144053.1|  PREDICTED: sucrose synthase                        516   1e-172   Cucumis sativus [cucumbers]
ref|NP_566865.2|  sucrose synthase 4                                    516   1e-172   Arabidopsis thaliana [mouse-ear cress]
gb|ADW80583.1|  sucrose synthase 2                                      516   1e-172   Populus tomentosa [Chinese white poplar]
gb|ABD61653.1|  sucrose synthase                                        516   1e-172   Cichorium intybus [radicchio]
gb|AGV22112.1|  sucrose synthase 2                                      515   2e-172   Betula luminifera [liang ye hua]
ref|XP_007154543.1|  hypothetical protein PHAVU_003G127500g             515   3e-172   Phaseolus vulgaris [French bean]
dbj|BAM05649.1|  sucrose synthase 3                                     515   3e-172   Eucalyptus globulus subsp. globulus
emb|CAA09910.1|  sucrose synthase                                       514   3e-172   Pisum sativum [garden pea]
gb|ABW76422.1|  sucrose synthase                                        514   3e-172   Populus tremuloides
ref|XP_008382924.1|  PREDICTED: sucrose synthase-like                   514   3e-172   
ref|XP_008349074.1|  PREDICTED: sucrose synthase-like                   514   3e-172   
gb|ACP17902.1|  sucrose synthase                                        514   5e-172   Phaseolus vulgaris [French bean]
ref|XP_002874016.1|  hypothetical protein ARALYDRAFT_910122             514   6e-172   Arabidopsis lyrata subsp. lyrata
ref|XP_002877269.1|  hypothetical protein ARALYDRAFT_484788             514   7e-172   
ref|NP_197583.1|  sucrose synthase 1                                    514   8e-172   Arabidopsis thaliana [mouse-ear cress]
gb|KHN47619.1|  Sucrose synthase                                        514   8e-172   Glycine soja [wild soybean]
ref|XP_003533802.1|  PREDICTED: sucrose synthase-like isoform X1        514   8e-172   Glycine max [soybeans]
gb|ADW80576.1|  sucrose synthase 2                                      513   8e-172   Populus tomentosa [Chinese white poplar]
pdb|3S28|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...    514   8e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008450968.1|  PREDICTED: sucrose synthase                        513   9e-172   Cucumis melo [Oriental melon]
ref|XP_006287059.1|  hypothetical protein CARUB_v10000208mg             514   1e-171   
ref|XP_009348896.1|  PREDICTED: sucrose synthase-like                   513   2e-171   Pyrus x bretschneideri [bai li]
ref|XP_002516210.1|  sucrose synthase, putative                         511   2e-171   
gb|AEK81522.1|  sucrose synthase isoform D                              513   2e-171   Gossypium hirsutum [American cotton]
gb|AII19313.1|  sucrose synthase 1                                      512   4e-171   Ricinus communis
gb|AIL23782.1|  sucrose synthase                                        511   5e-171   Prunus serrulata
gb|ABP88869.1|  sucrose synthase                                        511   6e-171   Medicago falcata [sickle alfalfa]
ref|XP_002275155.1|  PREDICTED: sucrose synthase                        511   7e-171   Vitis vinifera
sp|Q01390.1|SUSY_VIGRR  RecName: Full=Sucrose synthase; AltName: ...    511   7e-171   Vigna radiata var. radiata [golden gram]
dbj|BAA89232.1|  wsus                                                   511   7e-171   Citrullus lanatus [wild melon]
ref|XP_009343357.1|  PREDICTED: sucrose synthase                        511   9e-171   Pyrus x bretschneideri [bai li]
ref|XP_009348897.1|  PREDICTED: sucrose synthase-like                   511   1e-170   Pyrus x bretschneideri [bai li]
dbj|BAM05651.1|  sucrose synthase 3                                     510   1e-170   Eucalyptus pyrocarpa
sp|O65026.1|SUSY_MEDSA  RecName: Full=Sucrose synthase; AltName: ...    510   1e-170   Medicago sativa [alfalfa]
gb|KJB54541.1|  hypothetical protein B456_009G038000                    510   2e-170   Gossypium raimondii
dbj|BAM05650.1|  sucrose synthase 3                                     509   2e-170   Eucalyptus pilularis
dbj|BAH56282.1|  sucrose synthase                                       510   2e-170   Vigna angularis [azuki bean]
gb|KJB54539.1|  hypothetical protein B456_009G038000                    511   3e-170   Gossypium raimondii
emb|CAB40795.1|  sucrose synthase                                       509   4e-170   Medicago truncatula
ref|XP_003609949.1|  Sucrose synthase                                   509   4e-170   Medicago truncatula
emb|CAN82840.1|  hypothetical protein VITISV_024563                     509   5e-170   Vitis vinifera
ref|XP_009359754.1|  PREDICTED: sucrose synthase                        510   5e-170   
ref|NP_001289661.1|  sucrose synthase-like                              508   7e-170   Eucalyptus grandis [rose gum]
gb|AAR19769.1|  sucrose synthase                                        508   8e-170   Beta vulgaris [beet]
ref|XP_010049327.1|  PREDICTED: sucrose synthase-like                   508   9e-170   Eucalyptus grandis [rose gum]
gb|ABE73120.1|  SUS1                                                    498   1e-169   Dianthus caryophyllus [carnation]
ref|XP_004508033.1|  PREDICTED: sucrose synthase-like isoform X1        508   1e-169   
gb|AAN76498.1|AF315375_1  sucrose synthase                              508   1e-169   Phaseolus vulgaris [French bean]
ref|XP_010687574.1|  PREDICTED: sucrose synthase                        508   1e-169   
ref|XP_006474683.1|  PREDICTED: sucrose synthase-like                   506   2e-169   Citrus sinensis [apfelsine]
ref|XP_009343356.1|  PREDICTED: sucrose synthase-like                   507   3e-169   Pyrus x bretschneideri [bai li]
gb|ABY82048.1|  sucrose synthase                                        492   3e-169   Hymenaea courbaril var. stilbocarpa
gb|AAC28107.1|  nodule-enhanced sucrose synthase                        507   4e-169   Pisum sativum [garden pea]
emb|CAC32462.1|  sucrose synthase isoform 3                             506   5e-169   Pisum sativum [garden pea]
emb|CAA57881.1|  sucrose synthase                                       506   6e-169   Oxybasis rubra [pigweed]
gb|AFY03626.1|  sucrose synthase                                        506   6e-169   Eucalyptus globulus [blue gum]
ref|XP_003609946.1|  Sucrose synthase                                   508   8e-169   
ref|XP_008391777.1|  PREDICTED: sucrose synthase-like isoform X1        506   1e-168   
gb|KJB82967.1|  hypothetical protein B456_013G222400                    506   1e-168   Gossypium raimondii
ref|XP_008338289.1|  PREDICTED: sucrose synthase-like                   505   1e-168   
gb|KDO73800.1|  hypothetical protein CISIN_1g003947mg                   504   1e-168   Citrus sinensis [apfelsine]
ref|XP_008391788.1|  PREDICTED: sucrose synthase-like isoform X2        505   1e-168   
emb|CAA50317.1|  sucrose synthase                                       505   2e-168   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006452875.1|  hypothetical protein CICLE_v10010343mg             504   2e-168   
gb|AFM52233.1|  putative sucrose synthase 2                             503   5e-168   Gossypium arboreum [tree cotton]
dbj|BAD94975.1|  sucrose-UDP glucosyltransferase                        484   9e-168   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004488141.1|  PREDICTED: sucrose synthase-like isoform X1        503   1e-167   
gb|KJB07349.1|  hypothetical protein B456_001G017700                    501   7e-167   Gossypium raimondii
dbj|BAM05652.1|  sucrose synthase 3                                     500   1e-166   Eucalyptus globulus subsp. globulus
gb|AEV40461.1|  sucrose synthase 2                                      498   1e-166   Gossypium arboreum [tree cotton]
gb|AFY03625.1|  sucrose synthase                                        489   2e-166   Eucalyptus globulus [blue gum]
ref|XP_010051346.1|  PREDICTED: sucrose synthase-like                   498   8e-166   Eucalyptus grandis [rose gum]
ref|XP_004243680.1|  PREDICTED: sucrose synthase-like                   498   1e-165   Solanum lycopersicum
dbj|BAJ10424.1|  sucrose synthase                                       498   1e-165   Dianthus caryophyllus [carnation]
dbj|BAM05645.1|  sucrose synthase 1                                     497   1e-165   Eucalyptus pilularis
ref|XP_004287544.1|  PREDICTED: sucrose synthase-like                   496   2e-165   Fragaria vesca subsp. vesca
gb|KCW81848.1|  hypothetical protein EUGRSUZ_C03199                     497   3e-165   Eucalyptus grandis [rose gum]
sp|P49034.1|SUSY_ALNGL  RecName: Full=Sucrose synthase; AltName: ...    496   6e-165   Alnus glutinosa
pdb|3S27|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...    496   1e-164   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009789193.1|  PREDICTED: sucrose synthase-like                   494   2e-164   Nicotiana sylvestris
ref|XP_006353767.1|  PREDICTED: sucrose synthase-like                   494   3e-164   Solanum tuberosum [potatoes]
ref|XP_009625445.1|  PREDICTED: sucrose synthase-like                   494   4e-164   Nicotiana tomentosiformis
ref|XP_010937277.1|  PREDICTED: sucrose synthase 2-like                 493   8e-164   Elaeis guineensis
ref|XP_008783137.1|  PREDICTED: sucrose synthase 1-like isoform X2      492   3e-163   Phoenix dactylifera
ref|XP_008783129.1|  PREDICTED: sucrose synthase 1-like isoform X1      492   3e-163   Phoenix dactylifera
dbj|BAM05648.1|  sucrose synthase 1                                     490   6e-163   
ref|XP_008800466.1|  PREDICTED: sucrose synthase 2                      491   6e-163   
ref|XP_007012551.1|  Sucrose synthase 4                                 490   1e-162   
gb|AEK79901.1|  sucrose synthase isoform C                              488   4e-162   
ref|XP_008797380.1|  PREDICTED: sucrose synthase 1-like isoform X2      489   5e-162   
ref|XP_008783098.1|  PREDICTED: sucrose synthase 1                      489   6e-162   
ref|XP_010917399.1|  PREDICTED: sucrose synthase 1-like                 488   6e-162   
gb|AFW88069.1|  sucrose synthase1                                       473   8e-162   
sp|Q41608.1|SUS1_TULGE  RecName: Full=Sucrose synthase 1; AltName...    488   9e-162   
gb|AEK79898.1|  sucrose synthase isoform C                              487   1e-161   
gb|KHG07698.1|  Sucrose synthase                                        487   2e-161   
gb|AEK79906.1|  sucrose synthase isoform C                              487   2e-161   
gb|AEK79900.1|  sucrose synthase isoform C                              487   2e-161   
gb|AEK79903.1|  sucrose synthase isoform C                              486   2e-161   
ref|XP_010939862.1|  PREDICTED: sucrose synthase 1                      487   2e-161   
gb|AEK79904.1|  sucrose synthase isoform C                              486   3e-161   
gb|AEK79907.1|  sucrose synthase isoform C                              486   3e-161   
ref|XP_008797379.1|  PREDICTED: sucrose synthase 1-like isoform X1      488   6e-161   
gb|AAM95944.1|  sucrose synthase                                        486   7e-161   
gb|AEK79899.1|  sucrose synthase isoform C                              485   9e-161   
gb|ADY02961.1|  sucrose synthase                                        485   1e-160   
gb|AEK81521.1|  sucrose synthase isoform C                              484   2e-160   
gb|AEK79902.1|  sucrose synthase isoform C                              484   2e-160   
gb|ACN36258.1|  unknown                                                 473   7e-160   
ref|NP_001050319.1|  Os03g0401300                                       479   4e-158   
gb|EAY90371.1|  hypothetical protein OsI_11950                          479   4e-158   
ref|XP_009404100.1|  PREDICTED: sucrose synthase 2                      478   5e-158   
gb|AHM02468.1|  sucrose synthase                                        478   5e-158   
gb|EMT06653.1|  Sucrose synthase 1                                      478   7e-158   
ref|XP_009410254.1|  PREDICTED: sucrose synthase 1-like                 478   7e-158   
ref|XP_010932355.1|  PREDICTED: sucrose synthase 2-like isoform X2      476   1e-157   
gb|AAL50570.1|AF412037_1  sucrose synthase                              478   1e-157   
ref|XP_003557752.1|  PREDICTED: sucrose synthase 1                      477   2e-157   
ref|XP_003562658.1|  PREDICTED: sucrose synthase 2                      477   2e-157   
dbj|BAE06059.1|  sucrose synthase                                       478   2e-157   
ref|XP_010932353.1|  PREDICTED: sucrose synthase 1-like isoform X1      477   2e-157   
gb|EMS66266.1|  Sucrose synthase 1                                      476   3e-157   
dbj|BAK02964.1|  predicted protein                                      476   4e-157   
gb|AAV64256.2|  sucrose synthase                                        476   7e-157   
sp|Q41607.1|SUS2_TULGE  RecName: Full=Sucrose synthase 2; AltName...    475   9e-157   
ref|XP_009390318.1|  PREDICTED: sucrose synthase 2-like                 475   9e-157   
gb|EMS65561.1|  Sucrose synthase 2                                      474   3e-156   
pir||S24966  sucrose synthase (EC 2.4.1.13) - barley (fragment)         466   4e-156
ref|XP_006650177.1|  PREDICTED: sucrose synthase 1-like isoform X2      474   4e-156   
tpg|DAA45273.1|  TPA: putative sucrose synthase family protein          459   4e-156   
ref|XP_008659017.1|  PREDICTED: sucrose synthase 2 isoform X1           473   4e-156   
gb|AIL88516.1|  sucrose synthase type 2-1                               473   5e-156   
ref|XP_004984086.1|  PREDICTED: sucrose synthase 2-like                 473   5e-156   
ref|XP_002465161.1|  hypothetical protein SORBIDRAFT_01g033060          473   7e-156   
ref|XP_003564156.1|  PREDICTED: sucrose synthase 1                      472   1e-155   
ref|XP_006657957.1|  PREDICTED: sucrose synthase 3-like                 472   2e-155   
gb|EAZ04713.1|  hypothetical protein OsI_26874                          472   2e-155   
ref|XP_009380139.1|  PREDICTED: sucrose synthase 2-like                 472   2e-155   
gb|AGI56230.1|  sucrose synthase 1                                      472   2e-155   
gb|ACM69042.1|  sucrose synthase                                        471   2e-155   
gb|AIL88517.1|  sucrose synthase type 2-2                               471   3e-155   
ref|NP_001105323.1|  sucrose synthase 2                                 471   3e-155   
gb|AEA76429.1|  sucrose synthase 1                                      471   3e-155   
gb|AIO11845.1|  sucrose synthase                                        471   3e-155   
emb|CAA03935.1|  sucrose synthase type 2                                471   5e-155   
ref|NP_001060278.1|  Os07g0616800                                       471   6e-155   
gb|AAC41682.1|  sucrose synthase 3                                      471   6e-155   
gb|AAL50572.2|AF412039_1  sucrose synthase                              470   6e-155   
gb|AAA68209.1|  sus1                                                    470   8e-155   
gb|AAL50571.1|AF412038_1  sucrose synthase                              470   9e-155   
ref|XP_010685729.1|  PREDICTED: sucrose synthase-like                   469   1e-154   
ref|XP_004964611.1|  PREDICTED: sucrose synthase 1-like                 469   1e-154   
gb|AEX98033.1|  sucrose synthase                                        469   1e-154   
ref|XP_008659019.1|  PREDICTED: sucrose synthase 1 isoform X1           469   2e-154   
gb|AEO09338.2|  sucrose synthase                                        469   2e-154   
gb|AAM95943.1|  sucrose synthase                                        469   2e-154   
ref|NP_001105411.1|  sucrose synthase 1                                 469   2e-154   
tpg|DAA45279.1|  TPA: putative sucrose synthase family protein          456   2e-154   
ref|XP_009390882.1|  PREDICTED: sucrose synthase 2-like                 469   3e-154   
sp|P31923.1|SUS2_HORVU  RecName: Full=Sucrose synthase 2; AltName...    469   3e-154   
gb|AGW23638.1|  sucrose synthase                                        469   8e-154   
emb|CAZ64535.1|  sucrose synthase                                       468   8e-154   
gb|ACF78506.1|  unknown                                                 459   9e-154   
ref|XP_006655877.1|  PREDICTED: sucrose synthase 2-like                 467   1e-153   
dbj|BAJ99820.1|  predicted protein                                      467   1e-153   
sp|P31922.1|SUS1_HORVU  RecName: Full=Sucrose synthase 1; AltName...    467   1e-153   
gb|AAF85966.1|AF263384_1  sucrose synthase-2                            466   2e-153   
gb|AAM68126.1|  sucrose synthase                                        466   2e-153   
ref|NP_001266691.1|  sucrose synthase 1                                 466   3e-153   
ref|XP_010051398.1|  PREDICTED: sucrose synthase-like                   462   6e-153   
gb|ABK78799.1|  putative sucrose synthase                               462   2e-152   
gb|ABK78796.1|  putative sucrose synthase                               463   2e-152   
gb|ABK78782.1|  putative sucrose synthase                               463   2e-152   
gb|ABK78803.1|  putative sucrose synthase                               462   2e-152   
gb|ABK78797.1|  putative sucrose synthase                               462   2e-152   
gb|ABK78781.1|  putative sucrose synthase                               462   3e-152   
gb|ABK78792.1|  putative sucrose synthase                               462   3e-152   
gb|ABK78798.1|  putative sucrose synthase                               462   3e-152   
gb|ABK78793.1|  putative sucrose synthase                               462   3e-152   
gb|ABL74568.1|  sucrose synthase 2                                      463   4e-152   
gb|EAZ00002.1|  hypothetical protein OsI_22003                          462   6e-152   
ref|NP_001057047.1|  Os06g0194900                                       462   6e-152   
ref|XP_006489034.1|  PREDICTED: sucrose synthase 2-like isoform X2      461   6e-152   
ref|XP_006419508.1|  hypothetical protein CICLE_v10004341mg             462   6e-152   
gb|KDO71750.1|  hypothetical protein CISIN_1g003726mg                   462   7e-152   
emb|CAA78747.1|  sucrose synthase                                       462   8e-152   
ref|XP_009352312.1|  PREDICTED: sucrose synthase 2-like                 461   2e-151   
dbj|BAM75184.1|  sucrose synthase                                       444   3e-151   
gb|ABR15470.1|  sucrose synthase                                        461   3e-151   
gb|EMT33394.1|  Sucrose synthase 1                                      461   3e-151   
ref|XP_006838088.1|  PREDICTED: sucrose synthase 2                      461   4e-151   
emb|CAL25362.2|  sucrose synthase                                       461   4e-151   
ref|XP_002465303.1|  hypothetical protein SORBIDRAFT_01g035890          460   7e-151   
gb|ABF95854.1|  Sucrose synthase 2, putative, expressed                 454   1e-150   
ref|XP_008655408.1|  PREDICTED: sucrose synthase 4-like                 459   2e-150   
gb|KDO87158.1|  hypothetical protein CISIN_1g003492mg                   453   2e-150   
ref|XP_007225257.1|  hypothetical protein PRUPE_ppa001573mg             458   2e-150   
gb|AFW85479.1|  shrunken1                                               460   2e-150   
ref|NP_001105194.1|  sucrose synthase2                                  458   3e-150   
gb|KCW67227.1|  hypothetical protein EUGRSUZ_F01010                     449   4e-150   
gb|KDO87153.1|  hypothetical protein CISIN_1g003492mg                   454   4e-150   
gb|AFW85475.1|  shrunken1 isoform 1                                     460   4e-150   
gb|AJA37527.1|  sucrose synthase                                        457   7e-150   
gb|EMS59092.1|  Sucrose synthase 1                                      457   8e-150   
ref|XP_006444401.1|  hypothetical protein CICLE_v10018889mg             452   9e-150   
gb|AEX32875.1|  sucrose synthase 2                                      457   1e-149   
ref|XP_009610442.1|  PREDICTED: sucrose synthase 4-like                 440   1e-149   
dbj|BAE06058.1|  sucrose synthase                                       457   1e-149   
ref|XP_010088307.1|  Sucrose synthase 2                                 453   2e-149   
gb|AGV22111.1|  sucrose synthase 1                                      456   2e-149   
tpg|DAA45281.1|  TPA: putative sucrose synthase family protein          455   4e-149   
ref|XP_007200961.1|  hypothetical protein PRUPE_ppa002723mg             450   4e-149   
ref|XP_006651359.1|  PREDICTED: sucrose synthase 4-like                 455   8e-149   
emb|CAA04543.1|  sucrose synthase type I                                454   9e-149   
gb|AAL27096.1|  sucrose synthase                                        454   9e-149   
ref|NP_001050064.1|  Os03g0340500                                       454   1e-148   
dbj|BAA88904.1|  sucrose synthase                                       454   1e-148   
ref|XP_006480003.1|  PREDICTED: sucrose synthase 3-like                 454   1e-148   
ref|XP_010049329.1|  PREDICTED: sucrose synthase-like                   455   1e-148   
gb|KDO87151.1|  hypothetical protein CISIN_1g003492mg                   454   1e-148   
ref|XP_007035651.1|  Sucrose synthase 2 isoform 1                       453   2e-148   
gb|AIO11846.1|  sucrose synthase                                        453   2e-148   
ref|XP_002516963.1|  sucrose synthase, putative                         452   3e-148   
sp|O24301.1|SUS2_PEA  RecName: Full=Sucrose synthase 2; AltName: ...    452   4e-148   
ref|XP_006444402.1|  hypothetical protein CICLE_v10018889mg             452   5e-148   
gb|AJW82917.1|  sucrose synthase                                        452   5e-148   
ref|XP_008351185.1|  PREDICTED: sucrose synthase 2-like                 452   7e-148   
ref|XP_010092252.1|  Sucrose synthase 2                                 452   8e-148   
gb|KJB24380.1|  hypothetical protein B456_004G142700                    446   9e-148   
gb|KCW81856.1|  hypothetical protein EUGRSUZ_C03207                     451   1e-147   
ref|XP_004984440.1|  PREDICTED: sucrose synthase 4-like                 451   1e-147   
gb|AEN71096.1|  sucrose synthase SusA1                                  451   2e-147   
gb|AGQ57013.1|  sucrose synthase 2                                      451   2e-147   
gb|AGM14947.1|  sucrose synthase 2                                      451   2e-147   
gb|AEN71094.1|  sucrose synthase SusA1                                  451   2e-147   
gb|AEN71090.1|  sucrose synthase SusA1                                  451   2e-147   
ref|XP_012082813.1|  PREDICTED: sucrose synthase 2                      451   2e-147   
ref|XP_010921619.1|  PREDICTED: sucrose synthase 4                      450   4e-147   
gb|AEN71085.1|  sucrose synthase SusA1                                  450   5e-147   
gb|AEN71088.1|  sucrose synthase SusA1                                  450   5e-147   
gb|AEN71101.1|  sucrose synthase SusA1                                  450   5e-147   
ref|XP_003557951.1|  PREDICTED: sucrose synthase 4                      450   5e-147   
gb|AEN71083.1|  sucrose synthase SusA1                                  450   5e-147   
gb|AEN71092.1|  sucrose synthase SusA1                                  450   5e-147   
gb|AEN71103.1|  sucrose synthase SusA1                                  450   5e-147   
ref|XP_004494391.1|  PREDICTED: sucrose synthase 2-like isoform X2      450   5e-147   
gb|AEN71084.1|  sucrose synthase SusA1                                  450   5e-147   
gb|AEZ00746.1|  SusA1                                                   450   6e-147   
gb|AEV40896.1|  sucrose synthase                                        450   6e-147   
gb|AEN71106.1|  sucrose synthase SusA1                                  450   6e-147   
gb|AEN71105.1|  sucrose synthase SusA1                                  450   6e-147   
gb|AEN71104.1|  sucrose synthase SusA1                                  450   6e-147   
gb|AEN71089.1|  sucrose synthase SusA1                                  450   6e-147   
gb|AEZ00745.1|  SusA1                                                   449   6e-147   
gb|AEN71091.1|  sucrose synthase SusA1                                  449   7e-147   
gb|AIS75087.1|  sus1                                                    450   7e-147   
gb|KCW58409.1|  hypothetical protein EUGRSUZ_H01094                     444   7e-147   
gb|AEN71099.1|  sucrose synthase SusA1                                  449   8e-147   
ref|XP_008235123.1|  PREDICTED: sucrose synthase 3                      449   9e-147   
gb|AFM52237.1|  putative sucrose synthase 6                             449   1e-146   
gb|AEN71086.1|  sucrose synthase SusA1                                  449   1e-146   
gb|AJW82918.1|  sucrose synthase                                        449   2e-146   
gb|AEN71087.1|  sucrose synthase SusA1                                  448   2e-146   
dbj|BAA88981.1|  sucrose synthase                                       448   2e-146   
dbj|BAE79815.1|  sucrose synthase                                       450   2e-146   
gb|AEN71093.1|  sucrose synthase SusA1                                  448   2e-146   
ref|XP_008223243.1|  PREDICTED: sucrose synthase 2-like                 448   3e-146   
tpg|DAA45272.1|  TPA: putative sucrose synthase family protein          429   3e-146   
gb|KDO87150.1|  hypothetical protein CISIN_1g003492mg                   447   5e-146   
ref|NP_001268888.1|  sucrose synthase 2-like                            447   6e-146   
emb|CDX86250.1|  BnaA06g29670D                                          446   6e-146   
gb|AEV40895.1|  sucrose synthase                                        447   6e-146   
gb|KJB24379.1|  hypothetical protein B456_004G142700                    447   6e-146   
gb|AEV40893.1|  sucrose synthase                                        447   7e-146   
ref|XP_002271530.1|  PREDICTED: sucrose synthase 2                      446   1e-145   
gb|ABF50715.1|  sucrose synthase                                        446   1e-145   
ref|XP_010938368.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    446   2e-145   
gb|KGN52828.1|  hypothetical protein Csa_4G001950                       446   2e-145   
ref|XP_007225235.1|  hypothetical protein PRUPE_ppa001845mg             444   2e-145   
ref|XP_008454320.1|  PREDICTED: sucrose synthase 2                      446   2e-145   
gb|KEH24408.1|  sucrose synthase                                        446   3e-145   
ref|XP_012083986.1|  PREDICTED: sucrose synthase 2-like isoform X2      445   4e-145   
ref|XP_010069893.1|  PREDICTED: sucrose synthase 2                      445   4e-145   
gb|AIL88515.1|  sucrose synthase type 3                                 445   4e-145   
gb|KDO87154.1|  hypothetical protein CISIN_1g003492mg                   445   4e-145   
ref|XP_007163138.1|  hypothetical protein PHAVU_001G209600g             444   6e-145   
ref|XP_009151715.1|  PREDICTED: sucrose synthase 2                      444   6e-145   
ref|XP_004495938.1|  PREDICTED: sucrose synthase 2-like                 444   7e-145   
gb|AFP23359.1|  sucrose synthase                                        444   8e-145   
ref|XP_010556726.1|  PREDICTED: sucrose synthase 3                      444   8e-145   
ref|XP_002865717.1|  hypothetical protein ARALYDRAFT_494980             444   8e-145   
ref|XP_011462741.1|  PREDICTED: sucrose synthase 2                      444   9e-145   
ref|XP_010259474.1|  PREDICTED: sucrose synthase 4-like                 445   9e-145   
ref|XP_002523115.1|  sucrose synthase, putative                         442   1e-144   
ref|XP_002271896.1|  PREDICTED: sucrose synthase 2                      443   2e-144   
gb|AEV40894.1|  sucrose synthase                                        443   2e-144   
ref|XP_007050984.1|  Sucrose synthase 3 isoform 1                       444   2e-144   
ref|XP_010269598.1|  PREDICTED: sucrose synthase 2-like                 443   2e-144   
emb|CDX85398.1|  BnaC07g27090D                                          443   2e-144   
ref|XP_004494390.1|  PREDICTED: sucrose synthase 2-like isoform X1      443   3e-144   
emb|CAZ65725.1|  sucrose synthase                                       442   3e-144   
gb|AGM14950.1|  sucrose synthase 5                                      442   3e-144   
ref|NP_001280838.1|  sucrose synthase 3                                 442   5e-144   
ref|XP_010429475.1|  PREDICTED: sucrose synthase 3                      442   8e-144   
ref|XP_010456053.1|  PREDICTED: sucrose synthase 3-like                 441   9e-144   
ref|XP_003521575.1|  PREDICTED: sucrose synthase 2-like                 441   1e-143   



>ref|XP_009625446.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/291 (92%), Positives = 284/291 (98%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADMNLYFPY EKEKRLT+YHPEIE+LL+SDVEN+EH+CVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADMNLYFPYFEKEKRLTAYHPEIEELLFSDVENDEHMCVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE YAK+P+LRELVNLVVVGGDRRKESKD+EEQAEMKKMYELIKT+
Sbjct  575   TMARLDRVKNLTGLVELYAKNPRLRELVNLVVVGGDRRKESKDLEEQAEMKKMYELIKTH  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAMTCGLPTFATNH
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELL DFFE+CKK+PSHWE IS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLADFFERCKKEPSHWEAISEGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  755   IYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEAVPLAVE  805



>ref|XP_009792656.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/291 (92%), Positives = 284/291 (98%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADMNLYFPY EKEKRLT+YHPEIE+LL+SDVEN+EH+CVLK+R+KPI+F
Sbjct  515   FDPKFNIVSPGADMNLYFPYYEKEKRLTAYHPEIEELLFSDVENDEHMCVLKNRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE YAK+P+LRELVNLVVVGGDRRKESKD+EEQAEMKKMYELIKT+
Sbjct  575   TMARLDRVKNLTGLVELYAKNPQLRELVNLVVVGGDRRKESKDLEEQAEMKKMYELIKTH  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAMTCGLPTFATNH
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAAELL DFFEKCKK+PSHWE IS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDQAAELLADFFEKCKKEPSHWEAISEGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  755   IYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEAVPLAVE  805



>ref|NP_001274911.1| sucrose synthase 2 [Solanum tuberosum]
 gb|AAO34668.1| sucrose synthase 2 [Solanum tuberosum]
Length=805

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/291 (91%), Positives = 283/291 (97%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+NLYFPYSEKEKRLT++HPEIEDLL+SDVENEEHLCVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADVNLYFPYSEKEKRLTTFHPEIEDLLFSDVENEEHLCVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+YAK+P+LRELVNLVVVGGDRRKESKD+EEQAEMKKMYELIKT+
Sbjct  575   TMARLDRVKNLTGLVEWYAKNPRLRELVNLVVVGGDRRKESKDLEEQAEMKKMYELIKTH  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAM+CGLPTFATN 
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMSCGLPTFATNQ  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF IDPYHGEQAA+LL DFFEKCK DPSHWE IS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFQIDPYHGEQAADLLADFFEKCKVDPSHWEAISEGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ VPLA+E
Sbjct  755   IYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAQLVPLAVE  805



>sp|P49039.1|SUS2_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS65; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA97572.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/291 (91%), Positives = 283/291 (97%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+NLYFPYSEKEKRLT++HPEIEDLL+SDVENEEHLCVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADVNLYFPYSEKEKRLTTFHPEIEDLLFSDVENEEHLCVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+YAK+P+LRELVNLVVVGGDRRKESKD+EEQAEMKKMYELIKT+
Sbjct  575   TMARLDRVKNLTGLVEWYAKNPRLRELVNLVVVGGDRRKESKDLEEQAEMKKMYELIKTH  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAM+CGLPTFATN 
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMSCGLPTFATNQ  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF IDPYHGEQAA+LL DFFEKCK DPSHWE IS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFQIDPYHGEQAADLLADFFEKCKVDPSHWEAISEGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ VPLA+E
Sbjct  755   IYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAQLVPLAVE  805



>ref|XP_010323602.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323603.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323604.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323605.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 gb|ADM47608.1| sucrose synthase isoform 3 [Solanum lycopersicum]
Length=805

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/291 (91%), Positives = 283/291 (97%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+NLYFPYSEKEKRLT++HPEIEDLL+SDVENEEHLCVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADVNLYFPYSEKEKRLTTFHPEIEDLLFSDVENEEHLCVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+YAK+P+LRELVNLVVVGGDRRKESKD+EEQAEMKKMYELIKT+
Sbjct  575   TMARLDRVKNLTGLVEWYAKNPRLRELVNLVVVGGDRRKESKDLEEQAEMKKMYELIKTH  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAM+CGLPTFATN 
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMSCGLPTFATNQ  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF IDPYHGEQAA+LL +FFEKCK DPSHWE IS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFQIDPYHGEQAADLLAEFFEKCKVDPSHWEAISKGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  755   IYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAELVPLAVE  805



>ref|NP_001234804.1| sucrose synthase [Solanum lycopersicum]
 emb|CAA09593.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/291 (91%), Positives = 283/291 (97%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+NLYFPYSEKEKRLT++HPEIEDLL+SDVENEEHLCVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADVNLYFPYSEKEKRLTTFHPEIEDLLFSDVENEEHLCVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+YAK+P+LRELVNLVVVGGDRRKESKD+EEQAEMKKMYELIKT+
Sbjct  575   TMARLDRVKNLTGLVEWYAKNPRLRELVNLVVVGGDRRKESKDLEEQAEMKKMYELIKTH  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAM+CGLPTFATN 
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMSCGLPTFATNQ  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF IDPYHGEQAA+LL +FFEKCK DPSHWE IS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFQIDPYHGEQAADLLAEFFEKCKVDPSHWEAISKGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  755   IYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAELVPLAVE  805



>gb|AHL84158.1| sucrose synthase [Nicotiana tabacum]
Length=805

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/291 (91%), Positives = 283/291 (97%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+NLYFPYSEKEKRLT+ HPEIE+LLYSD+ENEEHLCVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADINLYFPYSEKEKRLTALHPEIEELLYSDIENEEHLCVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE YAK+P+LRELVNLVVVGGDRRKESKD+EEQAEMKKMYELIKT+
Sbjct  575   TMARLDRVKNLTGLVELYAKNPRLRELVNLVVVGGDRRKESKDLEEQAEMKKMYELIKTH  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAMTCGLPTFATNH
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSGFHIDPYHGEQAA+LL DFFEKCK +PSHWETIS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVNGKSGFHIDPYHGEQAADLLADFFEKCKTEPSHWETISTGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTLA+VYGFWKHVSKLDRLEIRRYL+MFYALK+RK+AE VPLA E
Sbjct  755   IYSERLLTLAAVYGFWKHVSKLDRLEIRRYLDMFYALKYRKMAEAVPLAAE  805



>ref|XP_011093886.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093887.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093888.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093889.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093890.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/291 (92%), Positives = 280/291 (96%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADMNLYFPY+EKEKRLT++HPEIE+LLYSDVENEEHLCVLKD+ KPILF
Sbjct  515   FDPKFNIVSPGADMNLYFPYTEKEKRLTAFHPEIEELLYSDVENEEHLCVLKDKKKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE YAKSPKLRELVNLVVVGGDRRKESKD+EEQAEMKKMY LI+TY
Sbjct  575   TMARLDRVKNLTGLVELYAKSPKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAMTCGLPTFAT H
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATLH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPY+GEQ AE+LVDFFEKCK DPSHWETISAGGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYNGEQVAEVLVDFFEKCKHDPSHWETISAGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTLA VYGFWK+VSKLDR EIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  755   IYSDRLLTLAGVYGFWKYVSKLDRREIRRYLEMFYALKFRKLAEAVPLAVE  805



>ref|XP_006353766.1| PREDICTED: sucrose synthase 2 isoform X2 [Solanum tuberosum]
Length=805

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/291 (91%), Positives = 283/291 (97%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+NLYFPYSEKEKRLT++HPEIEDLL+SDVENEEHLCVLK+R+KPI+F
Sbjct  515   FDPKFNIVSPGADVNLYFPYSEKEKRLTTFHPEIEDLLFSDVENEEHLCVLKNRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+YAK+P+LRELVNLVVVGGDRRKESKD+EEQAEMKKMYELIKT+
Sbjct  575   TMARLDRVKNLTGLVEWYAKNPRLRELVNLVVVGGDRRKESKDLEEQAEMKKMYELIKTH  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAM+CGLPTFATN 
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMSCGLPTFATNQ  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF IDPYHGEQAA+LL DFFEKCK DPSHWE IS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFQIDPYHGEQAADLLADFFEKCKVDPSHWEAISEGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ VPLA+E
Sbjct  755   IYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAQLVPLAVE  805



>ref|NP_001234655.1| sucrose synthase [Solanum lycopersicum]
 sp|P49037.1|SUSY_SOLLC RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Solanum lycopersicum]
 gb|AAA34196.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/291 (91%), Positives = 284/291 (98%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+NLYFPYSE EKRLT++HPEI++LLYSDVEN+EHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADINLYFPYSESEKRLTAFHPEIDELLYSDVENDEHLCVLKDRTKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+YAK+P+LR LVNLVVVGGDRRKESKD+EEQAEMKKMYELI+T+
Sbjct  575   TMARLDRVKNLTGLVEWYAKNPRLRGLVNLVVVGGDRRKESKDLEEQAEMKKMYELIETH  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKK+PSHWETIS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKEPSHWETISTGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  755   IYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>gb|ABV02029.1| sucrose sythase [Nicotiana langsdorffii x Nicotiana sanderae]
Length=805

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/291 (91%), Positives = 283/291 (97%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+NLYFPYSEKEKRLT+ HPEIE+LLYSDVENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADINLYFPYSEKEKRLTALHPEIEELLYSDVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+YAK+ +LRELVNLVVVGGDRRKESKD+EEQAEMKKMYELIKT+
Sbjct  575   TMARLDRVKNLTGLVEWYAKNARLRELVNLVVVGGDRRKESKDLEEQAEMKKMYELIKTH  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAMTCGLPTFATNH
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSGFHIDPYHGEQAA+LL DFFEKCK +PSHWETIS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVNGKSGFHIDPYHGEQAADLLADFFEKCKTEPSHWETISTGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  755   IYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>emb|CAA09681.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/291 (91%), Positives = 284/291 (98%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+NLYFPYSE EKRLT++HPEI++LLYSDVEN++HLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADINLYFPYSESEKRLTAFHPEIDELLYSDVENDDHLCVLKDRTKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+YAK+P+LR LVNLVVVGGDRRKESKD+EEQAEMKKMYELI+T+
Sbjct  575   TMARLDRVKNLTGLVEWYAKNPRLRGLVNLVVVGGDRRKESKDLEEQAEMKKMYELIETH  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKK+PSHWETIS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKEPSHWETISTGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  755   IYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>ref|XP_011078145.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078146.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078147.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078148.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/291 (92%), Positives = 279/291 (96%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADMNLYFPY+EKEKRLTSYHPEIE+LL+SDVENEEHLCVLKD+ KPILF
Sbjct  515   FDPKFNIVSPGADMNLYFPYTEKEKRLTSYHPEIEELLFSDVENEEHLCVLKDKKKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE YAK+PKLRELVNLVVVGGDRRKESKD+EEQAEMKKMY LI+TY
Sbjct  575   TMARLDRVKNLTGLVELYAKNPKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI D KGAFVQPAFYEAFGLTVVEAMTCGLPTFAT H
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADMKGAFVQPAFYEAFGLTVVEAMTCGLPTFATVH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPY+GEQ AE LV+FFEKCKKDPSHWETISAGGLKRI EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYNGEQVAETLVNFFEKCKKDPSHWETISAGGLKRIMEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTLA VYGFWK+VSKLDRLEIRRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSDRLLTLAGVYGFWKYVSKLDRLEIRRYLEMFYALKYRKLAEAVPLAAE  805



>ref|NP_001275286.1| sucrose synthase [Solanum tuberosum]
 emb|CAD61188.1| sucrose synthase 4 [Solanum tuberosum]
Length=805

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/291 (91%), Positives = 283/291 (97%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+NLYF YSE EKRLT++HPEI++LLYSDVEN+EHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADINLYFSYSETEKRLTAFHPEIDELLYSDVENDEHLCVLKDRTKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+YAK+P+LR LVNLVVVGGDRRKESKD+EEQAEMKKMYELI+T+
Sbjct  575   TMARLDRVKNLTGLVEWYAKNPRLRGLVNLVVVGGDRRKESKDLEEQAEMKKMYELIETH  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKK+PSHWETIS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKEPSHWETISTGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  755   IYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>ref|XP_006345244.1| PREDICTED: uncharacterized LOC102577594 [Solanum tuberosum]
Length=805

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/291 (91%), Positives = 283/291 (97%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+NLYF YSE EKRLT++HPEI++LLYSDVEN+EHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADINLYFSYSETEKRLTAFHPEIDELLYSDVENDEHLCVLKDRTKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+YAK+P+LR LVNLVVVGGDRRKESKD+EEQAEMKKMYELI+T+
Sbjct  575   TMARLDRVKNLTGLVEWYAKNPRLRGLVNLVVVGGDRRKESKDLEEQAEMKKMYELIETH  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKKDPSHWETIS GGLKRI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKDPSHWETISMGGLKRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  755   IYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>ref|XP_009760458.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
 ref|XP_009760459.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/291 (91%), Positives = 282/291 (97%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+NLYFPYSEKEKRLT+ HPEIE+LLYSDVENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADINLYFPYSEKEKRLTALHPEIEELLYSDVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+YAK+ +LRELVNLVVVGGDRRKESKD+EEQAEMKKMYELIKT+
Sbjct  575   TMARLDRVKNLTGLVEWYAKNARLRELVNLVVVGGDRRKESKDLEEQAEMKKMYELIKTH  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAMTCGLPTFATNH
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSGFHIDPYHGEQAA+LL DFFEKCK +P HWETIS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVNGKSGFHIDPYHGEQAADLLADFFEKCKTEPYHWETISTGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  755   IYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>gb|AAA97571.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/291 (90%), Positives = 283/291 (97%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+NLYF YSE EKRLT++HPEI++LLYSDVEN+EHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADINLYFSYSETEKRLTAFHPEIDELLYSDVENDEHLCVLKDRTKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+YAK+P+LR LVNLVVVGGDRRKESKD+EEQAEMKKMYELI+T+
Sbjct  575   TMARLDRVKNLTGLVEWYAKNPRLRGLVNLVVVGGDRRKESKDLEEQAEMKKMYELIETH  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCK++PSHWETIS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKREPSHWETISTGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  755   IYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>sp|P10691.1|SUS1_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS16; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA33841.1| sucrase synthase (EC 2.4.1.13) [Solanum tuberosum]
Length=805

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/291 (90%), Positives = 282/291 (97%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+NLYF YSE EKRLT++HPEI++LLYSDVEN+EHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADINLYFSYSETEKRLTAFHPEIDELLYSDVENDEHLCVLKDRTKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+YAK+P+LR LVNLVVVGGDRRKESKD+EEQAEMKKMYELI+T+
Sbjct  575   TMARLDRVKNLTGLVEWYAKNPRLRGLVNLVVVGGDRRKESKDLEEQAEMKKMYELIETH  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKKDPSHWETIS GGLKRI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKDPSHWETISMGGLKRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+ LLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  755   IYSESLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>ref|XP_009589756.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
 ref|XP_009589757.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/291 (90%), Positives = 280/291 (96%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+NLYFPYSEKEKRLT+ HPEIE+LLYSD+ENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADINLYFPYSEKEKRLTALHPEIEELLYSDIENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+YAK+ +LRELVNLVVVGGDRRKESKD+EEQ EMKKMYELIKT+
Sbjct  575   TMARLDRVKNLTGLVEWYAKNARLRELVNLVVVGGDRRKESKDLEEQTEMKKMYELIKTH  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI  T+GAFVQPAFYEAFGLTVVEAMTCGLPTFATNH
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIAGTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSGFHIDPYHGEQAA+LL DFFEKCK  PSHWETIS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVNGKSGFHIDPYHGEQAADLLADFFEKCKTQPSHWETISTGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  755   IYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>emb|CAJ32596.1| sucrose synthase [Coffea arabica]
Length=806

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/291 (89%), Positives = 280/291 (96%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD NLYFP++EKEKRLTS+HPEIE+LL+SDVENEEHLCVLKD+ KPILF
Sbjct  515   FDPKFNIVSPGADTNLYFPHTEKEKRLTSFHPEIEELLFSDVENEEHLCVLKDKKKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE YAK+PKLRELVNLVVVGGDRRKESKD+EEQAEMKKMY LI+TY
Sbjct  575   TMARLDRVKNLTGLVELYAKNPKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAMTCGLPTFATNH
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEII+HGKSGFHIDPYHGEQ +ELL +FFE+CKK+PS+W+TISAGGLKRIQEKYTWQ
Sbjct  695   GGPAEIIIHGKSGFHIDPYHGEQVSELLANFFERCKKEPSYWDTISAGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTLA VYGFWK VSKLDR EIRRYLEMFYALK+RKLAE VPLA++
Sbjct  755   IYSDRLLTLAGVYGFWKCVSKLDRQEIRRYLEMFYALKYRKLAEAVPLAVD  805



>emb|CAI56307.1| sucrose synthase [Coffea canephora]
 emb|CDP03035.1| unnamed protein product [Coffea canephora]
Length=806

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/291 (89%), Positives = 280/291 (96%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD NLY+P++EKEKRLTS+HPEIE+LL+SDVENEEHLCVLKD+ KPILF
Sbjct  515   FDPKFNIVSPGADTNLYYPHTEKEKRLTSFHPEIEELLFSDVENEEHLCVLKDKKKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE YAK+PKLRELVNLVVVGGDRRKESKD+EEQAEMKKMY LI+TY
Sbjct  575   TMARLDRVKNLTGLVELYAKNPKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEII+HGKSGFHIDPYHGEQ +ELL +FFE+CKK+PS+W+TISAGGLKRIQEKYTWQ
Sbjct  695   GGPAEIIIHGKSGFHIDPYHGEQVSELLANFFERCKKEPSYWDTISAGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTLA VYGFWK VSKLDR EIRRYLEMFYALK+RKLAE VPLA++
Sbjct  755   IYSDRLLTLAGVYGFWKCVSKLDRQEIRRYLEMFYALKYRKLAEAVPLAVD  805



>gb|ABI17891.1| sucrose synthase [Coffea canephora]
Length=806

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/291 (89%), Positives = 279/291 (96%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD NLY+P++EKEKRLTS+HPEIE+LL+SDVENEEHLCVLKD+ KPILF
Sbjct  515   FDPKFNIVSPGADTNLYYPHTEKEKRLTSFHPEIEELLFSDVENEEHLCVLKDKKKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE YAK+PKLRELVNLVVVGGDRRKESKD+EEQAEMKKMY LI+TY
Sbjct  575   TMARLDRVKNLTGLVELYAKNPKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEII+HGKSGFHIDPYHGEQ +ELL +FFE+CKK+PS+W+TI AGGLKRIQEKYTWQ
Sbjct  695   GGPAEIIIHGKSGFHIDPYHGEQVSELLANFFERCKKEPSYWDTIPAGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTLA VYGFWK VSKLDR EIRRYLEMFYALK+RKLAE VPLA++
Sbjct  755   IYSDRLLTLAGVYGFWKCVSKLDRQEIRRYLEMFYALKYRKLAEAVPLAVD  805



>sp|P49035.1|SUS1_DAUCA RecName: Full=Sucrose synthase isoform 1; AltName: Full=Sucrose 
synthase isoform I; AltName: Full=Sucrose-UDP glucosyltransferase 
1; AltName: Full=Susy*Dc1 [Daucus carota]
 emb|CAA53081.1| sucrose synthase [Daucus carota]
 emb|CAA76056.1| sucrose synthase isoform I [Daucus carota]
Length=808

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/289 (89%), Positives = 272/289 (94%), Gaps = 0/289 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YF Y EKEKRLT+ HPEIE+LLYS VENEEHLC++KD++KPILF
Sbjct  517   FDPKFNIVSPGADTSVYFSYKEKEKRLTTLHPEIEELLYSSVENEEHLCIIKDKNKPILF  576

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLD VKNLTG VE+YAKSPKLRELVNLVVVGGDRRKESKD+EEQA+MKKMYELI TY
Sbjct  577   TMARLDNVKNLTGFVEWYAKSPKLRELVNLVVVGGDRRKESKDLEEQAQMKKMYELIDTY  636

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYI DTKGAFVQPAFYEAFGLTVVEAMTCGLPTFAT H
Sbjct  637   KLNGQFRWISSQMNRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATLH  696

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQ AELLV+FFEKCK DPS W+ ISAGGLKRIQEKYTWQ
Sbjct  697   GGPAEIIVHGKSGFHIDPYHGEQVAELLVNFFEKCKTDPSQWDAISAGGLKRIQEKYTWQ  756

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  390
             IYS+RLLTLA VYGFWKHVSKLDRLEIRRYLEMFYALK+RKLAE VPLA
Sbjct  757   IYSERLLTLAGVYGFWKHVSKLDRLEIRRYLEMFYALKYRKLAESVPLA  805



>emb|CAA09680.1| sucrose synthase [Solanum lycopersicum]
Length=406

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/271 (91%), Positives = 263/271 (97%), Gaps = 0/271 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+NLYFPYSEKEKRLT++HPEIEDLL+SDVENEEHLCVLKDR+KPI+F
Sbjct  135   FDPKFNIVSPGADVNLYFPYSEKEKRLTTFHPEIEDLLFSDVENEEHLCVLKDRNKPIIF  194

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+YAK+P+LRELVNLVVVGGDRRKESKD+EEQAEMKKMYELIKT+
Sbjct  195   TMARLDRVKNLTGLVEWYAKNPRLRELVNLVVVGGDRRKESKDLEEQAEMKKMYELIKTH  254

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYR I DT+GAFVQPAFYEAFGLTVVEAM+CGLPTFATN 
Sbjct  255   NLNGQFRWISSQMNRVRNGELYRCIADTRGAFVQPAFYEAFGLTVVEAMSCGLPTFATNQ  314

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF IDPYHGEQAA+LL +FFEKCK DPSHWE IS GGLKRIQEKYTWQ
Sbjct  315   GGPAEIIVHGKSGFQIDPYHGEQAADLLAEFFEKCKVDPSHWEAISKGGLKRIQEKYTWQ  374

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYL  444
             IYSDRLLTLA+VYGFWKHVSKLDRLEIRRYL
Sbjct  375   IYSDRLLTLAAVYGFWKHVSKLDRLEIRRYL  405



>gb|AEN79500.1| sucrose synthase 1 [Orobanche ramosa]
Length=805

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/291 (88%), Positives = 273/291 (94%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADMNLYFPY+EKEKRLT+ HPEIE+LLYS+VEN+EHLCVLKD++KPI+F
Sbjct  515   FDPKFNIVSPGADMNLYFPYTEKEKRLTALHPEIEELLYSNVENDEHLCVLKDKNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN TGLVE YAKSPKLR+LVNLV+VGGDRRKESKD+EEQAEMKKMY LI+TY
Sbjct  575   TMARLDRVKNPTGLVELYAKSPKLRQLVNLVIVGGDRRKESKDLEEQAEMKKMYNLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR I DTKGAFVQPAFYEAFGLTVVEAMT GLPTFAT H
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRCIADTKGAFVQPAFYEAFGLTVVEAMTRGLPTFATLH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV GKSGFHIDPY+GEQ AE LV FFEKC KDPSHWE IS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVDGKSGFHIDPYNGEQVAETLVSFFEKCNKDPSHWEAISTGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTLA VYGFWK+VSKLDRLEIRRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSDRLLTLAGVYGFWKYVSKLDRLEIRRYLEMFYALKYRKLAEAVPLAVE  805



>gb|EYU25805.1| hypothetical protein MIMGU_mgv1a001207mg [Erythranthe guttata]
Length=866

 Score =   537 bits (1384),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 251/291 (86%), Positives = 272/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADMN+YFPY+++EKRLTS+HPEIE+LLYS+VEN+EHLCVLKD+ KPI+F
Sbjct  576   FDPKFNIVSPGADMNVYFPYTDEEKRLTSFHPEIEELLYSNVENDEHLCVLKDKKKPIIF  635

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE YAKSPKLRELVNLVVVGGDRRKESKD+EEQAEMKKMY LI+TY
Sbjct  636   TMARLDRVKNLTGLVELYAKSPKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSLIETY  695

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAMTCGLPTFAT H
Sbjct  696   ELNGQFRWISSQMNRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATLH  755

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV G SGFHIDPY+GE  AE+L+ FFEKC KDPSHWE IS GGLKRI+EKYTWQ
Sbjct  756   GGPAEIIVDGISGFHIDPYNGESVAEILIGFFEKCTKDPSHWEAISTGGLKRIREKYTWQ  815

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLL LA VYGFWK+VSKLDRLEI+RYLEM YALK RKLAE VPLA+E
Sbjct  816   IYSERLLNLAGVYGFWKYVSKLDRLEIKRYLEMLYALKLRKLAEAVPLAVE  866



>gb|AJW82916.1| sucrose synthase [Dimocarpus longan]
Length=805

 Score =   534 bits (1375),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 251/291 (86%), Positives = 273/291 (94%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RL S+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFPYTEEKQRLKSFHEEIEELLYSPVENKEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY LI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNSKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYGLIEQY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATFN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAAE+LVDFFEKCK DPSHW+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDQAAEILVDFFEKCKVDPSHWDKISQGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AEV40463.1| sucrose synthase 4 [Gossypium arboreum]
 gb|AFM52235.1| putative sucrose synthase 4 [Gossypium arboreum]
 gb|KHG06249.1| Sucrose synthase [Gossypium arboreum]
Length=806

 Score =   534 bits (1375),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 252/291 (87%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+EK++RL  +HPEIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFPYTEKKRRLKHFHPEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EE+AEMKKM+ELIKTY
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELVNLVVVGGDRRKESKDLEEKAEMKKMFELIKTY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFF+KCKK+PSHW  IS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFDKCKKEPSHWNDISEGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAEE  805



>dbj|BAA89049.1| sucrose synthase [Citrus unshiu]
Length=805

 Score =   533 bits (1374),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 250/291 (86%), Positives = 272/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RL S+HPEIE+LLYSDVEN+EHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFPYTEEKRRLKSFHPEIEELLYSDVENKEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY LI  Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSLIDQY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKISLGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_006474580.1| PREDICTED: sucrose synthase-like isoform X1 [Citrus sinensis]
 ref|XP_006474581.1| PREDICTED: sucrose synthase-like isoform X2 [Citrus sinensis]
 ref|XP_006474582.1| PREDICTED: sucrose synthase-like isoform X3 [Citrus sinensis]
 ref|XP_006474583.1| PREDICTED: sucrose synthase-like isoform X4 [Citrus sinensis]
 ref|XP_006474584.1| PREDICTED: sucrose synthase-like isoform X5 [Citrus sinensis]
 ref|XP_006474585.1| PREDICTED: sucrose synthase-like isoform X6 [Citrus sinensis]
 ref|XP_006474586.1| PREDICTED: sucrose synthase-like isoform X7 [Citrus sinensis]
 ref|XP_006474587.1| PREDICTED: sucrose synthase-like isoform X8 [Citrus sinensis]
 gb|KDO73779.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73780.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73781.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73782.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73783.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73784.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73785.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|AIN45138.1| sucrose synthase [Citrus suavissima]
Length=805

 Score =   533 bits (1374),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 250/291 (86%), Positives = 272/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RL S+HPEIE+LLYSDVEN+EHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFPYTEEKRRLKSFHPEIEELLYSDVENKEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY LI  Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSLIDQY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKISLGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_006452883.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452884.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452885.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452886.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452887.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452888.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452889.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452890.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452891.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66123.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66124.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66125.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66126.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66127.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66128.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66129.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66130.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66131.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
Length=806

 Score =   533 bits (1374),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 250/291 (86%), Positives = 272/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RL S+HPEIE+LLYSDVEN+EHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFPYTEEKRRLKSFHPEIEELLYSDVENKEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY LI  Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSLIDQY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKISLGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|KDO73788.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
Length=783

 Score =   532 bits (1371),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 250/291 (86%), Positives = 272/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RL S+HPEIE+LLYSDVEN+EHLCVLKDR+KPILF
Sbjct  493   FDPKFNIVSPGADMSIYFPYTEEKRRLKSFHPEIEELLYSDVENKEHLCVLKDRNKPILF  552

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY LI  Y
Sbjct  553   TMARLDRVKNLTGLVEWYGKNAKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSLIDQY  612

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  613   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  672

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS GGLKRI+EKYTW+
Sbjct  673   GGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKISLGGLKRIEEKYTWK  732

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  733   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  783



>gb|KJB65372.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65373.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65374.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=806

 Score =   532 bits (1371),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 250/291 (86%), Positives = 272/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RL  +HPEIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFPYTEEKRRLKHFHPEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EE+AEMKKM+ELI+TY
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELVNLVVVGGDRRKESKDLEEKAEMKKMFELIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTRGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFF+KCKKDPSHW  IS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFDKCKKDPSHWNDISEGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEV40464.1| sucrose synthase 5 [Gossypium arboreum]
Length=833

 Score =   533 bits (1372),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 252/291 (87%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+EK++RL  +HPEIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  542   FDPKFNIVSPGADMSIYFPYTEKKRRLKHFHPEIEDLLYSKVENEEHLCVLNDRNKPILF  601

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EE+AEMKKM+ELIKTY
Sbjct  602   TMARLDRVKNLTGLVEWYGKNAKLRELVNLVVVGGDRRKESKDLEEKAEMKKMFELIKTY  661

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  662   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  721

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFF+KCKK+PSHW  IS GGLKRIQEKYTWQ
Sbjct  722   GGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFDKCKKEPSHWNDISEGGLKRIQEKYTWQ  781

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA E
Sbjct  782   IYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAEE  832



>gb|ADR00484.1| sucrose synthase [Arachis hypogaea var. vulgaris]
Length=490

 Score =   520 bits (1340),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 241/291 (83%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YFPY++  +RLT++HPEIE+LLYS VENEEH+CVLKDRSKPI+F
Sbjct  199   FDPKFNIVSPGADQTIYFPYTDGSRRLTAFHPEIEELLYSSVENEEHICVLKDRSKPIIF  258

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ +LRELVNLVVV GDRRKESKD+EE+AEMKKMY LI+TY
Sbjct  259   TMARLDRVKNITGLVEWYGKNARLRELVNLVVVAGDRRKESKDLEEKAEMKKMYGLIETY  318

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  319   KLNGQFRWISSQMNRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCN  378

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFF+KCK DP+HW+ IS GGL+RI+EKYTWQ
Sbjct  379   GGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFDKCKVDPTHWDNISQGGLQRIEEKYTWQ  438

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  439   IYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  489



>gb|ADW80556.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   531 bits (1367),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDQKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80536.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80544.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80561.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80567.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80568.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1366),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDQKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80558.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1365),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDQKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80565.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1365),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDEKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80535.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80537.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1365),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDQKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80571.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1365),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDQKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80546.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1365),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDQKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80540.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1365),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDEKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80551.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1365),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDQKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80559.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1365),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDQKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80549.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1365),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDQKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80552.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1365),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDQKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80562.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1364),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDEKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80566.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1364),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDEKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80548.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1364),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDEKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80534.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1364),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDEKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80541.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80542.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80547.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80553.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80554.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80564.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1364),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDEKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80539.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80569.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1364),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDEKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80570.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1364),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDEKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80550.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1364),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDEKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80560.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1364),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDEKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80563.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   530 bits (1364),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDEKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADV71181.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80538.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80557.1| sucrose synthase 1 [Populus tomentosa]
 gb|AFZ78658.1| sucrose synthase [Populus tomentosa]
Length=805

 Score =   530 bits (1364),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDEKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80555.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   529 bits (1363),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDEKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>ref|XP_012077131.1| PREDICTED: sucrose synthase [Jatropha curcas]
 ref|XP_012077132.1| PREDICTED: sucrose synthase [Jatropha curcas]
 gb|KDP33978.1| hypothetical protein JCGZ_07549 [Jatropha curcas]
Length=805

 Score =   529 bits (1363),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 247/291 (85%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YF Y+E+++RLT++HPEIE+LLYS VENEEHLCVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADMSIYFAYTEEKRRLTAFHPEIEELLYSQVENEEHLCVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLREL NLVVVGGDRRKESKD+EEQAEMKKM+ LI+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEQAEMKKMHALIEQY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKG FVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGVFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHGEQAA+LLVDFFEKCK DPSHW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGEQAAQLLVDFFEKCKVDPSHWDKISQGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>dbj|BAM37539.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   529 bits (1363),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 247/291 (85%), Positives = 272/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RL S+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  510   FDPKFNIVSPGADMSIYFPYTEEKRRLKSFHAEIEELLYSPVENKEHLCVLKDRSKPILF  569

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE++ K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKM+ LI+TY
Sbjct  570   TMARLDRVKNLTGLVEWFGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMHSLIETY  629

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  630   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  689

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPSHW+ IS GGLKRI+EKYTW+
Sbjct  690   GGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKADPSHWDKISQGGLKRIEEKYTWK  749

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  750   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>dbj|BAM68521.1| sucrose synthase [Mangifera indica]
 dbj|BAM68528.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   529 bits (1362),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 247/291 (85%), Positives = 272/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RL S+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  510   FDPKFNIVSPGADMSIYFPYTEEKRRLKSFHAEIEELLYSPVENKEHLCVLKDRSKPILF  569

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE++ K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKM+ LI+TY
Sbjct  570   TMARLDRVKNLTGLVEWFGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMHSLIETY  629

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  630   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  689

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPSHW+ IS GGLKRI+EKYTW+
Sbjct  690   GGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKADPSHWDKISQGGLKRIEEKYTWK  749

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  750   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>dbj|BAA88905.1| sucrose synthase [Citrus unshiu]
Length=805

 Score =   528 bits (1361),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 248/291 (85%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RL S+HPEIE+LLYSDVEN+EHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFPYTEEKRRLKSFHPEIEELLYSDVENKEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY LI   
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSLIDQN  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYIC+TKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICETKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKISLGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>sp|O49845.1|SUS2_DAUCA RecName: Full=Sucrose synthase isoform 2; AltName: Full=Sucrose 
synthase isoform II; AltName: Full=Sucrose-UDP glucosyltransferase 
2; AltName: Full=Susy*Dc2 [Daucus carota]
 emb|CAA76057.1| sucrose synthase isoform II [Daucus carota]
Length=801

 Score =   528 bits (1361),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 272/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++Y+PY+EK++RLT+ HPEIEDLL+S VEN+EH+CVLKDR KPILF
Sbjct  511   FDPKFNIVSPGADTSVYYPYTEKKRRLTALHPEIEDLLFSSVENKEHICVLKDRYKPILF  570

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLD VKNLTG+VE+YAK+PKLRELVNLVVVGGDRRKESKD+EEQA+MKKMY LI TY
Sbjct  571   TMARLDNVKNLTGIVEWYAKNPKLRELVNLVVVGGDRRKESKDLEEQAQMKKMYGLIDTY  630

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWIS+Q NRVRNGELYR I DTKGAFVQPAFYEAFGLTV+EAMTCGLPTFAT H
Sbjct  631   KLNGQFRWISAQKNRVRNGELYRCIADTKGAFVQPAFYEAFGLTVIEAMTCGLPTFATIH  690

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHG SGFHIDPYHGE+AAEL+V+FFE+CK +PSHWETISAGGLKRIQEKYTWQ
Sbjct  691   GGPAEIIVHGTSGFHIDPYHGEKAAELIVNFFERCKTEPSHWETISAGGLKRIQEKYTWQ  750

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVSKLDR+EIRRYLEMF ALK+R LAE VPLA++
Sbjct  751   IYSERLLTLGGVYGFWKHVSKLDRIEIRRYLEMFCALKYRNLAESVPLAVD  801



>gb|ADW80545.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   528 bits (1360),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 248/291 (85%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDQKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RI EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIHEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80543.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   528 bits (1360),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 248/291 (85%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDQKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLD VKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDSVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>ref|XP_011010968.1| PREDICTED: sucrose synthase-like isoform X1 [Populus euphratica]
Length=812

 Score =   528 bits (1359),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  522   FDPKFNIVSPGADESIYFPYTDEKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  581

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  582   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  641

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  642   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  701

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFF+KCK DP+HWE IS GGL+RIQEKYTWQ
Sbjct  702   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFDKCKVDPAHWEKISHGGLQRIQEKYTWQ  761

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPL  E
Sbjct  762   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLTKE  812



>ref|XP_011010969.1| PREDICTED: sucrose synthase-like isoform X2 [Populus euphratica]
Length=805

 Score =   527 bits (1358),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDEKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFF+KCK DP+HWE IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFDKCKVDPAHWEKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLTKE  805



>ref|XP_008337809.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337810.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337811.1| PREDICTED: sucrose synthase [Malus domestica]
Length=807

 Score =   527 bits (1358),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPYSEKEKRLT++HPEIE+LLYS VEN+EHLCVLKDR+KPI+F
Sbjct  516   FDPKFNIVSPGADMSVYFPYSEKEKRLTNFHPEIEELLYSQVENKEHLCVLKDRNKPIIF  575

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD EE+AEMKKMYELI TY
Sbjct  576   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRKESKDNEEKAEMKKMYELIDTY  635

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  636   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCK  695

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSG+HIDPYHG+QAAE+LVDFFEK K DPSHW+ IS GGL+RI EKYTWQ
Sbjct  696   GGPAEIIVHGKSGYHIDPYHGDQAAEILVDFFEKSKADPSHWDKISQGGLQRIYEKYTWQ  755

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+ KLA  VPLA+E
Sbjct  756   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYSKLAASVPLAVE  806



>dbj|BAM68520.1| sucrose synthase [Mangifera indica]
 dbj|BAM68522.1| sucrose synthase [Mangifera indica]
 dbj|BAM68523.1| sucrose synthase [Mangifera indica]
 dbj|BAM68524.1| sucrose synthase [Mangifera indica]
 dbj|BAM68525.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   527 bits (1357),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 272/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RL S+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  510   FDPKFNIVSPGADMSIYFPYTEEKRRLKSFHAEIEELLYSPVENKEHLCVLKDRSKPILF  569

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE++ K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKM+ LI+TY
Sbjct  570   TMARLDRVKNLTGLVEWFGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMHSLIETY  629

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  630   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  689

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPS+W+ IS GGLKRI+EKYTW+
Sbjct  690   GGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKADPSYWDKISQGGLKRIEEKYTWK  749

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  750   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>dbj|BAM68527.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   527 bits (1357),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 272/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RL S+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  510   FDPKFNIVSPGADMSIYFPYTEEKRRLKSFHAEIEELLYSPVENKEHLCVLKDRSKPILF  569

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE++ K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKM+ LI+TY
Sbjct  570   TMARLDRVKNLTGLVEWFGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMHSLIETY  629

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  630   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  689

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPS+W+ IS GGLKRI+EKYTW+
Sbjct  690   GGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKADPSYWDKISQGGLKRIEEKYTWK  749

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  750   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>gb|ADY68846.1| sucrose synthase [Gossypium herbaceum subsp. africanum]
Length=805

 Score =   527 bits (1357),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 247/291 (85%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E+++RL  +HPEIEDLLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADMEIYFPYTEEKRRLKHFHPEIEDLLYSKVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EE+AEMKKM+ELI  Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEKAEMKKMFELIDKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNR+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>ref|XP_004287669.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
 ref|XP_011461050.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
Length=806

 Score =   526 bits (1356),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 247/291 (85%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPYSEKEKRLT +HPEIE+L+YS  EN+EHLCVLKDR+KPI+F
Sbjct  516   FDPKFNIVSPGADMDIYFPYSEKEKRLTHFHPEIEELIYSQEENKEHLCVLKDRNKPIIF  575

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKES+D EE+AE+KKMYELI TY
Sbjct  576   TMARLDRVKNITGLVEWYGKNKKLRELVNLVVVAGDRRKESQDNEEKAELKKMYELIDTY  635

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  636   KLNGQFRWISSQMNRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCK  695

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSG+HIDPYHGEQAAE+LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTWQ
Sbjct  696   GGPAEIIVHGKSGYHIDPYHGEQAAEILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWQ  755

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK++KLA+ VPLA E
Sbjct  756   IYSERLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYKKLADSVPLAEE  806



>ref|XP_010535796.1| PREDICTED: sucrose synthase 4 [Tarenaya hassleriana]
Length=806

 Score =   526 bits (1356),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RLTS+HPEIE+LLYSDVENEEHLCVLKD+ KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFPYTEEKRRLTSFHPEIEELLYSDVENEEHLCVLKDKKKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LRELVNLVVVGGDRRKESKD EE+AEMKKMY+LI+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNARLRELVNLVVVGGDRRKESKDNEEKAEMKKMYDLIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNR+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   GLNGQFRWISSQMNRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAAE+L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDQAAEILADFFAKCKEDPSHWDEISHGGLQRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKAVPLAQE  805



>dbj|BAM68526.1| sucrose synthase [Mangifera indica]
 dbj|BAM68529.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   526 bits (1355),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 272/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RL S+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  510   FDPKFNIVSPGADMSIYFPYTEEKRRLKSFHAEIEELLYSPVENKEHLCVLKDRSKPILF  569

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE++ K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKM+ LI+TY
Sbjct  570   TMARLDRVKNLTGLVEWFGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMHSLIETY  629

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  630   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  689

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPS+W+ IS GGLKRI+EKYTW+
Sbjct  690   GGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKVDPSYWDKISQGGLKRIEEKYTWK  749

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  750   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>gb|AGH29112.1| sucrose synthase [Jatropha curcas]
Length=805

 Score =   526 bits (1354),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YF Y+E+++RLT++HPEIE+LLYS VENEEHLCVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADMSIYFAYTEEKRRLTAFHPEIEELLYSQVENEEHLCVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLREL NLVVVGGDRRKESKD+EEQAEMKKM+  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEQAEMKKMHAPIEQY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKG FVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGVFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHGEQAA+LLVDFFEKCK DPSHW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGEQAAQLLVDFFEKCKVDPSHWDKISQGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|AGO61958.1| sucrose synthase, partial [Prunus serrulata]
Length=437

 Score =   513 bits (1320),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY  KEKRLTS+HPEIE+LLYS VEN+EHLCVLKDR+KPI+F
Sbjct  146   FDPKFNIVSPGADMSIYFPYFGKEKRLTSFHPEIEELLYSQVENKEHLCVLKDRNKPIIF  205

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD EE+AEMKKM+ELI TY
Sbjct  206   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRKESKDNEEKAEMKKMHELIDTY  265

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR I DTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  266   KLNGQFRWISSQMNRVRNGELYRVIADTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCK  325

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSG+HIDPYHG+QAAE+LVDFFEK + DPSHW+ IS GGL+RI EKYT Q
Sbjct  326   GGPAEIIVHGKSGYHIDPYHGDQAAEILVDFFEKSRADPSHWDKISQGGLQRIFEKYTRQ  385

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA E
Sbjct  386   IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAEE  436



>ref|XP_010520519.1| PREDICTED: sucrose synthase 4-like [Tarenaya hassleriana]
Length=807

 Score =   525 bits (1353),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 244/291 (84%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+ +RLTS+HPEIE+LLYS+VENEEHLCVLKD+ KPILF
Sbjct  516   FDPKFNIVSPGADMSIYFPYTEETRRLTSFHPEIEELLYSEVENEEHLCVLKDKKKPILF  575

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LRE VNLVVVGGDRRKESKDIEE+AEMKKMY+LI+ Y
Sbjct  576   TMARLDRVKNLSGLVEWYGKNTRLREFVNLVVVGGDRRKESKDIEEKAEMKKMYDLIEKY  635

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  636   NLNGQFRWISSQMNRVRNGELYRYICDTRGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  695

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSGFHIDPYHG+QAAE+L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  696   GGPAEIIVNGKSGFHIDPYHGDQAAEILADFFAKCKEDPSHWDEISHGGLQRIEEKYTWQ  755

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  756   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  806



>gb|AEV40462.1| sucrose synthase 3 [Gossypium arboreum]
 gb|AFM52234.1| putative sucrose synthase 3 [Gossypium arboreum]
 gb|KHG30366.1| Sucrose synthase [Gossypium arboreum]
Length=805

 Score =   525 bits (1353),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E+++RL  +HPEIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMEIYFPYTEEKRRLKHFHPEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EE+AEMKKM+ELI  Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEKAEMKKMFELIDKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNR+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ADR81996.1| sucrose synthase 1 [Populus trichocarpa]
 gb|ADV71183.1| sucrose synthase 1 [Populus trichocarpa]
Length=805

 Score =   525 bits (1353),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 247/291 (85%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDEKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSGFHIDPYHGE+AAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVNGKSGFHIDPYHGEKAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADY68848.1| sucrose synthase [Gossypium hirsutum]
Length=805

 Score =   525 bits (1353),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E+++RL  +HPEIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMEIYFPYTEEKRRLKHFHPEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EE+AEMKKM+ELI  Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEKAEMKKMFELIDKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNR+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71067.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score =   525 bits (1353),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E+++RL  +HPEIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMEIYFPYTEEKRRLKHFHPEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EE+AEMKKM+ELI  Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEKAEMKKMFELIDKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNR+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71063.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71065.1| sucrose synthase Sus1 [Gossypium darwinii]
 gb|AEN71069.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71071.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71073.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score =   525 bits (1353),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E+++RL  +HPEIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMEIYFPYTEEKRRLKHFHPEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EE+AEMKKM+ELI  Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEKAEMKKMFELIDKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNR+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>ref|XP_002324136.2| sucrose synthase family protein [Populus trichocarpa]
 gb|EEF02701.2| sucrose synthase family protein [Populus trichocarpa]
Length=805

 Score =   525 bits (1352),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 247/291 (85%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTDEKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSGFHIDPYHGE+AAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVNGKSGFHIDPYHGEKAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|AFO84090.1| sucrose synthase [Actinidia chinensis]
Length=806

 Score =   525 bits (1352),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 243/291 (84%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADMN+YFP++EK+KRLT +HPEIEDLL+SDVEN+EH+ VLKD +KPI+F
Sbjct  515   FDPKFNIVSPGADMNIYFPHTEKDKRLTKFHPEIEDLLFSDVENKEHIGVLKDPTKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             +MARLDRVKNLTGLVE Y K+ +LREL NLVVVGGDRRKESKD+EEQAEMKKMY+LI+TY
Sbjct  575   SMARLDRVKNLTGLVELYGKNARLRELANLVVVGGDRRKESKDLEEQAEMKKMYDLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR+I DTKG FVQPAFYEAFGLTVVEAMTCGLPTFAT H
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRFIADTKGVFVQPAFYEAFGLTVVEAMTCGLPTFATCH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEII+HGKSGFHIDPYHG+Q AELLV+F+EKCK DPSHW+ IS GGLKRI EKYTWQ
Sbjct  695   GGPAEIIIHGKSGFHIDPYHGDQVAELLVNFYEKCKVDPSHWDAISEGGLKRILEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RL+TLA VYGFWK+VSKLDR E RRYLEMFYALK+RKLAE VPLA++
Sbjct  755   IYSERLMTLAGVYGFWKYVSKLDRRETRRYLEMFYALKYRKLAEAVPLAVD  805



>emb|CDO97805.1| unnamed protein product [Coffea canephora]
Length=731

 Score =   522 bits (1345),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 244/289 (84%), Positives = 271/289 (94%), Gaps = 0/289 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YFPY+EK KRLT YHPEIE+LL+SD +NEEHLCVLKD+ KPILF
Sbjct  442   FDPKFNIVSPGADTKIYFPYTEKNKRLTEYHPEIEELLFSDDQNEEHLCVLKDKKKPILF  501

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTG+VE+YAK+ +LRELVNLVVVGGDRRKESKD+EEQAEMKKMYELI+TY
Sbjct  502   TMARLDRVKNLTGIVEWYAKNTRLRELVNLVVVGGDRRKESKDLEEQAEMKKMYELIETY  561

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAMTCGLPTFAT +
Sbjct  562   NLNGQFRWISSQMNRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATIN  621

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSGFHIDPY GEQ AE+LVDFFE+CK+D S+WETIS+GGLKRIQEKYTWQ
Sbjct  622   GGPAEIIVNGKSGFHIDPYKGEQVAEVLVDFFERCKEDASYWETISSGGLKRIQEKYTWQ  681

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  390
             IYSDR+LTLA VYGFWK VS+ DRL+++RYLEMFY L +RKLAE VP+A
Sbjct  682   IYSDRILTLAGVYGFWKEVSRPDRLKMQRYLEMFYLLNYRKLAESVPVA  730



>gb|AHA41509.1| sucrose synthase [Populus deltoides]
Length=805

 Score =   525 bits (1351),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPK NIVSPGAD ++YFPY+++++RLTS+HPEI++LLYS VENEEHLCVLKDR+KPILF
Sbjct  515   FDPKLNIVSPGADESIYFPYTDEKRRLTSFHPEIDELLYSPVENEEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRK+SKD+EEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTKLRELVNLVVVGGDRRKQSKDLEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVNGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|AAK59464.1| putative sucrose synthase [Arabidopsis thaliana]
Length=532

 Score =   515 bits (1326),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 267/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YF Y+E+++RLT++H EIE+LLYSDVENEEHLCVLKD+ KPI+F
Sbjct  241   FDPKFNIVSPGADMSIYFAYTEEKRRLTAFHLEIEELLYSDVENEEHLCVLKDKKKPIIF  300

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LRELVNLVVVGGDRRKES+D EE+AEMKKMYELI+ Y
Sbjct  301   TMARLDRVKNLSGLVEWYGKNTRLRELVNLVVVGGDRRKESQDNEEKAEMKKMYELIEEY  360

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  361   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  420

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AAE L DFF KCK DPSHW+ IS GGL+RIQEKYTWQ
Sbjct  421   GGPAEIIVHGKSGFHIDPYHGDKAAESLADFFTKCKHDPSHWDQISLGGLERIQEKYTWQ  480

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  481   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAHE  531



>gb|AGM14948.1| sucrose synthase 3 [Hevea brasiliensis]
Length=810

 Score =   525 bits (1351),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 269/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E++ RLTS+HPEIE+LLYS VENEEHLCVLKDR+KPI+F
Sbjct  519   FDPKFNIVSPGADMSIYFPYTEEKLRLTSFHPEIEELLYSPVENEEHLCVLKDRNKPIIF  578

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EEQAEMKKM+ LI+ Y
Sbjct  579   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEQAEMKKMHGLIEKY  638

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKG FVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  639   NLNGQFRWISSQMNRVRNGELYRYICDTKGVFVQPALYEAFGLTVVEAMTCGLPTFATCN  698

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAAELLVDFFEKCK DPS+W  IS G ++RIQEKYTWQ
Sbjct  699   GGPAEIIVHGKSGFNIDPYHGDQAAELLVDFFEKCKVDPSYWNNISHGAMQRIQEKYTWQ  758

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVSKLDRLE +RYLEMFYALK+ KLAE VPL +E
Sbjct  759   IYSQRLLTLTGVYGFWKHVSKLDRLESKRYLEMFYALKYHKLAESVPLTVE  809



>gb|AEN71079.1| sucrose synthase Sus1 [Gossypium aridum]
Length=805

 Score =   524 bits (1350),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E+++RL  +H EIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMEIYFPYTEEKRRLKHFHTEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EE+AEMKKM+ELI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELVNLVVVGGDRRKESKDLEEKAEMKKMFELIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNR+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AHL29281.1| sucrose synthase 1 [Camellia sinensis]
Length=805

 Score =   524 bits (1350),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 272/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFP++EKEKRLT +HPEIE+LL+S+VENEEHL +LKD+ KPI+F
Sbjct  515   FDPKFNIVSPGADMSIYFPHTEKEKRLTKFHPEIEELLFSEVENEEHLGMLKDKKKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             +MARLDRVKNLTGLVE Y K+ +LREL NLVVVGGDRRKESKD+EEQAEMKKMYE+I+TY
Sbjct  575   SMARLDRVKNLTGLVELYGKNARLRELANLVVVGGDRRKESKDLEEQAEMKKMYEMIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              L GQFRWISSQMNRVRNGELYR I DTKG FVQPAFYEAFGLTVVEAMTCGLPTFAT++
Sbjct  635   KLQGQFRWISSQMNRVRNGELYRCIADTKGVFVQPAFYEAFGLTVVEAMTCGLPTFATSY  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEII+HGKSGFHIDPYHG+Q AELLV+F+E+C KDPSHW+ ISAGGL+RI EKYTWQ
Sbjct  695   GGPAEIIIHGKSGFHIDPYHGDQVAELLVNFYERCSKDPSHWDEISAGGLQRIMEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RL+TLA VYGFWK+VSKLDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  755   IYSERLMTLAGVYGFWKYVSKLDRLETRRYLEMFYALKYRKLAESVPLAIE  805



>gb|ADY68844.1| sucrose synthase [Gossypium barbadense]
Length=805

 Score =   523 bits (1348),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 269/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E+++RL  +HPEIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMEIYFPYTEEKRRLKHFHPEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDR KNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EE+AEMKKM+ELI  Y
Sbjct  575   TMARLDRAKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEKAEMKKMFELIDKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNR+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>ref|XP_003551045.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006600427.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=805

 Score =   523 bits (1348),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 267/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YFP +E  +RLTS+HPEIE+LLYS VENEEH+CVLKDRSKPI+F
Sbjct  515   FDPKFNIVSPGADQTIYFPPTETSRRLTSFHPEIEELLYSSVENEEHICVLKDRSKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD+EE+AEMKKMY LI+TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRKESKDLEEKAEMKKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVICDTKGAFVQPAIYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEKCK DP+HWETIS  GL+RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFEKCKLDPTHWETISKAGLQRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|KHN17754.1| Sucrose synthase [Glycine soja]
Length=805

 Score =   523 bits (1348),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 267/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YFP +E  +RLTS+HPEIE+LLYS VENEEH+CVLKDRSKPI+F
Sbjct  515   FDPKFNIVSPGADQTIYFPPTETSRRLTSFHPEIEELLYSSVENEEHICVLKDRSKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD+EE+AEMKKMY LI+TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRKESKDLEEKAEMKKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVICDTKGAFVQPAIYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEKCK DP+HWETIS  GL+RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFEKCKLDPTHWETISKAGLQRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_007012547.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
 gb|EOY30166.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
Length=806

 Score =   523 bits (1348),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 269/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YF Y+E+++RL  + PEIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFSYTEEKRRLKHFKPEIEDLLYSKVENEEHLCVLNDRTKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EE+AEMKKM+E+I+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELVNLVVVGGDRRKESKDLEEKAEMKKMFEMIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKADPSYWNKISEGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AEK81520.1| sucrose synthase isoform B [Gossypium hirsutum]
Length=805

 Score =   523 bits (1347),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 269/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RL  +HPEIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFPYTEEKRRLKHFHPEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLRELVNLVVVGGDRRKES+D+EE+AEMKKM+ELI+TY
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELVNLVVVGGDRRKESEDLEEKAEMKKMFELIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDT+ AFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTRVAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAAE+L DFF+KCKKDPSHW  IS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAAEILADFFDKCKKDPSHWNDISEGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+ KLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYPKLAESVPLAEE  805



>gb|AFI57908.1| sucrose synthase 1 [Prunus persica]
Length=806

 Score =   523 bits (1347),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 248/291 (85%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPYSEKEKRLTS+HPEIE+LLYS VEN+EHLCVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADMSIYFPYSEKEKRLTSFHPEIEELLYSQVENKEHLCVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD EE+AEMKKMYELI TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRKESKDNEEKAEMKKMYELIDTY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYR I DTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRVIADTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSG+HIDPYHG+QAA++LVDFFEK + DPSHW+ IS GGL+RI EKYTWQ
Sbjct  695   GGPAEIIVHGKSGYHIDPYHGDQAADILVDFFEKSRADPSHWDKISQGGLQRIYEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VP A E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPRAEE  805



>gb|AEN71080.1| sucrose synthase Sus1 [Gossypium gossypioides]
Length=805

 Score =   523 bits (1346),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E+++RL  +H EIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMEIYFPYTEEKRRLKHFHTEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EE+AEMKKM+ELI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEKAEMKKMFELIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNR+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71075.1| sucrose synthase Sus1 [Gossypium armourianum]
 gb|AEN71076.1| sucrose synthase Sus1 [Gossypium harknessii]
Length=805

 Score =   523 bits (1346),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E+++RL  +H EIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMEIYFPYTEEKRRLKHFHTEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EE+AEMKKM+ELI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEKAEMKKMFELIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNR+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71078.1| sucrose synthase Sus1 [Gossypium klotzschianum]
Length=805

 Score =   523 bits (1346),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E+++RL  +H EIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMEIYFPYTEEKRRLKHFHTEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EE+AEMKKM+ELI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEKAEMKKMFELIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNR+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ACV72640.1| sucrose synthase 1 [Gossypium hirsutum]
 gb|ADY68849.1| sucrose synthase [Gossypium hirsutum]
 gb|AEN71074.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score =   523 bits (1346),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E+++RL  +H EIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMEIYFPYTEEKRRLKHFHTEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EE+AEMKKM+ELI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEKAEMKKMFELIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNR+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ADY68845.1| sucrose synthase [Gossypium barbadense]
 gb|ADY68847.1| sucrose synthase [Gossypium raimondii]
 gb|AEN71062.1| sucrose synthase Sus1 [Gossypium turneri]
 gb|AEN71064.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71070.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71072.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71077.1| sucrose synthase Sus1 [Gossypium davidsonii]
 gb|KJB54536.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54537.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54538.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=805

 Score =   523 bits (1346),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E+++RL  +H EIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMEIYFPYTEEKRRLKHFHTEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EE+AEMKKM+ELI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEKAEMKKMFELIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNR+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71061.1| sucrose synthase Sus1 [Gossypium schwendimanii]
Length=805

 Score =   522 bits (1345),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E+++RL  +H EIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMEIYFPYTEEKRRLKHFHTEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EE+AEMKKM+ELI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEKAEMKKMFELIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNR+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71066.1| sucrose synthase Sus1 [Gossypium darwinii]
Length=805

 Score =   522 bits (1345),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E+++RL  +H EIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMEIYFPYTEEKRRLKHFHTEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EE+AEMKKM+ELI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEKAEMKKMFELIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNR+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>ref|XP_004508035.1| PREDICTED: sucrose synthase-like isoform X3 [Cicer arietinum]
Length=806

 Score =   522 bits (1345),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 267/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YFPY+E  +RLTS+HPEIE+LLYS VENEEH+CVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADETIYFPYTETSRRLTSFHPEIEELLYSTVENEEHICVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN++GLVE+Y K+ KLRELVNLVVV GDRRKESKD+EE+AEMKKMY LI TY
Sbjct  575   TMARLDRVKNISGLVEWYGKNAKLRELVNLVVVAGDRRKESKDLEEKAEMKKMYALIDTY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM CGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMGCGLPTFATLN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGE+AA+LLV+FFEKCK DPSHW+ IS GGLKRI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGERAADLLVEFFEKCKVDPSHWDKISQGGLKRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_007012546.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
 gb|EOY30165.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
Length=852

 Score =   524 bits (1349),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 269/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YF Y+E+++RL  + PEIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  561   FDPKFNIVSPGADMSIYFSYTEEKRRLKHFKPEIEDLLYSKVENEEHLCVLNDRTKPILF  620

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EE+AEMKKM+E+I+ Y
Sbjct  621   TMARLDRVKNLTGLVEWYGKNAKLRELVNLVVVGGDRRKESKDLEEKAEMKKMFEMIEKY  680

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  681   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  740

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRIQEKYTWQ
Sbjct  741   GGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKADPSYWNKISEGGLKRIQEKYTWQ  800

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  801   IYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  851



>gb|AEE60913.1| nodule-enhanced sucrose synthase [Cicer arietinum]
Length=806

 Score =   522 bits (1344),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 267/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YFPY+E  +RLTS+HPEIE+LLYS VENEEH+CVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADETIYFPYTETSRRLTSFHPEIEELLYSTVENEEHICVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN++GLVE+Y K+ KLRELVNLVVV GDRRKESKD+EE+AEMKKMY LI TY
Sbjct  575   TMARLDRVKNISGLVEWYGKNAKLRELVNLVVVAGDRRKESKDLEEKAEMKKMYALIDTY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM CGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMGCGLPTFATLN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGE+AA+LLV+FFEKCK DPSHW+ IS GGLKRI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGERAADLLVEFFEKCKVDPSHWDKISQGGLKRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|KHG00606.1| Sucrose synthase [Gossypium arboreum]
Length=814

 Score =   522 bits (1344),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++Y+PY+E++KRL  +H EIE+LLYS VENEEH CVL DR+KPILF
Sbjct  523   FDPKFNIVSPGADMSIYYPYTEEKKRLKHFHSEIEELLYSKVENEEHWCVLNDRNKPILF  582

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EE+AEMKKM+ELI+ Y
Sbjct  583   TMARLDRVKNLTGLVEWYGKNAKLRELVNLVVVGGDRRKESKDLEEKAEMKKMFELIEKY  642

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  643   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  702

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRI+EKYTW+
Sbjct  703   GGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKTDPSYWTKISEGGLKRIEEKYTWK  762

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  763   IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  813



>ref|XP_010047438.1| PREDICTED: sucrose synthase [Eucalyptus grandis]
 gb|KCW79350.1| hypothetical protein EUGRSUZ_C00769 [Eucalyptus grandis]
Length=805

 Score =   521 bits (1343),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 243/291 (84%), Positives = 269/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YF Y+E++ RL S+H EIE+LL+SDVEN+EHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFSYTEEKLRLKSFHAEIEELLFSDVENKEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ +LRELVNLVVVGGDRRKESKD+EEQAEMKKMY LI+TY
Sbjct  575   TMARLDRVKNLTGLVEWYGKNTRLRELVNLVVVGGDRRKESKDLEEQAEMKKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICD +GAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDMRGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAAE L +FFEKCK DPSHW+ IS G ++RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDQAAETLANFFEKCKVDPSHWDKISQGAMQRIKEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLL L +VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSERLLNLTAVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AEV40460.1| sucrose synthase 1 [Gossypium arboreum]
 gb|AFM52232.1| putative sucrose synthase 1 [Gossypium arboreum]
Length=806

 Score =   521 bits (1343),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++Y+PY+E++KRL  +H EIE+LLYS VENEEH CVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMSIYYPYTEEKKRLKHFHSEIEELLYSKVENEEHWCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EE+AEMKKM+ELI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELVNLVVVGGDRRKESKDLEEKAEMKKMFELIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKTDPSYWTKISEGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AIJ28960.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   521 bits (1343),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 244/291 (84%), Positives = 269/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YF Y+E+++RLTS+HPEIE+LLYS VENEEHLCVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADESIYFAYTEEKRRLTSFHPEIEELLYSPVENEEHLCVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLREL NLVVVGGDRRKESKD+EEQAEMKKM+ LI+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNSKLRELANLVVVGGDRRKESKDLEEQAEMKKMHSLIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYR ICDTKG FVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRCICDTKGVFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAAELLV+FFEKCK DPSHW+ IS G ++RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAAELLVEFFEKCKADPSHWDKISQGAMQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVSKLDRLE RRYLEMFYALK+RKLAE VPL +E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSKLDRLESRRYLEMFYALKYRKLAESVPLTVE  805



>ref|XP_010247458.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247459.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247460.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score =   521 bits (1343),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 244/291 (84%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E+EKRLT+ HPEIEDLLYS VEN EHLCVL DR+KPI+F
Sbjct  515   FDPKFNIVSPGADMTIYFPYTEQEKRLTALHPEIEDLLYSKVENTEHLCVLNDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             +MARLDRVKN+TGLVE+Y K+ +LRELVNLVVV GDRRKESKD+EEQ+EMKKMY LI+ Y
Sbjct  575   SMARLDRVKNITGLVEWYGKNARLRELVNLVVVAGDRRKESKDLEEQSEMKKMYGLIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYI DTKGAFVQPAFYEAFGLTVVE+MTCGLPTFAT H
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVESMTCGLPTFATCH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AAELLV+FFEK K+DP++WE IS GGL+RI EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDRAAELLVNFFEKSKEDPTYWEKISQGGLQRIHEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RL+TLA VYGFWK+VSKLDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSGRLMTLAGVYGFWKYVSKLDRRETRRYLEMFYALKYRKLAEMVPLAVE  805



>gb|AEN71059.1| sucrose synthase Sus1 [Gossypium thurberi]
 gb|AEN71082.1| sucrose synthase Sus1 [Gossypium trilobum]
Length=805

 Score =   521 bits (1342),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 244/291 (84%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+ +YFPY+E+++RL  +H EIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADLEIYFPYTEEKRRLKHFHTEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EE+AEMKKM+ELI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEKAEMKKMFELIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNR+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71068.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score =   521 bits (1341),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 269/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM + FPY+E+++RL  +H EIEDLLYS VENEEHLCVL DRSKPILF
Sbjct  515   FDPKFNIVSPGADMEICFPYTEEKRRLKHFHTEIEDLLYSKVENEEHLCVLNDRSKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EE+AEMKKM+ELI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEKAEMKKMFELIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNR+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|KJB65376.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=818

 Score =   521 bits (1342),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 243/284 (86%), Positives = 266/284 (94%), Gaps = 0/284 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RL  +HPEIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFPYTEEKRRLKHFHPEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EE+AEMKKM+ELI+TY
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELVNLVVVGGDRRKESKDLEEKAEMKKMFELIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTRGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFF+KCKKDPSHW  IS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFDKCKKDPSHWNDISEGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE  405
             IYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKL +
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLVD  798



>gb|AIJ28961.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   521 bits (1341),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YF Y+E+++RLTS+HPEIE+LLYS VENEEHLCVLKDRSKPI+F
Sbjct  515   FDPKFNIVSPGADETIYFSYTEEKRRLTSFHPEIEELLYSPVENEEHLCVLKDRSKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EEQAEMKKM+ LI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEQAEMKKMHSLIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNG FRWISSQMNRVRNGELYRYICDTKG FVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGHFRWISSQMNRVRNGELYRYICDTKGVFVQPAIYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAAELLV FFEKCK DPSHW  IS G ++RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAAELLVQFFEKCKADPSHWIKISEGAMQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>ref|XP_007204649.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 ref|XP_007204650.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05848.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05849.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
Length=806

 Score =   521 bits (1341),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 247/291 (85%), Positives = 267/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPYSEKEKRLTS+HPEIE+LLYS VEN+EHLCVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADMSIYFPYSEKEKRLTSFHPEIEELLYSQVENKEHLCVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD EE+AEMKKMYELI TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRKESKDNEEKAEMKKMYELIDTY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR I DTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVIADTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSG+HIDPYHG+QAA++LVDFFEK + DPSHW+ IS GGL+RI EKYTWQ
Sbjct  695   GGPAEIIVHGKSGYHIDPYHGDQAADILVDFFEKSRADPSHWDKISQGGLQRIYEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VP A E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPRAEE  805



>gb|AEF56625.1| sucrose synthase [Arachis hypogaea var. vulgaris]
Length=806

 Score =   521 bits (1341),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 241/291 (83%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YFPY++  +RLT++HPEIE+LLYS VENEEH+CVLKDRSKPI+F
Sbjct  515   FDPKFNIVSPGADQTIYFPYTDGSRRLTAFHPEIEELLYSSVENEEHICVLKDRSKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ +LRELVNLVVV GDRRKESKD+EE+AEMKKMY LI+TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNARLRELVNLVVVAGDRRKESKDLEEKAEMKKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFF+KCK DP+HW+ IS GGL+RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFDKCKVDPTHWDKISQGGLQRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>emb|CDX92432.1| BnaA10g14710D [Brassica napus]
Length=805

 Score =   521 bits (1341),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 243/291 (84%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RLT +HPEIE+LLYS+VENEEHLCVLKD+ KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFPYTEEKRRLTKFHPEIEELLYSNVENEEHLCVLKDKKKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LRELVNLVVVGGDRRKESKD EE+AEMKKMY+LI+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNKRLRELVNLVVVGGDRRKESKDNEEKAEMKKMYDLIEEY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDQISKGGLQRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  805



>gb|ADW80606.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   520 bits (1340),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 247/291 (85%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRSKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80591.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   520 bits (1340),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 247/291 (85%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRSKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_011039917.1| PREDICTED: sucrose synthase [Populus euphratica]
Length=803

 Score =   520 bits (1340),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 267/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E+++RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKRRLTSFHEEIEELLYSSVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLRELVNLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYSHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEK+TW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKHTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLAE VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLAESVPLTIE  803



>gb|ADW80607.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   520 bits (1340),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 247/291 (85%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRSKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80587.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   520 bits (1340),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 247/291 (85%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRSKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80595.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   520 bits (1340),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 247/291 (85%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRSKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>emb|CDY16569.1| BnaC09g37040D [Brassica napus]
Length=805

 Score =   520 bits (1340),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 243/291 (84%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RLT +HPEIE+LLYS+VENEEHLCVLKD+ KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFPYTEEKRRLTKFHPEIEELLYSNVENEEHLCVLKDKKKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LRELVNLVVVGGDRRKESKD EE+AEMKKMY+LI+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNKRLRELVNLVVVGGDRRKESKDNEEKAEMKKMYDLIEEY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFAKCKEDPSHWDQISKGGLQRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  805



>gb|ADV71182.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80572.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80573.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80594.1| sucrose synthase 2 [Populus tomentosa]
 gb|AFZ78659.1| sucrose synthase [Populus tomentosa]
Length=803

 Score =   520 bits (1340),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 247/291 (85%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRSKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|AEN71060.1| sucrose synthase Sus1 [Gossypium laxum]
 gb|AEN71081.1| sucrose synthase Sus1 [Gossypium lobatum]
Length=805

 Score =   520 bits (1340),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 244/291 (84%), Positives = 269/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E+++RL  +H EIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMEIYFPYTEEKRRLKHFHTEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EE+AEMKKM+ELI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEKAEMKKMFELIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNR+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFE CKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEVCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ABD96570.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   520 bits (1340),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YF Y+E+++RLTS+HPEIE+LLYS VENEEHLCVLKDRSKPI+F
Sbjct  515   FDPKFNIVSPGADETIYFSYTEEKRRLTSFHPEIEELLYSPVENEEHLCVLKDRSKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EEQAEMKKM+ LI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEQAEMKKMHSLIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNG FRWISSQMNRVRNGELYRYICDTKG FVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGHFRWISSQMNRVRNGELYRYICDTKGVFVQPAIYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAAELLV FFEKCK DPSHW  IS G ++RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAAELLVQFFEKCKADPSHWIKISEGAMQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>ref|NP_001289655.1| sucrose synthase [Eucalyptus grandis]
 gb|ABB53602.1| sucrose synthase [Eucalyptus grandis]
Length=805

 Score =   520 bits (1339),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 269/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YF Y+E++ RL S+H EIE+LL+SDVEN+EHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFSYTEEKLRLKSFHAEIEELLFSDVENKEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ +LRELVNLVVVGGDRRKESKD+EEQAEMKKMY LI+TY
Sbjct  575   TMARLDRVKNLTGLVEWYGKNTRLRELVNLVVVGGDRRKESKDLEEQAEMKKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICD +GAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDMRGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAAE L +FFEKCK DPSHW+ IS G ++RI++KYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDQAAETLANFFEKCKVDPSHWDKISQGAMQRIKDKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLL L +VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSERLLNLTAVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|KJB82966.1| hypothetical protein B456_013G222400 [Gossypium raimondii]
Length=806

 Score =   520 bits (1340),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 244/291 (84%), Positives = 269/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++Y+PY+E++KRL  +H EIE LLYS VENEEH CVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMSIYYPYTEEKKRLKHFHSEIEQLLYSKVENEEHWCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EE+AEMKKM+ELI+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNAKLRELVNLVVVGGDRRKESKDLEEKAEMKKMFELIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKTDPSYWTKISEGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|KEH37657.1| sucrose synthase [Medicago truncatula]
Length=804

 Score =   520 bits (1339),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E E+RLTS+HPEIE+LLYS VENEEH+CVLKDRSKPI+F
Sbjct  513   FDPKFNIVSPGADMSIYFPYTETERRLTSFHPEIEELLYSSVENEEHICVLKDRSKPIIF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ +LRELVNLVVV GDRRKESKD+EE+AEMKKMY LI+TY
Sbjct  573   TMARLDRVKNITGLVEWYGKNARLRELVNLVVVAGDRRKESKDLEEKAEMKKMYGLIETY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNR+RNGELYR ICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   KLNGQFRWISSQMNRIRNGELYRVICDTKGAFVQPAIYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSG+HIDPYHG+QAAE LV+FFEK K DPS+W+ IS GGLKRI EKYTWQ
Sbjct  693   GGPAEIIVHGKSGYHIDPYHGDQAAETLVEFFEKSKADPSYWDKISHGGLKRIHEKYTWQ  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTL  VYGFWKHV+ LDR E +RYLEMFYALK+ KLAE VPLA+E
Sbjct  753   IYSDRLLTLTGVYGFWKHVTNLDRRESKRYLEMFYALKYSKLAESVPLAVE  803



>gb|ADW80600.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   520 bits (1339),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 247/291 (85%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRSKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80598.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   520 bits (1339),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 247/291 (85%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRSKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_006381564.1| sucrose synthase family protein [Populus trichocarpa]
 gb|ERP59361.1| sucrose synthase family protein [Populus trichocarpa]
Length=803

 Score =   520 bits (1338),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 247/291 (85%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+EK+ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEKKLRLTSFHEEIEELLYSSVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYSHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DPS+W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPSYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADR81997.1| sucrose synthase 2 [Populus trichocarpa]
 gb|ADV71184.1| sucrose synthase 2 [Populus trichocarpa]
Length=803

 Score =   520 bits (1338),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 247/291 (85%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+EK+ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEKKLRLTSFHEEIEELLYSSVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYSHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DPS+W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPSYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80610.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   520 bits (1338),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 247/291 (85%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E + RLTS+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEGKLRLTSFHEEIEELLYSPVENDEHLCVLKDRSKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_009120766.1| PREDICTED: LOW QUALITY PROTEIN: sucrose synthase 1 [Brassica 
rapa]
Length=805

 Score =   519 bits (1337),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RLT +HPEIE+LLYS+VENEEHLCVLKD+ KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFPYTEEKRRLTKFHPEIEELLYSNVENEEHLCVLKDKKKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LR+LVNLVVVGGDRRKESKD EE+AEMKKMY+LI+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNKRLRDLVNLVVVGGDRRKESKDNEEKAEMKKMYDLIEEY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDQISKGGLQRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  805



>ref|XP_006290612.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
 gb|EOA23510.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
Length=807

 Score =   519 bits (1337),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 243/291 (84%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YF Y+E+++RLT++H EIE+LLYSDVENEEHLCVLK++ KPILF
Sbjct  517   FDPKFNIVSPGADMSIYFAYTEEKRRLTAFHQEIEELLYSDVENEEHLCVLKEKKKPILF  576

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LRELVNLVVVGGDRRKES+D EE+AEMKKMY+LIK Y
Sbjct  577   TMARLDRVKNLSGLVEWYGKNTRLRELVNLVVVGGDRRKESQDNEEKAEMKKMYDLIKEY  636

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  637   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  696

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEII HGKSGFHIDPYHG+QAAE L DFF KCK+DPSHW+ IS GGL+RIQEKYTWQ
Sbjct  697   GGPAEIIEHGKSGFHIDPYHGDQAAETLADFFTKCKQDPSHWDQISLGGLQRIQEKYTWQ  756

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  757   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  807



>gb|AFS17277.1| sucrose synthase 1 [Amaranthus cruentus/Amaranthus hypocondriacus 
mixed library]
Length=803

 Score =   519 bits (1337),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++KRLT+ HPEIE+LLYS+ +NEEH+CVLKDRSKPI+F
Sbjct  512   FDPKFNIVSPGADQSIYFPYTEEKKRLTALHPEIEELLYSEAQNEEHICVLKDRSKPIIF  571

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             +MARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKDIEE+ EMKKMY LI+ Y
Sbjct  572   SMARLDRVKNMTGLVEWYGKNEKLRELVNLVVVAGDRRKESKDIEEKEEMKKMYGLIEQY  631

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              L+GQFRWIS+QMNRVRNGELYRYI DTKGAFVQPA+YEAFGLTVVE+MTCGLPTFAT H
Sbjct  632   KLDGQFRWISAQMNRVRNGELYRYIADTKGAFVQPAYYEAFGLTVVESMTCGLPTFATCH  691

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AAELLVDFF+K K DP+HWETIS GGLKRI+EKYTWQ
Sbjct  692   GGPAEIIVHGKSGFHIDPYHGDKAAELLVDFFKKSKADPTHWETISKGGLKRIEEKYTWQ  751

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTLA VYGFWK+VS LDR E RRYLEMFYALK++KLAE VPLAIE
Sbjct  752   IYSDRLLTLAGVYGFWKYVSNLDRREARRYLEMFYALKYKKLAESVPLAIE  802



>gb|ADW80593.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   519 bits (1337),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>emb|CDX88838.1| BnaA03g08110D [Brassica napus]
Length=743

 Score =   517 bits (1332),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 267/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RLT +HPEIE+LLYSDVEN+EHLCVLKD+ KPILF
Sbjct  452   FDPKFNIVSPGADMSIYFPYTEEKRRLTKFHPEIEELLYSDVENQEHLCVLKDKKKPILF  511

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LRELVNLVVVGGDRRKESKD EE+AEMK+MY+LI  Y
Sbjct  512   TMARLDRVKNLSGLVEWYGKNKRLRELVNLVVVGGDRRKESKDNEEKAEMKRMYDLIDEY  571

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  572   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  631

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  632   GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQ  691

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  692   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKAVPLAEE  742



>gb|ADW80589.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   519 bits (1337),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80575.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   519 bits (1337),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80586.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   519 bits (1337),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80581.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   519 bits (1336),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_003609947.1| Sucrose synthase [Medicago truncatula]
Length=531

 Score =   509 bits (1312),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 240/291 (82%), Positives = 264/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YFPY+E  +RLTS++PEIE+LLYS VENEEH+CVLKDR+KPI+F
Sbjct  241   FDPKFNIVSPGADQTIYFPYTETSRRLTSFYPEIEELLYSSVENEEHICVLKDRNKPIIF  300

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD+EE AEMKKMY LI+TY
Sbjct  301   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRKESKDLEEIAEMKKMYGLIETY  360

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM  GLPTFAT +
Sbjct  361   KLNGQFRWISSQMNRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMATGLPTFATLN  420

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTW 
Sbjct  421   GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISQGGLQRIEEKYTWT  480

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  481   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  531



>ref|NP_001237525.1| sucrose synthase [Glycine max]
 sp|P13708.2|SUSY_SOYBN RecName: Full=Sucrose synthase; AltName: Full=Nodulin-100; Short=N-100; 
AltName: Full=Sucrose-UDP glucosyltransferase [Glycine 
max]
 gb|AAC39323.1| sucrose synthase [Glycine max]
 gb|KHN45052.1| Sucrose synthase [Glycine soja]
Length=805

 Score =   519 bits (1336),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YFP++E  +RLTS+HPEIE+LLYS VENEEH+CVLKDRSKPI+F
Sbjct  515   FDPKFNIVSPGADQTIYFPHTETSRRLTSFHPEIEELLYSSVENEEHICVLKDRSKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD+EE+AEMKKMY LI+TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRKESKDLEEKAEMKKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVICDTRGAFVQPAVYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEKCK DP+HW+ IS  GL+RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFEKCKLDPTHWDKISKAGLQRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAAE  805



>gb|ADW80585.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   519 bits (1336),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80582.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   519 bits (1336),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|AAD28641.1| sucrose synthase [Gossypium hirsutum]
Length=806

 Score =   519 bits (1336),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 243/291 (84%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E+++RL  +HPEIEDLLY+ VENEEHLCVL DR+KPILF
Sbjct  516   FDPKFNIVSPGADMEIYFPYTEEKRRLKHFHPEIEDLLYTKVENEEHLCVLNDRNKPILF  575

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TM RLDRVKNLTGLVE+  K+PKLREL NLVVVGGDRRKESKD+EE+AEMKKM+ELI  Y
Sbjct  576   TMPRLDRVKNLTGLVEWCGKNPKLRELANLVVVGGDRRKESKDLEEKAEMKKMFELIDKY  635

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNR+RN ELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  636   NLNGQFRWISSQMNRIRNVELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  695

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  696   GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  755

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  756   IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  806



>gb|ADW80584.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   519 bits (1336),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80599.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   519 bits (1336),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRSKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+  PL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSAPLTIE  803



>ref|XP_010107074.1| Sucrose synthase [Morus notabilis]
 gb|EXC13595.1| Sucrose synthase [Morus notabilis]
Length=806

 Score =   519 bits (1336),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+EKEKRLTS+H E+E+LL+SDVENEEH+CVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADMSIYFPYTEKEKRLTSFHAELEELLFSDVENEEHICVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN++GLVE+Y KS KLRELVNLVVV GDRRKESKDIEE+AEM KMY LI+TY
Sbjct  575   TMARLDRVKNISGLVEWYGKSAKLRELVNLVVVAGDRRKESKDIEEKAEMAKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTRGAFVQPAVYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSG+HIDPYHG++AAELLVDFFEK K DPS W+ IS  GL+RI +KYTWQ
Sbjct  695   GGPAEIIVHGKSGYHIDPYHGDRAAELLVDFFEKSKADPSLWDKISQAGLQRIYDKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA++
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVD  805



>ref|XP_010420928.1| PREDICTED: sucrose synthase 1-like [Camelina sativa]
Length=808

 Score =   519 bits (1336),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RLT +H EIE+LLYSDVENEEHLCVLKD+ KPILF
Sbjct  517   FDPKFNIVSPGADMSIYFPYTEEKRRLTKFHSEIEELLYSDVENEEHLCVLKDKKKPILF  576

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LREL NLVVVGGDRRKESKD EE+AEMKKMY+LI+ Y
Sbjct  577   TMARLDRVKNLSGLVEWYGKNTRLRELANLVVVGGDRRKESKDNEEKAEMKKMYDLIEEY  636

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  637   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  696

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  697   GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISQGGLQRIEEKYTWQ  756

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  757   IYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  807



>emb|CDX70945.1| BnaC03g10290D [Brassica napus]
Length=806

 Score =   519 bits (1336),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 243/291 (84%), Positives = 267/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RLT +HPEIE+LLYSDVEN+EHLCVLKD+ KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFPYTEEKRRLTKFHPEIEELLYSDVENQEHLCVLKDKKKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LRELVNLVVVGGDRRKESKD EE+AEMKK+Y+LI  Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNKRLRELVNLVVVGGDRRKESKDNEEKAEMKKIYDLIDEY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGEQAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGEQAADTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKAVPLAEE  805



>ref|XP_009131818.1| PREDICTED: sucrose synthase 1 [Brassica rapa]
Length=806

 Score =   519 bits (1336),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RLT +HPEIE+LLYSDVEN+EHLCVLKD+ KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFPYTEEKRRLTKFHPEIEELLYSDVENQEHLCVLKDKKKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LR+LVNLVVVGGDRRKESKD EE+AEMKKMY+LI+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNKRLRDLVNLVVVGGDRRKESKDNEEKAEMKKMYDLIEEY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKAVPLAEE  805



>ref|XP_008242292.1| PREDICTED: sucrose synthase [Prunus mume]
 ref|XP_008242293.1| PREDICTED: sucrose synthase [Prunus mume]
Length=806

 Score =   519 bits (1336),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 267/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPYSEKEKRLTS+HPEIE+L+YS VEN+EHLCVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADMSIYFPYSEKEKRLTSFHPEIEELIYSQVENKEHLCVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD EE+AEMKKMYELI TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRKESKDNEEKAEMKKMYELIDTY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR I D+KGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVIADSKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSG+HIDPYHG+QAA++LVDFFEK + DPSHW+ IS GGL+RI EKYTWQ
Sbjct  695   GGPAEIIVHGKSGYHIDPYHGDQAADILVDFFEKSRADPSHWDKISQGGLQRIYEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VP A E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPRAEE  805



>ref|XP_010493195.1| PREDICTED: sucrose synthase 1 [Camelina sativa]
Length=808

 Score =   518 bits (1335),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RLT +H EIE+LLYSDVENEEHLCVLKD+ KPILF
Sbjct  517   FDPKFNIVSPGADMSIYFPYTEEKRRLTKFHSEIEELLYSDVENEEHLCVLKDKKKPILF  576

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LREL NLVVVGGDRRKESKD EE+AEMKKMY+LI+ Y
Sbjct  577   TMARLDRVKNLSGLVEWYGKNTRLRELANLVVVGGDRRKESKDNEEKAEMKKMYDLIEEY  636

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  637   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  696

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  697   GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISQGGLQRIEEKYTWQ  756

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  757   IYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  807



>gb|ADW80602.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   518 bits (1335),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFH+DPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHVDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80574.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   518 bits (1334),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRSKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEE AEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEHAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_010454391.1| PREDICTED: sucrose synthase 1-like isoform X2 [Camelina sativa]
Length=808

 Score =   518 bits (1335),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RLT +H EIE+LLYSDVENEEHLCVLKD+ KPILF
Sbjct  517   FDPKFNIVSPGADMSIYFPYTEEKRRLTKFHSEIEELLYSDVENEEHLCVLKDKKKPILF  576

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LREL NLVVVGGDRRKESKD EE+AEMKKMY+LI+ Y
Sbjct  577   TMARLDRVKNLSGLVEWYGKNTRLRELANLVVVGGDRRKESKDNEEKAEMKKMYDLIEEY  636

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  637   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  696

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  697   GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISQGGLQRIEEKYTWQ  756

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  757   IYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  807



>gb|ADW80596.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   518 bits (1333),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKF+IVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  513   FDPKFDIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRSKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|AIJ28959.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   518 bits (1333),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 243/291 (84%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YF Y+E+++RLTS+HPEIE+LLYS VENEEHLCVLKDRSKPI+F
Sbjct  515   FDPKFNIVSPGADESIYFSYTEEKRRLTSFHPEIEELLYSPVENEEHLCVLKDRSKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLREL NLVVVGGDRRKESKD+EEQAEMKKM+ LI+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEQAEMKKMHSLIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNG FRWISSQMNRVRNGELYRYICDTKG FVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGHFRWISSQMNRVRNGELYRYICDTKGVFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAAELLV FF KCK DPSHW  IS G ++RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAAELLVQFFVKCKADPSHWTKISEGAMQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|AAR03498.1| sucrose synthase [Populus tremuloides]
Length=805

 Score =   518 bits (1333),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 267/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADESIYFPYTEQKLRLTSFHEEIEELLYSPVENDEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLRE++NL VVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNTKLREVLNLDVVGGDRRKESKDIEEQAEMKKMYSHIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>ref|XP_010454392.1| PREDICTED: sucrose synthase 1-like isoform X3 [Camelina sativa]
Length=838

 Score =   518 bits (1335),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RLT +H EIE+LLYSDVENEEHLCVLKD+ KPILF
Sbjct  547   FDPKFNIVSPGADMSIYFPYTEEKRRLTKFHSEIEELLYSDVENEEHLCVLKDKKKPILF  606

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LREL NLVVVGGDRRKESKD EE+AEMKKMY+LI+ Y
Sbjct  607   TMARLDRVKNLSGLVEWYGKNTRLRELANLVVVGGDRRKESKDNEEKAEMKKMYDLIEEY  666

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  667   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  726

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  727   GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISQGGLQRIEEKYTWQ  786

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  787   IYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  837



>gb|ADW80603.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   517 bits (1332),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFW+HVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWEHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80608.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   517 bits (1332),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+ LYS VEN+EHLCVLKDRSKPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEEPLYSPVENDEHLCVLKDRSKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_003546526.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006597891.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=806

 Score =   517 bits (1332),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 240/291 (82%), Positives = 269/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E E+RLT +HP+IE+LLYS VENEEH+CVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADMSIYFPYTETERRLTEFHPDIEELLYSSVENEEHICVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ +LRELVNLVVV GDRRKESKD+EE+AEMKKMY LI+TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNARLRELVNLVVVAGDRRKESKDLEEKAEMKKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVICDTRGAFVQPAVYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSG+HIDPYHG++AAE+LV+FFEK K DPSHW+ IS GGLKRI EKYTWQ
Sbjct  695   GGPAEIIVHGKSGYHIDPYHGDRAAEILVEFFEKSKADPSHWDKISQGGLKRIHEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  755   IYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>sp|P31926.1|SUSY_VICFA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vicia faba]
 emb|CAA49428.1| sucrose synthase [Vicia faba]
 gb|AAC37346.1| UDP-glucose:D-fructose-2-glucosyltransferase [Vicia faba]
Length=806

 Score =   517 bits (1332),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 243/291 (84%), Positives = 267/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YFPY+E  +RLTS++PEIE+LLYS VENEEH+CVLKDRSKPI+F
Sbjct  515   FDPKFNIVSPGADQTIYFPYTETSRRLTSFYPEIEELLYSTVENEEHICVLKDRSKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD+EE+AEMKKMYELI+TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRKESKDLEEKAEMKKMYELIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM  GLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMATGLPTFATLN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKADPSHWDKISLGGLQRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|ADW80578.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   517 bits (1332),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKM+  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMHNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80579.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   517 bits (1332),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWR  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKH S LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHASNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|AGM14949.1| sucrose synthase 4 [Hevea brasiliensis]
Length=806

 Score =   517 bits (1332),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 243/291 (84%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YF Y+E+++RLTS+HPEIE+LL+S VENEEHLCVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADESIYFAYTEEKRRLTSFHPEIEELLFSPVENEEHLCVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EEQAEMKKM+ LI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEQAEMKKMHGLIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNG FRWISSQMNRVRNGELYRYICDTKG FVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGHFRWISSQMNRVRNGELYRYICDTKGVFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAAELLVDFFEK K DPSHW  IS G ++RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAAELLVDFFEKSKADPSHWNNISQGAMQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|ADW80588.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   517 bits (1332),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD +++FPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIHFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|KHN49081.1| Sucrose synthase [Glycine soja]
Length=806

 Score =   517 bits (1332),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 240/291 (82%), Positives = 269/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E E+RLT +HP+IE+LLYS VENEEH+CVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADMSIYFPYTETERRLTEFHPDIEELLYSSVENEEHICVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ +LRELVNLVVV GDRRKESKD+EE+AEMKKMY LI+TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNARLRELVNLVVVAGDRRKESKDLEEKAEMKKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVICDTRGAFVQPAVYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSG+HIDPYHG++AAE+LV+FFEK K DPSHW+ IS GGLKRI EKYTWQ
Sbjct  695   GGPAEIIVHGKSGYHIDPYHGDRAAEILVEFFEKSKADPSHWDKISQGGLKRIHEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  755   IYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>gb|AIJ28962.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   517 bits (1332),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 267/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YF Y+E+++RLTS+HPEIE+LLYS VENEEHLCVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADESIYFAYTEEKRRLTSFHPEIEELLYSPVENEEHLCVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLREL NLVVVGGDRRKESKD+EEQAEMKKM+ LI+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEQAEMKKMHSLIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYR ICDTKG FVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRCICDTKGVFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAAELLV+FFEKCK DP HW+ IS G ++RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAAELLVEFFEKCKADPPHWDKISQGAMQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|ADW80590.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   517 bits (1331),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTG VE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGFVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80577.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   517 bits (1331),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLE+FYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEVFYALKYRKLADSVPLTIE  803



>gb|ADW80592.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   517 bits (1331),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRSKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+  
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKC  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80605.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   517 bits (1331),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKES+DIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESEDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_006400648.1| hypothetical protein EUTSA_v10012719mg [Eutrema salsugineum]
 gb|ESQ42101.1| hypothetical protein EUTSA_v10012719mg [Eutrema salsugineum]
Length=806

 Score =   517 bits (1331),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 267/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RLT ++PEIE+LLYSDVENEEHLCVLKD+ KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFPYTEEKRRLTKFYPEIEELLYSDVENEEHLCVLKDKKKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LRELVNLVVVGGDRRKESKD EE+AEMKKMY+LI+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNTRLRELVNLVVVGGDRRKESKDNEEKAEMKKMYDLIEEY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFAKCKEDPSHWDEISKGGLQRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD LE RRYLEMFYALK+R LA+ VPLA E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDHLESRRYLEMFYALKYRPLAQAVPLAQE  805



>gb|ADW80611.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   517 bits (1331),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRSKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAF LTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFELTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80597.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   517 bits (1331),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++ FPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  513   FDPKFNIVSPGADESICFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRSKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIERY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_007138617.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 ref|XP_007138618.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 gb|ESW10611.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 gb|ESW10612.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
Length=806

 Score =   517 bits (1331),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E E+RLT++H EIE+LLYS VENEEH+CVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADMGIYFPYTETERRLTNFHAEIEELLYSSVENEEHICVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ +LRELVNLVVV GDRRKESKD+EE+AEMKKMY LI+TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNARLRELVNLVVVAGDRRKESKDLEEKAEMKKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATFN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV GKSG+HIDPYHG++AAE+LVDFFEK K DPSHW+ IS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVDGKSGYHIDPYHGDRAAEILVDFFEKSKADPSHWDKISQGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  755   IYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>gb|ADW80609.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   516 bits (1330),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 246/291 (85%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRSKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARL RVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLYRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_010271909.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score =   516 bits (1330),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 243/291 (84%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+E RLTS HPEIE+LLYS VENEEHLCVL DRSKPI+F
Sbjct  515   FDPKFNIVSPGADMSIYFPYTEEENRLTSLHPEIEELLYSKVENEEHLCVLNDRSKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             +MARLDRVKN+TGLVE+Y K+ +LRELVNLVVV GDRRKESKD EE+ EMKKMY LI+ Y
Sbjct  575   SMARLDRVKNMTGLVEWYGKNTRLRELVNLVVVAGDRRKESKDNEEKEEMKKMYGLIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYI DTKGAFVQPAFYEAFGLTVVEAMTCGLPTFAT H
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATCH  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPY G++AAELLV FFEKCK+DPSHWE IS GGLKRI EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYQGDRAAELLVHFFEKCKEDPSHWEKISQGGLKRIHEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RL+TL+ VYGFWK+VSKL+R E RRYLEMFYALK+RKLA+ VPLA++
Sbjct  755   IYSERLMTLSGVYGFWKYVSKLERRETRRYLEMFYALKYRKLAQMVPLAVD  805



>gb|ADW80601.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   516 bits (1330),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 244/291 (84%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTRGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKY W+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYAWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80580.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   516 bits (1330),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS V N+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVGNDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|KGN66333.1| hypothetical protein Csa_1G597800 [Cucumis sativus]
Length=783

 Score =   516 bits (1328),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 269/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E EKRLT++HPEIE+LLYS+VENEEHLCVLKDRSKPI+F
Sbjct  492   FDPKFNIVSPGADMSIYFPYTETEKRLTAFHPEIEELLYSEVENEEHLCVLKDRSKPIIF  551

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ +LRELVNLVVV GDRRKESKD EE+AEM+KMY LIKTY
Sbjct  552   TMARLDRVKNITGLVEWYGKNDRLRELVNLVVVAGDRRKESKDNEEKAEMEKMYNLIKTY  611

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWIS+QMNRVRNGELYRYI DTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  612   NLNGQFRWISAQMNRVRNGELYRYIADTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCN  671

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV GKSGFHIDPY G++AAE+LVDFFEK K+DP+HW+ IS  GLKRI EKYTWQ
Sbjct  672   GGPAEIIVDGKSGFHIDPYRGDRAAEILVDFFEKSKEDPTHWDEISQAGLKRIYEKYTWQ  731

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLA+ VP A++
Sbjct  732   IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLADSVPPAVD  782



>ref|XP_010454390.1| PREDICTED: sucrose synthase 1-like isoform X1 [Camelina sativa]
Length=862

 Score =   518 bits (1334),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RLT +H EIE+LLYSDVENEEHLCVLKD+ KPILF
Sbjct  571   FDPKFNIVSPGADMSIYFPYTEEKRRLTKFHSEIEELLYSDVENEEHLCVLKDKKKPILF  630

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LREL NLVVVGGDRRKESKD EE+AEMKKMY+LI+ Y
Sbjct  631   TMARLDRVKNLSGLVEWYGKNTRLRELANLVVVGGDRRKESKDNEEKAEMKKMYDLIEEY  690

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  691   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  750

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  751   GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISQGGLQRIEEKYTWQ  810

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  811   IYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  861



>ref|XP_004488146.1| PREDICTED: sucrose synthase-like isoform X6 [Cicer arietinum]
Length=806

 Score =   516 bits (1329),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 241/291 (83%), Positives = 267/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E E+RLTS+HPEIE+LLYS VENEEH+CVLKDRSKPI+F
Sbjct  515   FDPKFNIVSPGADMSIYFPYTETERRLTSFHPEIEELLYSSVENEEHICVLKDRSKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ +LRELVNLVVV GDRRKESKD+EE+AEMKKMY LI+TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNARLRELVNLVVVAGDRRKESKDLEEKAEMKKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNR+RNGELYR ICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRIRNGELYRVICDTKGAFVQPAIYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSG+HIDPYHG+ AAE LV+FFEK K DPS+W+ IS GGLKRI EKYTWQ
Sbjct  695   GGPAEIIVHGKSGYHIDPYHGDLAAETLVEFFEKSKADPSYWDKISHGGLKRIHEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTL  VYGFWKHV+ LDR E +RYLEMFYALK+ KLAE VPLA+E
Sbjct  755   IYSDRLLTLTGVYGFWKHVTNLDRRESKRYLEMFYALKYNKLAEAVPLAVE  805



>ref|NP_001292638.1| sucrose synthase [Cucumis sativus]
 gb|AEN83999.1| sucrose synthase [Cucumis sativus]
Length=806

 Score =   516 bits (1329),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 269/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E EKRLT++HPEIE+LLYS+VENEEHLCVLKDRSKPI+F
Sbjct  515   FDPKFNIVSPGADMSIYFPYTETEKRLTAFHPEIEELLYSEVENEEHLCVLKDRSKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ +LRELVNLVVV GDRRKESKD EE+AEM+KMY LIKTY
Sbjct  575   TMARLDRVKNITGLVEWYGKNDRLRELVNLVVVAGDRRKESKDNEEKAEMEKMYNLIKTY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWIS+QMNRVRNGELYRYI DTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISAQMNRVRNGELYRYIADTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV GKSGFHIDPY G++AAE+LVDFFEK K+DP+HW+ IS  GLKRI EKYTWQ
Sbjct  695   GGPAEIIVDGKSGFHIDPYRGDRAAEILVDFFEKSKEDPTHWDEISQAGLKRIYEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLA+ VP A++
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLADSVPPAVD  805



>gb|AGQ57012.1| sucrose synthase 1 [Hevea brasiliensis]
Length=806

 Score =   516 bits (1329),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 243/291 (84%), Positives = 264/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E++ RLTS+HPEIE+LLYS VENEEHLCVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADMSIYFPYTEEKLRLTSFHPEIEELLYSPVENEEHLCVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EEQAEMKKM+ LI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEQAEMKKMHGLIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNG FRWISSQMNRVRNGELYR+ICDTKG FVQPA YEAFGL VVEAMTCGLPTFAT +
Sbjct  635   NLNGHFRWISSQMNRVRNGELYRFICDTKGVFVQPALYEAFGLAVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGK GF+IDPYHG QAAELLVDFFEK K DPSHW  IS G ++RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKPGFNIDPYHGGQAAELLVDFFEKSKADPSHWNNISRGAMQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|ADW80604.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   516 bits (1328),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDRSKPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRSKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NL+GQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGL VVEAMTCGLPTFAT +
Sbjct  633   NLSGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLPVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_004144053.1| PREDICTED: sucrose synthase [Cucumis sativus]
 ref|XP_011660038.1| PREDICTED: sucrose synthase [Cucumis sativus]
Length=806

 Score =   516 bits (1328),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 269/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E EKRLT++HPEIE+LLYS+VENEEHLCVLKDRSKPI+F
Sbjct  515   FDPKFNIVSPGADMSIYFPYTETEKRLTAFHPEIEELLYSEVENEEHLCVLKDRSKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ +LRELVNLVVV GDRRKESKD EE+AEM+KMY LIKTY
Sbjct  575   TMARLDRVKNITGLVEWYGKNDRLRELVNLVVVAGDRRKESKDNEEKAEMEKMYNLIKTY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWIS+QMNRVRNGELYRYI DTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISAQMNRVRNGELYRYIADTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV GKSGFHIDPY G++AAE+LVDFFEK K+DP+HW+ IS  GLKRI EKYTWQ
Sbjct  695   GGPAEIIVDGKSGFHIDPYRGDRAAEILVDFFEKSKEDPTHWDEISQAGLKRIYEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLA+ VP A++
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLADSVPPAVD  805



>ref|NP_566865.2| sucrose synthase 4 [Arabidopsis thaliana]
 sp|Q9LXL5.1|SUS4_ARATH RecName: Full=Sucrose synthase 4; Short=AtSUS4; AltName: Full=Sucrose-UDP 
glucosyltransferase 4 [Arabidopsis thaliana]
 emb|CAB89040.1| sucrose synthase-like protein [Arabidopsis thaliana]
 gb|AEE77773.1| sucrose synthase 4 [Arabidopsis thaliana]
Length=808

 Score =   516 bits (1328),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 267/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YF Y+E+++RLT++H EIE+LLYSDVENEEHLCVLKD+ KPI+F
Sbjct  517   FDPKFNIVSPGADMSIYFAYTEEKRRLTAFHLEIEELLYSDVENEEHLCVLKDKKKPIIF  576

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LRELVNLVVVGGDRRKES+D EE+AEMKKMYELI+ Y
Sbjct  577   TMARLDRVKNLSGLVEWYGKNTRLRELVNLVVVGGDRRKESQDNEEKAEMKKMYELIEEY  636

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  637   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  696

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AAE L DFF KCK DPSHW+ IS GGL+RIQEKYTWQ
Sbjct  697   GGPAEIIVHGKSGFHIDPYHGDKAAESLADFFTKCKHDPSHWDQISLGGLERIQEKYTWQ  756

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  757   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAHE  807



>gb|ADW80583.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   516 bits (1328),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHI PYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIVPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ABD61653.1| sucrose synthase [Cichorium intybus]
Length=806

 Score =   516 bits (1328),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 243/292 (83%), Positives = 265/292 (91%), Gaps = 1/292 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKR-LTSYHPEIEDLLYSDVENEEHLCVLKDRSKPIL  1080
             FDPKFNIVSPGADM +YF Y+EKE   LT+ HPEI++LL+S VENEEHLCVLKD+ KPIL
Sbjct  514   FDPKFNIVSPGADMGIYFSYTEKENVVLTALHPEIDELLFSSVENEEHLCVLKDKKKPIL  573

Query  1079  FTMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKT  900
             FTMARLD VKNLTGLVE+YAK+ KLRELVNLVVVGGDRRKESKD+EEQA+MKKMY+LI  
Sbjct  574   FTMARLDNVKNLTGLVEWYAKNDKLRELVNLVVVGGDRRKESKDLEEQAQMKKMYDLIDE  633

Query  899   YNLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATN  720
             Y LNGQFRWISSQMNR+RNGELYR I DT+GAF+QPAFYEAFGLTVVEAMTCGLPTFAT 
Sbjct  634   YKLNGQFRWISSQMNRIRNGELYRVIADTRGAFIQPAFYEAFGLTVVEAMTCGLPTFATL  693

Query  719   HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  540
             HGGPAEIIVHGKSGFHIDPYHG+Q  +LLV FFEK K DPSHWE IS G  +RIQEKYTW
Sbjct  694   HGGPAEIIVHGKSGFHIDPYHGDQVTDLLVKFFEKTKVDPSHWEAISKGAEQRIQEKYTW  753

Query  539   QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             QIYSDRLLTLA VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA++
Sbjct  754   QIYSDRLLTLAGVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAESVPLAVD  805



>gb|AGV22112.1| sucrose synthase 2 [Betula luminifera]
Length=807

 Score =   515 bits (1326),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 241/291 (83%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+EKEKRLTS+HPEIE+LLYS VENEEHLCVLKDR+KPI+F
Sbjct  517   FDPKFNIVSPGADMSIYFPYTEKEKRLTSFHPEIEELLYSPVENEEHLCVLKDRNKPIIF  576

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ +LRELVNLVVV GDRRKESKD EE+AEMKKM+ LI+TY
Sbjct  577   TMARLDRVKNITGLVEWYGKNARLRELVNLVVVAGDRRKESKDNEEKAEMKKMHGLIETY  636

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYI DT+GAFVQPA YEAFGLTVVE+MTCGLPTFAT +
Sbjct  637   KLNGQFRWISSQMNRVRNGELYRYIADTRGAFVQPAVYEAFGLTVVESMTCGLPTFATCN  696

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSG+HIDPYHG+QAA+LLVDFFEK K DPSHW+ IS GGL+RI EKYTW+
Sbjct  697   GGPAEIIVHGKSGYHIDPYHGDQAAQLLVDFFEKSKADPSHWDKISQGGLQRILEKYTWK  756

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDRLE RRY+ MFYALK+RKLAE VP  +E
Sbjct  757   IYSERLLTLTGVYGFWKHVSNLDRLESRRYIGMFYALKYRKLAESVPPVVE  807



>ref|XP_007154543.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
 gb|ESW26537.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
Length=805

 Score =   515 bits (1326),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 240/291 (82%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YF + E  +RLTS+HPEIE+LLYS VENEEH+CVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADQTIYFSHKETSRRLTSFHPEIEELLYSSVENEEHICVLKDRTKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD+EE+AEMKKMY LI+TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNEKLRELVNLVVVAGDRRKESKDLEEKAEMKKMYSLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR I DT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVISDTRGAFVQPAVYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEKCK +PSHW+TIS  GL+RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKCKVEPSHWDTISQAGLQRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>dbj|BAM05649.1| sucrose synthase 3 [Eucalyptus globulus subsp. globulus]
Length=806

 Score =   515 bits (1326),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 241/290 (83%), Positives = 265/290 (91%), Gaps = 0/290 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YF Y+E++ RL S+H EIE+LL+SDVEN+EHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFSYTEEKLRLKSFHAEIEELLFSDVENKEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ +LRELVNLVVVGGDRRKESKD+EEQAEMKKMY LI+TY
Sbjct  575   TMARLDRVKNLTGLVEWYGKNTRLRELVNLVVVGGDRRKESKDLEEQAEMKKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTRGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAAE L DFFEKCK DPSHW+ IS G ++RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDQAAETLADFFEKCKVDPSHWDKISQGAMQRIKEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAI  387
             IYS+RLL L +VYGFWKHVS LDRLE RRYLEMFYALK+RKL  D  L I
Sbjct  755   IYSERLLNLTAVYGFWKHVSNLDRLESRRYLEMFYALKYRKLVRDSQLFI  804



>emb|CAA09910.1| sucrose synthase [Pisum sativum]
Length=806

 Score =   514 bits (1325),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YFPY+E  +RLTS++PEIE+LLYS VENEEH+CVLKDRSKPI+F
Sbjct  515   FDPKFNIVSPGADQTIYFPYTETSRRLTSFYPEIEELLYSTVENEEHICVLKDRSKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD+EE+AEMKKMYE I+TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRKESKDLEEKAEMKKMYEHIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM  GLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMATGLPTFATLN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKTDPSHWDKISQGGLQRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|ABW76422.1| sucrose synthase [Populus tremuloides]
Length=803

 Score =   514 bits (1325),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 243/291 (84%), Positives = 264/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E+++RLTS+H EIE  LYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEQKRRLTSFHEEIETPLYSSVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDI+E AEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIDEHAEMKKMYSHIEKY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_008382924.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   514 bits (1325),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 263/291 (90%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADMN+YFP+SEKEKRLT +HPEIE+LLY  VEN EHLCVLKDR+KPI+F
Sbjct  516   FDPKFNIVSPGADMNVYFPFSEKEKRLTHFHPEIEELLYGQVENIEHLCVLKDRNKPIIF  575

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRR ESKD EE+AE+KKMYELI TY
Sbjct  576   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRNESKDNEEKAELKKMYELIDTY  635

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQ RWISSQMNRVRNGELYRYICDT+GAFVQPA YEAFGLTV+EAMTCGLPTFAT  
Sbjct  636   KLNGQLRWISSQMNRVRNGELYRYICDTRGAFVQPAVYEAFGLTVIEAMTCGLPTFATCK  695

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSG+HIDPYHG+QAAE+ VDFFEK K DPSHW+ IS GGL+RI EKYTWQ
Sbjct  696   GGPAEIIVNGKSGYHIDPYHGDQAAEIJVDFFEKNKADPSHWDKISQGGLQRIYEKYTWQ  755

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  756   IYSERLLTLTGVYGFWKDVSNLDRLESRRYLEMFYALKFRKLAASVPLAVE  806



>ref|XP_008349074.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   514 bits (1325),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 263/291 (90%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADMN+YFP+SEKEKRLT +HPEIE+LLY  VEN EHLCVLKDR+KPI+F
Sbjct  516   FDPKFNIVSPGADMNVYFPFSEKEKRLTHFHPEIEELLYGQVENIEHLCVLKDRNKPIIF  575

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRR ESKD EE+AE+KKMYELI TY
Sbjct  576   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRNESKDNEEKAELKKMYELIDTY  635

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQ RWISSQMNRVRNGELYRYICDT+GAFVQPA YEAFGLTV+EAMTCGLPTFAT  
Sbjct  636   KLNGQLRWISSQMNRVRNGELYRYICDTRGAFVQPAVYEAFGLTVIEAMTCGLPTFATCK  695

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSG+HIDPYHG+QAAE+ VDFFEK K DPSHW+ IS GGL+RI EKYTWQ
Sbjct  696   GGPAEIIVNGKSGYHIDPYHGDQAAEIJVDFFEKNKADPSHWDKISQGGLQRIYEKYTWQ  755

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  756   IYSERLLTLTGVYGFWKDVSNLDRLESRRYLEMFYALKFRKLAASVPLAVE  806



>gb|ACP17902.1| sucrose synthase [Phaseolus vulgaris]
Length=806

 Score =   514 bits (1324),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 240/291 (82%), Positives = 267/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E E+RLT++H E+E+LLYS VENEEH+CVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADMGIYFPYTETERRLTNFHAEVEELLYSSVENEEHICVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ +LRELVNLVVV GDRRKESKD+EE+AEMKKMY LI+TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNARLRELVNLVVVAGDRRKESKDLEEKAEMKKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATFN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV GKSG+HIDPYHG++AAE+LVDFFEK K DPSHWE IS GGLKRIQEKYTWQ
Sbjct  695   GGPAEIIVDGKSGYHIDPYHGDRAAEILVDFFEKSKADPSHWEKISQGGLKRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             +YSDRLLTL  VYGFWKHV+ L+R E +R LEMFYALK+RKLAE VPLAIE
Sbjct  755   VYSDRLLTLTGVYGFWKHVTNLERRESKRSLEMFYALKYRKLAESVPLAIE  805



>ref|XP_002874016.1| hypothetical protein ARALYDRAFT_910122 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50275.1| hypothetical protein ARALYDRAFT_910122 [Arabidopsis lyrata subsp. 
lyrata]
Length=808

 Score =   514 bits (1323),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 240/289 (83%), Positives = 263/289 (91%), Gaps = 0/289 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RLT +H EIE+LLYSDVENEEHLCVLKD+ KPILF
Sbjct  517   FDPKFNIVSPGADMSIYFPYTEEKRRLTKFHSEIEELLYSDVENEEHLCVLKDKKKPILF  576

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LREL NLVVVGGDRRKESKD EE+AEMKKMY+LI+ Y
Sbjct  577   TMARLDRVKNLSGLVEWYGKNTRLRELANLVVVGGDRRKESKDNEEKAEMKKMYDLIEEY  636

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  637   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  696

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAA  L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  697   GGPAEIIVHGKSGFHIDPYHGDQAANTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQ  756

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  390
             IYS RLLTL  VYGFWKHVS LD LE RRYLEMFYALK+R LA+ VPLA
Sbjct  757   IYSQRLLTLTGVYGFWKHVSNLDHLEARRYLEMFYALKYRPLAQAVPLA  805



>ref|XP_002877269.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53528.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
Length=808

 Score =   514 bits (1323),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 241/291 (83%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADMN+YF Y+E+++RLT++H EIE+LLYSDVENE+HLCVLKD+ KPILF
Sbjct  517   FDPKFNIVSPGADMNIYFAYTEEKRRLTAFHQEIEELLYSDVENEKHLCVLKDKKKPILF  576

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LRELVNLVVVGGDR KES+D EE+AEMKKMY+LI+ Y
Sbjct  577   TMARLDRVKNLSGLVEWYGKNTRLRELVNLVVVGGDRSKESQDNEEKAEMKKMYDLIEEY  636

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMT GLPTFAT +
Sbjct  637   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTSGLPTFATCN  696

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAAE L DFF KCK DPSHW+ IS GGL+RIQEKYTWQ
Sbjct  697   GGPAEIIVHGKSGFHIDPYHGDQAAETLADFFTKCKHDPSHWDQISLGGLERIQEKYTWQ  756

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  757   IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  807



>ref|NP_197583.1| sucrose synthase 1 [Arabidopsis thaliana]
 ref|NP_001031915.1| sucrose synthase 1 [Arabidopsis thaliana]
 sp|P49040.3|SUSY1_ARATH RecName: Full=Sucrose synthase 1; Short=AtSUS1; AltName: Full=Sucrose-UDP 
glucosyltransferase 1 [Arabidopsis thaliana]
 dbj|BAH19538.1| AT5G20830 [Arabidopsis thaliana]
 gb|AED92894.1| sucrose synthase 1 [Arabidopsis thaliana]
 gb|AED92895.1| sucrose synthase 1 [Arabidopsis thaliana]
Length=808

 Score =   514 bits (1323),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 239/289 (83%), Positives = 265/289 (92%), Gaps = 0/289 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RLT +H EIE+LLYSDVEN+EHLCVLKD+ KPILF
Sbjct  517   FDPKFNIVSPGADMSIYFPYTEEKRRLTKFHSEIEELLYSDVENKEHLCVLKDKKKPILF  576

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LREL NLVVVGGDRRKESKD EE+AEMKKMY+LI+ Y
Sbjct  577   TMARLDRVKNLSGLVEWYGKNTRLRELANLVVVGGDRRKESKDNEEKAEMKKMYDLIEEY  636

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQM+RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  637   KLNGQFRWISSQMDRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  696

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  697   GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQ  756

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  390
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA
Sbjct  757   IYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLA  805



>gb|KHN47619.1| Sucrose synthase [Glycine soja]
Length=806

 Score =   514 bits (1323),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 239/291 (82%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E E+RLT +H +IE+LLYS VENEEH+CVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADMGIYFPYTETERRLTEFHSDIEELLYSSVENEEHICVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ +LRELVNLVVV GDRRKESKD+EE+AEMKKMY LI+TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNARLRELVNLVVVAGDRRKESKDLEEKAEMKKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVICDTRGAFVQPAVYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSG+HIDPYHG+ AAE+LV+FFEK K DPSHW+ IS GGLKRI EKYTWQ
Sbjct  695   GGPAEIIVHGKSGYHIDPYHGDHAAEILVEFFEKSKADPSHWDKISQGGLKRIHEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  755   IYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>ref|XP_003533802.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006587064.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=806

 Score =   514 bits (1323),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 239/291 (82%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E E+RLT +H +IE+LLYS VENEEH+CVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADMGIYFPYTETERRLTEFHSDIEELLYSSVENEEHICVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ +LRELVNLVVV GDRRKESKD+EE+AEMKKMY LI+TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNARLRELVNLVVVAGDRRKESKDLEEKAEMKKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVICDTRGAFVQPAVYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSG+HIDPYHG+ AAE+LV+FFEK K DPSHW+ IS GGLKRI EKYTWQ
Sbjct  695   GGPAEIIVHGKSGYHIDPYHGDHAAEILVEFFEKSKADPSHWDKISQGGLKRIHEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  755   IYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>gb|ADW80576.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   513 bits (1322),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++YFPY+E++ RLTS+H EIE+LLYS VEN+EHLCVLKDR+KPILF
Sbjct  513   FDPKFNIVSPGADESIYFPYTEEKLRLTSFHEEIEELLYSPVENDEHLCVLKDRNKPILF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKDIEEQAEMKKMY  I+ Y
Sbjct  573   TMARLDRVKNLTGLVEWYGKNTKLRELANLVVVGGDRRKESKDIEEQAEMKKMYNHIEEY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMT GLPTFAT +
Sbjct  633   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTRGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693   GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753   IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>pdb|3S28|A Chain A, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|B Chain B, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|C Chain C, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|D Chain D, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|E Chain E, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|F Chain F, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|G Chain G, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|H Chain H, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S29|A Chain A, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|B Chain B, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|C Chain C, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|D Chain D, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|E Chain E, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|F Chain F, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|G Chain G, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|H Chain H, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
Length=816

 Score =   514 bits (1323),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 239/289 (83%), Positives = 265/289 (92%), Gaps = 0/289 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RLT +H EIE+LLYSDVEN+EHLCVLKD+ KPILF
Sbjct  517   FDPKFNIVSPGADMSIYFPYTEEKRRLTKFHSEIEELLYSDVENKEHLCVLKDKKKPILF  576

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LREL NLVVVGGDRRKESKD EE+AEMKKMY+LI+ Y
Sbjct  577   TMARLDRVKNLSGLVEWYGKNTRLRELANLVVVGGDRRKESKDNEEKAEMKKMYDLIEEY  636

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQM+RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  637   KLNGQFRWISSQMDRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  696

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  697   GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQ  756

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  390
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA
Sbjct  757   IYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLA  805



>ref|XP_008450968.1| PREDICTED: sucrose synthase [Cucumis melo]
 ref|XP_008450969.1| PREDICTED: sucrose synthase [Cucumis melo]
 ref|XP_008450970.1| PREDICTED: sucrose synthase [Cucumis melo]
Length=806

 Score =   513 bits (1322),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E EKRLTS+HPEIE+LLYS+VENEEHLCVLKDRSKPI+F
Sbjct  515   FDPKFNIVSPGADMSIYFPYTETEKRLTSFHPEIEELLYSEVENEEHLCVLKDRSKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ +LRELVNLVVV GDRRKESKD EE+AEM+KMY LIKTY
Sbjct  575   TMARLDRVKNITGLVEWYGKNNRLRELVNLVVVAGDRRKESKDNEEKAEMEKMYNLIKTY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWIS+QMNRVRNGELYR I DTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISAQMNRVRNGELYRCIADTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV GKSGFHIDPY G++AAE+LVDFFEK K+DP+HW+ IS  GLKRI EKYTWQ
Sbjct  695   GGPAEIIVDGKSGFHIDPYRGDRAAEILVDFFEKSKEDPTHWDKISQAGLKRIYEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLA+ VP A++
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLADSVPPAVD  805



>ref|XP_006287059.1| hypothetical protein CARUB_v10000208mg, partial [Capsella rubella]
 gb|EOA19957.1| hypothetical protein CARUB_v10000208mg, partial [Capsella rubella]
Length=850

 Score =   514 bits (1325),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 240/289 (83%), Positives = 265/289 (92%), Gaps = 0/289 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E+++RLT +H EIE+LLYSDVENEEHLCVLKD+ KPILF
Sbjct  559   FDPKFNIVSPGADMSIYFPYTEEKRRLTKFHSEIEELLYSDVENEEHLCVLKDKKKPILF  618

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ +LREL NLVVVGGDRRKESKD EE+AEMKKMY+LI+ Y
Sbjct  619   TMARLDRVKNLSGLVEWYGKNTRLRELANLVVVGGDRRKESKDNEEKAEMKKMYDLIEKY  678

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQM+RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  679   KLNGQFRWISSQMDRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  738

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  739   GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISLGGLQRIEEKYTWQ  798

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  390
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA
Sbjct  799   IYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLA  847



>ref|XP_009348896.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   513 bits (1321),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 241/291 (83%), Positives = 264/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPYSEKEKRLT +HPEIE+LLY  VEN E LCVLKDR+KPI+F
Sbjct  516   FDPKFNIVSPGADMDVYFPYSEKEKRLTHFHPEIEELLYGQVENIEQLCVLKDRNKPIIF  575

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNL+VV GDRR ESKDIEE+AE+KKMYELI TY
Sbjct  576   TMARLDRVKNITGLVEWYGKNAKLRELVNLLVVAGDRRNESKDIEEKAELKKMYELIDTY  635

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQ RWISSQMNRVRNGELYRYICDT+GAFVQPA YEAFGLTV+EAMTCGLPTFAT  
Sbjct  636   KLNGQLRWISSQMNRVRNGELYRYICDTRGAFVQPAVYEAFGLTVIEAMTCGLPTFATCM  695

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSG+HIDPYHG+QAAE+LVDFFEK K DPSHW+ IS GGL+RI EKYTWQ
Sbjct  696   GGPAEIIVNGKSGYHIDPYHGDQAAEILVDFFEKSKADPSHWDKISQGGLQRIYEKYTWQ  755

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALK+RKLA  VPLA+E
Sbjct  756   IYSERLLTLTGVYGFWKDVSNLDRLESRRYLEMFYALKYRKLAASVPLAVE  806



>ref|XP_002516210.1| sucrose synthase, putative [Ricinus communis]
 gb|EEF46212.1| sucrose synthase, putative [Ricinus communis]
Length=773

 Score =   511 bits (1317),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 239/291 (82%), Positives = 267/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++Y+PY++ ++RLTS+HPEIE+LLYS VENEEHLCVLKDRSKPI+F
Sbjct  483   FDPKFNIVSPGADESIYYPYTDTKRRLTSFHPEIEELLYSPVENEEHLCVLKDRSKPIIF  542

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMAR+DRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EEQAEMKKM+ LI+ Y
Sbjct  543   TMARMDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEQAEMKKMHGLIEKY  602

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYR ICDTKG FVQPA YEAFGLTVVE+M+CGLPTFAT +
Sbjct  603   NLNGQFRWISSQMNRVRNGELYRCICDTKGVFVQPALYEAFGLTVVESMSCGLPTFATCN  662

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAAELLV+FFEKCK DP  W+ IS GGL+RIQEKYTWQ
Sbjct  663   GGPAEIIVHGKSGFNIDPYHGDQAAELLVEFFEKCKADPCVWDEISKGGLQRIQEKYTWQ  722

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK++KLA+ VPL +E
Sbjct  723   IYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYKKLADSVPLTVE  773



>gb|AEK81522.1| sucrose synthase isoform D [Gossypium hirsutum]
Length=806

 Score =   513 bits (1320),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 241/291 (83%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++Y+PY+E++KRL  +H EIE LLYS VENEEH CVL D +KPILF
Sbjct  515   FDPKFNIVSPGADMSIYYPYTEEKKRLKHFHSEIEQLLYSKVENEEHWCVLNDHNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNL+GLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EE+AEMKKM+ELI+ Y
Sbjct  575   TMARLDRVKNLSGLVEWYGKNAKLRELVNLVVVGGDRRKESKDLEEKAEMKKMFELIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEA GLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEALGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK D S+W  IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKTDSSYWTKISEGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AII19313.1| sucrose synthase 1, partial [Ricinus communis]
Length=805

 Score =   512 bits (1318),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 239/291 (82%), Positives = 267/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD ++Y+PY++ ++RLTS+HPEIE+LLYS VENEEHLCVLKDRSKPI+F
Sbjct  515   FDPKFNIVSPGADESIYYPYTDTKRRLTSFHPEIEELLYSPVENEEHLCVLKDRSKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMAR+DRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EEQAEMKKM+ LI+ Y
Sbjct  575   TMARMDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEQAEMKKMHGLIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYR ICDTKG FVQPA YEAFGLTVVE+M+CGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRCICDTKGVFVQPALYEAFGLTVVESMSCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAAELLV+FFEKCK DP  W+ IS GGL+RIQEKYTWQ
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAAELLVEFFEKCKADPCVWDEISKGGLQRIQEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK++KLA+ VPL +E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYKKLADSVPLTVE  805



>gb|AIL23782.1| sucrose synthase [Prunus serrulata]
Length=806

 Score =   511 bits (1317),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 245/291 (84%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY  KEKRLTS+HPEIE+LLYS VEN+EHLCVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADMSIYFPYFGKEKRLTSFHPEIEELLYSQVENKEHLCVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD EE+AEMKKM+ELI TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRKESKDNEEKAEMKKMHELIDTY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR I DTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVIADTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSG+HIDPYHG+QAAE+LVDFFEK + DPSHW+ IS GGL+RI EKYT Q
Sbjct  695   GGPAEIIVHGKSGYHIDPYHGDQAAEILVDFFEKSRADPSHWDKISQGGLQRIFEKYTRQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA E
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ABP88869.1| sucrose synthase [Medicago falcata]
Length=804

 Score =   511 bits (1316),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 241/291 (83%), Positives = 264/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YFPY+E  +RLTS++PEIE+LLYS VENEEH+CVLKDR+KPI+F
Sbjct  514   FDPKFNIVSPGADQTIYFPYTETSRRLTSFYPEIEELLYSSVENEEHICVLKDRNKPIIF  573

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD+EE AEMKKMY LI+TY
Sbjct  574   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRKESKDLEEIAEMKKMYGLIETY  633

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM  GLPTFAT +
Sbjct  634   KLNGQFRWISSQMNRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMATGLPTFATLN  693

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGE+AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTW 
Sbjct  694   GGPAEIIVHGKSGFHIDPYHGERAADLLVEFFEKVKADPSHWDKISQGGLQRIEEKYTWT  753

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  754   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  804



>ref|XP_002275155.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656083.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656084.1| PREDICTED: sucrose synthase [Vitis vinifera]
 emb|CBI27755.3| unnamed protein product [Vitis vinifera]
Length=806

 Score =   511 bits (1316),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 238/291 (82%), Positives = 269/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YF Y+E++ RL + HPEIE+LL+S VEN+EHLCVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADMTIYFSYTEEKMRLKALHPEIEELLFSPVENKEHLCVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             +MARLDRVKNLTGLVE+Y K+ +LRELVNLVVVGGDRRKESKD+EEQ+EMKKM+ELI+TY
Sbjct  575   SMARLDRVKNLTGLVEWYGKNTRLRELVNLVVVGGDRRKESKDLEEQSEMKKMHELIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQM+RVRNGELYRYI DTKG FVQPAFYEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMDRVRNGELYRYIADTKGVFVQPAFYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AAELL +FFEKCK DP+HWE IS  GLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDKAAELLANFFEKCKADPTHWEKISKAGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTLA VYGFWK+VS LDR E RRYLEMFYALK+RKLA+ VPLA+E
Sbjct  755   IYSERLLTLAGVYGFWKYVSNLDRRETRRYLEMFYALKYRKLAQSVPLAVE  805



>sp|Q01390.1|SUSY_VIGRR RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vigna radiata var. radiata]
 dbj|BAA01108.1| sucrose synthase [Vigna radiata var. radiata]
Length=805

 Score =   511 bits (1316),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 240/291 (82%), Positives = 264/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YFP++E  +RLTS+H EIE+LLYS VENEEH+CVLKDRSKPI+F
Sbjct  515   FDPKFNIVSPGADQTIYFPHTETSRRLTSFHTEIEELLYSSVENEEHICVLKDRSKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD+EE+AEMKKMY LI+TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRKESKDLEEKAEMKKMYSLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR I DTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVIADTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS  GL+RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISQAGLQRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>dbj|BAA89232.1| wsus [Citrullus lanatus]
Length=806

 Score =   511 bits (1316),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 240/291 (82%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E EKRLTS+HPEIE+LLYS+VENEEHLCVLKDRSKPI+F
Sbjct  515   FDPKFNIVSPGADMSIYFPYTETEKRLTSFHPEIEELLYSEVENEEHLCVLKDRSKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ +LRELVNLVVV GDRRKESKD EE+AEM+KMY LIKTY
Sbjct  575   TMARLDRVKNITGLVEWYGKNKRLRELVNLVVVAGDRRKESKDNEEKAEMEKMYILIKTY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWIS+QMNRVRNGE+YR I DTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISAQMNRVRNGEVYRCIADTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEII+ GKSGFHIDPY G++AAE+LVDFFEK K+DPSHW+ IS  GL+RI EKYTWQ
Sbjct  695   GGPAEIIIDGKSGFHIDPYRGDRAAEILVDFFEKSKEDPSHWDKISQAGLQRIYEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLA+ VP A++
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLADSVPQAVD  805



>ref|XP_009343357.1| PREDICTED: sucrose synthase [Pyrus x bretschneideri]
Length=807

 Score =   511 bits (1315),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 240/291 (82%), Positives = 264/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPYSEKEKRLT +HPEIE+LLYS VEN E +CVLKDR+KPI+F
Sbjct  516   FDPKFNIVSPGADMSVYFPYSEKEKRLTHFHPEIEELLYSQVENIEQICVLKDRNKPIIF  575

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNL+VV GDRR ESKDIEE+AE+KKMYELI TY
Sbjct  576   TMARLDRVKNITGLVEWYGKNAKLRELVNLLVVAGDRRNESKDIEEKAELKKMYELIDTY  635

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQ RWISSQMNRVRNGELYRYICDT+GAFVQPA YEAFGLTV+EAMTCGLPTFAT  
Sbjct  636   KLNGQLRWISSQMNRVRNGELYRYICDTRGAFVQPAVYEAFGLTVIEAMTCGLPTFATCM  695

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSG+HIDPYHG+QAAE+LVDFFEK K DPSHW+ IS GGL+RI EKYTWQ
Sbjct  696   GGPAEIIVNGKSGYHIDPYHGDQAAEILVDFFEKSKADPSHWDKISQGGLQRIYEKYTWQ  755

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWK VS LDR E RRYLEMFYALK+RKLA  VPLA+E
Sbjct  756   IYSERLLTLTGVYGFWKDVSTLDRRESRRYLEMFYALKYRKLAASVPLAVE  806



>ref|XP_009348897.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   511 bits (1315),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 241/291 (83%), Positives = 263/291 (90%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPYSEKEKRLT +HPEIE+LLYS VEN E +CVLKDR+KPI+F
Sbjct  516   FDPKFNIVSPGADMSVYFPYSEKEKRLTHFHPEIEELLYSQVENIEQICVLKDRNKPIIF  575

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVV  GDRR ESKD EE+AE+KKMYELI+TY
Sbjct  576   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVAAGDRRNESKDNEEKAELKKMYELIETY  635

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQ RWISSQMNRVRNGELYRYICDT+GAFVQPA YEAFGLTV+EAMTCGLPTFAT  
Sbjct  636   KLNGQLRWISSQMNRVRNGELYRYICDTRGAFVQPAVYEAFGLTVIEAMTCGLPTFATCK  695

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSG+HIDPY G+QAAE+LVDFFEK K DPSHWE IS GGL+RI EKYTWQ
Sbjct  696   GGPAEIIVNGKSGYHIDPYQGDQAAEILVDFFEKSKADPSHWEKISQGGLQRIYEKYTWQ  755

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  756   IYSERLLTLTGVYGFWKDVSNLDRLENRRYLEMFYALKFRKLAASVPLAVE  806



>dbj|BAM05651.1| sucrose synthase 3, partial [Eucalyptus pyrocarpa]
Length=795

 Score =   510 bits (1313),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 238/281 (85%), Positives = 261/281 (93%), Gaps = 0/281 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YF Y E+++RL S+H EIE+LL+SDVEN+EHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFSYVEEKRRLKSFHAEIEELLFSDVENKEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ +LRELVNLVVVGGDRRKESKD+EEQAEMKKMY LI+TY
Sbjct  575   TMARLDRVKNLTGLVEWYGKNTRLRELVNLVVVGGDRRKESKDLEEQAEMKKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAAE L DFFEKCK DPSHW+ IS G ++RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDQAAETLADFFEKCKVDPSHWDKISQGAMQRIKEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRK  414
             IYS+RLL L +VYGFWKHVS LDRLE RRYLEMFYALK+RK
Sbjct  755   IYSERLLNLTAVYGFWKHVSNLDRLESRRYLEMFYALKYRK  795



>sp|O65026.1|SUSY_MEDSA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Medicago sativa]
 gb|AAC17867.1| sucrose synthase [Medicago sativa]
Length=805

 Score =   510 bits (1314),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 240/291 (82%), Positives = 264/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YFPY+E  +RLTS++PEIE+LLYS VENEEH+CVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADQTIYFPYTETSRRLTSFYPEIEELLYSSVENEEHICVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD+EE AEMKKMY LI+TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRKESKDLEEIAEMKKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM  GLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMATGLPTFATLN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTW 
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKADPSHWDKISQGGLQRIEEKYTWT  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|KJB54541.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=819

 Score =   510 bits (1314),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 238/284 (84%), Positives = 264/284 (93%), Gaps = 0/284 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E+++RL  +H EIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMEIYFPYTEEKRRLKHFHTEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EE+AEMKKM+ELI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEKAEMKKMFELIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNR+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE  405
             IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKL +
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLNQ  798



>dbj|BAM05650.1| sucrose synthase 3, partial [Eucalyptus pilularis]
Length=795

 Score =   509 bits (1312),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 238/281 (85%), Positives = 261/281 (93%), Gaps = 0/281 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YF Y E+++RL S+H EIE+LL+SDVEN+EHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFSYIEEKRRLKSFHAEIEELLFSDVENKEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ +LRELVNLVVVGGDRRKESKD+EEQAEMKKMY LI+TY
Sbjct  575   TMARLDRVKNLTGLVEWYGKNTRLRELVNLVVVGGDRRKESKDLEEQAEMKKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAAE L DFFEKCK DPSHW+ IS G ++RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDQAAETLADFFEKCKVDPSHWDKISQGAMQRIKEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRK  414
             IYS+RLL L +VYGFWKHVS LDRLE RRYLEMFYALK+RK
Sbjct  755   IYSERLLNLTAVYGFWKHVSNLDRLESRRYLEMFYALKYRK  795



>dbj|BAH56282.1| sucrose synthase [Vigna angularis]
Length=805

 Score =   510 bits (1313),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 239/291 (82%), Positives = 264/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YF ++E  +RLTS+HPEIE+LLYS VENEEH+CVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADQTIYFSHTETSRRLTSFHPEIEELLYSSVENEEHICVLKDRTKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD+EE+AEMKKMY LI+TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRKESKDLEEKAEMKKMYSLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR I DTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVIADTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS  GL+RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISEAGLQRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|KJB54539.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=833

 Score =   511 bits (1315),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 238/283 (84%), Positives = 263/283 (93%), Gaps = 0/283 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY+E+++RL  +H EIEDLLYS VENEEHLCVL DR+KPILF
Sbjct  515   FDPKFNIVSPGADMEIYFPYTEEKRRLKHFHTEIEDLLYSKVENEEHLCVLNDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRKESKD+EE+AEMKKM+ELI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNAKLRELANLVVVGGDRRKESKDLEEKAEMKKMFELIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNR+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   NLNGQFRWISSQMNRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLA  408
             IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKL 
Sbjct  755   IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLV  797



>emb|CAB40795.1| sucrose synthase [Medicago truncatula]
Length=805

 Score =   509 bits (1311),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 240/291 (82%), Positives = 264/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YFPY+E  +RLTS++PEIE+LLYS VENEEH+CVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADQTIYFPYTETSRRLTSFYPEIEELLYSSVENEEHICVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD+EE AEMKKMY LI+TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRKESKDLEEIAEMKKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM  GLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMATGLPTFATLN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTW 
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISQGGLQRIEEKYTWT  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_003609949.1| Sucrose synthase [Medicago truncatula]
 emb|CAB40794.1| sucrose synthase [Medicago truncatula]
 gb|AES92146.1| sucrose synthase [Medicago truncatula]
Length=805

 Score =   509 bits (1311),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 240/291 (82%), Positives = 264/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YFPY+E  +RLTS++PEIE+LLYS VENEEH+CVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADQTIYFPYTETSRRLTSFYPEIEELLYSSVENEEHICVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD+EE AEMKKMY LI+TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRKESKDLEEIAEMKKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM  GLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMATGLPTFATLN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTW 
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISQGGLQRIEEKYTWT  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>emb|CAN82840.1| hypothetical protein VITISV_024563 [Vitis vinifera]
Length=806

 Score =   509 bits (1311),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 237/291 (81%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YF Y+E++ RL + HPEIE+LL+S V N+EHLCVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADMTIYFSYTEEKMRLKALHPEIEELLFSPVXNKEHLCVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             +MARLDRVKNLTGLVE+Y K+ +LRELVNLVVVGGDRRKESKD+EEQ+EMKKM+ELI+TY
Sbjct  575   SMARLDRVKNLTGLVEWYGKNTRLRELVNLVVVGGDRRKESKDLEEQSEMKKMHELIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQM+RVRNGELYRYI DTKG FVQPAFYEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMDRVRNGELYRYIADTKGVFVQPAFYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AAELL +FFEKCK DP+HWE IS  GLKRI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDKAAELLANFFEKCKADPTHWEKISKAGLKRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTLA VYGFWK+VS LDR E RRYLEMFYALK+RKLA+ VPLA+E
Sbjct  755   IYSERLLTLAGVYGFWKYVSNLDRRETRRYLEMFYALKYRKLAQSVPLAVE  805



>ref|XP_009359754.1| PREDICTED: sucrose synthase [Pyrus x bretschneideri]
Length=837

 Score =   510 bits (1313),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 241/282 (85%), Positives = 260/282 (92%), Gaps = 0/282 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+EKEKRLT++HPEIE+LLYS VEN+EHLCVLKDR+KPI+F
Sbjct  516   FDPKFNIVSPGADMSVYFPYTEKEKRLTNFHPEIEELLYSQVENKEHLCVLKDRNKPIIF  575

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD EE+ EMKKMYELI TY
Sbjct  576   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRKESKDNEEKDEMKKMYELIDTY  635

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  636   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCK  695

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSG+HIDPYHG+QAAE+LVDFFEK K DPSHW+ IS  GL+RI EKYTWQ
Sbjct  696   GGPAEIIVHGKSGYHIDPYHGDQAAEILVDFFEKSKADPSHWDKISQAGLQRIYEKYTWQ  755

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKL  411
             IYS RLLTL  VYGFWKHVSKLDRLE RRYLEMFYALK+ KL
Sbjct  756   IYSQRLLTLTGVYGFWKHVSKLDRLESRRYLEMFYALKYSKL  797



>ref|NP_001289661.1| sucrose synthase-like [Eucalyptus grandis]
 gb|ABB53601.1| sucrose synthase [Eucalyptus grandis]
Length=805

 Score =   508 bits (1309),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 234/291 (80%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YF Y+E+E+RL S+HPEIE+LL+SDVEN+EHLCVLKD+ KPI+F
Sbjct  515   FDPKFNIVSPGADMSIYFAYTEQERRLKSFHPEIEELLFSDVENKEHLCVLKDKKKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRK+SKD+EEQ+EMKKMY+LI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNSKLRELANLVVVGGDRRKDSKDLEEQSEMKKMYDLIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKG FVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTKGVFVQPAIYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSG+HIDPYHG+QAAELLVDFF KCK D SHW+ IS G ++RI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGYHIDPYHGDQAAELLVDFFNKCKIDQSHWDEISKGAMQRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLL L +VYGFWKHV+ LDR E RRYLEMFYALK+R LA+ VP A+E
Sbjct  755   IYSERLLNLTAVYGFWKHVTNLDRRESRRYLEMFYALKYRPLAQSVPPAVE  805



>gb|AAR19769.1| sucrose synthase [Beta vulgaris]
Length=805

 Score =   508 bits (1309),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 236/291 (81%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+++YF Y+E++KRLT+ HPEIE+LL+S+ +NEEH+CVLKDR KPI+F
Sbjct  512   FDPKFNIVSPGADLSIYFNYTEEKKRLTALHPEIEELLFSETQNEEHICVLKDRKKPIIF  571

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             +MARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD EE+ EMKKMY LI+ Y
Sbjct  572   SMARLDRVKNMTGLVEWYGKNKKLRELVNLVVVAGDRRKESKDTEEKEEMKKMYSLIEEY  631

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWIS+QMNRVRNGELYRYI DT+GAFVQPA+YEAFGLTVVEAMTCGLPTFAT H
Sbjct  632   NLNGQFRWISAQMNRVRNGELYRYIADTRGAFVQPAYYEAFGLTVVEAMTCGLPTFATCH  691

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEK   DPS+WE IS GGL+RI+EKYTW+
Sbjct  692   GGPAEIIVHGKSGFHIDPYHGDKAADLLVDFFEKSTADPSYWENISKGGLQRIEEKYTWK  751

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTLA VYGFWK+VS LDR E RRYLEMFYALK++KLAE VPLAIE
Sbjct  752   IYSDRLLTLAGVYGFWKYVSNLDRREARRYLEMFYALKYKKLAESVPLAIE  802



>ref|XP_010049327.1| PREDICTED: sucrose synthase-like [Eucalyptus grandis]
 ref|XP_010049328.1| PREDICTED: sucrose synthase-like [Eucalyptus grandis]
Length=805

 Score =   508 bits (1309),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 234/291 (80%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YF Y+E+E+RL S+HPEIE+LL+SDVEN+EHLCVLKD+ KPI+F
Sbjct  515   FDPKFNIVSPGADMSIYFAYTEQERRLKSFHPEIEELLFSDVENKEHLCVLKDKKKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLREL NLVVVGGDRRK+SKD+EEQ+EMKKMY+LI+ Y
Sbjct  575   TMARLDRVKNLTGLVEWYGKNSKLRELANLVVVGGDRRKDSKDLEEQSEMKKMYDLIEKY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKG FVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRYICDTKGVFVQPAIYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSG+HIDPYHG+QAAELLVDFF KCK D SHW+ IS G ++RI+EKYTW+
Sbjct  695   GGPAEIIVHGKSGYHIDPYHGDQAAELLVDFFNKCKIDQSHWDEISKGAMQRIEEKYTWK  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLL L +VYGFWKHV+ LDR E RRYLEMFYALK+R LA+ VP A+E
Sbjct  755   IYSERLLNLTAVYGFWKHVTNLDRRESRRYLEMFYALKYRPLAQSVPPAVE  805



>gb|ABE73120.1| SUS1 [Dianthus caryophyllus]
Length=509

 Score =   498 bits (1282),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 234/291 (80%), Positives = 265/291 (91%), Gaps = 1/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E++KRLT+ HPEIE+LL+SDV+NEEH CVLKDR+KPI+F
Sbjct  219   FDPKFNIVSPGADMSIYFPYTEEKKRLTALHPEIEELLFSDVQNEEHTCVLKDRNKPIIF  278

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             +MARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD EE+ EMKKMY LI+ Y
Sbjct  279   SMARLDRVKNMTGLVEWYGKNEKLRELVNLVVVAGDRRKESKDTEEKEEMKKMYGLIEEY  338

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWIS+QMNRVRNGELYRYI DTKGAFVQPA+YEAFGLTVVEAMTCGLPTFAT H
Sbjct  339   KLNGQFRWISAQMNRVRNGELYRYIADTKGAFVQPAYYEAFGLTVVEAMTCGLPTFATCH  398

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSGFHIDPYHG++AAELLV FFEKCK DPSHW+ IS GGLKRI+EKYTWQ
Sbjct  399   GGPAEIIVNGKSGFHIDPYHGDKAAELLVGFFEKCKADPSHWDAISLGGLKRIEEKYTWQ  458

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTLA VYG  K +S+    E +RYLEMFYALK+RKLA+ VPLA++
Sbjct  459   IYSDRLLTLAGVYGLRK-MSRTSTSEAKRYLEMFYALKYRKLAQSVPLAVD  508



>ref|XP_004508033.1| PREDICTED: sucrose synthase-like isoform X1 [Cicer arietinum]
 ref|XP_004508034.1| PREDICTED: sucrose synthase-like isoform X2 [Cicer arietinum]
Length=811

 Score =   508 bits (1309),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 238/283 (84%), Positives = 259/283 (92%), Gaps = 0/283 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YFPY+E  +RLTS+HPEIE+LLYS VENEEH+CVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADETIYFPYTETSRRLTSFHPEIEELLYSTVENEEHICVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN++GLVE+Y K+ KLRELVNLVVV GDRRKESKD+EE+AEMKKMY LI TY
Sbjct  575   TMARLDRVKNISGLVEWYGKNAKLRELVNLVVVAGDRRKESKDLEEKAEMKKMYALIDTY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM CGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMGCGLPTFATLN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHGE+AA+LLV+FFEKCK DPSHW+ IS GGLKRI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGERAADLLVEFFEKCKVDPSHWDKISQGGLKRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLA  408
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKL 
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLV  797



>gb|AAN76498.1|AF315375_1 sucrose synthase [Phaseolus vulgaris]
Length=805

 Score =   508 bits (1308),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 238/291 (82%), Positives = 263/291 (90%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKF IVSPGAD  +YF   E  +RLTS+HPEIE+LLYS VENEEH+CVLKDR+KPI+F
Sbjct  515   FDPKFTIVSPGADQTIYFSPKETSRRLTSFHPEIEELLYSSVENEEHICVLKDRTKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+ GLVE+Y K+ KLRELVNLVVV GDRRKESKD+EE+AEMKKMY LI+TY
Sbjct  575   TMARLDRVKNIPGLVEWYGKNEKLRELVNLVVVAGDRRKESKDLEEKAEMKKMYSLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR I DT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVISDTRGAFVQPAVYEAFGLTVVEAMTCGLPTFATCN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEKCK +PSHW+TIS  GL+RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKCKVEPSHWDTISQAGLQRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_010687574.1| PREDICTED: sucrose synthase [Beta vulgaris subsp. vulgaris]
Length=805

 Score =   508 bits (1308),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 236/291 (81%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+++YF Y+E++KRLT+ HPEIE+LL+S+ +NEEH+CVLKDR KPI+F
Sbjct  512   FDPKFNIVSPGADLSIYFNYTEEKKRLTALHPEIEELLFSETQNEEHICVLKDRKKPIIF  571

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             +MARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD EE+ EMKKMY LI+ Y
Sbjct  572   SMARLDRVKNMTGLVEWYGKNKKLRELVNLVVVAGDRRKESKDTEEKEEMKKMYGLIEEY  631

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWIS+QMNRVRNGELYRYI DT+GAFVQPA+YEAFGLTVVEAMTCGLPTFAT H
Sbjct  632   NLNGQFRWISAQMNRVRNGELYRYIADTRGAFVQPAYYEAFGLTVVEAMTCGLPTFATCH  691

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEK   DPS+WE IS GGL+RI+EKYTW+
Sbjct  692   GGPAEIIVHGKSGFHIDPYHGDKAADLLVDFFEKSTADPSYWENISKGGLQRIEEKYTWK  751

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTLA VYGFWK+VS LDR E RRYLEMFYALK++KLAE VPLAIE
Sbjct  752   IYSDRLLTLAGVYGFWKYVSNLDRREARRYLEMFYALKYKKLAESVPLAIE  802



>ref|XP_006474683.1| PREDICTED: sucrose synthase-like [Citrus sinensis]
Length=784

 Score =   506 bits (1304),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 237/291 (81%), Positives = 261/291 (90%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM +YFPY E+++RL  +H EIE+LLYS VEN+EHLCVLKD SKPILF
Sbjct  493   FDPKFNIVSPGADMTIYFPYMEEKRRLKHFHSEIEELLYSPVENKEHLCVLKDSSKPILF  552

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ KLRELVNLVVVGGDRRKESKD+EEQAEMKKMY L+ TY
Sbjct  553   TMARLDRVKNLTGLVEWYGKNAKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYGLVDTY  612

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +
Sbjct  613   KLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCN  672

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPY G+QAA +LVDFFEKCK DP HW+ IS GGLKRIQEKYTW+
Sbjct  673   GGPAEIIVHGKSGFHIDPYKGDQAAGILVDFFEKCKVDPGHWDEISQGGLKRIQEKYTWK  732

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLL L+ VYGFWKH+SKLD  E  RYLEMFY+L +RK  + VPLA++
Sbjct  733   IYSERLLNLSGVYGFWKHLSKLDSREKNRYLEMFYSLMYRKQVQTVPLAVD  783



>ref|XP_009343356.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   507 bits (1305),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 239/291 (82%), Positives = 262/291 (90%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPYSEKEKRLT +HPEIE+LLYS VEN E +CVLKDR+KPI+F
Sbjct  516   FDPKFNIVSPGADMSVYFPYSEKEKRLTHFHPEIEELLYSQVENIEQICVLKDRNKPIIF  575

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVV  GD R ESKD EE+AE+KKMYELI+TY
Sbjct  576   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVAAGDHRNESKDNEEKAELKKMYELIETY  635

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQ RWISSQMNRVRNGELYRYICDT+GAFVQPA YEAFGLTV+EAMTCGLPTFAT  
Sbjct  636   KLNGQLRWISSQMNRVRNGELYRYICDTRGAFVQPAVYEAFGLTVIEAMTCGLPTFATCK  695

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSG+HIDPY G+QAAE+LVDFFEK K DPSHW+ IS GGL+RI EKYTWQ
Sbjct  696   GGPAEIIVNGKSGYHIDPYQGDQAAEILVDFFEKSKADPSHWDKISQGGLQRIYEKYTWQ  755

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  756   IYSERLLTLTGVYGFWKDVSNLDRLENRRYLEMFYALKFRKLAASVPLAVE  806



>gb|ABY82048.1| sucrose synthase [Hymenaea courbaril var. stilbocarpa]
Length=382

 Score =   492 bits (1266),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 233/294 (79%), Positives = 257/294 (87%), Gaps = 16/294 (5%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YFPY+E +KRLTS+HPEIE+LLYS VENEEH+CVLKDR+KPI+F
Sbjct  89    FDPKFNIVSPGADMSIYFPYTETQKRLTSFHPEIEELLYSSVENEEHICVLKDRTKPIIF  148

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ +LRELVNLVVV GDRRKES+D+EE+AEMKKMY LI+TY
Sbjct  149   TMARLDRVKNITGLVEWYGKNARLRELVNLVVVAGDRRKESQDLEEKAEMKKMYGLIETY  208

Query  896   NLNGQFRWISSQMNRVRNGELY----------------RYICDTKGAFVQPAFYEAFGLT  765
              LNGQFRWISSQMNRVRNGELY                R ICDTKGAFVQPA YEAFGLT
Sbjct  209   KLNGQFRWISSQMNRVRNGELYRVICDTKGAFEAEFQHRVICDTKGAFVQPAVYEAFGLT  268

Query  764   VVEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWET  585
             VVEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AAE LV FFEKCK DP+HW+ 
Sbjct  269   VVEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDRAAETLVGFFEKCKADPTHWDK  328

Query  584   ISAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALK  423
             IS GGLKRI EKYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYA+K
Sbjct  329   ISQGGLKRIHEKYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYAVK  382



>gb|AAC28107.1| nodule-enhanced sucrose synthase [Pisum sativum]
Length=806

 Score =   507 bits (1305),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 239/291 (82%), Positives = 263/291 (90%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD  +YFPY+E  +RLTS++PEIE LLYS   NEEH+CVLKDR+KPI+F
Sbjct  515   FDPKFNIVSPGADQTIYFPYTETSRRLTSFYPEIEKLLYSTGGNEEHICVLKDRNKPIIF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE+Y K+ KLRELVNLVVV GDRRKESKD+EE+AEMKKMYE I+TY
Sbjct  575   TMARLDRVKNITGLVEWYGKNAKLRELVNLVVVAGDRRKESKDLEEKAEMKKMYEHIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWISSQMNRVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM  GLPTFAT +
Sbjct  635   KLNGQFRWISSQMNRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMATGLPTFATLN  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKTDPSHWDKISQGGLQRIEEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755   IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>emb|CAC32462.1| sucrose synthase isoform 3 [Pisum sativum]
Length=804

 Score =   506 bits (1304),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 233/291 (80%), Positives = 266/291 (91%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+++YFPY+E E+RLTS+HP+IE+LLYS VENEEH+CVLKDRSKPI+F
Sbjct  513   FDPKFNIVSPGADLSIYFPYTETERRLTSFHPDIEELLYSTVENEEHICVLKDRSKPIIF  572

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKN+TGLVE Y K+ +LRELVNLVVV GDRRKESKD+EE AEMKKMY LI+TY
Sbjct  573   TMARLDRVKNITGLVECYGKNARLRELVNLVVVAGDRRKESKDLEEIAEMKKMYGLIETY  632

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
              LNGQFRWIS+QM+R+RNGELYR ICDTKGAFVQPA YEAFGLTV+EAM+CGLPTFAT +
Sbjct  633   KLNGQFRWISAQMDRIRNGELYRVICDTKGAFVQPAIYEAFGLTVIEAMSCGLPTFATCN  692

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSG+HIDPYHG++AAE LV+FFEK K DP++W+ IS GGLKRI EKYTWQ
Sbjct  693   GGPAEIIVHGKSGYHIDPYHGDRAAETLVEFFEKSKADPTYWDKISHGGLKRIHEKYTWQ  752

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+ KLAE VPLA+E
Sbjct  753   IYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYSKLAESVPLAVE  803



>emb|CAA57881.1| sucrose synthase [Oxybasis rubra]
Length=803

 Score =   506 bits (1303),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 235/291 (81%), Positives = 269/291 (92%), Gaps = 0/291 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGAD+++YFPY+E++KRL + HPEIE+LLYS+V+NEEH+CVLKDR+KPI+F
Sbjct  512   FDPKFNIVSPGADLSIYFPYTEEKKRLKALHPEIEELLYSEVQNEEHICVLKDRNKPIIF  571

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             +MARLDRVKN+TGLVE+Y K+ KLR+LVNLVVV GDRRKESKDIEE+ EMKKMY LI+ Y
Sbjct  572   SMARLDRVKNMTGLVEWYGKNKKLRQLVNLVVVAGDRRKESKDIEEKEEMKKMYGLIEEY  631

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWIS+QMNRVRNGELYRYI DTKGAFVQPA+YEAFGLTVVEAMTCGLPTFAT H
Sbjct  632   NLNGQFRWISAQMNRVRNGELYRYIADTKGAFVQPAYYEAFGLTVVEAMTCGLPTFATCH  691

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIV+GKSG+HIDPYHG++AAELLV+FFEK   +PSHWE IS GGLKRI+EKYTW+
Sbjct  692   GGPAEIIVNGKSGYHIDPYHGDKAAELLVEFFEKSTANPSHWEAISNGGLKRIEEKYTWK  751

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  384
             IYSDRLLTLA VYGFWK+VS LDR E RRYLEMFYALK++K AE VPL +E
Sbjct  752   IYSDRLLTLAGVYGFWKYVSNLDRREARRYLEMFYALKYKKPAESVPLLVE  802



>gb|AFY03626.1| sucrose synthase, partial [Eucalyptus globulus]
Length=796

 Score =   506 bits (1302),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 236/282 (84%), Positives = 260/282 (92%), Gaps = 0/282 (0%)
 Frame = -3

Query  1256  FDPKFNIVSPGADMNLYFPYSEKEKRLTSYHPEIEDLLYSDVENEEHLCVLKDRSKPILF  1077
             FDPKFNIVSPGADM++YF Y+E++ RL S+H EIE+LL+SDVEN+EHLCVLKDR+KPILF
Sbjct  515   FDPKFNIVSPGADMSIYFSYTEEKLRLKSFHAEIEELLFSDVENKEHLCVLKDRNKPILF  574

Query  1076  TMARLDRVKNLTGLVEFYAKSPKLRELVNLVVVGGDRRKESKDIEEQAEMKKMYELIKTY  897
             TMARLDRVKNLTGLVE+Y K+ +LRELVNLVVVGGDRRKESKD+EEQAEMKKMY LI+TY
Sbjct  575   TMARLDRVKNLTGLVEWYGKNTRLRELVNLVVVGGDRRKESKDLEEQAEMKKMYGLIETY  634

Query  896   NLNGQFRWISSQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNH  717
             NLNGQFRWISSQMNRVRNGELYRYICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT  
Sbjct  635   NLNGQFRWISSQMNRVRNGELYRYICDTRGAFVQPALYEAFGLTVVEAMTCGLPTFATCK  694

Query  716   GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  537
             GGPAEIIVHGKSGFHIDPYHG+QAAE L +FFEKCK DPS W+ IS G ++RI EKYTWQ
Sbjct  695   GGPAEIIVHGKSGFHIDPYHGDQAAETLABFFEKCKVDPSXWDKISQGAMQRIXEKYTWQ  754

Query  536   IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKL  411
             IYS+RLL L +VYGFWKHVS LDRLE RRYLEMFYALK+RKL
Sbjct  755   IYSERLLNLTAVYGFWKHVSNLDRLESRRYLEMFYALKYRKL  796



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3596579911983