BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig610

Length=788
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009775565.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    369   7e-119   Nicotiana sylvestris
ref|XP_009626922.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    368   3e-118   Nicotiana tomentosiformis
ref|XP_011048330.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    367   8e-118   Populus euphratica
gb|EPS69204.1|  hypothetical protein M569_05562                         352   9e-118   Genlisea aurea
ref|XP_011048329.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    367   1e-117   Populus euphratica
ref|XP_002325019.2|  hypothetical protein POPTR_0018s09300g             366   1e-117   Populus trichocarpa [western balsam poplar]
ref|XP_002871900.1|  hypothetical protein ARALYDRAFT_488863             365   4e-117   
ref|XP_006287100.1|  hypothetical protein CARUB_v10000271mg             364   9e-117   Capsella rubella
gb|KGN65137.1|  hypothetical protein Csa_1G237060                       347   1e-116   Cucumis sativus [cucumbers]
ref|XP_004497228.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    363   1e-116   Cicer arietinum [garbanzo]
ref|XP_007013064.1|  Staurosporin and temperature sensitive 3-lik...    362   2e-116   
ref|XP_003592715.1|  Dolichyl-diphosphooligosaccharide-protein gl...    363   2e-116   Medicago truncatula
gb|KFK26187.1|  hypothetical protein AALP_AA8G213900                    363   3e-116   Arabis alpina [alpine rockcress]
gb|AAK91413.1|  AT5g19690/T29J13_110                                    362   5e-116   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568380.1|  dolichyl-diphosphooligosaccharide--protein glyc...    362   5e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010519673.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    362   5e-116   Tarenaya hassleriana [spider flower]
ref|XP_010493048.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    362   6e-116   Camelina sativa [gold-of-pleasure]
ref|XP_006400531.1|  hypothetical protein EUTSA_v10012742mg             362   7e-116   Eutrema salsugineum [saltwater cress]
tpg|DAA57613.1|  TPA: hypothetical protein ZEAMMB73_748744              346   7e-116   
ref|XP_006451260.1|  hypothetical protein CICLE_v10007513mg             358   1e-115   
emb|CDX70886.1|  BnaC03g09700D                                          362   1e-115   
ref|XP_004287460.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    361   1e-115   Fragaria vesca subsp. vesca
ref|XP_010454254.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    358   1e-115   
ref|XP_007013063.1|  Staurosporin and temperature sensitive 3-lik...    362   1e-115   
ref|XP_012076776.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    361   1e-115   Jatropha curcas
ref|XP_010420783.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    361   2e-115   Camelina sativa [gold-of-pleasure]
ref|XP_003516821.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    361   2e-115   Glycine max [soybeans]
emb|CDX88879.1|  BnaA03g07700D                                          361   2e-115   
gb|KHN40395.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    360   2e-115   Glycine soja [wild soybean]
ref|XP_007152904.1|  hypothetical protein PHAVU_004G170000g             360   2e-115   Phaseolus vulgaris [French bean]
ref|XP_006853616.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    360   2e-115   Amborella trichopoda
ref|XP_010535959.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    360   2e-115   Tarenaya hassleriana [spider flower]
ref|XP_007013062.1|  Staurosporin and temperature sensitive 3-lik...    361   3e-115   
ref|XP_004251627.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    360   3e-115   Solanum lycopersicum
ref|XP_009131748.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    360   3e-115   Brassica rapa
emb|CDP03275.1|  unnamed protein product                                360   5e-115   Coffea canephora [robusta coffee]
gb|KJB65009.1|  hypothetical protein B456_010G075800                    357   6e-115   Gossypium raimondii
gb|KHN16965.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    359   1e-114   Glycine soja [wild soybean]
ref|XP_006353484.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    358   1e-114   Solanum tuberosum [potatoes]
ref|XP_010454253.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    358   1e-114   Camelina sativa [gold-of-pleasure]
ref|XP_003547741.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    358   1e-114   Glycine max [soybeans]
ref|XP_010095369.1|  Dolichyl-diphosphooligosaccharide--protein g...    358   1e-114   Morus notabilis
ref|XP_006451261.1|  hypothetical protein CICLE_v10007513mg             357   1e-114   
ref|XP_007203242.1|  hypothetical protein PRUPE_ppa001464mg             359   2e-114   
ref|XP_002514244.1|  oligosaccharyl transferase, putative               358   3e-114   Ricinus communis
ref|XP_006451262.1|  hypothetical protein CICLE_v10007513mg             357   4e-114   Citrus clementina [clementine]
gb|KHG22028.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    355   8e-114   Gossypium arboreum [tree cotton]
gb|KJB65007.1|  hypothetical protein B456_010G075800                    357   1e-113   Gossypium raimondii
emb|CDX92509.1|  BnaA10g15480D                                          356   1e-113   
ref|XP_008242518.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    356   1e-113   Prunus mume [ume]
gb|AFW78838.1|  hypothetical protein ZEAMMB73_319539                    353   1e-113   
ref|XP_009120866.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    356   1e-113   Brassica rapa
ref|XP_010688294.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    356   2e-113   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008462758.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    355   2e-113   Cucumis melo [Oriental melon]
ref|XP_010047698.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    355   3e-113   Eucalyptus grandis [rose gum]
ref|XP_008387183.1|  PREDICTED: LOW QUALITY PROTEIN: dolichyl-dip...    355   3e-113   
gb|KJB83104.1|  hypothetical protein B456_013G229700                    355   3e-113   Gossypium raimondii
gb|KHG24964.1|  Oligosaccharyl transferase subunit STT3                 355   3e-113   Gossypium arboreum [tree cotton]
ref|XP_009352534.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    355   4e-113   
ref|XP_008462759.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    355   4e-113   
gb|EYU30721.1|  hypothetical protein MIMGU_mgv1a001650mg                355   5e-113   Erythranthe guttata [common monkey flower]
ref|XP_011655447.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    354   6e-113   Cucumis sativus [cucumbers]
gb|ACL54353.1|  unknown                                                 353   9e-113   Zea mays [maize]
ref|XP_008647462.1|  PREDICTED: uncharacterized protein LOC100217...    353   1e-112   Zea mays [maize]
ref|XP_010249572.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    352   3e-112   Nelumbo nucifera [Indian lotus]
ref|XP_004969929.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    352   6e-112   Setaria italica
ref|XP_010232314.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    349   6e-112   
ref|XP_006654660.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    350   3e-111   Oryza brachyantha
ref|XP_010924651.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    350   4e-111   Elaeis guineensis
ref|XP_011078262.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    349   6e-111   Sesamum indicum [beniseed]
ref|XP_002280521.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    348   2e-110   Vitis vinifera
ref|NP_001056068.1|  Os05g0519900                                       348   2e-110   
ref|XP_003569794.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    348   2e-110   Brachypodium distachyon [annual false brome]
ref|XP_008672724.1|  PREDICTED: hypothetical protein isoform X1         347   3e-110   Zea mays [maize]
ref|XP_004961472.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    347   3e-110   Setaria italica
ref|XP_010254009.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    347   3e-110   Nelumbo nucifera [Indian lotus]
ref|XP_009410892.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    343   8e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002441399.1|  hypothetical protein SORBIDRAFT_09g025920          343   1e-108   Sorghum bicolor [broomcorn]
dbj|BAJ94938.1|  predicted protein                                      341   8e-108   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002983693.1|  oligosaccharyltransferase subunit STT3             340   1e-107   
ref|XP_008810656.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    340   2e-107   Phoenix dactylifera
ref|XP_003568077.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    340   3e-107   Brachypodium distachyon [annual false brome]
ref|XP_010915814.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    336   5e-106   Elaeis guineensis
gb|EEC79544.1|  hypothetical protein OsI_20658                          339   1e-104   Oryza sativa Indica Group [Indian rice]
ref|XP_001784419.1|  predicted protein                                  327   2e-102   
gb|EMS46014.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    326   4e-101   Triticum urartu
dbj|BAJ97693.1|  predicted protein                                      306   2e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008672725.1|  PREDICTED: hypothetical protein isoform X2         311   6e-97    Zea mays [maize]
gb|EMS67963.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    309   3e-94    Triticum urartu
gb|EMT28410.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    307   2e-93    
gb|ADE76891.1|  unknown                                                 266   2e-86    Picea sitchensis
ref|XP_011009352.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    258   5e-82    Populus euphratica
ref|XP_002456347.1|  hypothetical protein SORBIDRAFT_03g034385          258   7e-77    
gb|ADB65765.1|  oligosaccharyl transferase                              258   8e-77    Dunaliella salina
gb|KIZ00091.1|  dolichyl-diphosphooligosaccharide--protein glycos...    242   3e-76    Monoraphidium neglectum
emb|CBJ33619.1|  Dolichyl-diphosphooligosaccharide--protein glyco...    247   7e-76    Ectocarpus siliculosus
ref|NP_001146306.1|  hypothetical protein                               255   1e-75    Zea mays [maize]
ref|XP_005650137.1|  STT3 subunit of Oligosaccharyl transferase         253   8e-75    Coccomyxa subellipsoidea C-169
gb|KFM62990.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    233   2e-72    Stegodyphus mimosarum
gb|KDO31570.1|  hypothetical protein SPRG_03499                         234   3e-72    Saprolegnia parasitica CBS 223.65
ref|XP_008543151.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    243   2e-71    Microplitis demolitor
ref|XP_011301152.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    242   6e-71    Fopius arisanus
ref|XP_010162595.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   1e-70    Antrostomus carolinensis
emb|CCD58842.1|  60S ribosomal protein L35, putative                    236   3e-70    Schistosoma mansoni
gb|AAH64436.1|  LOC779022 protein                                       234   3e-70    Xenopus laevis [clawed frog]
ref|XP_002955643.1|  hypothetical protein VOLCADRAFT_66117              241   5e-70    Volvox carteri f. nagariensis
gb|AAH43914.1|  Itm1 protein                                            233   8e-70    Xenopus laevis [clawed frog]
ref|XP_010795337.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   1e-69    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_001439477.1|  hypothetical protein                               239   2e-69    Paramecium tetraurelia strain d4-2
ref|XP_003399124.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    238   2e-69    Bombus terrestris [large earth bumblebee]
ref|XP_001991867.1|  GH12900                                            238   2e-69    Drosophila grimshawi
gb|EFX86763.1|  hypothetical protein DAPPUDRAFT_307851                  239   3e-69    Daphnia pulex
ref|XP_006677749.1|  hypothetical protein BATDEDRAFT_10658              237   6e-69    Batrachochytrium dendrobatidis JAM81
ref|XP_004536915.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    235   6e-69    
ref|XP_008481607.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   9e-69    Diaphorina citri
ref|XP_002155260.2|  PREDICTED: dolichyl-diphosphooligosaccharide...    236   1e-68    Hydra vulgaris
ref|XP_002011908.1|  GI14454                                            236   1e-68    Drosophila mojavensis
emb|CCO31174.1|  dolichyl-diphosphooligosaccharide--protein glyco...    228   1e-68    Rhizoctonia solani AG-1 IB
ref|XP_002071638.1|  GK10089                                            236   2e-68    Drosophila willistoni
ref|XP_003747556.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    236   2e-68    Galendromus occidentalis
ref|XP_009126383.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    223   2e-68    
gb|KFH65096.1|  dolichyl-diphosphooligosaccharide-protein glycosy...    236   2e-68    Mortierella verticillata NRRL 6337
ref|XP_011405586.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    238   2e-68    
ref|XP_003747558.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    236   2e-68    
ref|XP_002039599.1|  GM22642                                            235   2e-68    Drosophila sechellia
ref|XP_011541110.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    227   3e-68    
ref|XP_003747557.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    235   3e-68    
gb|ETL46143.1|  hypothetical protein L916_03922                         237   3e-68    Phytophthora parasitica
ref|XP_008901318.1|  hypothetical protein PPTG_08136                    237   3e-68    Phytophthora parasitica INRA-310
gb|ETP50646.1|  hypothetical protein F442_04081                         237   3e-68    Phytophthora parasitica P10297
ref|NP_608425.1|  CG1518, isoform A                                     235   3e-68    Drosophila melanogaster
ref|XP_004536913.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    235   3e-68    
ref|XP_001978657.1|  GG17558                                            235   3e-68    Drosophila erecta
ref|XP_004923047.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    235   3e-68    Bombyx mori [silk moth]
emb|CDQ67856.1|  unnamed protein product                                235   3e-68    Oncorhynchus mykiss
ref|XP_007894244.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    235   3e-68    Callorhinchus milii [Australian ghost shark]
ref|XP_002101953.1|  GE15319                                            235   4e-68    Drosophila yakuba
ref|XP_011177440.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    235   4e-68    Zeugodacus cucurbitae [melon fruit fly]
gb|ACD81859.1|  LD39332p                                                235   4e-68    Drosophila melanogaster
ref|XP_002055439.1|  GJ18789                                            234   5e-68    Drosophila virilis
ref|XP_009529396.1|  hypothetical protein PHYSODRAFT_302104             236   5e-68    Phytophthora sojae
ref|XP_010868983.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    234   5e-68    Esox lucius
ref|NP_001135197.1|  Dolichyl-diphosphooligosaccharide--protein g...    234   6e-68    Salmo salar
emb|CDQ66412.1|  unnamed protein product                                234   6e-68    Oncorhynchus mykiss
gb|ETI52837.1|  hypothetical protein F443_04108                         236   6e-68    Phytophthora parasitica P1569
gb|ACN10714.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    234   7e-68    Salmo salar
ref|XP_001967075.1|  GF21857                                            234   7e-68    Drosophila ananassae
emb|CAF90157.1|  unnamed protein product                                229   8e-68    Tetraodon nigroviridis
ref|XP_008609258.1|  dolichyl-diphosphooligosaccharide-protein gl...    236   8e-68    Saprolegnia diclina VS20
ref|XP_009582365.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   9e-68    Fulmarus glacialis
dbj|BAE00677.1|  unnamed protein product                                223   1e-67    Macaca fascicularis [crab eating macaque]
gb|EHJ63188.1|  oligosaccharyl transferase                              233   1e-67    
ref|XP_002607356.1|  hypothetical protein BRAFLDRAFT_69762              232   1e-67    Branchiostoma floridae
emb|CEI99383.1|  Putative Oligosaccharyl transferase STT3 subunit       232   1e-67    Rhizopus microsporus
gb|KFP56370.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    231   1e-67    Cathartes aura
gb|KFV95152.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    231   1e-67    Fulmarus glacialis
ref|XP_011268921.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    233   1e-67    Camponotus floridanus
gb|KFQ60087.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    232   1e-67    Pelecanus crispus
ref|XP_011200722.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    233   2e-67    Bactrocera dorsalis [papaya fruit fly]
ref|XP_003691905.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    233   2e-67    Apis florea [dwarf honeybee]
gb|AAI72202.1|  source of immunodominant MHC-associated peptides        223   2e-67    synthetic construct
ref|XP_392786.2|  PREDICTED: dolichyl-diphosphooligosaccharide--p...    233   2e-67    Apis mellifera [bee]
ref|XP_001648748.1|  AAEL004228-PA                                      233   2e-67    Aedes aegypti
ref|XP_003487818.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    233   2e-67    Bombus impatiens
ref|XP_009478720.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   2e-67    Pelecanus crispus
gb|KFV84946.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    232   2e-67    Struthio camelus australis
ref|XP_009059058.1|  hypothetical protein LOTGIDRAFT_164315             233   2e-67    Lottia gigantea
gb|KFP55644.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    232   2e-67    Cariama cristata
ref|XP_009916234.1|  PREDICTED: LOW QUALITY PROTEIN: dolichyl-dip...    232   2e-67    Haliaeetus albicilla
ref|XP_010282506.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   2e-67    Phaethon lepturus
ref|XP_006116753.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    233   2e-67    Pelodiscus sinensis [Chinese softshell turtle]
gb|KFQ72349.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    232   2e-67    Phaethon lepturus
ref|NP_001083986.1|  STT3A, subunit of the oligosaccharyltransfer...    233   2e-67    Xenopus laevis [clawed frog]
ref|XP_009819540.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   2e-67    Gavia stellata
ref|XP_003225760.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    233   2e-67    Anolis carolinensis [Carolina anole]
gb|KFZ57236.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    232   2e-67    Podiceps cristatus
ref|XP_010006392.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    233   2e-67    Chaetura pelagica
ref|XP_001865872.1|  oligosaccharyl transferase                         233   2e-67    Culex quinquefasciatus
ref|XP_008478222.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    226   2e-67    
ref|NP_001154172.1|  Dolichyl-diphosphooligosaccharide--protein g...    220   3e-67    Oncorhynchus mykiss
dbj|BAE87452.1|  unnamed protein product                                227   3e-67    Macaca fascicularis [crab eating macaque]
ref|XP_002197814.2|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   3e-67    Taeniopygia guttata
ref|XP_011068113.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   3e-67    Acromyrmex echinatior
gb|KFU85517.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    232   3e-67    Chaetura pelagica
ref|XP_012055663.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   3e-67    Atta cephalotes
ref|XP_011875506.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   3e-67    Vollenhovia emeryi
ref|XP_005294744.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   3e-67    Chrysemys picta bellii
ref|XP_009680262.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    233   3e-67    Struthio camelus australis
ref|XP_005019699.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   3e-67    
ref|XP_003642654.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   3e-67    
ref|XP_008496706.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   3e-67    Calypte anna
ref|XP_003459018.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   3e-67    Oreochromis niloticus
ref|XP_009070476.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   3e-67    Acanthisitta chloris
ref|XP_008635110.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   4e-67    Corvus brachyrhynchos
gb|KFP77925.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    232   4e-67    Acanthisitta chloris
ref|XP_011703340.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   4e-67    Wasmannia auropunctata
gb|EIE80503.1|  hypothetical protein RO3G_05208                         233   4e-67    Rhizopus delemar RA 99-880
ref|XP_011638122.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   4e-67    Pogonomyrmex barbatus
ref|XP_005058753.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   4e-67    Ficedula albicollis
ref|XP_002909211.1|  dolichyl-diphosphooligosaccharide-protein gl...    234   4e-67    Phytophthora infestans T30-4
ref|XP_009503240.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   4e-67    Phalacrocorax carbo [common cormorant]
gb|KFW96584.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    232   4e-67    Phalacrocorax carbo [common cormorant]
ref|XP_010721863.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   4e-67    Meleagris gallopavo [common turkey]
ref|XP_011172616.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   4e-67    
ref|NP_001001202.1|  STT3A, subunit of the oligosaccharyltransfer...    232   4e-67    Xenopus tropicalis [western clawed frog]
gb|KFP04495.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    232   4e-67    Calypte anna
gb|KFR01965.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    232   4e-67    Nipponia nippon
gb|KFO81837.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    232   4e-67    Cuculus canorus
ref|XP_007427479.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   4e-67    Python bivittatus
ref|XP_005142858.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   4e-67    Melopsittacus undulatus
gb|KFO61594.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    232   4e-67    Corvus brachyrhynchos
gb|KGL99280.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    232   4e-67    Charadrius vociferus
ref|XP_010010547.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   4e-67    Nestor notabilis
ref|XP_004379409.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   4e-67    Trichechus manatus latirostris
gb|KFO12039.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    232   4e-67    Balearica regulorum gibbericeps
gb|KFQ47423.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    232   4e-67    Nestor notabilis
ref|XP_009982575.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   4e-67    Tauraco erythrolophus
gb|KFV00546.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    232   5e-67    Pterocles gutturalis
gb|KFV16358.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    231   5e-67    Tauraco erythrolophus
ref|XP_005185991.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   5e-67    Musca domestica
ref|XP_004948011.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    233   5e-67    
ref|XP_007558076.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   5e-67    Poecilia formosa
ref|XP_010579661.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   5e-67    Haliaeetus leucocephalus
ref|XP_003764397.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   5e-67    Sarcophilus harrisii
ref|XP_001365210.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   5e-67    Monodelphis domestica
ref|XP_006788770.1|  PREDICTED: LOW QUALITY PROTEIN: dolichyl-dip...    231   5e-67    Neolamprologus brichardi [lyretail cichlid]
ref|XP_005806733.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   6e-67    Xiphophorus maculatus
ref|XP_003700582.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   6e-67    Megachile rotundata
ref|XP_004469308.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   6e-67    
ref|XP_006021419.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   6e-67    
ref|XP_005509242.1|  PREDICTED: LOW QUALITY PROTEIN: dolichyl-dip...    231   6e-67    
gb|KFM03307.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    231   6e-67    Aptenodytes forsteri
ref|XP_011344412.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   6e-67    Ooceraea biroi
ref|XP_004469309.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   7e-67    Dasypus novemcinctus
gb|EPB81833.1|  dolichyl-diphosphooligosaccharide-protein glycosy...    232   7e-67    Mucor circinelloides f. circinelloides 1006PhL
gb|AAB05994.1|  putative transmembrane protein precursor                231   7e-67    Homo sapiens [man]
emb|CEG83090.1|  Putative Oligosaccharyl transferase STT3 subunit       232   8e-67    Rhizopus microsporus
dbj|GAN09602.1|  oligosaccharyl transferase STT3 subunit                232   8e-67    Mucor ambiguus
dbj|GAA52497.1|  dolichyl-diphosphooligosaccharide--protein glyco...    221   9e-67    Clonorchis sinensis [oriental liver fluke]
ref|XP_001601974.2|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   9e-67    
ref|XP_011149388.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   9e-67    Harpegnathos saltator
gb|EFX84969.1|  hypothetical protein DAPPUDRAFT_300830                  231   9e-67    Daphnia pulex
ref|XP_004992971.1|  hypothetical protein PTSG_06075                    228   9e-67    Salpingoeca rosetta
ref|XP_009017952.1|  hypothetical protein HELRODRAFT_111950             233   9e-67    Helobdella robusta
ref|XP_005019697.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   9e-67    
ref|XP_007244780.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   1e-66    Astyanax mexicanus [blind cave fish]
ref|XP_012145182.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   1e-66    Megachile rotundata
ref|XP_001175790.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   1e-66    Strongylocentrotus purpuratus [purple urchin]
emb|CEP10613.1|  hypothetical protein                                   231   1e-66    Parasitella parasitica
emb|CCI41730.1|  unnamed protein product                                232   1e-66    Albugo candida
ref|XP_005095974.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   1e-66    Aplysia californica
gb|EDL76965.1|  rCG25591, isoform CRA_b                                 224   1e-66    Rattus norvegicus [brown rat]
ref|XP_005095973.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   1e-66    
emb|CCI41731.1|  unnamed protein product                                233   1e-66    Albugo candida
ref|XP_006616543.1|  PREDICTED: LOW QUALITY PROTEIN: dolichyl-dip...    232   1e-66    Apis dorsata [rock honeybee]
ref|XP_003705191.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   1e-66    Megachile rotundata
ref|XP_005019694.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   1e-66    
gb|KFB38788.1|  AGAP000434-PA-like protein                              231   1e-66    Anopheles sinensis
ref|XP_003493122.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   1e-66    Bombus impatiens
ref|XP_004878252.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   1e-66    
ref|XP_008287848.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    230   2e-66    Stegastes partitus
ref|XP_003395697.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   2e-66    Bombus terrestris [large earth bumblebee]
ref|NP_001229365.1|  STT3, subunit of the oligosaccharyltransfera...    231   2e-66    Apis mellifera [bee]
ref|XP_004991063.1|  oligosaccharyl transferase                         231   2e-66    Salpingoeca rosetta
dbj|GAM26838.1|  hypothetical protein SAMD00019534_100130               230   2e-66    Acytostelium subglobosum LB1
ref|XP_011496379.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    230   2e-66    Ceratosolen solmsi marchali
ref|XP_004317195.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   2e-66    
ref|XP_008330481.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    230   2e-66    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_010200490.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    230   2e-66    Colius striatus
ref|XP_009890858.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   2e-66    Charadrius vociferus
ref|XP_004948007.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    232   2e-66    
ref|XP_010747757.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    230   2e-66    Larimichthys crocea [croceine croaker]
ref|XP_011173303.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   2e-66    Solenopsis invicta [imported red fire ant]
ref|XP_011173302.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   2e-66    Solenopsis invicta [imported red fire ant]
ref|XP_011067312.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   2e-66    Acromyrmex echinatior
gb|KFP31835.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    230   2e-66    Colius striatus
ref|XP_011067311.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   3e-66    Acromyrmex echinatior
ref|XP_001638406.1|  predicted protein                                  230   3e-66    Nematostella vectensis
ref|XP_011173301.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   3e-66    Solenopsis invicta [imported red fire ant]
ref|XP_011067310.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   3e-66    
ref|XP_639887.1|  oligosaccharyl transferase, STT3 subunit              230   3e-66    
ref|XP_004084644.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   3e-66    
ref|XP_004948010.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   3e-66    
ref|XP_011343673.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   3e-66    
ref|XP_012055162.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   3e-66    
ref|XP_011343674.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   3e-66    
ref|XP_003976527.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   3e-66    
ref|XP_001016052.1|  Oligosaccharyl transferase STT3 subunit fami...    231   3e-66    
ref|XP_011689836.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   3e-66    
gb|KDR18262.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    229   4e-66    
gb|KDR10570.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    230   4e-66    
ref|XP_011860119.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   4e-66    
ref|XP_010959958.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
ref|XP_011138057.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   4e-66    
ref|XP_007950292.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
gb|ABS45021.1|  integral membrane protein 1                             229   4e-66    
ref|XP_011343671.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   4e-66    
ref|NP_958866.1|  dolichyl-diphosphooligosaccharide--protein glyc...    229   4e-66    
ref|XP_002131357.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
ref|XP_005667536.1|  PREDICTED: STT3, subunit of the oligosacchar...    229   4e-66    
dbj|BAE35910.1|  unnamed protein product                                229   4e-66    
ref|XP_011689835.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   4e-66    
ref|XP_007463663.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
ref|XP_006174391.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
ref|XP_003472755.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
gb|AAH85313.1|  STT3, subunit of the oligosaccharyltransferase co...    229   4e-66    
gb|KIO34235.1|  glycosyltransferase family 66 protein                   230   4e-66    
ref|XP_007106668.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
ref|XP_002924040.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
ref|XP_011257569.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   4e-66    
gb|EFN85392.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    230   4e-66    
ref|XP_008833141.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
ref|XP_008591523.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
ref|NP_001039445.1|  dolichyl-diphosphooligosaccharide--protein g...    229   4e-66    
ref|XP_004417265.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
ref|XP_005378712.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    230   4e-66    
ref|XP_011860118.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    231   4e-66    
ref|XP_002708712.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
ref|XP_006915269.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
ref|XP_006867724.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
ref|XP_005339596.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
dbj|BAE40746.1|  unnamed protein product                                229   4e-66    
dbj|BAE29728.1|  unnamed protein product                                229   4e-66    
ref|XP_005085908.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
ref|XP_010984787.1|  PREDICTED: LOW QUALITY PROTEIN: dolichyl-dip...    229   4e-66    
ref|NP_032434.3|  dolichyl-diphosphooligosaccharide--protein glyc...    229   4e-66    
ref|XP_004604845.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
ref|XP_004280767.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
ref|XP_003696801.1|  PREDICTED: LOW QUALITY PROTEIN: dolichyl-dip...    230   4e-66    
ref|XP_011257570.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    230   4e-66    
ref|XP_005347095.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
ref|XP_008069614.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
ref|XP_005870963.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
dbj|BAC26921.1|  unnamed protein product                                229   4e-66    
ref|XP_004641444.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   4e-66    
ref|XP_007066428.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   5e-66    
ref|XP_007520709.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   5e-66    
ref|NP_001230781.1|  STT3, subunit of the oligosaccharyltransfera...    229   5e-66    
ref|XP_009271290.1|  PREDICTED: LOW QUALITY PROTEIN: dolichyl-dip...    233   5e-66    
dbj|BAE35579.1|  unnamed protein product                                229   5e-66    
ref|XP_004346072.1|  oligosaccharyl transferase STT3 subunit            230   5e-66    
gb|EFN67572.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    230   5e-66    
gb|ETN61504.1|  oligosaccharyl transferase                              229   5e-66    
ref|XP_011138056.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    230   5e-66    
ref|XP_011309135.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    230   6e-66    
ref|XP_011309118.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    230   6e-66    
ref|XP_011257568.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    230   6e-66    
ref|XP_005978402.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   6e-66    
ref|XP_009014673.1|  hypothetical protein HELRODRAFT_98643              228   6e-66    
ref|XP_312559.4|  AGAP002396-PA                                         230   6e-66    
ref|XP_011531767.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    223   6e-66    
gb|EPQ10562.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    229   6e-66    
ref|XP_011414451.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   7e-66    
ref|XP_003286566.1|  STT3 subunit of oligosaccharyl transferase         229   7e-66    
ref|XP_006267434.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   7e-66    
ref|XP_004924572.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   7e-66    
ref|XP_011199370.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    224   8e-66    
ref|XP_007106667.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   8e-66    
ref|XP_002116637.1|  hypothetical protein TRIADDRAFT_31147              229   8e-66    
ref|XP_011114731.1|  hypothetical protein H072_9072                     229   8e-66    
emb|CCM02664.1|  predicted protein                                      229   9e-66    
gb|AAL77539.1|L47337_1  transmembrane protein                           228   9e-66    
ref|XP_008527561.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   9e-66    
ref|XP_006892874.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    228   1e-65    
gb|KII85991.1|  glycosyltransferase family 66 protein                   229   1e-65    
ref|XP_007386676.1|  oligosaccharyl transferase STT3 subunit            229   1e-65    
ref|XP_001601373.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   1e-65    
ref|XP_001943161.2|  PREDICTED: dolichyl-diphosphooligosaccharide...    228   1e-65    
ref|XP_546418.3|  PREDICTED: dolichyl-diphosphooligosaccharide--p...    229   1e-65    
ref|XP_008216174.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   1e-65    
ref|XP_011647806.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   1e-65    
ref|XP_011647804.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   1e-65    
ref|XP_006242870.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    228   1e-65    
ref|XP_006510101.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    228   1e-65    
ref|XP_002121937.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    228   1e-65    
ref|NP_689926.1|  dolichyl-diphosphooligosaccharide--protein glyc...    228   1e-65    
emb|CCI41729.1|  unnamed protein product                                229   1e-65    
ref|XP_004037041.1|  hypothetical protein IMG5_062800                   228   1e-65    
ref|XP_002754607.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    228   1e-65    
ref|XP_011647807.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    229   1e-65    
gb|AAP36824.1|  Homo sapiens integral membrane protein 1                228   2e-65    
gb|EAW67643.1|  hCG2032701, isoform CRA_a                               228   2e-65    
ref|XP_003511082.2|  PREDICTED: dolichyl-diphosphooligosaccharide...    228   2e-65    
ref|XP_002430030.1|  Dolichyl-diphosphooligosaccharide--protein g...    228   2e-65    
ref|XP_007327465.1|  hypothetical protein AGABI1DRAFT_111863            228   2e-65    
ref|XP_006461707.1|  oligosaccharyl transferase STT3 subunit            228   2e-65    
gb|EUC54830.1|  dolichyl-diphosphooligosaccharide-protein glycosy...    228   2e-65    
gb|ENN79584.1|  hypothetical protein YQE_04046                          227   2e-65    
gb|KEP49351.1|  dolichyl-diphosphooligosaccharide-protein glycosy...    228   2e-65    
ref|XP_011789990.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    228   2e-65    
ref|XP_011730759.1|  PREDICTED: LOW QUALITY PROTEIN: dolichyl-dip...    227   2e-65    
gb|EJY69225.1|  Oligosaccharyl transferase STT3 subunit family pr...    228   2e-65    
ref|XP_002841789.1|  hypothetical protein                               227   2e-65    
dbj|BAE30692.1|  unnamed protein product                                227   2e-65    
ref|XP_002785679.1|  Stt3 protein, putative                             228   3e-65    
emb|CEL56378.1|  dolichyl-diphosphooligosaccharide--protein glyco...    228   3e-65    
gb|ESA07903.1|  hypothetical protein GLOINDRAFT_32311                   228   3e-65    
ref|XP_006140661.1|  PREDICTED: LOW QUALITY PROTEIN: dolichyl-dip...    227   3e-65    
ref|XP_008555284.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    228   3e-65    
emb|CDW81938.1|  dolichyl-diphosphooligosaccharide--protein glyco...    229   3e-65    
gb|EFA77669.1|  oligosaccharyl transferase                              226   4e-65    
gb|ELK09784.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    229   4e-65    
gb|AAD27851.2|AF132552_1  GM01838p                                      228   4e-65    
ref|XP_002134555.1|  GA22298                                            226   4e-65    
ref|XP_002104840.1|  GD18237                                            227   5e-65    
ref|XP_002043861.1|  GM17756                                            227   5e-65    
gb|EDL84046.1|  similar to integral membrane protein 1 (predicted)      226   5e-65    
ref|XP_011195122.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    223   6e-65    
ref|XP_001897932.1|  ITM1 protein                                       226   6e-65    
emb|CAX70128.1|  STT3, subunit of the oligosaccharyltransferase c...    226   6e-65    
gb|EWC44905.1|  dolichyl-diphosphooligosaccharide--protein glycos...    227   6e-65    
ref|XP_001981879.1|  GG12291                                            227   6e-65    
emb|CAX74505.1|  STT3, subunit of the oligosaccharyltransferase c...    226   6e-65    
ref|NP_524494.1|  oligosaccharyl transferase 3                          227   7e-65    
ref|XP_001641089.1|  predicted protein                                  227   7e-65    
ref|XP_002099120.1|  GE10744                                            227   7e-65    
ref|XP_001662467.1|  AAEL002804-PA                                      227   8e-65    
gb|KFB44137.1|  hypothetical protein ZHAS_00011973                      231   8e-65    
gb|ERL86897.1|  hypothetical protein D910_04300                         229   8e-65    
ref|XP_011434154.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    226   8e-65    
ref|XP_007846602.1|  oligosaccharyl transferase subunit                 227   8e-65    
ref|XP_001850247.1|  oligosaccharyl transferase                         226   8e-65    
gb|KDR80909.1|  hypothetical protein GALMADRAFT_241421                  226   9e-65    
ref|XP_011500973.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    227   9e-65    
gb|KFP87141.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    226   9e-65    
ref|XP_009865986.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    226   9e-65    
emb|CAX74506.1|  STT3, subunit of the oligosaccharyltransferase c...    226   9e-65    
emb|CDP94204.1|  Protein Bm9516, isoform b                              226   9e-65    
gb|KIM90271.1|  glycosyltransferase family 66 protein                   226   1e-64    
ref|XP_009217935.1|  oligosaccharyl transferase STT3 subunit            226   1e-64    
gb|EKC29997.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    225   1e-64    
gb|KHJ43741.1|  iron-sulfur cluster assembly accessory protein          231   1e-64    
ref|XP_010128573.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    225   1e-64    
ref|XP_005847365.1|  hypothetical protein CHLNCDRAFT_31189              226   1e-64    
dbj|BAE32233.1|  unnamed protein product                                226   1e-64    
gb|EPT01100.1|  hypothetical protein FOMPIDRAFT_159423                  226   1e-64    
ref|XP_001508672.2|  PREDICTED: dolichyl-diphosphooligosaccharide...    226   1e-64    
ref|XP_004519479.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    226   2e-64    
ref|XP_005108238.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    225   2e-64    
gb|EPZ32901.1|  Oligosaccharyl transferase, STT3 subunit domain-c...    225   2e-64    
ref|XP_009046220.1|  hypothetical protein LOTGIDRAFT_110908             225   2e-64    
gb|ETN58574.1|  oligosaccharyl transferase                              226   2e-64    
gb|ELU11110.1|  hypothetical protein CAPTEDRAFT_179664                  226   2e-64    
ref|XP_002114080.1|  conserved hypothetical protein                     224   2e-64    
ref|XP_001953684.1|  GF17105                                            226   2e-64    
ref|XP_004379410.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    224   2e-64    
gb|EPS67017.1|  hypothetical protein M569_07758                         225   3e-64    
emb|CCX34806.1|  Similar to Dolichyl-diphosphooligosaccharide--pr...    225   3e-64    
gb|EFN88856.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    224   3e-64    
ref|XP_002668944.1|  predicted protein                                  224   3e-64    
ref|XP_001892857.1|  Oligosaccharyl transferase STT3 subunit homolog    225   3e-64    
gb|KHJ94197.1|  oligosaccharyl transferase STT3 subunit                 216   3e-64    
gb|EJW88167.1|  hypothetical protein WUBG_00919                         225   3e-64    
gb|KIK23605.1|  glycosyltransferase family 66 protein                   225   3e-64    
ref|XP_011548704.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    225   3e-64    
gb|EHJ68763.1|  putative oligosaccharyl transferase                     225   3e-64    
gb|KIJ65465.1|  glycosyltransferase family 66 protein                   225   3e-64    
ref|XP_011548703.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    225   3e-64    
ref|XP_001874437.1|  oligosaccharyl transferase STT3 subunit            225   3e-64    
ref|XP_008037982.1|  oligosaccharyl transferase STT3 subunit            225   3e-64    
ref|XP_006851655.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    225   3e-64    
ref|XP_007864971.1|  oligosaccharyl transferase STT3 subunit            225   4e-64    
ref|XP_003245338.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    225   4e-64    
gb|KIK45569.1|  glycosyltransferase family 66 protein                   225   4e-64    
emb|CDO68832.1|  Glycosyltransferase Family 66 protein                  225   4e-64    
ref|XP_007516910.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    225   4e-64    
gb|KIK05689.1|  glycosyltransferase family 66 protein                   225   4e-64    
ref|XP_009548802.1|  glycosyltransferase family 66 protein              224   4e-64    
ref|XP_007235829.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    219   4e-64    
gb|EJW83386.1|  hypothetical protein WUBG_05703                         224   5e-64    
gb|EYU17803.1|  hypothetical protein MIMGU_mgv1a001976mg                224   5e-64    
ref|XP_007310483.1|  Oligosaccharyl transferase STT3 subunit            224   5e-64    
gb|KIM39622.1|  glycosyltransferase family 66 protein                   224   6e-64    
ref|XP_004414672.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    224   6e-64    
gb|EMD38962.1|  glycosyltransferase family 66 protein                   224   6e-64    
ref|XP_011359314.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    224   6e-64    
gb|ELU12621.1|  hypothetical protein CAPTEDRAFT_166596                  223   6e-64    
ref|XP_007363240.1|  oligosaccharyl transferase STT3 subunit            224   7e-64    
ref|XP_004419512.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    224   7e-64    
ref|XP_002476395.1|  predicted protein                                  223   7e-64    
ref|XP_007774555.1|  glycosyltransferase family 66 protein              224   7e-64    
ref|XP_004419511.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    224   7e-64    
ref|XP_004414671.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    224   7e-64    
ref|XP_003737761.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    224   7e-64    
ref|XP_008152110.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    224   7e-64    
ref|XP_004676415.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    224   7e-64    
ref|XP_542747.2|  PREDICTED: dolichyl-diphosphooligosaccharide--p...    224   8e-64    
ref|XP_006734063.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    224   8e-64    
ref|XP_011086954.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    223   8e-64    
ref|XP_004588315.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    224   8e-64    
ref|XP_002979240.1|  oligosaccharyltransferase subunit STT3             223   9e-64    
ref|XP_004377413.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    224   9e-64    
gb|KHJ33583.1|  putative oligosaccharyl transferase subunit             223   9e-64    
ref|XP_005317370.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    224   1e-63    
ref|XP_007400852.1|  glycosyltransferase family 66 protein              223   1e-63    
ref|XP_002052960.1|  GJ23594                                            224   1e-63    
emb|CCU81360.1|  Dolichyl-diphosphooligosaccharide--protein glyco...    223   1e-63    
ref|XP_006007693.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    223   1e-63    
ref|XP_004689182.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    222   1e-63    
ref|XP_004857954.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    223   1e-63    



>ref|XP_009775565.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Nicotiana sylvestris]
Length=772

 Score =   369 bits (948),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 197/217 (91%), Positives = 201/217 (93%), Gaps = 3/217 (1%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            MA  SD+   P S   LRQAFGNVFSL ILILIGV+AFSIRLFSVIKYESVIHEFDPYFN
Sbjct  1    MAASSDTVVTPSS---LRQAFGNVFSLFILILIGVLAFSIRLFSVIKYESVIHEFDPYFN  57

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE
Sbjct  58   YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  117

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            TVCVFTAP FSAFA+WATYLLTKEVKG GAGL AAALL MVPSYISRSVAGSYDNEAVAI
Sbjct  118  TVCVFTAPTFSAFAAWATYLLTKEVKGPGAGLTAAALLAMVPSYISRSVAGSYDNEAVAI  177

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FALIFTFYLYIKTLNTGSLFYATLNA+AYFYMV S G
Sbjct  178  FALIFTFYLYIKTLNTGSLFYATLNALAYFYMVCSWG  214



>ref|XP_009626922.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Nicotiana tomentosiformis]
Length=772

 Score =   368 bits (944),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 196/217 (90%), Positives = 201/217 (93%), Gaps = 3/217 (1%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            MA  SD+   P S   LR+AFGNVFSL ILILIGV+AFSIRLFSVIKYESVIHEFDPYFN
Sbjct  1    MAASSDTVVTPSS---LRRAFGNVFSLFILILIGVLAFSIRLFSVIKYESVIHEFDPYFN  57

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE
Sbjct  58   YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  117

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            TVCVFTAP FSAFA+WATYLLTKEVKG GAGL AAALL MVPSYISRSVAGSYDNEAVAI
Sbjct  118  TVCVFTAPTFSAFAAWATYLLTKEVKGPGAGLTAAALLAMVPSYISRSVAGSYDNEAVAI  177

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FALIFTFYLYIKTLNTGSLFYATLNA+AYFYMV S G
Sbjct  178  FALIFTFYLYIKTLNTGSLFYATLNALAYFYMVCSWG  214



>ref|XP_011048330.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A isoform X2 [Populus euphratica]
Length=781

 Score =   367 bits (942),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 199/214 (93%), Gaps = 1/214 (0%)
 Frame = +1

Query  97   SDSEA-VPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRV  273
            +D E+    +A TLR AFGNV S  IL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRV
Sbjct  2    ADGESSKEATARTLRNAFGNVLSFFILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRV  61

Query  274  TQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVC  453
            TQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWW+LNSLNIPLSVETVC
Sbjct  62   TQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWLLNSLNIPLSVETVC  121

Query  454  VFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFAL  633
            VFTAPIFSAFASWATYLLTKEVKGTGAGL AA LL MVPSYISRSVAGSYDNEAVAIFAL
Sbjct  122  VFTAPIFSAFASWATYLLTKEVKGTGAGLTAAVLLAMVPSYISRSVAGSYDNEAVAIFAL  181

Query  634  IFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            IFTFYLYIKTLNTGSLFYATLNA+AYFYMV S G
Sbjct  182  IFTFYLYIKTLNTGSLFYATLNALAYFYMVCSWG  215



>gb|EPS69204.1| hypothetical protein M569_05562, partial [Genlisea aurea]
Length=306

 Score =   352 bits (902),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 194/210 (92%), Gaps = 2/210 (1%)
 Frame = +1

Query  106  EAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFL  285
            EA  G   T+R  FGNV S+ +L LIG++AFSIRLFSVIKYESVIHEFDPYFNYRVTQ+L
Sbjct  3    EASKG--GTMRDVFGNVLSIFVLCLIGILAFSIRLFSVIKYESVIHEFDPYFNYRVTQYL  60

Query  286  TKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTA  465
            TK+G+YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILN+LNIPLSVETVCVFTA
Sbjct  61   TKHGVYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNTLNIPLSVETVCVFTA  120

Query  466  PIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTF  645
            PIFSAFASWA YLLTKE+KG GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFTF
Sbjct  121  PIFSAFASWAAYLLTKEIKGVGAGLTAAALLAMVPSYISRSVAGSYDNEAVAIFALIFTF  180

Query  646  YLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            YLYIKTLNTGSLFYATLN+IAYFYMV S G
Sbjct  181  YLYIKTLNTGSLFYATLNSIAYFYMVCSWG  210



>ref|XP_011048329.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A isoform X1 [Populus euphratica]
Length=782

 Score =   367 bits (941),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 199/214 (93%), Gaps = 1/214 (0%)
 Frame = +1

Query  97   SDSEA-VPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRV  273
            +D E+    +A TLR AFGNV S  IL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRV
Sbjct  2    ADGESSKEATARTLRNAFGNVLSFFILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRV  61

Query  274  TQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVC  453
            TQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWW+LNSLNIPLSVETVC
Sbjct  62   TQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWLLNSLNIPLSVETVC  121

Query  454  VFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFAL  633
            VFTAPIFSAFASWATYLLTKEVKGTGAGL AA LL MVPSYISRSVAGSYDNEAVAIFAL
Sbjct  122  VFTAPIFSAFASWATYLLTKEVKGTGAGLTAAVLLAMVPSYISRSVAGSYDNEAVAIFAL  181

Query  634  IFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            IFTFYLYIKTLNTGSLFYATLNA+AYFYMV S G
Sbjct  182  IFTFYLYIKTLNTGSLFYATLNALAYFYMVCSWG  215



>ref|XP_002325019.2| hypothetical protein POPTR_0018s09300g [Populus trichocarpa]
 gb|EEF03584.2| hypothetical protein POPTR_0018s09300g [Populus trichocarpa]
Length=780

 Score =   366 bits (940),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 199/214 (93%), Gaps = 1/214 (0%)
 Frame = +1

Query  97   SDSEA-VPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRV  273
            +D E+    +A TLR AFGNV S  IL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRV
Sbjct  2    ADGESSKEATARTLRNAFGNVLSFFILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRV  61

Query  274  TQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVC  453
            TQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWW+LNSLNIPLSVETVC
Sbjct  62   TQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWLLNSLNIPLSVETVC  121

Query  454  VFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFAL  633
            VFTAPIFSAFASWATYLLTKEVKGTGAGL AA LL MVPSYISRSVAGSYDNEAVAIFAL
Sbjct  122  VFTAPIFSAFASWATYLLTKEVKGTGAGLTAAVLLAMVPSYISRSVAGSYDNEAVAIFAL  181

Query  634  IFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            IFTFYLYIKTLNTGSLFYATLNA+AYFYMV S G
Sbjct  182  IFTFYLYIKTLNTGSLFYATLNALAYFYMVCSWG  215



>ref|XP_002871900.1| hypothetical protein ARALYDRAFT_488863 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48159.1| hypothetical protein ARALYDRAFT_488863 [Arabidopsis lyrata subsp. 
lyrata]
Length=779

 Score =   365 bits (937),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 186/207 (90%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = +1

Query  115  PGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKN  294
            PG+   +R AFGNV S+LIL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFL+KN
Sbjct  9    PGTPTAMRNAFGNVLSVLILVLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLSKN  68

Query  295  GIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIF  474
            GIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVETVCVFTAP+F
Sbjct  69   GIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWVLNSLNIPLSVETVCVFTAPVF  128

Query  475  SAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLY  654
            SAFASWATYLLTKEVKG+GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFTFYLY
Sbjct  129  SAFASWATYLLTKEVKGSGAGLAAAALLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLY  188

Query  655  IKTLNTGSLFYATLNAIAYFYMVGSLG  735
            IKTLNTGSLFYATLNA+AYFYMV S G
Sbjct  189  IKTLNTGSLFYATLNALAYFYMVCSWG  215



>ref|XP_006287100.1| hypothetical protein CARUB_v10000271mg [Capsella rubella]
 gb|EOA19998.1| hypothetical protein CARUB_v10000271mg [Capsella rubella]
Length=776

 Score =   364 bits (935),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 186/207 (90%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = +1

Query  115  PGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKN  294
            P +A  +R AFGNV S+LIL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFL+KN
Sbjct  9    PATATAMRHAFGNVLSVLILVLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLSKN  68

Query  295  GIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIF  474
            GIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVETVCVFTAP+F
Sbjct  69   GIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWVLNSLNIPLSVETVCVFTAPVF  128

Query  475  SAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLY  654
            SAFASWATYLLTKEVKG+GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFTFYLY
Sbjct  129  SAFASWATYLLTKEVKGSGAGLAAAALLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLY  188

Query  655  IKTLNTGSLFYATLNAIAYFYMVGSLG  735
            IKTLNTGSLFYATLNA+AYFYMV S G
Sbjct  189  IKTLNTGSLFYATLNALAYFYMVCSWG  215



>gb|KGN65137.1| hypothetical protein Csa_1G237060 [Cucumis sativus]
Length=267

 Score =   347 bits (891),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +1

Query  94   PSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRV  273
            P  + ++P   +TLR AFGNV S  ILILIGV+AFSIRLFSVIKYESVIHEFDPYFNYRV
Sbjct  58   PFMAASLPSKGSTLRDAFGNVLSFFILILIGVLAFSIRLFSVIKYESVIHEFDPYFNYRV  117

Query  274  TQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVC  453
            TQ+L+K GIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLW +LN+LNIPLSVETVC
Sbjct  118  TQYLSKMGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWRVLNALNIPLSVETVC  177

Query  454  VFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFAL  633
            VFTAPIFSAFASWATYLLTKEVKG GAGL AAALL MVPSYISRSVAGSYDNEAVAIFAL
Sbjct  178  VFTAPIFSAFASWATYLLTKEVKGPGAGLTAAALLAMVPSYISRSVAGSYDNEAVAIFAL  237

Query  634  IFTFYLYIKTLNTGSLFYATLNAIAYFYM  720
            IFTFYLY+KTLNTGSLFYATLNAIAYFY+
Sbjct  238  IFTFYLYLKTLNTGSLFYATLNAIAYFYI  266



>ref|XP_004497228.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Cicer arietinum]
Length=773

 Score =   363 bits (933),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = +1

Query  109  AVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLT  288
            A   + ++LR AFGNV +  ILILIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLT
Sbjct  2    AATEAQSSLRHAFGNVLAFFILILIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLT  61

Query  289  KNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAP  468
            KNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAP
Sbjct  62   KNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAP  121

Query  469  IFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFY  648
            IFSAFASWATYLLTKEVKG GAGL AA LL MVPSYISRSVAGSYDNEAVAIFALIFTFY
Sbjct  122  IFSAFASWATYLLTKEVKGAGAGLTAAVLLAMVPSYISRSVAGSYDNEAVAIFALIFTFY  181

Query  649  LYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            LYIKTLNTGSLFYATLN+IAYFYMV S G
Sbjct  182  LYIKTLNTGSLFYATLNSIAYFYMVCSWG  210



>ref|XP_007013064.1| Staurosporin and temperature sensitive 3-like A isoform 3 [Theobroma 
cacao]
 gb|EOY30683.1| Staurosporin and temperature sensitive 3-like A isoform 3 [Theobroma 
cacao]
Length=708

 Score =   362 bits (928),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 192/220 (87%), Positives = 200/220 (91%), Gaps = 3/220 (1%)
 Frame = +1

Query  85   MAVP-SDSEAVPG--SAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDP  255
            MA P + S AVP   +  TLR AFG V S  IL+LIGV+AFSIRLFSVIKYESVIHEFDP
Sbjct  1    MAAPEASSAAVPTLMTNNTLRNAFGGVLSFFILLLIGVLAFSIRLFSVIKYESVIHEFDP  60

Query  256  YFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPL  435
            YFNYRVTQFLTKNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPL
Sbjct  61   YFNYRVTQFLTKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPL  120

Query  436  SVETVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEA  615
            SVETVCVFTAPIFSAFASWATYLLTKEVKG GAGL AA LL MVPSYISRSVAGSYDNEA
Sbjct  121  SVETVCVFTAPIFSAFASWATYLLTKEVKGAGAGLTAAVLLAMVPSYISRSVAGSYDNEA  180

Query  616  VAIFALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            VAIFALIFTFYLYIKTLNTGSLFYATLN+IAYFYMV S G
Sbjct  181  VAIFALIFTFYLYIKTLNTGSLFYATLNSIAYFYMVCSWG  220



>ref|XP_003592715.1| Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 
subunit STT3A [Medicago truncatula]
 gb|AES62966.1| oligosaccharyltransferase subunit STT3 [Medicago truncatula]
Length=773

 Score =   363 bits (932),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +1

Query  109  AVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLT  288
            A   +  +LR AFGNV +  ILILIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLT
Sbjct  2    AATDAQTSLRHAFGNVLAFFILILIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLT  61

Query  289  KNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAP  468
            KNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWW+LNSLNIPLSVETVCVFTAP
Sbjct  62   KNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWVLNSLNIPLSVETVCVFTAP  121

Query  469  IFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFY  648
            IFSAFASWATYLLTKEVKG GAGL AA LL MVPSYISRSVAGSYDNEAVAIFALIFTFY
Sbjct  122  IFSAFASWATYLLTKEVKGAGAGLTAAVLLAMVPSYISRSVAGSYDNEAVAIFALIFTFY  181

Query  649  LYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            LYIKTLNTGSLFYATLN+IAYFYMV S G
Sbjct  182  LYIKTLNTGSLFYATLNSIAYFYMVCSWG  210



>gb|KFK26187.1| hypothetical protein AALP_AA8G213900 [Arabis alpina]
Length=780

 Score =   363 bits (931),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 185/207 (89%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = +1

Query  115  PGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKN  294
            PG+ + +R AFGNV S+LIL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFL+KN
Sbjct  9    PGTPSAMRHAFGNVLSVLILVLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLSKN  68

Query  295  GIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIF  474
            GIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW++NSLNIPLSVETVCVFTAP+F
Sbjct  69   GIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWVVNSLNIPLSVETVCVFTAPVF  128

Query  475  SAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLY  654
            SAFASWATY LTKEVKG+GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFTFYLY
Sbjct  129  SAFASWATYFLTKEVKGSGAGLAAAALLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLY  188

Query  655  IKTLNTGSLFYATLNAIAYFYMVGSLG  735
            IKTLNTGSLFYATLNAIAYFYMV S G
Sbjct  189  IKTLNTGSLFYATLNAIAYFYMVCSWG  215



>gb|AAK91413.1| AT5g19690/T29J13_110 [Arabidopsis thaliana]
 gb|AAL31142.1| AT5g19690/T29J13_110 [Arabidopsis thaliana]
Length=779

 Score =   362 bits (930),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +1

Query  112  VPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTK  291
            +PG+   +R AFGNV S+LIL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFL+K
Sbjct  8    LPGTPTAMRNAFGNVLSVLILVLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLSK  67

Query  292  NGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPI  471
            NGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW LNSLNIPLSVETVCVFTAP+
Sbjct  68   NGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWGLNSLNIPLSVETVCVFTAPV  127

Query  472  FSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYL  651
            FSAFASWATYLLTKEVKG+GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFTFYL
Sbjct  128  FSAFASWATYLLTKEVKGSGAGLAAAALLAMVPSYISRSVAGSYDNEAVAIFALIFTFYL  187

Query  652  YIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            YIKTLNTGSLFYATLNA+AYFYMV S G
Sbjct  188  YIKTLNTGSLFYATLNALAYFYMVCSWG  215



>ref|NP_568380.1| dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Arabidopsis thaliana]
 sp|Q93ZY3.1|STT3A_ARATH RecName: Full=Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A; Short=Oligosaccharyl transferase 
subunit STT3A; Short=STT3-A; AltName: Full=Integral membrane 
protein 1; AltName: Full=Protein STAUROSPORIN AND TEMPERATURE 
SENSITIVE 3-LIKE A [Arabidopsis thaliana]
 gb|AAL07040.1| putative oligosaccharyl transferase STT3 [Arabidopsis thaliana]
 gb|AED92738.1| dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Arabidopsis thaliana]
 gb|AHL38618.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=779

 Score =   362 bits (930),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +1

Query  112  VPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTK  291
            +PG+   +R AFGNV S+LIL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFL+K
Sbjct  8    LPGTPTAMRNAFGNVLSVLILVLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLSK  67

Query  292  NGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPI  471
            NGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW LNSLNIPLSVETVCVFTAP+
Sbjct  68   NGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWGLNSLNIPLSVETVCVFTAPV  127

Query  472  FSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYL  651
            FSAFASWATYLLTKEVKG+GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFTFYL
Sbjct  128  FSAFASWATYLLTKEVKGSGAGLAAAALLAMVPSYISRSVAGSYDNEAVAIFALIFTFYL  187

Query  652  YIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            YIKTLNTGSLFYATLNA+AYFYMV S G
Sbjct  188  YIKTLNTGSLFYATLNALAYFYMVCSWG  215



>ref|XP_010519673.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Tarenaya hassleriana]
Length=780

 Score =   362 bits (930),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 188/217 (87%), Positives = 199/217 (92%), Gaps = 3/217 (1%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            MA P   +    +A +LR AFGNV S +IL+LIGV+AFSIRLFSVIKYESVIHEFDPYFN
Sbjct  1    MAAPESQQR---TATSLRHAFGNVLSFVILVLIGVLAFSIRLFSVIKYESVIHEFDPYFN  57

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            YRVTQFL+KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVE
Sbjct  58   YRVTQFLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWVLNSLNIPLSVE  117

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            TVCVFTAPIFSAFASWATYLLTKEVKG GAGL AA LL MVPSYISRSVAGSYDNEAVAI
Sbjct  118  TVCVFTAPIFSAFASWATYLLTKEVKGPGAGLTAAVLLAMVPSYISRSVAGSYDNEAVAI  177

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FALIFTFYLYIKTLNTGSLFYATLNA+AYFYMV S G
Sbjct  178  FALIFTFYLYIKTLNTGSLFYATLNALAYFYMVCSWG  214



>ref|XP_010493048.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Camelina sativa]
Length=778

 Score =   362 bits (929),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = +1

Query  100  DSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQ  279
            +S     +A  +R AFGNV S+LIL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQ
Sbjct  5    ESPQPAATATAMRHAFGNVLSVLILVLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQ  64

Query  280  FLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVF  459
            FL+KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVETVCVF
Sbjct  65   FLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWVLNSLNIPLSVETVCVF  124

Query  460  TAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIF  639
            TAP+FSAFASWATYLLTKEVKG+GAGL AA LL MVPSYISRSVAGSYDNEAVAIFALIF
Sbjct  125  TAPVFSAFASWATYLLTKEVKGSGAGLAAAVLLAMVPSYISRSVAGSYDNEAVAIFALIF  184

Query  640  TFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            TFYLYIKTLNTGSLFYATLNA+AYFYMV S G
Sbjct  185  TFYLYIKTLNTGSLFYATLNALAYFYMVCSWG  216



>ref|XP_006400531.1| hypothetical protein EUTSA_v10012742mg [Eutrema salsugineum]
 gb|ESQ41984.1| hypothetical protein EUTSA_v10012742mg [Eutrema salsugineum]
Length=777

 Score =   362 bits (929),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 186/207 (90%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = +1

Query  115  PGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKN  294
            PG+ + +R AFG+V S LIL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFL+KN
Sbjct  9    PGTPSAMRHAFGSVLSALILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLSKN  68

Query  295  GIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIF  474
            GIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVETVCVFTAP+F
Sbjct  69   GIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWVLNSLNIPLSVETVCVFTAPVF  128

Query  475  SAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLY  654
            SAFASWATYLLTKEVKG+GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFTFYLY
Sbjct  129  SAFASWATYLLTKEVKGSGAGLAAAALLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLY  188

Query  655  IKTLNTGSLFYATLNAIAYFYMVGSLG  735
            IKTLNTGSLFYATLNAIAYFYMV S G
Sbjct  189  IKTLNTGSLFYATLNAIAYFYMVCSWG  215



>tpg|DAA57613.1| TPA: hypothetical protein ZEAMMB73_748744 [Zea mays]
Length=281

 Score =   346 bits (887),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            M  P  S A  GS   LR AFG V  +  L+LIGV+AFSIRLFSVIKYESVIHEFDPYFN
Sbjct  1    MPEPQSSVASSGSVDRLRNAFGGVLCIFTLLLIGVLAFSIRLFSVIKYESVIHEFDPYFN  60

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            YRVTQFL+KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVE
Sbjct  61   YRVTQFLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPLSVE  120

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            TVCVFTAP+FS  ASWATYLLTKE KG GAGLMAA +L MVPSYISRSVAGSYDNEAVAI
Sbjct  121  TVCVFTAPVFSVNASWATYLLTKETKGPGAGLMAATILAMVPSYISRSVAGSYDNEAVAI  180

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FALIFTFYLY+KTLNTGSLFYA LN+++YFYMV S G
Sbjct  181  FALIFTFYLYVKTLNTGSLFYAALNSLSYFYMVCSWG  217



>ref|XP_006451260.1| hypothetical protein CICLE_v10007513mg [Citrus clementina]
 gb|ESR64500.1| hypothetical protein CICLE_v10007513mg [Citrus clementina]
Length=658

 Score =   358 bits (919),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +1

Query  130  TLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDF  309
            TLR AFGNV S  IL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDF
Sbjct  11   TLRHAFGNVLSFFILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDF  70

Query  310  WNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFAS  489
            WNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVETVCVFTAPIFSAFAS
Sbjct  71   WNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPLSVETVCVFTAPIFSAFAS  130

Query  490  WATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLN  669
            WATYLLTKEVKG GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALI TFYLYIKTLN
Sbjct  131  WATYLLTKEVKGAGAGLTAAALLAMVPSYISRSVAGSYDNEAVAIFALIITFYLYIKTLN  190

Query  670  TGSLFYATLNAIAYFYMVGSLG  735
            TGSLFYATLNAIAYFYMV S G
Sbjct  191  TGSLFYATLNAIAYFYMVCSWG  212



>emb|CDX70886.1| BnaC03g09700D [Brassica napus]
Length=778

 Score =   362 bits (928),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 185/207 (89%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = +1

Query  115  PGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKN  294
            PG+ + +R AFG V S LIL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFL+KN
Sbjct  9    PGTPSAMRNAFGTVLSALILVLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLSKN  68

Query  295  GIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIF  474
            GIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNS+NIPLSVETVCVFTAP+F
Sbjct  69   GIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWVLNSINIPLSVETVCVFTAPVF  128

Query  475  SAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLY  654
            SAFASWATYLLTKEVKG+GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFTFYLY
Sbjct  129  SAFASWATYLLTKEVKGSGAGLAAAALLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLY  188

Query  655  IKTLNTGSLFYATLNAIAYFYMVGSLG  735
            IKTLNTGSLFYATLNAIAYFYMV S G
Sbjct  189  IKTLNTGSLFYATLNAIAYFYMVCSWG  215



>ref|XP_004287460.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Fragaria vesca subsp. vesca]
Length=777

 Score =   361 bits (927),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = +1

Query  121  SAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGI  300
            S  TLR AFGNV + LILILIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGI
Sbjct  8    SGKTLRNAFGNVLAFLILILIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGI  67

Query  301  YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSA  480
            YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWW+LNSLNIPLSVET+CVFTAPIFSA
Sbjct  68   YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWLLNSLNIPLSVETICVFTAPIFSA  127

Query  481  FASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIK  660
            F SW+TYLLT+EVKGTGAGL AAAL+ MVPSYISRSVAGSYDNEAVAIFALIFTFYLYIK
Sbjct  128  FTSWSTYLLTREVKGTGAGLTAAALIAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYIK  187

Query  661  TLNTGSLFYATLNAIAYFYMVGSLG  735
            TLNTGSLFYATLN++AYFYMV S G
Sbjct  188  TLNTGSLFYATLNSLAYFYMVCSWG  212



>ref|XP_010454254.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform X2 [Camelina sativa]
Length=683

 Score =   358 bits (920),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = +1

Query  100  DSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQ  279
            +S     +A  +R AFGNV S+LIL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQ
Sbjct  5    ESPQPAATATAMRHAFGNVLSVLILVLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQ  64

Query  280  FLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVF  459
            FL+KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW LNSLNIPLSVETVCVF
Sbjct  65   FLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWFLNSLNIPLSVETVCVF  124

Query  460  TAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIF  639
            TAP+FSAFASWATYLLT+EVKG+GAGL AA LL MVPSYISRSVAGSYDNEAVAIFALIF
Sbjct  125  TAPVFSAFASWATYLLTQEVKGSGAGLAAAVLLAMVPSYISRSVAGSYDNEAVAIFALIF  184

Query  640  TFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            TFYLYIKTLNTGSLFYATLNA+AYFYMV S G
Sbjct  185  TFYLYIKTLNTGSLFYATLNALAYFYMVCSWG  216



>ref|XP_007013063.1| Staurosporin and temperature sensitive 3-like A isoform 2 [Theobroma 
cacao]
 gb|EOY30682.1| Staurosporin and temperature sensitive 3-like A isoform 2 [Theobroma 
cacao]
Length=787

 Score =   362 bits (928),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 192/220 (87%), Positives = 200/220 (91%), Gaps = 3/220 (1%)
 Frame = +1

Query  85   MAVP-SDSEAVPG--SAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDP  255
            MA P + S AVP   +  TLR AFG V S  IL+LIGV+AFSIRLFSVIKYESVIHEFDP
Sbjct  1    MAAPEASSAAVPTLMTNNTLRNAFGGVLSFFILLLIGVLAFSIRLFSVIKYESVIHEFDP  60

Query  256  YFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPL  435
            YFNYRVTQFLTKNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPL
Sbjct  61   YFNYRVTQFLTKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPL  120

Query  436  SVETVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEA  615
            SVETVCVFTAPIFSAFASWATYLLTKEVKG GAGL AA LL MVPSYISRSVAGSYDNEA
Sbjct  121  SVETVCVFTAPIFSAFASWATYLLTKEVKGAGAGLTAAVLLAMVPSYISRSVAGSYDNEA  180

Query  616  VAIFALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            VAIFALIFTFYLYIKTLNTGSLFYATLN+IAYFYMV S G
Sbjct  181  VAIFALIFTFYLYIKTLNTGSLFYATLNSIAYFYMVCSWG  220



>ref|XP_012076776.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Jatropha curcas]
 gb|KDP33728.1| hypothetical protein JCGZ_07299 [Jatropha curcas]
Length=776

 Score =   361 bits (927),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 193/202 (96%), Gaps = 0/202 (0%)
 Frame = +1

Query  130  TLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDF  309
            TLR AFGNVFS  ILILIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTK GIYDF
Sbjct  12   TLRHAFGNVFSFFILILIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKKGIYDF  71

Query  310  WNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFAS  489
            WNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFAS
Sbjct  72   WNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFAS  131

Query  490  WATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLN  669
            WATYLLTKEVKG GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLN
Sbjct  132  WATYLLTKEVKGAGAGLTAAALLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLN  191

Query  670  TGSLFYATLNAIAYFYMVGSLG  735
            TGSLFYATLNA+AYFYMV S G
Sbjct  192  TGSLFYATLNALAYFYMVCSWG  213



>ref|XP_010420783.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Camelina sativa]
Length=778

 Score =   361 bits (926),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 187/210 (89%), Positives = 198/210 (94%), Gaps = 3/210 (1%)
 Frame = +1

Query  115  PGSAAT---LRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFL  285
            P  AAT   +R AFGNV S+LIL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFL
Sbjct  7    PQPAATTTAMRHAFGNVLSVLILVLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFL  66

Query  286  TKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTA  465
            +KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVETVCVFTA
Sbjct  67   SKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWVLNSLNIPLSVETVCVFTA  126

Query  466  PIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTF  645
            P+FSAFASWATYLLTKEVKG+GAGL AA LL MVPSYISRSVAGSYDNEAVAIFALIFTF
Sbjct  127  PVFSAFASWATYLLTKEVKGSGAGLAAAVLLAMVPSYISRSVAGSYDNEAVAIFALIFTF  186

Query  646  YLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            YLYIKTLNTGSLFYATLNA+AYFYMV S G
Sbjct  187  YLYIKTLNTGSLFYATLNALAYFYMVCSWG  216



>ref|XP_003516821.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Glycine max]
Length=778

 Score =   361 bits (926),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 185/202 (92%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +1

Query  130  TLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDF  309
            ++R AFGNV +  IL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDF
Sbjct  14   SIRHAFGNVLAFFILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDF  73

Query  310  WNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFAS  489
            WNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWW+LNSLNIPLSVETVCVFTAPIFSAFAS
Sbjct  74   WNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWVLNSLNIPLSVETVCVFTAPIFSAFAS  133

Query  490  WATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLN  669
            WATYLLTKEVKG GAGL AA LL MVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLN
Sbjct  134  WATYLLTKEVKGAGAGLTAAVLLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLN  193

Query  670  TGSLFYATLNAIAYFYMVGSLG  735
            TGSLFYATLN+IAYFYMV S G
Sbjct  194  TGSLFYATLNSIAYFYMVCSWG  215



>emb|CDX88879.1| BnaA03g07700D [Brassica napus]
Length=778

 Score =   361 bits (926),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = +1

Query  115  PGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKN  294
            PG+ + +R AFG V S LIL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFL+KN
Sbjct  9    PGTPSAMRNAFGTVLSALILVLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLSKN  68

Query  295  GIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIF  474
            GIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LN++NIPLSVETVCVFTAP+F
Sbjct  69   GIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWVLNAINIPLSVETVCVFTAPVF  128

Query  475  SAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLY  654
            SAFASWATYLLTKEVKG+GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFTFYLY
Sbjct  129  SAFASWATYLLTKEVKGSGAGLAAAALLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLY  188

Query  655  IKTLNTGSLFYATLNAIAYFYMVGSLG  735
            IKTLNTGSLFYATLNAIAYFYMV S G
Sbjct  189  IKTLNTGSLFYATLNAIAYFYMVCSWG  215



>gb|KHN40395.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3 [Glycine soja]
Length=761

 Score =   360 bits (924),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 185/202 (92%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +1

Query  130  TLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDF  309
            ++R AFGNV +  IL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDF
Sbjct  14   SIRHAFGNVLAFFILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDF  73

Query  310  WNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFAS  489
            WNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWW+LNSLNIPLSVETVCVFTAPIFSAFAS
Sbjct  74   WNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWVLNSLNIPLSVETVCVFTAPIFSAFAS  133

Query  490  WATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLN  669
            WATYLLTKEVKG GAGL AA LL MVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLN
Sbjct  134  WATYLLTKEVKGAGAGLTAAVLLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLN  193

Query  670  TGSLFYATLNAIAYFYMVGSLG  735
            TGSLFYATLN+IAYFYMV S G
Sbjct  194  TGSLFYATLNSIAYFYMVCSWG  215



>ref|XP_007152904.1| hypothetical protein PHAVU_004G170000g [Phaseolus vulgaris]
 gb|ESW24898.1| hypothetical protein PHAVU_004G170000g [Phaseolus vulgaris]
Length=774

 Score =   360 bits (925),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +1

Query  130  TLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDF  309
            ++R AFGNV +  IL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDF
Sbjct  12   SVRHAFGNVLAFFILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDF  71

Query  310  WNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFAS  489
            WNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFAS
Sbjct  72   WNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFAS  131

Query  490  WATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLN  669
            WATYLLTKEVKG GAGL AA LL MVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLN
Sbjct  132  WATYLLTKEVKGAGAGLTAAILLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLN  191

Query  670  TGSLFYATLNAIAYFYMVGSLG  735
            TGSLFYATLN+IAYFYMV S G
Sbjct  192  TGSLFYATLNSIAYFYMVCSWG  213



>ref|XP_006853616.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Amborella trichopoda]
 gb|ERN15083.1| hypothetical protein AMTR_s00056p00052520 [Amborella trichopoda]
Length=774

 Score =   360 bits (925),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 186/203 (92%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = +1

Query  127  ATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYD  306
            ATLR AFGNV S+ ILILIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYD
Sbjct  2    ATLRDAFGNVLSVFILILIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYD  61

Query  307  FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFA  486
            FWNWFDDRTWYPLGRVIGGTVYPGLTLTAG++WW LNSLNIPLSVETVCVFTAPIFSAFA
Sbjct  62   FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGSIWWFLNSLNIPLSVETVCVFTAPIFSAFA  121

Query  487  SWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTL  666
            SWATYLLTKEVKG GAGL AAAL+ MVPSYISRSVAGSYDNEAVAIFAL+FTFYLYIKTL
Sbjct  122  SWATYLLTKEVKGVGAGLTAAALIAMVPSYISRSVAGSYDNEAVAIFALVFTFYLYIKTL  181

Query  667  NTGSLFYATLNAIAYFYMVGSLG  735
            NTGSLFYATLNA++YFYMV S G
Sbjct  182  NTGSLFYATLNALSYFYMVCSWG  204



>ref|XP_010535959.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Tarenaya hassleriana]
Length=781

 Score =   360 bits (925),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 188/217 (87%), Positives = 195/217 (90%), Gaps = 2/217 (1%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            M  P   +  P  A  LR AFGNV S  IL+LIGV+AFSIRLFSVIKYESVIHEFDPYFN
Sbjct  1    MVTPESQQ--PEKATPLRHAFGNVLSFAILVLIGVLAFSIRLFSVIKYESVIHEFDPYFN  58

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            YRVTQFL+KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW LNSLNIPLSVE
Sbjct  59   YRVTQFLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTMWWALNSLNIPLSVE  118

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            TVCVFTAPIFSAFASWATYLLTKEVKG GAGL AA LL MVPSYISRSVAGSYDNEAVAI
Sbjct  119  TVCVFTAPIFSAFASWATYLLTKEVKGPGAGLTAAVLLAMVPSYISRSVAGSYDNEAVAI  178

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FALIFTFYLYIKTLNTGSLFYATLNA+AYFYMV S G
Sbjct  179  FALIFTFYLYIKTLNTGSLFYATLNALAYFYMVCSWG  215



>ref|XP_007013062.1| Staurosporin and temperature sensitive 3-like A isoform 1 [Theobroma 
cacao]
 gb|EOY30681.1| Staurosporin and temperature sensitive 3-like A isoform 1 [Theobroma 
cacao]
Length=819

 Score =   361 bits (927),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 192/220 (87%), Positives = 200/220 (91%), Gaps = 3/220 (1%)
 Frame = +1

Query  85   MAVP-SDSEAVPG--SAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDP  255
            MA P + S AVP   +  TLR AFG V S  IL+LIGV+AFSIRLFSVIKYESVIHEFDP
Sbjct  1    MAAPEASSAAVPTLMTNNTLRNAFGGVLSFFILLLIGVLAFSIRLFSVIKYESVIHEFDP  60

Query  256  YFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPL  435
            YFNYRVTQFLTKNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPL
Sbjct  61   YFNYRVTQFLTKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPL  120

Query  436  SVETVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEA  615
            SVETVCVFTAPIFSAFASWATYLLTKEVKG GAGL AA LL MVPSYISRSVAGSYDNEA
Sbjct  121  SVETVCVFTAPIFSAFASWATYLLTKEVKGAGAGLTAAVLLAMVPSYISRSVAGSYDNEA  180

Query  616  VAIFALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            VAIFALIFTFYLYIKTLNTGSLFYATLN+IAYFYMV S G
Sbjct  181  VAIFALIFTFYLYIKTLNTGSLFYATLNSIAYFYMVCSWG  220



>ref|XP_004251627.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Solanum lycopersicum]
Length=772

 Score =   360 bits (924),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 191/217 (88%), Positives = 201/217 (93%), Gaps = 4/217 (2%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            MA  SD+     + ++LR AFGNVFSL ILILIGV+AFSIR+FSVIKYESVIHEFDPYFN
Sbjct  1    MAASSDTV----TPSSLRLAFGNVFSLFILILIGVLAFSIRIFSVIKYESVIHEFDPYFN  56

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWI+NSLNIPLSVE
Sbjct  57   YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWIINSLNIPLSVE  116

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            TVCVFTAP FSAFA+WATYLLTKEVKG GAGL AAALL MVPSYISRSVAGSYDNEAVAI
Sbjct  117  TVCVFTAPTFSAFAAWATYLLTKEVKGVGAGLTAAALLAMVPSYISRSVAGSYDNEAVAI  176

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FALIFTFYLYIKTLNTGSLFYATLNA++YFYMV S G
Sbjct  177  FALIFTFYLYIKTLNTGSLFYATLNALSYFYMVCSWG  213



>ref|XP_009131748.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Brassica rapa]
Length=778

 Score =   360 bits (924),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = +1

Query  115  PGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKN  294
            PG+ + +R AFG V S LIL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFL+KN
Sbjct  9    PGTPSAMRNAFGTVLSALILVLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLSKN  68

Query  295  GIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIF  474
            GIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LN++NIPLSVETVCVFTAP+F
Sbjct  69   GIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWVLNAINIPLSVETVCVFTAPVF  128

Query  475  SAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLY  654
            SAFASWATYLLTKEVKG+GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFTFYLY
Sbjct  129  SAFASWATYLLTKEVKGSGAGLAAAALLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLY  188

Query  655  IKTLNTGSLFYATLNAIAYFYMVGSLG  735
            IKTLNTGSLFYATLNAIAYFYMV S G
Sbjct  189  IKTLNTGSLFYATLNAIAYFYMVCSWG  215



>emb|CDP03275.1| unnamed protein product [Coffea canephora]
Length=796

 Score =   360 bits (924),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 193/217 (89%), Positives = 200/217 (92%), Gaps = 4/217 (2%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            MA P  S     + ++LR AFG+VFS  ILILIGV+AFSIRLFSVIKYESVIHEFDPYFN
Sbjct  1    MAAPETSP----TPSSLRNAFGHVFSFFILILIGVLAFSIRLFSVIKYESVIHEFDPYFN  56

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWW+LNSLNIPLSVE
Sbjct  57   YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWLLNSLNIPLSVE  116

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            TVCVFTAPIFSAFASWATYLLTKEVKG GAGL AAALL MVPSYISRSVAGSYDNEAVAI
Sbjct  117  TVCVFTAPIFSAFASWATYLLTKEVKGAGAGLTAAALLAMVPSYISRSVAGSYDNEAVAI  176

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FALIFTFYLYIKTLNTGSLFYATLN+IAYFYMV S G
Sbjct  177  FALIFTFYLYIKTLNTGSLFYATLNSIAYFYMVCSWG  213



>gb|KJB65009.1| hypothetical protein B456_010G075800 [Gossypium raimondii]
Length=671

 Score =   357 bits (915),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 194/220 (88%), Positives = 200/220 (91%), Gaps = 3/220 (1%)
 Frame = +1

Query  85   MAVPSDS-EAVPG--SAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDP  255
            MA P  S  AVP   +  TLR AFG V S  IL+LIGVMAFSIRLFSVIKYESVIHEFDP
Sbjct  1    MAAPETSTAAVPTLYTNNTLRNAFGGVLSFFILLLIGVMAFSIRLFSVIKYESVIHEFDP  60

Query  256  YFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPL  435
            YFNYRVTQFL KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPL
Sbjct  61   YFNYRVTQFLAKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPL  120

Query  436  SVETVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEA  615
            SVETVCVFTAPIFSAFASWATYLLTKEVKGTGAGL AAALL MVPSYISRSVAGSYDNEA
Sbjct  121  SVETVCVFTAPIFSAFASWATYLLTKEVKGTGAGLTAAALLAMVPSYISRSVAGSYDNEA  180

Query  616  VAIFALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            VAIFALIFTFYLYIKTLNTGSLFYATLN+IAYFYMV S G
Sbjct  181  VAIFALIFTFYLYIKTLNTGSLFYATLNSIAYFYMVCSWG  220



>gb|KHN16965.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3 [Glycine soja]
Length=778

 Score =   359 bits (921),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 197/212 (93%), Gaps = 1/212 (0%)
 Frame = +1

Query  103  SEAVPGSAAT-LRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQ  279
            SEA+ G+  T +R AFGNV +  IL++IGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQ
Sbjct  4    SEALNGTTTTSIRHAFGNVLAFFILLMIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQ  63

Query  280  FLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVF  459
            FLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLW ILNS+NIPLSVETVCVF
Sbjct  64   FLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWRILNSINIPLSVETVCVF  123

Query  460  TAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIF  639
            TAPIFSAFASWATYLLTKEVKG GAGL AA LL MVPSYISRSVAGSYDNEAVAIFALIF
Sbjct  124  TAPIFSAFASWATYLLTKEVKGVGAGLTAAVLLAMVPSYISRSVAGSYDNEAVAIFALIF  183

Query  640  TFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            TFYLYIKTLNTGSLFYATLN+IAYFYMV S G
Sbjct  184  TFYLYIKTLNTGSLFYATLNSIAYFYMVCSWG  215



>ref|XP_006353484.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Solanum tuberosum]
Length=772

 Score =   358 bits (920),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 192/217 (88%), Positives = 201/217 (93%), Gaps = 4/217 (2%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            MA  SD+     + ++LR AFGNVFSL ILILIGV+AFSIR+FSVIKYESVIHEFDPYFN
Sbjct  1    MAASSDTV----TPSSLRLAFGNVFSLFILILIGVLAFSIRIFSVIKYESVIHEFDPYFN  56

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE
Sbjct  57   YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  116

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            TVCVFTAP FSAFA+WATYLLTKEVKG GAGL AAALL MVPSYISRSVAGSYDNEAVAI
Sbjct  117  TVCVFTAPTFSAFAAWATYLLTKEVKGAGAGLTAAALLAMVPSYISRSVAGSYDNEAVAI  176

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FALIFTFYLYIKTLNTGSLFYATLNA++YFYMV S G
Sbjct  177  FALIFTFYLYIKTLNTGSLFYATLNALSYFYMVCSWG  213



>ref|XP_010454253.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform X1 [Camelina sativa]
Length=778

 Score =   358 bits (920),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = +1

Query  100  DSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQ  279
            +S     +A  +R AFGNV S+LIL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQ
Sbjct  5    ESPQPAATATAMRHAFGNVLSVLILVLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQ  64

Query  280  FLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVF  459
            FL+KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW LNSLNIPLSVETVCVF
Sbjct  65   FLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWFLNSLNIPLSVETVCVF  124

Query  460  TAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIF  639
            TAP+FSAFASWATYLLT+EVKG+GAGL AA LL MVPSYISRSVAGSYDNEAVAIFALIF
Sbjct  125  TAPVFSAFASWATYLLTQEVKGSGAGLAAAVLLAMVPSYISRSVAGSYDNEAVAIFALIF  184

Query  640  TFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            TFYLYIKTLNTGSLFYATLNA+AYFYMV S G
Sbjct  185  TFYLYIKTLNTGSLFYATLNALAYFYMVCSWG  216



>ref|XP_003547741.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Glycine max]
Length=778

 Score =   358 bits (920),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 197/212 (93%), Gaps = 1/212 (0%)
 Frame = +1

Query  103  SEAVPGSAAT-LRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQ  279
            SEA+ G+  T +R AFGNV +  IL++IGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQ
Sbjct  4    SEALNGTTTTSIRHAFGNVLAFFILLMIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQ  63

Query  280  FLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVF  459
            FLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLW ILNS+NIPLSVETVCVF
Sbjct  64   FLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWRILNSINIPLSVETVCVF  123

Query  460  TAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIF  639
            TAPIFSAFASWATYLLTKEVKG GAGL AA LL MVPSYISRSVAGSYDNEAVAIFALIF
Sbjct  124  TAPIFSAFASWATYLLTKEVKGVGAGLTAAVLLAMVPSYISRSVAGSYDNEAVAIFALIF  183

Query  640  TFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            TFYLYIKTLNTGSLFYATLN+IAYFYMV S G
Sbjct  184  TFYLYIKTLNTGSLFYATLNSIAYFYMVCSWG  215



>ref|XP_010095369.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3 [Morus notabilis]
 gb|EXB59788.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3 [Morus notabilis]
Length=779

 Score =   358 bits (920),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 190/202 (94%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +1

Query  130  TLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDF  309
            TLR AFGNVFS  ILILIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTK+GIY+F
Sbjct  11   TLRNAFGNVFSFFILILIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKSGIYEF  70

Query  310  WNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFAS  489
            WNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVETVCVFTAPIFSAFAS
Sbjct  71   WNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPLSVETVCVFTAPIFSAFAS  130

Query  490  WATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLN  669
            WATYLLTKEVKGTGAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLN
Sbjct  131  WATYLLTKEVKGTGAGLTAAALLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLN  190

Query  670  TGSLFYATLNAIAYFYMVGSLG  735
            TGSLFYATLNAIAYFYMV S G
Sbjct  191  TGSLFYATLNAIAYFYMVCSWG  212



>ref|XP_006451261.1| hypothetical protein CICLE_v10007513mg [Citrus clementina]
 gb|ESR64501.1| hypothetical protein CICLE_v10007513mg [Citrus clementina]
 gb|KDO66517.1| hypothetical protein CISIN_1g003973mg [Citrus sinensis]
Length=737

 Score =   357 bits (917),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +1

Query  130  TLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDF  309
            TLR AFGNV S  IL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDF
Sbjct  11   TLRHAFGNVLSFFILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDF  70

Query  310  WNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFAS  489
            WNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVETVCVFTAPIFSAFAS
Sbjct  71   WNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPLSVETVCVFTAPIFSAFAS  130

Query  490  WATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLN  669
            WATYLLTKEVKG GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALI TFYLYIKTLN
Sbjct  131  WATYLLTKEVKGAGAGLTAAALLAMVPSYISRSVAGSYDNEAVAIFALIITFYLYIKTLN  190

Query  670  TGSLFYATLNAIAYFYMVGSLG  735
            TGSLFYATLNAIAYFYMV S G
Sbjct  191  TGSLFYATLNAIAYFYMVCSWG  212



>ref|XP_007203242.1| hypothetical protein PRUPE_ppa001464mg [Prunus persica]
 gb|EMJ04441.1| hypothetical protein PRUPE_ppa001464mg [Prunus persica]
Length=821

 Score =   359 bits (922),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = +1

Query  94   PSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRV  273
            PS + +   +  +LR AFGNV S  ILILIGV+AFSIRLFSVIKYESVIHEFDPYFNYRV
Sbjct  42   PSMAASETSNGTSLRHAFGNVLSFFILILIGVLAFSIRLFSVIKYESVIHEFDPYFNYRV  101

Query  274  TQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVC  453
            TQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWW+LNSLNIPLSVET+C
Sbjct  102  TQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWLLNSLNIPLSVETIC  161

Query  454  VFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFAL  633
            VFTAPIFSAF SWATYLLT+EVKG GAGL AAAL+ MVPSYISRSVAGSYDNEAVAIFAL
Sbjct  162  VFTAPIFSAFTSWATYLLTREVKGAGAGLTAAALIAMVPSYISRSVAGSYDNEAVAIFAL  221

Query  634  IFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            IFTFYLYIKTLNTGSLFYATLNAIAYFYMV S G
Sbjct  222  IFTFYLYIKTLNTGSLFYATLNAIAYFYMVCSWG  255



>ref|XP_002514244.1| oligosaccharyl transferase, putative [Ricinus communis]
 gb|EEF48198.1| oligosaccharyl transferase, putative [Ricinus communis]
Length=779

 Score =   358 bits (918),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 197/213 (92%), Gaps = 1/213 (0%)
 Frame = +1

Query  97   SDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVT  276
            + SE+  G   TLR AFGNV S  ILILIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVT
Sbjct  2    AGSESAKGET-TLRYAFGNVLSFFILILIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVT  60

Query  277  QFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCV  456
            QFLTK GIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWW+LNSLNIPLSVETVCV
Sbjct  61   QFLTKKGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWLLNSLNIPLSVETVCV  120

Query  457  FTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALI  636
            FTAPIFSAFASWATYLLTKEVKG GAGL AAA+L MVPSYISRSVAGSYDNEAVAIFALI
Sbjct  121  FTAPIFSAFASWATYLLTKEVKGAGAGLTAAAILAMVPSYISRSVAGSYDNEAVAIFALI  180

Query  637  FTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FTFYLY+KTLNTGSLFYATLNA+AYFYMV S G
Sbjct  181  FTFYLYLKTLNTGSLFYATLNALAYFYMVCSWG  213



>ref|XP_006451262.1| hypothetical protein CICLE_v10007513mg [Citrus clementina]
 ref|XP_006494313.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Citrus sinensis]
 gb|ESR64502.1| hypothetical protein CICLE_v10007513mg [Citrus clementina]
 gb|KDO66516.1| hypothetical protein CISIN_1g003973mg [Citrus sinensis]
Length=782

 Score =   357 bits (917),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +1

Query  130  TLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDF  309
            TLR AFGNV S  IL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDF
Sbjct  11   TLRHAFGNVLSFFILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDF  70

Query  310  WNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFAS  489
            WNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVETVCVFTAPIFSAFAS
Sbjct  71   WNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPLSVETVCVFTAPIFSAFAS  130

Query  490  WATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLN  669
            WATYLLTKEVKG GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALI TFYLYIKTLN
Sbjct  131  WATYLLTKEVKGAGAGLTAAALLAMVPSYISRSVAGSYDNEAVAIFALIITFYLYIKTLN  190

Query  670  TGSLFYATLNAIAYFYMVGSLG  735
            TGSLFYATLNAIAYFYMV S G
Sbjct  191  TGSLFYATLNAIAYFYMVCSWG  212



>gb|KHG22028.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3 [Gossypium arboreum]
Length=724

 Score =   355 bits (911),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 188/220 (85%), Positives = 198/220 (90%), Gaps = 3/220 (1%)
 Frame = +1

Query  85   MAVPSDS-EAVPG--SAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDP  255
            MA P  S  AVP   +  TLR AFG V S  IL+LIGV+AFSIRLFSVIKYESVIHEFDP
Sbjct  1    MAAPEASTAAVPTLYTNNTLRNAFGGVLSFFILLLIGVLAFSIRLFSVIKYESVIHEFDP  60

Query  256  YFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPL  435
            YFNYRVTQFLTK GIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPL
Sbjct  61   YFNYRVTQFLTKKGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPL  120

Query  436  SVETVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEA  615
            SVETVCVFTAPIFSAFASWATYLLTKEVKG GAGL +A LL MVPSYISRSVAGSYDNEA
Sbjct  121  SVETVCVFTAPIFSAFASWATYLLTKEVKGAGAGLTSAVLLAMVPSYISRSVAGSYDNEA  180

Query  616  VAIFALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            VAIFALIFTFYLY+KTLNTGSLFYATLN++AYFYMV S G
Sbjct  181  VAIFALIFTFYLYLKTLNTGSLFYATLNSLAYFYMVCSWG  220



>gb|KJB65007.1| hypothetical protein B456_010G075800 [Gossypium raimondii]
Length=788

 Score =   357 bits (915),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 194/220 (88%), Positives = 200/220 (91%), Gaps = 3/220 (1%)
 Frame = +1

Query  85   MAVPSDS-EAVPG--SAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDP  255
            MA P  S  AVP   +  TLR AFG V S  IL+LIGVMAFSIRLFSVIKYESVIHEFDP
Sbjct  1    MAAPETSTAAVPTLYTNNTLRNAFGGVLSFFILLLIGVMAFSIRLFSVIKYESVIHEFDP  60

Query  256  YFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPL  435
            YFNYRVTQFL KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPL
Sbjct  61   YFNYRVTQFLAKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPL  120

Query  436  SVETVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEA  615
            SVETVCVFTAPIFSAFASWATYLLTKEVKGTGAGL AAALL MVPSYISRSVAGSYDNEA
Sbjct  121  SVETVCVFTAPIFSAFASWATYLLTKEVKGTGAGLTAAALLAMVPSYISRSVAGSYDNEA  180

Query  616  VAIFALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            VAIFALIFTFYLYIKTLNTGSLFYATLN+IAYFYMV S G
Sbjct  181  VAIFALIFTFYLYIKTLNTGSLFYATLNSIAYFYMVCSWG  220



>emb|CDX92509.1| BnaA10g15480D [Brassica napus]
Length=779

 Score =   356 bits (914),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 197/208 (95%), Gaps = 1/208 (0%)
 Frame = +1

Query  115  PG-SAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTK  291
            PG S++ +R AFG V S LIL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFL+K
Sbjct  7    PGTSSSAMRNAFGTVLSALILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLSK  66

Query  292  NGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPI  471
            NGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW LN++NIPLSVETVCVFTAP+
Sbjct  67   NGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWALNAINIPLSVETVCVFTAPV  126

Query  472  FSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYL  651
            FSAFASWATYLLTKEVKG+GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFTFYL
Sbjct  127  FSAFASWATYLLTKEVKGSGAGLAAAALLAMVPSYISRSVAGSYDNEAVAIFALIFTFYL  186

Query  652  YIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            YIKTLNTGSLFYATLNAIAYFYMV S G
Sbjct  187  YIKTLNTGSLFYATLNAIAYFYMVCSWG  214



>ref|XP_008242518.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Prunus mume]
Length=778

 Score =   356 bits (914),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = +1

Query  121  SAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGI  300
            +  +LR AFGNV S  ILILIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGI
Sbjct  8    NGTSLRHAFGNVLSFFILILIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGI  67

Query  301  YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSA  480
            YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWW+LNSLNIPLSVET+CVFTAPIFSA
Sbjct  68   YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWLLNSLNIPLSVETICVFTAPIFSA  127

Query  481  FASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIK  660
            F SWATYLLT+EVKG GAGL AAAL+ MVPSYISRSVAGSYDNEAVAIFALIFTFYLYIK
Sbjct  128  FTSWATYLLTREVKGAGAGLTAAALIAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYIK  187

Query  661  TLNTGSLFYATLNAIAYFYMVGSLG  735
            TLNTGSLFYATLNAIAYFYMV S G
Sbjct  188  TLNTGSLFYATLNAIAYFYMVCSWG  212



>gb|AFW78838.1| hypothetical protein ZEAMMB73_319539 [Zea mays]
Length=690

 Score =   353 bits (907),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 184/217 (85%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            MA P  S A  G    LR AFG V     L+LIGV+AFSIRLFSVIKYESVIHEFDPYFN
Sbjct  1    MAEPEVSPAAAGGGGRLRNAFGGVLCAFTLLLIGVVAFSIRLFSVIKYESVIHEFDPYFN  60

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            +RVTQFL+KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVE
Sbjct  61   FRVTQFLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTMWWLLNSLNIPLSVE  120

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            TVCVFTAPIFSA ASWATYLLTKE KGTGAGLMAAA+L MVPSYISRSVAGSYDNEAVAI
Sbjct  121  TVCVFTAPIFSANASWATYLLTKEAKGTGAGLMAAAILAMVPSYISRSVAGSYDNEAVAI  180

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FALIFTFYLY+KTLNTGSLFYATLNA++YFYMV S G
Sbjct  181  FALIFTFYLYVKTLNTGSLFYATLNALSYFYMVCSWG  217



>ref|XP_009120866.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Brassica rapa]
Length=781

 Score =   356 bits (914),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 197/208 (95%), Gaps = 1/208 (0%)
 Frame = +1

Query  115  PG-SAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTK  291
            PG S++ +R AFG V S LIL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFL+K
Sbjct  9    PGTSSSAMRNAFGTVLSALILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLSK  68

Query  292  NGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPI  471
            NGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW LN++NIPLSVETVCVFTAP+
Sbjct  69   NGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWALNAINIPLSVETVCVFTAPV  128

Query  472  FSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYL  651
            FSAFASWATYLLTKEVKG+GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFTFYL
Sbjct  129  FSAFASWATYLLTKEVKGSGAGLAAAALLAMVPSYISRSVAGSYDNEAVAIFALIFTFYL  188

Query  652  YIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            YIKTLNTGSLFYATLNAIAYFYMV S G
Sbjct  189  YIKTLNTGSLFYATLNAIAYFYMVCSWG  216



>ref|XP_010688294.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Beta vulgaris subsp. vulgaris]
Length=781

 Score =   356 bits (913),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +1

Query  118  GSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNG  297
             + ++LRQA GNV ++ ILILIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNG
Sbjct  7    ANVSSLRQACGNVLAVFILILIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNG  66

Query  298  IYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFS  477
            IYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WWIL+S+N+PLSVETVCVFTAP+FS
Sbjct  67   IYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTMWWILHSVNVPLSVETVCVFTAPVFS  126

Query  478  AFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYI  657
            AFASWATYLLTKE+KG+GAGL AA LLGMVPSYISRSVAGSYDNEAVAIFALIFTFYLY+
Sbjct  127  AFASWATYLLTKEMKGSGAGLTAALLLGMVPSYISRSVAGSYDNEAVAIFALIFTFYLYV  186

Query  658  KTLNTGSLFYATLNAIAYFYMVGSLG  735
            KTLNTGSLFYATLNAI+YFYMV S G
Sbjct  187  KTLNTGSLFYATLNAISYFYMVCSWG  212



>ref|XP_008462758.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A isoform X1 [Cucumis melo]
Length=763

 Score =   355 bits (911),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = +1

Query  103  SEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQF  282
            + ++P   +TLR AFGNV S  ILILIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQ+
Sbjct  2    AASLPSKGSTLRDAFGNVLSFFILILIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQY  61

Query  283  LTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFT  462
            L+K GIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLW +LN+LNIPLSVETVCVFT
Sbjct  62   LSKMGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWRVLNALNIPLSVETVCVFT  121

Query  463  APIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFT  642
            APIFSAFASWATYLLTKEVKG GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFT
Sbjct  122  APIFSAFASWATYLLTKEVKGPGAGLTAAALLAMVPSYISRSVAGSYDNEAVAIFALIFT  181

Query  643  FYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FYLY+KTLNTGSLFYATLNAIAYFYMV S G
Sbjct  182  FYLYLKTLNTGSLFYATLNAIAYFYMVCSWG  212



>ref|XP_010047698.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Eucalyptus grandis]
 gb|KCW79655.1| hypothetical protein EUGRSUZ_C01008 [Eucalyptus grandis]
Length=786

 Score =   355 bits (912),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 188/201 (94%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = +1

Query  133  LRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFW  312
            LRQAFG V S  IL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFW
Sbjct  19   LRQAFGGVLSFFILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFW  78

Query  313  NWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASW  492
            NWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASW
Sbjct  79   NWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASW  138

Query  493  ATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNT  672
            ATYLLTKEVKG GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFTF+LYIKTLNT
Sbjct  139  ATYLLTKEVKGAGAGLTAAALLAMVPSYISRSVAGSYDNEAVAIFALIFTFFLYIKTLNT  198

Query  673  GSLFYATLNAIAYFYMVGSLG  735
            GSLFYATLNAI+YFYMV S G
Sbjct  199  GSLFYATLNAISYFYMVCSWG  219



>ref|XP_008387183.1| PREDICTED: LOW QUALITY PROTEIN: dolichyl-diphosphooligosaccharide--protein 
glycosyltransferase subunit STT3A [Malus domestica]
Length=777

 Score =   355 bits (911),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = +1

Query  121  SAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGI  300
            +  TLR AFGNV S  ILILIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGI
Sbjct  8    NGTTLRHAFGNVLSFFILILIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGI  67

Query  301  YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSA  480
            YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAG+LWW LNSLNIPLSVET+CVFTAPIFSA
Sbjct  68   YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGSLWWFLNSLNIPLSVETICVFTAPIFSA  127

Query  481  FASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIK  660
            F SWATYLLT+EVKG GAGL AAAL+ MVPSYISRSVAGSYDNEAVAIFALIFTFYLYIK
Sbjct  128  FTSWATYLLTREVKGAGAGLTAAALIAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYIK  187

Query  661  TLNTGSLFYATLNAIAYFYMVGSLG  735
            TLNTGSLFYATLNAIAYFYMV S G
Sbjct  188  TLNTGSLFYATLNAIAYFYMVCSWG  212



>gb|KJB83104.1| hypothetical protein B456_013G229700 [Gossypium raimondii]
Length=793

 Score =   355 bits (912),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 189/220 (86%), Positives = 198/220 (90%), Gaps = 3/220 (1%)
 Frame = +1

Query  85   MAVPSDS-EAVPG--SAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDP  255
            MA P  S  AVP   +  TLR AFG V S  IL+LIGV+AFSIRLFSVIKYESVIHEFDP
Sbjct  1    MAAPETSTAAVPTLYTNNTLRNAFGGVLSFFILLLIGVLAFSIRLFSVIKYESVIHEFDP  60

Query  256  YFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPL  435
            YFNYRVTQFLTK GIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPL
Sbjct  61   YFNYRVTQFLTKKGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPL  120

Query  436  SVETVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEA  615
            SVETVCVFTAPIFSAFASWATYLLTKEVKG GAGL AA LL MVPSYISRSVAGSYDNEA
Sbjct  121  SVETVCVFTAPIFSAFASWATYLLTKEVKGAGAGLTAAVLLAMVPSYISRSVAGSYDNEA  180

Query  616  VAIFALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            VAIFALIFTFYLY+KTLNTGSLFYATLN++AYFYMV S G
Sbjct  181  VAIFALIFTFYLYLKTLNTGSLFYATLNSLAYFYMVCSWG  220



>gb|KHG24964.1| Oligosaccharyl transferase subunit STT3 [Gossypium arboreum]
Length=788

 Score =   355 bits (911),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 193/220 (88%), Positives = 200/220 (91%), Gaps = 3/220 (1%)
 Frame = +1

Query  85   MAVPSDS-EAVPG--SAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDP  255
            MA P  S  AVP   +  TLR AFG V S  IL+LIGVMAFSIRLFSVIKYESVIHEFDP
Sbjct  1    MAAPETSTAAVPTLYTNNTLRNAFGGVLSFFILLLIGVMAFSIRLFSVIKYESVIHEFDP  60

Query  256  YFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPL  435
            YFNYRVTQFL KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPL
Sbjct  61   YFNYRVTQFLAKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPL  120

Query  436  SVETVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEA  615
            SVETVCVFTAPIFSAFASWATYLLTKEVKGTGAGL AAALL MVPSYISRSVAGSYDNEA
Sbjct  121  SVETVCVFTAPIFSAFASWATYLLTKEVKGTGAGLTAAALLAMVPSYISRSVAGSYDNEA  180

Query  616  VAIFALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            VAIFALIFTFYLYIKTLNTGSLFYATLN+I+YFYMV S G
Sbjct  181  VAIFALIFTFYLYIKTLNTGSLFYATLNSISYFYMVCSWG  220



>ref|XP_009352534.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Pyrus x bretschneideri]
Length=779

 Score =   355 bits (910),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = +1

Query  121  SAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGI  300
            +  TLR AFGNV S  ILILIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGI
Sbjct  8    NGTTLRHAFGNVLSFFILILIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGI  67

Query  301  YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSA  480
            YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAG+LWW LNSLNIPLSVET+CVFTAPIFSA
Sbjct  68   YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGSLWWFLNSLNIPLSVETICVFTAPIFSA  127

Query  481  FASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIK  660
            F SWATYLLT+EVKG GAGL AAAL+ MVPSYISRSVAGSYDNEAVAIFALIFTFYLYIK
Sbjct  128  FTSWATYLLTREVKGAGAGLTAAALIAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYIK  187

Query  661  TLNTGSLFYATLNAIAYFYMVGSLG  735
            TLNTGSLFYATLNAIAYFYMV S G
Sbjct  188  TLNTGSLFYATLNAIAYFYMVCSWG  212



>ref|XP_008462759.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A isoform X2 [Cucumis melo]
Length=777

 Score =   355 bits (910),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = +1

Query  103  SEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQF  282
            + ++P   +TLR AFGNV S  ILILIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQ+
Sbjct  2    AASLPSKGSTLRDAFGNVLSFFILILIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQY  61

Query  283  LTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFT  462
            L+K GIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLW +LN+LNIPLSVETVCVFT
Sbjct  62   LSKMGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWRVLNALNIPLSVETVCVFT  121

Query  463  APIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFT  642
            APIFSAFASWATYLLTKEVKG GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFT
Sbjct  122  APIFSAFASWATYLLTKEVKGPGAGLTAAALLAMVPSYISRSVAGSYDNEAVAIFALIFT  181

Query  643  FYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FYLY+KTLNTGSLFYATLNAIAYFYMV S G
Sbjct  182  FYLYLKTLNTGSLFYATLNAIAYFYMVCSWG  212



>gb|EYU30721.1| hypothetical protein MIMGU_mgv1a001650mg [Erythranthe guttata]
Length=778

 Score =   355 bits (910),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 187/217 (86%), Positives = 197/217 (91%), Gaps = 3/217 (1%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            MA P + +     AAT+R AFGNV S LIL+LIGV+AFSIRLFSVIKYESVIHEFDPYFN
Sbjct  1    MAAPENPQQ---QAATIRHAFGNVLSFLILLLIGVLAFSIRLFSVIKYESVIHEFDPYFN  57

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            YRVTQFL K+G+YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLW I N+LNIPL+VE
Sbjct  58   YRVTQFLIKSGVYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWRIFNALNIPLTVE  117

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            TVCVFTAPIFSAFA+WATYLLTKEVKG GAGL AAALL MVPSYISRSVAGSYDNEAVAI
Sbjct  118  TVCVFTAPIFSAFAAWATYLLTKEVKGVGAGLTAAALLAMVPSYISRSVAGSYDNEAVAI  177

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FALI TFYLYIKTLNTGSLFYATLNAIAYFYMV S G
Sbjct  178  FALIITFYLYIKTLNTGSLFYATLNAIAYFYMVCSWG  214



>ref|XP_011655447.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Cucumis sativus]
Length=776

 Score =   354 bits (909),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = +1

Query  103  SEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQF  282
            + ++P   +TLR AFGNV S  ILILIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQ+
Sbjct  2    AASLPSKGSTLRDAFGNVLSFFILILIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQY  61

Query  283  LTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFT  462
            L+K GIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLW +LN+LNIPLSVETVCVFT
Sbjct  62   LSKMGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWRVLNALNIPLSVETVCVFT  121

Query  463  APIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFT  642
            APIFSAFASWATYLLTKEVKG GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFT
Sbjct  122  APIFSAFASWATYLLTKEVKGPGAGLTAAALLAMVPSYISRSVAGSYDNEAVAIFALIFT  181

Query  643  FYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FYLY+KTLNTGSLFYATLNAIAYFYMV S G
Sbjct  182  FYLYLKTLNTGSLFYATLNAIAYFYMVCSWG  212



>gb|ACL54353.1| unknown [Zea mays]
 gb|AFW78837.1| hypothetical protein ZEAMMB73_319539 [Zea mays]
Length=753

 Score =   353 bits (906),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 184/217 (85%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            MA P  S A  G    LR AFG V     L+LIGV+AFSIRLFSVIKYESVIHEFDPYFN
Sbjct  1    MAEPEVSPAAAGGGGRLRNAFGGVLCAFTLLLIGVVAFSIRLFSVIKYESVIHEFDPYFN  60

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            +RVTQFL+KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVE
Sbjct  61   FRVTQFLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTMWWLLNSLNIPLSVE  120

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            TVCVFTAPIFSA ASWATYLLTKE KGTGAGLMAAA+L MVPSYISRSVAGSYDNEAVAI
Sbjct  121  TVCVFTAPIFSANASWATYLLTKEAKGTGAGLMAAAILAMVPSYISRSVAGSYDNEAVAI  180

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FALIFTFYLY+KTLNTGSLFYATLNA++YFYMV S G
Sbjct  181  FALIFTFYLYVKTLNTGSLFYATLNALSYFYMVCSWG  217



>ref|XP_008647462.1| PREDICTED: uncharacterized protein LOC100217123 isoform X1 [Zea 
mays]
 gb|AFW78839.1| hypothetical protein ZEAMMB73_319539 [Zea mays]
Length=781

 Score =   353 bits (907),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 184/217 (85%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            MA P  S A  G    LR AFG V     L+LIGV+AFSIRLFSVIKYESVIHEFDPYFN
Sbjct  1    MAEPEVSPAAAGGGGRLRNAFGGVLCAFTLLLIGVVAFSIRLFSVIKYESVIHEFDPYFN  60

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            +RVTQFL+KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVE
Sbjct  61   FRVTQFLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTMWWLLNSLNIPLSVE  120

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            TVCVFTAPIFSA ASWATYLLTKE KGTGAGLMAAA+L MVPSYISRSVAGSYDNEAVAI
Sbjct  121  TVCVFTAPIFSANASWATYLLTKEAKGTGAGLMAAAILAMVPSYISRSVAGSYDNEAVAI  180

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FALIFTFYLY+KTLNTGSLFYATLNA++YFYMV S G
Sbjct  181  FALIFTFYLYVKTLNTGSLFYATLNALSYFYMVCSWG  217



>ref|XP_010249572.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Nelumbo nucifera]
Length=785

 Score =   352 bits (904),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +1

Query  118  GSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNG  297
            G A TLR AFG+V    IL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNG
Sbjct  7    GGATTLRHAFGSVLCFFILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNG  66

Query  298  IYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFS  477
            IYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAG+LWW+LNSLNIPLSVETVCVFTAPIFS
Sbjct  67   IYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGSLWWLLNSLNIPLSVETVCVFTAPIFS  126

Query  478  AFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYI  657
            A A+WATYLLTKEV+GTGAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFTFYLY+
Sbjct  127  ANAAWATYLLTKEVRGTGAGLTAAALLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYV  186

Query  658  KTLNTGSLFYATLNAIAYFYMVGSLG  735
            KTLNTGSLFYATLNA+AYFYMV S G
Sbjct  187  KTLNTGSLFYATLNALAYFYMVCSWG  212



>ref|XP_004969929.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Setaria italica]
Length=770

 Score =   352 bits (902),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 181/217 (83%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            M  P  S A  G    LR AFG V     L+LIGV+AFSIRLFSVIKYESVIHEFDPYFN
Sbjct  1    MPEPQSSTAASGGGGRLRDAFGEVLCTFTLLLIGVLAFSIRLFSVIKYESVIHEFDPYFN  60

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            YRVTQFL+KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVE
Sbjct  61   YRVTQFLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPLSVE  120

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            T CVFTAPIFSA ASWATYLLTKE KG+GAGLMAAA+L +VPSYISRSVAGSYDNEAVAI
Sbjct  121  TACVFTAPIFSANASWATYLLTKEAKGSGAGLMAAAILAVVPSYISRSVAGSYDNEAVAI  180

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FALIFTFYLY+KTLNTGSLFYATLNA++YFYMV S G
Sbjct  181  FALIFTFYLYVKTLNTGSLFYATLNALSYFYMVCSWG  217



>ref|XP_010232314.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform X2 [Brachypodium distachyon]
Length=691

 Score =   349 bits (896),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +1

Query  118  GSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNG  297
            G +A LR+AFG V     L+LIG++AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTK+G
Sbjct  13   GGSARLRKAFGGVLCAFTLLLIGILAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKSG  72

Query  298  IYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFS  477
            IY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNS+NIPLSVETVCVFTAPIFS
Sbjct  73   IYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSINIPLSVETVCVFTAPIFS  132

Query  478  AFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYI  657
            A ASWATYLLTKE KG GAGLMAA +L MVPSYISRSVAGSYDNEAVAIFALIFTFYLYI
Sbjct  133  ANASWATYLLTKEAKGHGAGLMAATILAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYI  192

Query  658  KTLNTGSLFYATLNAIAYFYMVGSLG  735
            KTLNTGSLFYATLNA++YFYMV S G
Sbjct  193  KTLNTGSLFYATLNALSYFYMVCSWG  218



>ref|XP_006654660.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Oryza brachyantha]
Length=787

 Score =   350 bits (898),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 184/217 (85%), Positives = 195/217 (90%), Gaps = 1/217 (0%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            MA P  S A  G    LR AFG V     L+LIGV+AFSIRLFSVIKYESVIHEFDPYFN
Sbjct  1    MAEPESSTAAAG-GRRLRNAFGGVLCAFTLLLIGVLAFSIRLFSVIKYESVIHEFDPYFN  59

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            +RVTQFL+KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVE
Sbjct  60   FRVTQFLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPLSVE  119

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            TVCVFTAPIFSA ASWATYLLTKE KGTGAGLMAAA+L MVPSYISRSVAGSYDNEAVAI
Sbjct  120  TVCVFTAPIFSANASWATYLLTKEAKGTGAGLMAAAILAMVPSYISRSVAGSYDNEAVAI  179

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FALIFTFYLY+KTLNTGSLFYATLNA++YFYMV S G
Sbjct  180  FALIFTFYLYVKTLNTGSLFYATLNALSYFYMVCSWG  216



>ref|XP_010924651.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Elaeis guineensis]
Length=788

 Score =   350 bits (897),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +1

Query  127  ATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYD  306
            +TLR AFG V  + IL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQ+LTKNGIYD
Sbjct  11   STLRNAFGGVLGVFILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQYLTKNGIYD  70

Query  307  FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFA  486
            FWNWFDDRTWYPLGRVIGGTVYPGLTLTAG++WW+LNSLNIPLSVETVCVFTAPIFSA A
Sbjct  71   FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGSMWWLLNSLNIPLSVETVCVFTAPIFSANA  130

Query  487  SWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTL  666
            +WAT+LLTKEVKGTGAGL AA LL MVPSYISRSVAGSYDNEAVAIFAL+FTFYLYIKTL
Sbjct  131  AWATFLLTKEVKGTGAGLTAAVLLAMVPSYISRSVAGSYDNEAVAIFALVFTFYLYIKTL  190

Query  667  NTGSLFYATLNAIAYFYMVGSLG  735
            NTGSLFYATLNA++YFYMV S G
Sbjct  191  NTGSLFYATLNALSYFYMVCSWG  213



>ref|XP_011078262.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Sesamum indicum]
Length=774

 Score =   349 bits (895),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 188/217 (87%), Positives = 195/217 (90%), Gaps = 5/217 (2%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            MA P   +       TLR AFGNV S  +L+LIGV+AFSIRLFSVIKYESVIHEFDPYFN
Sbjct  1    MAAPETPQP-----DTLRHAFGNVLSFFVLLLIGVLAFSIRLFSVIKYESVIHEFDPYFN  55

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            YRVTQ+LTK+G+YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLW ILN LNIPLSVE
Sbjct  56   YRVTQYLTKSGVYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWRILNFLNIPLSVE  115

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            TVCVFTAPIFSAFASWATYLLTKEVKG GAGL AAALL MVPSYISRSVAGSYDNEAVAI
Sbjct  116  TVCVFTAPIFSAFASWATYLLTKEVKGAGAGLTAAALLAMVPSYISRSVAGSYDNEAVAI  175

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMV S G
Sbjct  176  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVCSWG  212



>ref|XP_002280521.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Vitis vinifera]
 emb|CBI28016.3| unnamed protein product [Vitis vinifera]
Length=778

 Score =   348 bits (892),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 187/217 (86%), Positives = 196/217 (90%), Gaps = 5/217 (2%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            MA   DS     + + +R  FG+V S  ILILIGV+AFSIRLFSVIKYESVIHEFDPYFN
Sbjct  1    MAASEDS-----NQSKIRAVFGSVLSFFILILIGVLAFSIRLFSVIKYESVIHEFDPYFN  55

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAG++WW+LNSLNIPLSVE
Sbjct  56   YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGSIWWLLNSLNIPLSVE  115

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            TVCVFTAPIFSA A+WATYLLTKEVKGTGAGL AAALL MVPSYISRSVAGSYDNEAVAI
Sbjct  116  TVCVFTAPIFSANAAWATYLLTKEVKGTGAGLTAAALLAMVPSYISRSVAGSYDNEAVAI  175

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FALIFTFYLYIKTLNTGSLFYATLNAI YFYMV S G
Sbjct  176  FALIFTFYLYIKTLNTGSLFYATLNAITYFYMVCSWG  212



>ref|NP_001056068.1| Os05g0519900 [Oryza sativa Japonica Group]
 sp|Q6F2Z1.1|STT3A_ORYSJ RecName: Full=Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A; Short=Oligosaccharyl transferase 
subunit STT3A; Short=STT3-A; AltName: Full=Protein STAUROSPORIN 
AND TEMPERATURE SENSITIVE 3-LIKE A [Oryza sativa Japonica 
Group]
 gb|AAT69659.1| putative oligosaccharyl transferase STT3 subunit [Oryza sativa 
Japonica Group]
 gb|AAU44267.1| putative oligosaccharyl transferase STT3 [Oryza sativa Japonica 
Group]
 dbj|BAF17982.1| Os05g0519900 [Oryza sativa Japonica Group]
 dbj|BAG90322.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64392.1| hypothetical protein OsJ_19234 [Oryza sativa Japonica Group]
Length=787

 Score =   348 bits (892),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 183/217 (84%), Positives = 195/217 (90%), Gaps = 1/217 (0%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            MA P  S A  G  + LR A G V     L+LIGV+AFSIRLFSVIKYESVIHEFDPYFN
Sbjct  1    MAEPESSTAAAG-GSRLRNACGGVLCAFTLLLIGVLAFSIRLFSVIKYESVIHEFDPYFN  59

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            +RVTQFL+KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVE
Sbjct  60   FRVTQFLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPLSVE  119

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            TVCVFTAPIFSA ASWATYLLTKE KGTGAGLMAAA+L MVPSYISRSVAGSYDNEAVAI
Sbjct  120  TVCVFTAPIFSANASWATYLLTKEAKGTGAGLMAAAILAMVPSYISRSVAGSYDNEAVAI  179

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FALIFTFYLY+KTLNTGSLFYATLNA++YFYMV S G
Sbjct  180  FALIFTFYLYVKTLNTGSLFYATLNALSYFYMVCSWG  216



>ref|XP_003569794.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform X1 [Brachypodium distachyon]
Length=788

 Score =   348 bits (892),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 179/209 (86%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = +1

Query  109  AVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLT  288
            A  G +A LR+AFG V     L+LIG++AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLT
Sbjct  10   ASGGGSARLRKAFGGVLCAFTLLLIGILAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLT  69

Query  289  KNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAP  468
            K+GIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNS+NIPLSVETVCVFTAP
Sbjct  70   KSGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSINIPLSVETVCVFTAP  129

Query  469  IFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFY  648
            IFSA ASWATYLLTKE KG GAGLMAA +L MVPSYISRSVAGSYDNEAVAIFALIFTFY
Sbjct  130  IFSANASWATYLLTKEAKGHGAGLMAATILAMVPSYISRSVAGSYDNEAVAIFALIFTFY  189

Query  649  LYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            LYIKTLNTGSLFYATLNA++YFYMV S G
Sbjct  190  LYIKTLNTGSLFYATLNALSYFYMVCSWG  218



>ref|XP_008672724.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=770

 Score =   347 bits (891),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            M  P  S A  GS   LR AFG V  +  L+LIGV+AFSIRLFSVIKYESVIHEFDPYFN
Sbjct  1    MPEPQSSVASSGSVDRLRNAFGGVLCIFTLLLIGVLAFSIRLFSVIKYESVIHEFDPYFN  60

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            YRVTQFL+KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVE
Sbjct  61   YRVTQFLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPLSVE  120

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            TVCVFTAP+FS  ASWATYLLTKE KG GAGLMAA +L MVPSYISRSVAGSYDNEAVAI
Sbjct  121  TVCVFTAPVFSVNASWATYLLTKETKGPGAGLMAATILAMVPSYISRSVAGSYDNEAVAI  180

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FALIFTFYLY+KTLNTGSLFYA LN+++YFYMV S G
Sbjct  181  FALIFTFYLYVKTLNTGSLFYAALNSLSYFYMVCSWG  217



>ref|XP_004961472.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Setaria italica]
Length=784

 Score =   347 bits (891),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 182/217 (84%), Positives = 195/217 (90%), Gaps = 1/217 (0%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            MA P  S A  G    LR AFG V     L+LIGV+AFSIRLFSVIKYESVIHEFDPYFN
Sbjct  1    MAEPVSSAAASG-GGRLRNAFGGVLCAFTLLLIGVVAFSIRLFSVIKYESVIHEFDPYFN  59

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            +RVTQFL+KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW++N+LNIPLSVE
Sbjct  60   FRVTQFLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTMWWLVNALNIPLSVE  119

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            TVCVFTAPIFSA ASWATYLLTKE KGTGAGLMAAA+L MVPSYISRSVAGSYDNEAVAI
Sbjct  120  TVCVFTAPIFSANASWATYLLTKEAKGTGAGLMAAAILAMVPSYISRSVAGSYDNEAVAI  179

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FALIFTFYLY+KTLNTGSLFYATLNA++YFYMV S G
Sbjct  180  FALIFTFYLYVKTLNTGSLFYATLNALSYFYMVCSWG  216



>ref|XP_010254009.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Nelumbo nucifera]
Length=786

 Score =   347 bits (891),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = +1

Query  124  AATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIY  303
             ATLR AFGNV +  IL LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQ+LTKNGIY
Sbjct  9    GATLRHAFGNVLTFFILPLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQYLTKNGIY  68

Query  304  DFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAF  483
            DFWNWFDDRTWYPLGRVIGGTVYPGLTLTAG++WW+LNSLNIPLSVETVCVFTAPIFSA 
Sbjct  69   DFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGSIWWLLNSLNIPLSVETVCVFTAPIFSAN  128

Query  484  ASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKT  663
            A+WATYLLTKEV+GTGAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFTFYLY+KT
Sbjct  129  AAWATYLLTKEVRGTGAGLTAAALLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYVKT  188

Query  664  LNTGSLFYATLNAIAYFYMVGSLG  735
            LNTGSLFYATLN++AYFYMV S G
Sbjct  189  LNTGSLFYATLNSLAYFYMVCSWG  212



>ref|XP_009410892.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Musa acuminata subsp. malaccensis]
Length=782

 Score =   343 bits (881),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 182/217 (84%), Positives = 196/217 (90%), Gaps = 4/217 (2%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            MA  S+++       T+R+AFG V    IL+LIG +AFSIRLFSVIKYESVIHEFDPYFN
Sbjct  1    MAASSETKG----EGTMRKAFGGVLGFFILLLIGALAFSIRLFSVIKYESVIHEFDPYFN  56

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAG++WW+LN+LNIPLSVE
Sbjct  57   YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGSIWWLLNNLNIPLSVE  116

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            TVCVFTAPIFSA ASWATYLLTKEVKGTGAGL AAALL +VPSYISRSVAGSYDNEAVAI
Sbjct  117  TVCVFTAPIFSANASWATYLLTKEVKGTGAGLTAAALLALVPSYISRSVAGSYDNEAVAI  176

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FALIFTFYLY KTLNTGSLFYATLNA++YFYMV S G
Sbjct  177  FALIFTFYLYTKTLNTGSLFYATLNALSYFYMVCSWG  213



>ref|XP_002441399.1| hypothetical protein SORBIDRAFT_09g025920 [Sorghum bicolor]
 gb|EES19829.1| hypothetical protein SORBIDRAFT_09g025920 [Sorghum bicolor]
Length=782

 Score =   343 bits (879),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 177/201 (88%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  133  LRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFW  312
            LR AFG V     L+LIGV+AFSIRLFSVIKYESVIHEFDPYFN+RVTQ+L+KNGIY+FW
Sbjct  17   LRNAFGGVLCAFTLLLIGVVAFSIRLFSVIKYESVIHEFDPYFNFRVTQYLSKNGIYEFW  76

Query  313  NWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASW  492
            NWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVETVCVFTAPIFSA ASW
Sbjct  77   NWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPLSVETVCVFTAPIFSANASW  136

Query  493  ATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNT  672
            ATYLLTKE KGTGAGLMAAA+L MVPSYISRSVAGSYDNEAVAIFALIFTFYLY+KTLNT
Sbjct  137  ATYLLTKEAKGTGAGLMAAAILAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYVKTLNT  196

Query  673  GSLFYATLNAIAYFYMVGSLG  735
            GSLFYATLNA++YFYMV S G
Sbjct  197  GSLFYATLNALSYFYMVCSWG  217



>dbj|BAJ94938.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=788

 Score =   341 bits (875),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  133  LRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFW  312
            LR AFG V     L+LIGV+AFSIRLFSVIKYESVIHEFDPYFN+RVTQFL+KNGIY+FW
Sbjct  18   LRNAFGGVLCAFTLLLIGVLAFSIRLFSVIKYESVIHEFDPYFNFRVTQFLSKNGIYEFW  77

Query  313  NWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASW  492
            NWFDDRTWYPLGRVIGGTVYPGLTLTAG++WW++N+LNIPLSVETVCVFTAPIFSA ASW
Sbjct  78   NWFDDRTWYPLGRVIGGTVYPGLTLTAGSIWWLVNALNIPLSVETVCVFTAPIFSANASW  137

Query  493  ATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNT  672
            ATYLLTKE KGTGAGLMAAA+L MVPSYISRSVAGSYDNEAVAIFAL+FTFYLY+KTLNT
Sbjct  138  ATYLLTKEAKGTGAGLMAAAILAMVPSYISRSVAGSYDNEAVAIFALVFTFYLYVKTLNT  197

Query  673  GSLFYATLNAIAYFYMVGSLG  735
            GSLFYATLNA++YFYMV S G
Sbjct  198  GSLFYATLNALSYFYMVCSWG  218



>ref|XP_002983693.1| oligosaccharyltransferase subunit STT3 [Selaginella moellendorffii]
 gb|EFJ15189.1| oligosaccharyltransferase subunit STT3 [Selaginella moellendorffii]
Length=759

 Score =   340 bits (871),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = +1

Query  136  RQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWN  315
            ++AFG V + LIL LIG+MAFSIRLFSVIKYESVIHEFDPYFNYRVT++LTK GIY+FWN
Sbjct  23   KRAFGTVLAALILCLIGIMAFSIRLFSVIKYESVIHEFDPYFNYRVTKYLTKAGIYEFWN  82

Query  316  WFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWA  495
            WFDDRTWYPLGRVIGGTVYPGLT+TAGT+WWILN+ NIPLSVETVCVFTAPIFS+FA+WA
Sbjct  83   WFDDRTWYPLGRVIGGTVYPGLTITAGTMWWILNAFNIPLSVETVCVFTAPIFSSFAAWA  142

Query  496  TYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTG  675
            TYLLT EVKG GAGL AAALL MVPSYISRSVAGSYDNEAVAIFALIFTFYLY+KTLNTG
Sbjct  143  TYLLTSEVKGRGAGLTAAALLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYVKTLNTG  202

Query  676  SLFYATLNAIAYFYMVGSLG  735
            SLFYATLNA+AYFYMV S G
Sbjct  203  SLFYATLNALAYFYMVCSWG  222



>ref|XP_008810656.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Phoenix dactylifera]
Length=787

 Score =   340 bits (871),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = +1

Query  124  AATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIY  303
            A+ LR AFG+V  + IL+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQ+LTKNGIY
Sbjct  10   ASALRNAFGSVLGVFILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQYLTKNGIY  69

Query  304  DFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAF  483
            DFWNWFDDRTWYPLGRVIGGTV+PGLTLTAG++WW LNSLNIPLSVETVCVFTAPIFSA 
Sbjct  70   DFWNWFDDRTWYPLGRVIGGTVFPGLTLTAGSMWWFLNSLNIPLSVETVCVFTAPIFSAN  129

Query  484  ASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKT  663
            A+WA YLLTKEVKGTGAGL AAALL MVPSYISRSVAGSYDNEAVAIFAL+FTFYLY+KT
Sbjct  130  AAWAAYLLTKEVKGTGAGLTAAALLAMVPSYISRSVAGSYDNEAVAIFALVFTFYLYVKT  189

Query  664  LNTGSLFYATLNAIAYFYMVGSLG  735
            LNTGSLFYATLN+++YFYMV S G
Sbjct  190  LNTGSLFYATLNSLSYFYMVCSWG  213



>ref|XP_003568077.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Brachypodium distachyon]
Length=793

 Score =   340 bits (871),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  133  LRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFW  312
            LR AFG V     L+LIGV+AFSIRLFSVIKYESVIHEFDPYFN+RVTQFL+KNGIY+FW
Sbjct  18   LRNAFGGVLCAFTLLLIGVLAFSIRLFSVIKYESVIHEFDPYFNFRVTQFLSKNGIYEFW  77

Query  313  NWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASW  492
            NWFDDRTWYPLGRVIGGTVYPGLTLTAG++WW++N+LNIPLSVETVCVFTAPIFSA ASW
Sbjct  78   NWFDDRTWYPLGRVIGGTVYPGLTLTAGSIWWLVNALNIPLSVETVCVFTAPIFSANASW  137

Query  493  ATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNT  672
            ATYLLTKE KGTGAGLMAAA+L MVPSYISRSVAGSYDNEAVAIFAL+FTFYLY+KTLNT
Sbjct  138  ATYLLTKEAKGTGAGLMAAAILAMVPSYISRSVAGSYDNEAVAIFALVFTFYLYLKTLNT  197

Query  673  GSLFYATLNAIAYFYMVGSLG  735
            GSLFYATLNA++YFYMV S G
Sbjct  198  GSLFYATLNALSYFYMVCSWG  218



>ref|XP_010915814.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Elaeis guineensis]
Length=775

 Score =   336 bits (862),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = +1

Query  124  AATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIY  303
            A+ LR AFG +  + IL+LIG+ AFSIRLFSVIKYESVIHEFDPYFNYRVTQ+LT NGIY
Sbjct  10   ASALRNAFGGILGVFILLLIGIFAFSIRLFSVIKYESVIHEFDPYFNYRVTQYLTNNGIY  69

Query  304  DFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAF  483
            DFWNWFDDRTWYPLGR IGGTVYPGLTLTAG++WW+LNSLNIPLSVETVCVFTAPIFSA 
Sbjct  70   DFWNWFDDRTWYPLGRAIGGTVYPGLTLTAGSMWWLLNSLNIPLSVETVCVFTAPIFSAN  129

Query  484  ASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKT  663
            A+WATYLLTKEVKGTGAGL AAALL MVPSYISRSVAGSYDNEAVAIFALI TFY Y+KT
Sbjct  130  AAWATYLLTKEVKGTGAGLTAAALLAMVPSYISRSVAGSYDNEAVAIFALILTFYFYVKT  189

Query  664  LNTGSLFYATLNAIAYFYMVGSLG  735
            LN+GSLFYATLNA++YFYMV S G
Sbjct  190  LNSGSLFYATLNALSYFYMVCSWG  213



>gb|EEC79544.1| hypothetical protein OsI_20658 [Oryza sativa Indica Group]
Length=1119

 Score =   339 bits (870),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  142  AFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWF  321
            A G V     L+LIGV+AFSIRLFSVIKYESVIHEFDPYFN+RVTQFL+KNGIY+FWNWF
Sbjct  351  ACGGVLCAFTLLLIGVLAFSIRLFSVIKYESVIHEFDPYFNFRVTQFLSKNGIYEFWNWF  410

Query  322  DDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATY  501
            DDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVETVCVFTAPIFSA ASWATY
Sbjct  411  DDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPLSVETVCVFTAPIFSANASWATY  470

Query  502  LLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSL  681
            LLTKE KGTGAGLMAAA+L MVPSYISRSVAGSYDNEAVAIFALIFTFYLY+KTLNTGSL
Sbjct  471  LLTKEAKGTGAGLMAAAILAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYVKTLNTGSL  530

Query  682  FYATLNAIAYFYMVGSLG  735
            FYATLNA++YFYMV S G
Sbjct  531  FYATLNALSYFYMVCSWG  548



>ref|XP_001784419.1| predicted protein [Physcomitrella patens]
 gb|EDQ50771.1| predicted protein [Physcomitrella patens]
Length=784

 Score =   327 bits (838),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = +1

Query  169  ILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLG  348
            I +LIGV+AFSIRLFSVIKYES+IHEFDPYFNYRVTQ+LTK GIY+FWNWFDDRTWYPLG
Sbjct  15   IFVLIGVLAFSIRLFSVIKYESIIHEFDPYFNYRVTQYLTKAGIYEFWNWFDDRTWYPLG  74

Query  349  RVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKGT  528
            RVIGGTVYPGLTLTAGT+WW+  ++NIPLSVETVCVFTAP+FSAFASWAT+LLTKEVKGT
Sbjct  75   RVIGGTVYPGLTLTAGTMWWVAQAINIPLSVETVCVFTAPVFSAFASWATFLLTKEVKGT  134

Query  529  gaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNAIA  708
            GAGL AA LL MVPSYISRSVAGSYDNEAVAIFAL+ TFYLY+KTLNTGSLFYATLN++A
Sbjct  135  GAGLTAAVLLAMVPSYISRSVAGSYDNEAVAIFALVLTFYLYVKTLNTGSLFYATLNSLA  194

Query  709  YFYMVGSLG  735
            YFYM  S G
Sbjct  195  YFYMTCSWG  203



>gb|EMS46014.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Triticum urartu]
Length=873

 Score =   326 bits (835),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 173/206 (84%), Gaps = 17/206 (8%)
 Frame = +1

Query  118  GSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNG  297
            G    LR A   V     L+LIGV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFL+K+G
Sbjct  68   GGGGRLRNALSGVLCAFTLLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLSKSG  127

Query  298  IYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFS  477
            IY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVETVCVFTAPIFS
Sbjct  128  IYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPLSVETVCVFTAPIFS  187

Query  478  AFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYI  657
            A ASWATYLLTK                 VPSYISRSVAGSYDNEAVAIFALIFTFYLY+
Sbjct  188  ANASWATYLLTK-----------------VPSYISRSVAGSYDNEAVAIFALIFTFYLYV  230

Query  658  KTLNTGSLFYATLNAIAYFYMVGSLG  735
            KTLNTGSLFYATLNA++YFYMV S G
Sbjct  231  KTLNTGSLFYATLNALSYFYMVCSWG  256



>dbj|BAJ97693.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +1

Query  214  SVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTA  393
             VIKYESVIHEFDPYFNYRVTQFL+K+GIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTA
Sbjct  14   QVIKYESVIHEFDPYFNYRVTQFLSKSGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTA  73

Query  394  GTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPS  573
            GT+WW+LNSLNIPLSVETVCVFTAP+FSA ASWATYLLTKE KG GAGLMAA +L MVPS
Sbjct  74   GTIWWLLNSLNIPLSVETVCVFTAPVFSANASWATYLLTKEAKGNGAGLMAATILAMVPS  133

Query  574  YISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            YISRSVAGSYDNEAVAIFALIFTFYLY+KTLNTGSLFYATLNA++YFYMV S G
Sbjct  134  YISRSVAGSYDNEAVAIFALIFTFYLYVKTLNTGSLFYATLNALSYFYMVCSWG  187



>ref|XP_008672725.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=750

 Score =   311 bits (798),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 161/197 (82%), Positives = 172/197 (87%), Gaps = 0/197 (0%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            M  P  S A  GS   LR AFG V  +  L+LIGV+AFSIRLFSVIKYESVIHEFDPYFN
Sbjct  1    MPEPQSSVASSGSVDRLRNAFGGVLCIFTLLLIGVLAFSIRLFSVIKYESVIHEFDPYFN  60

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            YRVTQFL+KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVE
Sbjct  61   YRVTQFLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPLSVE  120

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
            TVCVFTAP+FS  ASWATYLLTKE KG GAGLMAA +L MVPSYISRSVAGSYDNEAVAI
Sbjct  121  TVCVFTAPVFSVNASWATYLLTKETKGPGAGLMAATILAMVPSYISRSVAGSYDNEAVAI  180

Query  625  FALIFTFYLYIKTLNTG  675
            FALIFTFYLY+K  + G
Sbjct  181  FALIFTFYLYVKVCSWG  197



>gb|EMS67963.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3 [Triticum urartu]
Length=950

 Score =   309 bits (791),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  205  RLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLT  384
            R   VIKYESVIHEFDPYFN+RVTQFL+KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLT
Sbjct  158  RDREVIKYESVIHEFDPYFNFRVTQFLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLT  217

Query  385  LTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgm  564
            LTAG++WW++N+LNIPLSVETVCVFTAPIFSA ASWATYLLTKE KGTGAGLMAAA+L M
Sbjct  218  LTAGSIWWLVNALNIPLSVETVCVFTAPIFSAIASWATYLLTKEAKGTGAGLMAAAILAM  277

Query  565  VPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            VPSYISRSVAGSYDNEAVAIFAL+FTFYLY+KTLNTGSLFYATLNA++YFYMV S G
Sbjct  278  VPSYISRSVAGSYDNEAVAIFALVFTFYLYVKTLNTGSLFYATLNALSYFYMVCSWG  334



>gb|EMT28410.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3 [Aegilops tauschii]
Length=1002

 Score =   307 bits (787),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 155/173 (90%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = +1

Query  217  VIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAG  396
            VIKYESVIHEFDPYFN+RVTQFL+KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAG
Sbjct  260  VIKYESVIHEFDPYFNFRVTQFLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAG  319

Query  397  TLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSY  576
            ++WW +N+LNIPLSVETVCVFTAPIFSA ASWATYLLTKE KGTGAGLMAAA+L MVPSY
Sbjct  320  SIWWFVNALNIPLSVETVCVFTAPIFSAIASWATYLLTKEAKGTGAGLMAAAILAMVPSY  379

Query  577  ISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            ISRSVAGSYDNEAVAIFAL+FTFYLY+KTLNTGSLFYATLNA++YFYMV S G
Sbjct  380  ISRSVAGSYDNEAVAIFALVFTFYLYVKTLNTGSLFYATLNALSYFYMVCSWG  432



>gb|ADE76891.1| unknown [Picea sitchensis]
Length=169

 Score =   266 bits (681),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  121  SAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGI  300
            S   +R AFG+V S  ILIL+ ++AFSIRLFSVIKYESVIHEFDPYFNYRVT++LTK+G+
Sbjct  7    SRVGVRDAFGSVLSTAILILVAILAFSIRLFSVIKYESVIHEFDPYFNYRVTKYLTKSGV  66

Query  301  YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSA  480
            YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+ N+LNIPLSVETVCVFTAPIFSA
Sbjct  67   YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTMWWVFNALNIPLSVETVCVFTAPIFSA  126

Query  481  FASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDN  609
             A+WATYLL KEVKG GAGL AA +L MVPSYISRSVAGSYDN
Sbjct  127  NAAWATYLLKKEVKGIGAGLTAATILAMVPSYISRSVAGSYDN  169



>ref|XP_011009352.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform X1 [Populus euphratica]
Length=256

 Score =   258 bits (660),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = +1

Query  121  SAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGI  300
            +A TLR AFGNV S  IL+L GV+AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNG+
Sbjct  11   TAKTLRNAFGNVLSFFILLLSGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGV  70

Query  301  YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSA  480
            YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWW+LNSLNIPLSVE+VCVFT PIFSA
Sbjct  71   YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWLLNSLNIPLSVESVCVFTVPIFSA  130

Query  481  FASWATYLLTKEVKGT  528
            FASWATYL+TK VKGT
Sbjct  131  FASWATYLVTKAVKGT  146



>ref|XP_002456347.1| hypothetical protein SORBIDRAFT_03g034385 [Sorghum bicolor]
 gb|EES01467.1| hypothetical protein SORBIDRAFT_03g034385, partial [Sorghum bicolor]
Length=705

 Score =   258 bits (659),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = +1

Query  280  FLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVF  459
            FL+KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVETVCVF
Sbjct  1    FLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPLSVETVCVF  60

Query  460  TAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIF  639
            TAPIFS  ASWATYLLTKE K  GAGLMAA +L MVPSYISRSVAGSYDNEAVAIFALIF
Sbjct  61   TAPIFSVNASWATYLLTKETKDPGAGLMAATILAMVPSYISRSVAGSYDNEAVAIFALIF  120

Query  640  TFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            TFYLY+KTLNTGSLFYATLNA++YFYMV S G
Sbjct  121  TFYLYVKTLNTGSLFYATLNALSYFYMVCSWG  152



>gb|ADB65765.1| oligosaccharyl transferase [Dunaliella salina]
Length=726

 Score =   258 bits (659),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = +1

Query  121  SAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGI  300
            S A      G       L  I V++FSIRLFSV+KYESVIHEFDPYFNYRVTQFLT  G 
Sbjct  6    SPAKEHGMLGKALQYATLTSICVLSFSIRLFSVVKYESVIHEFDPYFNYRVTQFLTTQGF  65

Query  301  YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSA  480
            YD WNWFDDRTWYPLGR IGGT YPGL  TAG+++ +L++LNIP+ ++ VCVFTAP+FSA
Sbjct  66   YDMWNWFDDRTWYPLGRGIGGTTYPGLIFTAGSIYRVLHALNIPIHIQEVCVFTAPLFSA  125

Query  481  FASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIK  660
              + A Y L +EV+GTGAG++A+A +GMVPSYISRSVAGSYDNE VAIFAL+  F+L++K
Sbjct  126  LCALACYGLVREVRGTGAGMLASAFVGMVPSYISRSVAGSYDNEGVAIFALVNVFFLFVK  185

Query  661  TLNTGSLFYATLNAIAYFYMVGSLG  735
            TLNTGSL +AT   + Y YMV S G
Sbjct  186  TLNTGSLAWATTLVLGYLYMVMSWG  210



>gb|KIZ00091.1| dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
[Monoraphidium neglectum]
Length=211

 Score =   242 bits (618),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = +1

Query  166  LILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPL  345
            L+LI+I VMAFSIRLFSV+KYESVIHEFDPYFNYRVTQFLTK G+Y  W+WFDDRTWYPL
Sbjct  14   LLLIMIAVMAFSIRLFSVVKYESVIHEFDPYFNYRVTQFLTKEGVYSMWDWFDDRTWYPL  73

Query  346  GRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKG  525
            GRVIGGTVYPGL +TAG ++  L++LNIP+ V+ VCVFTAP+FSAF + A Y L KE + 
Sbjct  74   GRVIGGTVYPGLIVTAGAMYRFLHALNIPIHVQEVCVFTAPLFSAFCALAAYGLVKECRS  133

Query  526  TgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIK  660
             GAGL+AA L+ MVPSYISRSVAGSYDNE VAIFAL+  FY ++K
Sbjct  134  EGAGLVAATLVAMVPSYISRSVAGSYDNEGVAIFALVNVFYTFVK  178



>emb|CBJ33619.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, N-terminal fragment, family GT66 [Ectocarpus 
siliculosus]
Length=396

 Score =   247 bits (631),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 158/215 (73%), Gaps = 1/215 (0%)
 Frame = +1

Query  94   PSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRV  273
            P    A P   A +R  F  V    IL +I  +AF IRLF+V++YESVIHEFDPYFN+R 
Sbjct  52   PDAGGAWPEEPAEIRTGFPAVMKYAILAMICALAFFIRLFAVVRYESVIHEFDPYFNFRT  111

Query  274  TQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVC  453
            T+FL   G  DF NWFDDR WYPLGR IGGT+YPGL  TA + +WIL++L+I +++  VC
Sbjct  112  TKFLATEGFLDFLNWFDDRGWYPLGRTIGGTIYPGLMATAASFYWILHALHITINIRNVC  171

Query  454  VFTAPIFSAFASWATYLLTKEV-KGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFA  630
            VF AP+F+A  + A+YLLT EV K +  GL+AAA   +VPSYISRSV GSYDNE VAIFA
Sbjct  172  VFLAPLFAANTAVASYLLTTEVTKRSSTGLLAAAFTAIVPSYISRSVGGSYDNEGVAIFA  231

Query  631  LIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            LIF FYL+IK++NTGS+ +A L A+AYFYMV + G
Sbjct  232  LIFVFYLWIKSVNTGSMMWACLTALAYFYMVAAWG  266



>ref|NP_001146306.1| hypothetical protein [Zea mays]
 gb|ACL53661.1| unknown [Zea mays]
 tpg|DAA57614.1| TPA: hypothetical protein ZEAMMB73_748744 [Zea mays]
Length=718

 Score =   255 bits (651),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            M  P  S A  GS   LR AFG V  +  L+LIGV+AFSIRLFSVIKYESVIHEFDPYFN
Sbjct  1    MPEPQSSVASSGSVDRLRNAFGGVLCIFTLLLIGVLAFSIRLFSVIKYESVIHEFDPYFN  60

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            YRVTQFL+KNGIY+FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGT+WW+LNSLNIPLSVE
Sbjct  61   YRVTQFLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPLSVE  120

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKG  525
            TVCVFTAP+FS  ASWATYLLTKE KG
Sbjct  121  TVCVFTAPVFSVNASWATYLLTKETKG  147



>ref|XP_005650137.1| STT3 subunit of Oligosaccharyl transferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25593.1| STT3 subunit of Oligosaccharyl transferase [Coccomyxa subellipsoidea 
C-169]
Length=721

 Score =   253 bits (645),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = +1

Query  181  IGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIG  360
            I VMAFS+RLFSV+KYESVIHEFDPYFN+RVT +LTK G Y+ WNWFDDRTWYPLGRV+G
Sbjct  3    ICVMAFSLRLFSVVKYESVIHEFDPYFNFRVTIYLTKEGFYNLWNWFDDRTWYPLGRVVG  62

Query  361  GTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKGTgagl  540
            GTVYPGL  TAG ++ +L++LNIP++V+ VCVFTAP+FSAF S A YLL KE++G GAGL
Sbjct  63   GTVYPGLIWTAGVIFKVLHALNIPINVQEVCVFTAPLFSAFCSLAAYLLVKEIRGQGAGL  122

Query  541  maaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNAIAYFYM  720
             AAA + MVPSYISRSVAGS+DNE VAIFAL+F F+LY+K LNTGSL +++  A+AY YM
Sbjct  123  TAAAFMAMVPSYISRSVAGSFDNEGVAIFALVFVFFLYVKALNTGSLAWSSAAALAYLYM  182

Query  721  VGSLG  735
            V S G
Sbjct  183  VASWG  187



>gb|KFM62990.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Stegodyphus mimosarum]
Length=218

 Score =   233 bits (593),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 153/191 (80%), Gaps = 0/191 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
             +  +LIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T++L +NG Y+F NWFDDR
Sbjct  28   TLLKMLILSMAAVLSFSSRLFSVLRFESVIHEFDPYFNYRTTRYLAENGFYNFHNWFDDR  87

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+ T++ +L  L+I + +  VCVF AP+FS+  +  TYLLT
Sbjct  88   AWYPLGRIIGGTIYPGLMITSATIYHVLQFLHITIDIRNVCVFLAPLFSSLTTIITYLLT  147

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+K   +GL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS++++
Sbjct  148  KELKDASSGLVAAAMISVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWS  207

Query  691  TLNAIAYFYMV  723
             + A+AYFYMV
Sbjct  208  AMCAVAYFYMV  218



>gb|KDO31570.1| hypothetical protein SPRG_03499 [Saprolegnia parasitica CBS 223.65]
Length=261

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 150/186 (81%), Gaps = 1/186 (1%)
 Frame = +1

Query  169  ILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLG  348
            +L  I +M+FSIRLFSV++YESVIHEFDPYFN+R T++L   G  +F +WFDDR WYPLG
Sbjct  65   LLAAICLMSFSIRLFSVVRYESVIHEFDPYFNFRTTKYLASEGFLEFLDWFDDRAWYPLG  124

Query  349  RVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEV-KG  525
            R+IGGT+YPGL  TA  ++W+LN LNI ++V   CVF AP+F+A  + A+Y+LTKEV K 
Sbjct  125  RIIGGTIYPGLMYTAALVYWVLNWLNISINVRNTCVFLAPMFAANTAIASYMLTKEVTKR  184

Query  526  TgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNAI  705
            T AGL+AAA  G+VPSYISRSV GSYDNE VAIFALIF FYL+IK +NTGS+F+A   ++
Sbjct  185  TSAGLLAAAFAGVVPSYISRSVGGSYDNEGVAIFALIFVFYLWIKAVNTGSMFWAAACSL  244

Query  706  AYFYMV  723
            AYFYMV
Sbjct  245  AYFYMV  250



>ref|XP_008543151.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Microplitis demolitor]
 ref|XP_008543152.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Microplitis demolitor]
Length=705

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 154/199 (77%), Gaps = 0/199 (0%)
 Frame = +1

Query  139  QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNW  318
            Q    +  L IL L  V++F+ RLFSV++YESVIHEFDPYFNYR T++L + G Y F NW
Sbjct  15   QKHETLLKLTILSLAAVLSFATRLFSVLRYESVIHEFDPYFNYRTTKYLAEEGFYSFHNW  74

Query  319  FDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWAT  498
            FDDR WYPLGR+IGGT+YPGL +T+ TL+ +   LNIP+ +  VCVF AP+FS+F +  T
Sbjct  75   FDDRVWYPLGRIIGGTIYPGLMVTSATLYRLAQMLNIPIDIRNVCVFLAPLFSSFTTIVT  134

Query  499  YLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGS  678
            YLLTKE+K + +GL AA ++ +VP YISRSVAGSYDNE +AIF ++FT+Y++IK + TG+
Sbjct  135  YLLTKELKDSSSGLFAACMIAIVPGYISRSVAGSYDNEGIAIFCMLFTYYMWIKAVKTGA  194

Query  679  LFYATLNAIAYFYMVGSLG  735
            +F++T  A+AYFYMV S G
Sbjct  195  IFWSTCAALAYFYMVSSWG  213



>ref|XP_011301152.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Fopius arisanus]
Length=705

 Score =   242 bits (618),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 155/199 (78%), Gaps = 0/199 (0%)
 Frame = +1

Query  139  QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNW  318
            Q    +  L +L L  V++F+ RLFSV++YESVIHEFDPYFNYR T+FL + G Y F NW
Sbjct  15   QKQETLLKLTVLSLAAVLSFATRLFSVLRYESVIHEFDPYFNYRTTKFLAEEGFYAFHNW  74

Query  319  FDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWAT  498
            FDDR WYPLGR+IGGT+YPGL +T+ T++ +L  LNIP+ +  VCVF AP+FS+F +  T
Sbjct  75   FDDRVWYPLGRIIGGTIYPGLMITSATIYRLLQMLNIPIDIRNVCVFLAPLFSSFTTIVT  134

Query  499  YLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGS  678
            Y LTKE+K + +GL AA+++ +VP YISRSVAGSYDNE +AIF ++FT+Y++IK + TG+
Sbjct  135  YHLTKELKDSASGLFAASMIAIVPGYISRSVAGSYDNEGIAIFCMLFTYYMWIKAVKTGA  194

Query  679  LFYATLNAIAYFYMVGSLG  735
            +F++T  A+AYFYMV S G
Sbjct  195  IFWSTCAALAYFYMVSSWG  213



>ref|XP_010162595.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like, partial [Caprimulgus carolinensis]
Length=338

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 153/195 (78%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
             +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  16   TLLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDR  75

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+  ++ +L+  ++ + +  VCVF AP+FS+F +  TY LT
Sbjct  76   AWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHVTIDIRNVCVFLAPLFSSFTTIVTYHLT  135

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A
Sbjct  136  KELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWA  195

Query  691  TLNAIAYFYMVGSLG  735
             + A+AYFYMV S G
Sbjct  196  AMCALAYFYMVSSWG  210



>emb|CCD58842.1| 60S ribosomal protein L35, putative [Schistosoma mansoni]
Length=505

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 158/200 (79%), Gaps = 2/200 (1%)
 Frame = +1

Query  136  RQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWN  315
            +QA   +  L ++ +  ++AF++RL+SVI++ESVIHEFDPYFNYR T+F+T NG Y F +
Sbjct  13   KQAI--LLQLFVVCVAAILAFAVRLYSVIRFESVIHEFDPYFNYRTTRFMTDNGFYQFHD  70

Query  316  WFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWA  495
            WFDD  WYPLGR+IGGT+YPGL +T+  ++ +L+++N+ + +  VCVF AP+FS+F + A
Sbjct  71   WFDDMAWYPLGRIIGGTIYPGLMMTSSFIYSLLHAINVTMDIRNVCVFLAPLFSSFTTLA  130

Query  496  TYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTG  675
            T+LLT E++ T +GL+AAAL+ +VP YISRSVAGSYDNE +AIF +IFTFYL+IK + TG
Sbjct  131  TFLLTSEIQDTSSGLIAAALVAIVPGYISRSVAGSYDNEGIAIFCMIFTFYLWIKAVKTG  190

Query  676  SLFYATLNAIAYFYMVGSLG  735
             LF+A   ++AYFYMV S G
Sbjct  191  YLFWACACSLAYFYMVSSWG  210



>gb|AAH64436.1| LOC779022 protein [Xenopus laevis]
Length=444

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 154/195 (79%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
             +  LLIL +  +++FS RLFSV+++ESVIHEFDPYFNYR T+FLT+ G Y+F NWFDDR
Sbjct  16   TLLKLLILSMAAILSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLTEEGFYNFHNWFDDR  75

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+   + IL+  +I + +  VCVF AP+FS+F +  TY LT
Sbjct  76   AWYPLGRIIGGTIYPGLMITSAAFYHILHFFHITIDIRNVCVFLAPLFSSFTTIVTYNLT  135

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A
Sbjct  136  KELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWA  195

Query  691  TLNAIAYFYMVGSLG  735
             L A+AYFYMV S G
Sbjct  196  ALCALAYFYMVSSWG  210



>ref|XP_002955643.1| hypothetical protein VOLCADRAFT_66117 [Volvox carteri f. nagariensis]
 gb|EFJ43283.1| hypothetical protein VOLCADRAFT_66117 [Volvox carteri f. nagariensis]
Length=767

 Score =   241 bits (614),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 150/190 (79%), Gaps = 0/190 (0%)
 Frame = +1

Query  166  LILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPL  345
            L L  I V+AFSIRLFS+IKYESVIHEFDPYFNYRVTQFLTK G Y+ WNWFDDRTWYPL
Sbjct  14   LALTGICVLAFSIRLFSIIKYESVIHEFDPYFNYRVTQFLTKEGFYEMWNWFDDRTWYPL  73

Query  346  GRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKG  525
            GRVIGGTVYPGL  TAG+++ IL+  +IP+ V+ VCV TAP+FSAF + A Y L  + + 
Sbjct  74   GRVIGGTVYPGLIFTAGSIYRILHFFHIPIHVQEVCVLTAPLFSAFCALACYGLVSQARS  133

Query  526  TgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNAI  705
             GAGL+AA  + +VPSYISRSVAGS+DNE VAIFAL+  FY ++KT+NTGSL  A +   
Sbjct  134  HGAGLLAAFFVAVVPSYISRSVAGSFDNEGVAIFALVNVFYWFLKTVNTGSLADAVVLVA  193

Query  706  AYFYMVGSLG  735
            +Y YMV S G
Sbjct  194  SYGYMVMSWG  203



>gb|AAH43914.1| Itm1 protein, partial [Xenopus laevis]
Length=444

 Score =   233 bits (595),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 154/195 (79%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
             +  LLIL +  +++FS RLFSV+++ESVIHEFDPYFNYR T+FLT+ G Y+F NWFDDR
Sbjct  16   TLLKLLILSMAAILSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLTEEGFYNFHNWFDDR  75

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+   + +L+  +I + +  VCVF AP+FS+F +  TY LT
Sbjct  76   AWYPLGRIIGGTIYPGLMITSAAFYHLLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLT  135

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A
Sbjct  136  KELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWA  195

Query  691  TLNAIAYFYMVGSLG  735
             + A+AYFYMV S G
Sbjct  196  AMCALAYFYMVSSWG  210



>ref|XP_010795337.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Notothenia coriiceps]
Length=406

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 154/195 (79%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
             +  LLIL + G+++FS RLFSV+++ESVIHEFDPYFNYR T+FLT+ G Y F NWFDDR
Sbjct  16   TLLKLLILSMAGILSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLTEEGFYKFHNWFDDR  75

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+  L+ +L+  +I + +  VCVF AP+FS+F    TY  T
Sbjct  76   AWYPLGRIIGGTIYPGLMITSAVLYHVLHFFHITIDIRNVCVFLAPLFSSFTVVVTYHFT  135

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS++++
Sbjct  136  KELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSVYWS  195

Query  691  TLNAIAYFYMVGSLG  735
            ++ A+AYFYMV S G
Sbjct  196  SVCALAYFYMVSSWG  210



>ref|XP_001439477.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK72080.1| unnamed protein product [Paramecium tetraurelia]
Length=745

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 155/195 (79%), Gaps = 1/195 (1%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            VF++ IL+ I +++  IR+FSVI+YES+IHEFDP+FNYR TQ+L K G Y  WNW+D  +
Sbjct  25   VFNMTILLSIAIISCLIRVFSVIRYESIIHEFDPWFNYRTTQYLVKEGPYALWNWYDSES  84

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR +GGTVYPGL +T+G ++W+L+ L+IP+ +  VCVF APIFSAF S A Y +TK
Sbjct  85   WYPLGRSVGGTVYPGLMMTSGMIYWVLHKLSIPIDIRNVCVFLAPIFSAFTSLAAYGMTK  144

Query  514  EV-KGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            E+ K + AGL++A  + +VPSY+SRSVAGSYDNE V+IFAL+FTFY ++KT+NTGS+ + 
Sbjct  145  EITKRSEAGLLSALFVAIVPSYMSRSVAGSYDNEGVSIFALVFTFYTFLKTVNTGSILWG  204

Query  691  TLNAIAYFYMVGSLG  735
               A+A+FYMV S G
Sbjct  205  VYTALAFFYMVASWG  219



>ref|XP_003399124.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Bombus terrestris]
Length=705

 Score =   238 bits (607),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 156/199 (78%), Gaps = 0/199 (0%)
 Frame = +1

Query  139  QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNW  318
            Q    +  L +L L  +++F+ RLFSV+++ESVIHEFDPYFNYR T++L +NG Y F+NW
Sbjct  15   QKQETLLKLTVLSLAAILSFATRLFSVLRFESVIHEFDPYFNYRTTKYLAENGFYSFYNW  74

Query  319  FDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWAT  498
            FDDR WYPLGR+IGGT+YPGL +T+  L+ +   LNI L + T+CVF AP+FS+F +  T
Sbjct  75   FDDRVWYPLGRIIGGTIYPGLMITSAALYHLSWLLNITLDIRTICVFLAPLFSSFTTIIT  134

Query  499  YLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGS  678
            YLLTKE+K + +GL AAA++ +VP YISRSVAGSYDNEA+AIF ++FT+Y++IK + TG+
Sbjct  135  YLLTKELKDSASGLFAAAMIAIVPGYISRSVAGSYDNEAIAIFCMLFTYYMWIKAVKTGA  194

Query  679  LFYATLNAIAYFYMVGSLG  735
            + +AT  A+AYFYMV S G
Sbjct  195  ICWATCAALAYFYMVSSWG  213



>ref|XP_001991867.1| GH12900 [Drosophila grimshawi]
 gb|EDW00492.1| GH12900 [Drosophila grimshawi]
Length=719

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 162/218 (74%), Gaps = 6/218 (3%)
 Frame = +1

Query  100  DSEAVPGSAATLRQAF------GNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYF  261
            D+  V G A T  + F       ++  L ILIL  V++F+ RLFSV+++ESVIHEFDPYF
Sbjct  4    DTSNVSGGAGTKAKGFLTWEKQEHLVKLAILILAAVLSFATRLFSVLRFESVIHEFDPYF  63

Query  262  NYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSV  441
            NYR T+FL + G Y F NWFDDR WYPLGR+IGGT+YPGL +T+  L+ ++  LN+ + +
Sbjct  64   NYRTTRFLAEQGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMVTSAALYRLMWMLNVTIDI  123

Query  442  ETVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVA  621
              VCVF AP FS+  +  TY LTKE+  TGAGL+AAAL+ +VP YISRSVAGSYDNE +A
Sbjct  124  RNVCVFLAPFFSSLTTLVTYALTKEIHSTGAGLVAAALISIVPGYISRSVAGSYDNEGIA  183

Query  622  IFALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            IF ++FT+YL+IK + TG++F++ ++A+AYFYMV S G
Sbjct  184  IFCMLFTYYLWIKAVKTGTIFWSAMSALAYFYMVSSWG  221



>gb|EFX86763.1| hypothetical protein DAPPUDRAFT_307851 [Daphnia pulex]
Length=783

 Score =   239 bits (610),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 166/213 (78%), Gaps = 2/213 (1%)
 Frame = +1

Query  103  SEAVPGSAATLRQAFG--NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVT  276
            S++   S ATL  A G  ++ +  IL L  +  F+ RLF+VI++ES+IHEFDP+FNYR T
Sbjct  12   SKSKTKSKATLLNALGYKSLLTFTILALACIAGFASRLFAVIRFESIIHEFDPWFNYRAT  71

Query  277  QFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCV  456
             ++ ++  Y+F NWFDDR WYPLGR++GGTVYPGL +T+G++ +IL++LNIP+ +  +CV
Sbjct  72   AYMVQHNFYNFLNWFDDRAWYPLGRIVGGTVYPGLMITSGSIHYILHALNIPVHIRDICV  131

Query  457  FTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALI  636
            F AP+FS   + ATY LTKE+  +GAGL+AA  + +VP YISRSVAGSYDNE +AIFAL+
Sbjct  132  FLAPVFSGLTALATYFLTKELWSSGAGLLAACFIAIVPGYISRSVAGSYDNEGIAIFALM  191

Query  637  FTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            FT+YL++K++ TGS+F+ATL A++YFYMV + G
Sbjct  192  FTYYLWVKSVKTGSVFWATLTALSYFYMVSAWG  224



>ref|XP_006677749.1| hypothetical protein BATDEDRAFT_10658, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF81568.1| hypothetical protein BATDEDRAFT_10658, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=738

 Score =   237 bits (605),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = +1

Query  169  ILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLG  348
            IL+LIG++AFS RLFSV+++ESVIHEFDP+FNYR T  L +NG YDF NWFD+ +WYPLG
Sbjct  5    ILVLIGILAFSSRLFSVLRFESVIHEFDPWFNYRTTIQLVENGFYDFLNWFDELSWYPLG  64

Query  349  RVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKGT  528
            RV+GGTVYPG+ +TAG + ++LN LN P+ +  +CVF AP+FSA  + A YLLT E+K T
Sbjct  65   RVVGGTVYPGIMVTAGLIHYVLNLLNFPIHIREICVFLAPLFSALTAVAAYLLTTELKDT  124

Query  529  gaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNAIA  708
             AGL+AA  +G+ P YISRSVAGSYDNE +AIF L+FTFYL+IK L  GS FY  L A+ 
Sbjct  125  SAGLLAAIFIGIAPGYISRSVAGSYDNEGIAIFLLVFTFYLWIKALKLGSAFYGILTAVF  184

Query  709  YFYMVGSLG  735
            YFYMV + G
Sbjct  185  YFYMVSAWG  193



>ref|XP_004536915.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform X3 [Ceratitis capitata]
Length=619

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 163/215 (76%), Gaps = 3/215 (1%)
 Frame = +1

Query  100  DSEAVPGSAATLR---QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYR  270
            D+ +V GS + +    +   ++  L +LIL  V++F+ RLFSV+++ESVIHEFDPYFNYR
Sbjct  4    DTASVIGSRSRISLTWEKQEHLIKLAVLILAAVLSFATRLFSVLRFESVIHEFDPYFNYR  63

Query  271  VTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETV  450
             T+FL + G Y F NWFDDR WYPLGR+IGGT+YPGL +TA  L+ ++  LNI + +  V
Sbjct  64   TTRFLAEQGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMVTAAALYRLMWLLNITIEIRNV  123

Query  451  CVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFA  630
            CVF AP FS+  +  TY LTKE+  TGAGL+AAAL+ +VP YISRSVAGSYDNE +AIF 
Sbjct  124  CVFLAPFFSSLTTLVTYALTKEIHSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFC  183

Query  631  LIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            ++FT+YL+IK + +G++F++ ++A+AYFYMV S G
Sbjct  184  MLFTYYLWIKAVKSGAIFWSAMSALAYFYMVSSWG  218



>ref|XP_008481607.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B-like, partial [Diaphorina citri]
Length=457

 Score =   231 bits (588),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = +1

Query  169  ILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLG  348
            +L+L  +  FS RLF+VI++ES+IHEFDP+FNYR T ++ ++G Y+F NWFD+R WYPLG
Sbjct  19   VLLLACIAGFSARLFAVIRFESIIHEFDPWFNYRSTAYMVEHGFYNFLNWFDERAWYPLG  78

Query  349  RVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKGT  528
            R++GGTVYPGL LT+G + ++L++LNIP+ +  +CVF APIFS   + +TYLLTKE+   
Sbjct  79   RIVGGTVYPGLMLTSGCIHYVLHALNIPIHIRDICVFLAPIFSGLTAVSTYLLTKELWSA  138

Query  529  gaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNAIA  708
            GAGL +A  + +VP YISRSVAGSYDNE +AIFAL FT+YL++K++ TGS+F+A L A++
Sbjct  139  GAGLFSACFIAIVPGYISRSVAGSYDNEGIAIFALQFTYYLWVKSVKTGSVFWAALTALS  198

Query  709  YFYMVGSLG  735
            YFYMV + G
Sbjct  199  YFYMVSAWG  207



>ref|XP_002155260.2| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Hydra vulgaris]
Length=716

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 155/194 (80%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++F+ RLFSV+++ESVIHEFDPYFNYR T+FLT+ G Y+F NWFDDR 
Sbjct  25   LLKLLILSIAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLTEEGFYEFHNWFDDRA  84

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  L+ I++  +I + +  VCVF AP+FS+F    T+LLTK
Sbjct  85   WYPLGRIIGGTIYPGLMVTSAALYHIMHFFHITIEIRNVCVFLAPLFSSFTVIVTFLLTK  144

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K   AGL+AA+++ +VP YISRSVAGSYDNE +AIF ++ T+Y ++K++ TGSLF++T
Sbjct  145  ELKDASAGLIAASMIAIVPGYISRSVAGSYDNEGIAIFCMLLTYYFWVKSVKTGSLFWST  204

Query  694  LNAIAYFYMVGSLG  735
            L ++AYFYMV S G
Sbjct  205  LCSLAYFYMVSSWG  218



>ref|XP_002011908.1| GI14454 [Drosophila mojavensis]
 gb|EDW08029.1| GI14454 [Drosophila mojavensis]
Length=719

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 161/214 (75%), Gaps = 8/214 (4%)
 Frame = +1

Query  118  GSAATLRQAFG--------NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRV  273
            GS+ T  +A G        ++  L ILIL  V++F+ RLFSV+++ESVIHEFDPYFNYR 
Sbjct  8    GSSGTATKARGFLTWEKREHLVKLTILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRT  67

Query  274  TQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVC  453
            T+FL + G Y F NWFDDR WYPLGR+IGGT+YPGL +T+  L+ ++  LNI + +  VC
Sbjct  68   TRFLAEQGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMVTSAALYRLMWMLNITIDIRNVC  127

Query  454  VFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFAL  633
            VF AP FS+  +  TY LTKE+  TGAGL+AAAL+ +VP YISRSVAGSYDNE +AIF +
Sbjct  128  VFLAPFFSSLTTLVTYALTKEIHSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFCM  187

Query  634  IFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            +FT+YL+IK + TG++F++ ++A+AYFYMV S G
Sbjct  188  LFTYYLWIKAVKTGTIFWSAMSALAYFYMVSSWG  221



>emb|CCO31174.1| dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
[Rhizoctonia solani AG-1 IB]
Length=371

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 154/212 (73%), Gaps = 8/212 (4%)
 Frame = +1

Query  100  DSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQ  279
              EAV  +A+ LR        ++IL+ I   A + RLF+VI +ES+IHEFDP+FNYR T+
Sbjct  11   SKEAVANTASLLR--------IVILVFISGAAIASRLFAVINFESIIHEFDPWFNYRATK  62

Query  280  FLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVF  459
             L K+G Y+FWNWFD   WYPLGRV+GGT+YPGL  T+G ++  L++L++P+ +  +CV 
Sbjct  63   VLAKDGFYEFWNWFDPTAWYPLGRVVGGTIYPGLMATSGVIYNFLHALHLPVDIRNICVL  122

Query  460  TAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIF  639
             AP FSA  ++ATYL TKE+K   AGL+AA  +G+ P YISRSVAGSYDNEA+AIF L+F
Sbjct  123  LAPGFSALTAYATYLFTKEMKDESAGLLAAIFIGIAPGYISRSVAGSYDNEAIAIFLLMF  182

Query  640  TFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            TFYL+I+ L  GS F+ TL AI YFYMV + G
Sbjct  183  TFYLWIRALKQGSAFFGTLAAIFYFYMVAAWG  214



>ref|XP_002071638.1| GK10089 [Drosophila willistoni]
 gb|EDW82624.1| GK10089 [Drosophila willistoni]
Length=709

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 155/195 (79%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
            ++  L+ILI   V++F+ RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  17   HLVKLIILITAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFYKFHNWFDDR  76

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+  L+ I+  LNI + +  VCVF AP FS+  +  TY LT
Sbjct  77   AWYPLGRIIGGTIYPGLMVTSAALYRIMWLLNITIDIRNVCVFLAPFFSSLTTLVTYALT  136

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+  TGAGL+AAAL+ +VP YISRSVAGSYDNE +AIF ++FT+YL+IK + TG++F++
Sbjct  137  KEIHSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFCMLFTYYLWIKAVKTGTIFWS  196

Query  691  TLNAIAYFYMVGSLG  735
            +L+A+AYFYMV S G
Sbjct  197  SLSALAYFYMVSSWG  211



>ref|XP_003747556.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform 1 [Metaseiulus occidentalis]
Length=716

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 150/194 (77%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            V  L+IL +  +++FS RLFSV+++ESVIHEFDPYFNYR TQFL+ NG Y F NWFDDR 
Sbjct  31   VLKLVILSIACILSFSCRLFSVLRFESVIHEFDPYFNYRTTQFLSDNGFYAFHNWFDDRA  90

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ + N+LNI + V  VCVF AP FS+  +  TYLLT+
Sbjct  91   WYPLGRIIGGTIYPGLMVTSAAIYHVANALNITIDVRNVCVFLAPAFSSLTTIVTYLLTR  150

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+  T +GL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+YL++K + TGS+  A 
Sbjct  151  ELSNTSSGLVAAAMISIVPGYISRSVAGSYDNEGIAIFCMLLTYYLWVKAVKTGSVLTAA  210

Query  694  LNAIAYFYMVGSLG  735
              AIAYFYMV S G
Sbjct  211  TCAIAYFYMVSSWG  224



>ref|XP_009126383.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Brassica rapa]
Length=214

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 141/176 (80%), Gaps = 16/176 (9%)
 Frame = +1

Query  133  LRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFW  312
            +R AFG V S LIL+LIGV+AFSIRLFSVIKYESVI+EFDPYFNYRVTQFL+KNGIY+FW
Sbjct  1    MRNAFGTVLSALILVLIGVLAFSIRLFSVIKYESVINEFDPYFNYRVTQFLSKNGIYEFW  60

Query  313  NWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASW  492
            NWFDDRTW    R                L W+  +++    + TVCVFTAP+FSAFASW
Sbjct  61   NWFDDRTWPCDWR--------------NCLPWV--NIDCWNHLVTVCVFTAPVFSAFASW  104

Query  493  ATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIK  660
            ATYLLTKEVKG+GAGL AAA L MVPSYISRSVAGSYDNEAVAIFALIFTFYLYIK
Sbjct  105  ATYLLTKEVKGSGAGLAAAAFLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYIK  160



>gb|KFH65096.1| dolichyl-diphosphooligosaccharide-protein glycosyltransferase 
[Mortierella verticillata NRRL 6337]
Length=762

 Score =   236 bits (603),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = +1

Query  169  ILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLG  348
            ILILI ++A S RLFS+I++ESVIHEFDP+FNYR TQ L KNG YDFWNWFD+++WYPLG
Sbjct  17   ILILIALVAISSRLFSIIRFESVIHEFDPWFNYRTTQHLVKNGFYDFWNWFDEKSWYPLG  76

Query  349  RVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKGT  528
            RV+GGTVYPG+ +T+  +  +L+  N P+ +  VCVF AP+FS   +++ YLLTKE+K +
Sbjct  77   RVVGGTVYPGIMVTSAIIHNVLHFFNFPVDIRNVCVFLAPMFSGLTAFSAYLLTKELKDS  136

Query  529  gaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNAIA  708
             AGL+AAA LG+ P YISRSVAGSYDNE +AIF L+FTFYL+IK + TGS F+  L A+ 
Sbjct  137  SAGLLAAAFLGVAPGYISRSVAGSYDNEGIAIFLLVFTFYLWIKAVKTGSAFFGLLTALF  196

Query  709  YFYMVGSLG  735
            YFYMV + G
Sbjct  197  YFYMVSAWG  205



>ref|XP_011405586.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Amphimedon queenslandica]
Length=901

 Score =   238 bits (607),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 155/194 (80%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  L++L L  +++FS RLF+V+++ESVIHEFDPYFNYR T+FLT+ G Y F NWFDDR 
Sbjct  1    MIKLVVLSLAAILSFSTRLFAVLRFESVIHEFDPYFNYRTTRFLTEEGFYQFHNWFDDRA  60

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ IL++LNI + +  VCVF AP+FS+    ATY LTK
Sbjct  61   WYPLGRIIGGTIYPGLMVTSAGIYHILHALNITIEIRNVCVFLAPLFSSLTVVATYHLTK  120

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL AA ++ +VP YISRSVAGSYDNE +AIF +IFT+ L+IK++ TGS+F++T
Sbjct  121  ELKDAGAGLCAAVMIAIVPGYISRSVAGSYDNEGIAIFCMIFTYLLWIKSVKTGSMFWST  180

Query  694  LNAIAYFYMVGSLG  735
            L ++AYFYMV S G
Sbjct  181  LCSLAYFYMVSSWG  194



>ref|XP_003747558.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform 3 [Metaseiulus occidentalis]
Length=717

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 150/194 (77%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            V  L+IL +  +++FS RLFSV+++ESVIHEFDPYFNYR TQFL+ NG Y F NWFDDR 
Sbjct  31   VLKLVILSIACILSFSCRLFSVLRFESVIHEFDPYFNYRTTQFLSDNGFYAFHNWFDDRA  90

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ + N+LNI + V  VCVF AP FS+  +  TYLLT+
Sbjct  91   WYPLGRIIGGTIYPGLMVTSAAIYHVANALNITIDVRNVCVFLAPAFSSLTTIVTYLLTR  150

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+  T +GL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+YL++K + TGS+  A 
Sbjct  151  ELSNTSSGLVAAAMISIVPGYISRSVAGSYDNEGIAIFCMLLTYYLWVKAVKTGSVLTAA  210

Query  694  LNAIAYFYMVGSLG  735
              AIAYFYMV S G
Sbjct  211  TCAIAYFYMVSSWG  224



>ref|XP_002039599.1| GM22642 [Drosophila sechellia]
 gb|EDW56341.1| GM22642 [Drosophila sechellia]
Length=713

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 155/195 (79%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
            ++  L ILIL  V++F+ RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  20   HLIKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFYKFHNWFDDR  79

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL LT+  L+ ++  LN+ + +  VCVF AP FS+  +  TY LT
Sbjct  80   AWYPLGRIIGGTIYPGLMLTSAALYRLMWLLNVTIDIRNVCVFLAPFFSSLTTLVTYALT  139

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+  TGAGL+AAAL+ +VP YISRSVAGSYDNE +AIF ++FT+YL+IKT+ TG++F++
Sbjct  140  KEIHSTGAGLVAAALISIVPEYISRSVAGSYDNEGIAIFCMLFTYYLWIKTVKTGTIFWS  199

Query  691  TLNAIAYFYMVGSLG  735
             ++A+AYFY+V S G
Sbjct  200  AMSALAYFYIVSSWG  214



>ref|XP_011541110.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A isoform X2 [Homo sapiens]
Length=375

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 151/195 (77%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
             +  LLIL +  V++FS RLF+V+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  16   TLLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDR  75

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LT
Sbjct  76   AWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLT  135

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+ +A
Sbjct  136  KELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSICWA  195

Query  691  TLNAIAYFYMVGSLG  735
               A+AYFYMV S G
Sbjct  196  AKCALAYFYMVSSWG  210



>ref|XP_003747557.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform 2 [Metaseiulus occidentalis]
Length=727

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 150/194 (77%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            V  L+IL +  +++FS RLFSV+++ESVIHEFDPYFNYR TQFL+ NG Y F NWFDDR 
Sbjct  31   VLKLVILSIACILSFSCRLFSVLRFESVIHEFDPYFNYRTTQFLSDNGFYAFHNWFDDRA  90

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ + N+LNI + V  VCVF AP FS+  +  TYLLT+
Sbjct  91   WYPLGRIIGGTIYPGLMVTSAAIYHVANALNITIDVRNVCVFLAPAFSSLTTIVTYLLTR  150

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+  T +GL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+YL++K + TGS+  A 
Sbjct  151  ELSNTSSGLVAAAMISIVPGYISRSVAGSYDNEGIAIFCMLLTYYLWVKAVKTGSVLTAA  210

Query  694  LNAIAYFYMVGSLG  735
              AIAYFYMV S G
Sbjct  211  TCAIAYFYMVSSWG  224



>gb|ETL46143.1| hypothetical protein L916_03922 [Phytophthora parasitica]
Length=885

 Score =   237 bits (605),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 157/208 (75%), Gaps = 1/208 (0%)
 Frame = +1

Query  115  PGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKN  294
            P  A     A   V    IL +I +M+FSIRLF+V++YESVIHEFDPYFN+R T++L   
Sbjct  48   PRDAEDDENALAPVAKYAILSMICLMSFSIRLFAVVRYESVIHEFDPYFNFRTTKYLASE  107

Query  295  GIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIF  474
            G  +F +WFDDR WYPLGR+IGGT+YPGL  TA  ++W+LN LNI ++V   CVF AP+F
Sbjct  108  GFLEFLDWFDDRAWYPLGRIIGGTIYPGLMYTAALVYWVLNLLNISINVRNTCVFLAPLF  167

Query  475  SAFASWATYLLTKEV-KGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYL  651
            +A  + A+YLLTKEV K + AGL+AAA  G+VPSYISRSV GSYDNE VAIFALIF FYL
Sbjct  168  AANTAIASYLLTKEVTKRSSAGLLAAAFAGIVPSYISRSVGGSYDNEGVAIFALIFVFYL  227

Query  652  YIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            +IK ++TGS+F++   A+AYFYMV + G
Sbjct  228  WIKAVHTGSMFWSAGCALAYFYMVAAWG  255



>ref|XP_008901318.1| hypothetical protein PPTG_08136 [Phytophthora parasitica INRA-310]
 gb|ETI52861.1| hypothetical protein F443_04106 [Phytophthora parasitica P1569]
 gb|ETK92728.1| hypothetical protein L915_03976 [Phytophthora parasitica]
 gb|ETL99277.1| hypothetical protein L917_03837 [Phytophthora parasitica]
 gb|ETM52438.1| hypothetical protein L914_03944 [Phytophthora parasitica]
 gb|ETN13256.1| hypothetical protein PPTG_08136 [Phytophthora parasitica INRA-310]
 gb|ETO81535.1| hypothetical protein F444_04160 [Phytophthora parasitica P1976]
 gb|ETP22668.1| hypothetical protein F441_04071 [Phytophthora parasitica CJ01A1]
Length=885

 Score =   237 bits (605),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 157/208 (75%), Gaps = 1/208 (0%)
 Frame = +1

Query  115  PGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKN  294
            P  A     A   V    IL +I +M+FSIRLF+V++YESVIHEFDPYFN+R T++L   
Sbjct  48   PRDAEDDENALAPVAKYAILSMICLMSFSIRLFAVVRYESVIHEFDPYFNFRTTKYLASE  107

Query  295  GIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIF  474
            G  +F +WFDDR WYPLGR+IGGT+YPGL  TA  ++W+LN LNI ++V   CVF AP+F
Sbjct  108  GFLEFLDWFDDRAWYPLGRIIGGTIYPGLMYTAALVYWVLNLLNISINVRNTCVFLAPLF  167

Query  475  SAFASWATYLLTKEV-KGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYL  651
            +A  + A+YLLTKEV K + AGL+AAA  G+VPSYISRSV GSYDNE VAIFALIF FYL
Sbjct  168  AANTAIASYLLTKEVTKRSSAGLLAAAFAGIVPSYISRSVGGSYDNEGVAIFALIFVFYL  227

Query  652  YIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            +IK ++TGS+F++   A+AYFYMV + G
Sbjct  228  WIKAVHTGSMFWSAGCALAYFYMVAAWG  255



>gb|ETP50646.1| hypothetical protein F442_04081 [Phytophthora parasitica P10297]
Length=885

 Score =   237 bits (605),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 157/208 (75%), Gaps = 1/208 (0%)
 Frame = +1

Query  115  PGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKN  294
            P  A     A   V    IL +I +M+FSIRLF+V++YESVIHEFDPYFN+R T++L   
Sbjct  48   PRDAEDDENALAPVAKYAILSMICLMSFSIRLFAVVRYESVIHEFDPYFNFRTTKYLASE  107

Query  295  GIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIF  474
            G  +F +WFDDR WYPLGR+IGGT+YPGL  TA  ++W+LN LNI ++V   CVF AP+F
Sbjct  108  GFLEFLDWFDDRAWYPLGRIIGGTIYPGLMYTAALVYWVLNLLNISINVRNTCVFLAPLF  167

Query  475  SAFASWATYLLTKEV-KGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYL  651
            +A  + A+YLLTKEV K + AGL+AAA  G+VPSYISRSV GSYDNE VAIFALIF FYL
Sbjct  168  AANTAIASYLLTKEVTKRSSAGLLAAAFAGIVPSYISRSVGGSYDNEGVAIFALIFVFYL  227

Query  652  YIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            +IK ++TGS+F++   A+AYFYMV + G
Sbjct  228  WIKAVHTGSMFWSAGCALAYFYMVAAWG  255



>ref|NP_608425.1| CG1518, isoform A [Drosophila melanogaster]
 ref|NP_001259751.2| CG1518, isoform C [Drosophila melanogaster]
 gb|AAF50861.1| CG1518, isoform A [Drosophila melanogaster]
 gb|AGB95589.2| CG1518, isoform C [Drosophila melanogaster]
Length=713

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 154/195 (79%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
            ++  L ILIL  V++F+ RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  20   HLVKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFYKFHNWFDDR  79

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL LT+  L+ ++  LN+ + +  VCVF AP FS+  +  TY LT
Sbjct  80   AWYPLGRIIGGTIYPGLMLTSAALYRLMWLLNVTIDIRNVCVFLAPFFSSLTTLVTYALT  139

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+  TGAGL+AAAL+ +VP YISRSVAGSYDNE +AIF ++FT+YL+IK + TG++F++
Sbjct  140  KEIHSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFCMLFTYYLWIKAVKTGTIFWS  199

Query  691  TLNAIAYFYMVGSLG  735
             ++A+AYFYMV S G
Sbjct  200  AMSALAYFYMVSSWG  214



>ref|XP_004536913.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform X1 [Ceratitis capitata]
 ref|XP_004536914.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform X2 [Ceratitis capitata]
Length=715

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 163/215 (76%), Gaps = 3/215 (1%)
 Frame = +1

Query  100  DSEAVPGSAATLR---QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYR  270
            D+ +V GS + +    +   ++  L +LIL  V++F+ RLFSV+++ESVIHEFDPYFNYR
Sbjct  4    DTASVIGSRSRISLTWEKQEHLIKLAVLILAAVLSFATRLFSVLRFESVIHEFDPYFNYR  63

Query  271  VTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETV  450
             T+FL + G Y F NWFDDR WYPLGR+IGGT+YPGL +TA  L+ ++  LNI + +  V
Sbjct  64   TTRFLAEQGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMVTAAALYRLMWLLNITIEIRNV  123

Query  451  CVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFA  630
            CVF AP FS+  +  TY LTKE+  TGAGL+AAAL+ +VP YISRSVAGSYDNE +AIF 
Sbjct  124  CVFLAPFFSSLTTLVTYALTKEIHSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFC  183

Query  631  LIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            ++FT+YL+IK + +G++F++ ++A+AYFYMV S G
Sbjct  184  MLFTYYLWIKAVKSGAIFWSAMSALAYFYMVSSWG  218



>ref|XP_001978657.1| GG17558 [Drosophila erecta]
 gb|EDV47584.1| GG17558 [Drosophila erecta]
Length=713

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 154/195 (79%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
            ++  L ILIL  V++F+ RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  20   HLVKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFYKFHNWFDDR  79

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL LT+  L+ ++  LN+ + +  VCVF AP FS+  +  TY LT
Sbjct  80   AWYPLGRIIGGTIYPGLMLTSAALYRLMWLLNVTIDIRNVCVFLAPFFSSLTTLVTYALT  139

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+  TGAGL+AAAL+ +VP YISRSVAGSYDNE +AIF ++FT+YL+IK + TG++F++
Sbjct  140  KEIHSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFCMLFTYYLWIKAVKTGTIFWS  199

Query  691  TLNAIAYFYMVGSLG  735
             ++A+AYFYMV S G
Sbjct  200  AMSALAYFYMVSSWG  214



>ref|XP_004923047.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Bombyx mori]
Length=707

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 153/192 (80%), Gaps = 0/192 (0%)
 Frame = +1

Query  160  SLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWY  339
             L +L +  +++F+ RLFSV+++ESVIHEFDPYFNYR T++LT+ G Y+F NWFDDR WY
Sbjct  24   KLSVLSMAAILSFATRLFSVLRFESVIHEFDPYFNYRTTRYLTEEGFYNFHNWFDDRAWY  83

Query  340  PLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEV  519
            PLGR+IGGT+YPGL +T+ TL+ I+  LNI + +  VCVF AP FS+  +  TYLLTKE+
Sbjct  84   PLGRIIGGTIYPGLMVTSATLYNIMQYLNITIDIRNVCVFLAPFFSSLTTIVTYLLTKEL  143

Query  520  KGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLN  699
            K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y +IK +NTG++ +AT+ 
Sbjct  144  KNEGAGLVAAAMIAIVPGYISRSVAGSYDNEGIAIFCMLLTYYFWIKAVNTGTIMWATMT  203

Query  700  AIAYFYMVGSLG  735
            A+AYFYMV S G
Sbjct  204  ALAYFYMVSSWG  215



>emb|CDQ67856.1| unnamed protein product [Oncorhynchus mykiss]
Length=705

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 155/194 (80%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  +++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y+F NWFDDR 
Sbjct  17   LLKLLILSMAAILSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLVEEGFYNFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  L+ +LN  +I + +  VCVF AP+FS+F +  TY  TK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAALYHVLNFFHITIDIRNVCVFLAPLFSSFTAIVTYHFTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK +NTGS+++++
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVNTGSIYWSS  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_007894244.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Callorhinchus milii]
Length=705

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 156/194 (80%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FLT+ G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLTEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+ TL+ +L+  +I + +  VCVF AP+FS+F +  TY LT+
Sbjct  77   WYPLGRIIGGTIYPGLMITSATLYHVLHFFHITVDIRNVCVFLAPLFSSFTTIVTYHLTR  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++++
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWSS  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_002101953.1| GE15319 [Drosophila yakuba]
 gb|EDX03061.1| GE15319 [Drosophila yakuba]
Length=713

 Score =   235 bits (599),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 154/195 (79%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
            ++  L ILIL  V++F+ RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  20   HLVKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFYKFHNWFDDR  79

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL LT+  L+ ++  LN+ + +  VCVF AP FS+  +  TY LT
Sbjct  80   AWYPLGRIIGGTIYPGLMLTSAALYRLMWLLNVTIDIRNVCVFLAPFFSSLTTLVTYALT  139

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+  TGAGL+AAAL+ +VP YISRSVAGSYDNE +AIF ++FT+YL+IK + TG++F++
Sbjct  140  KEIHSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFCMLFTYYLWIKAVKTGTIFWS  199

Query  691  TLNAIAYFYMVGSLG  735
             ++A+AYFYMV S G
Sbjct  200  AMSALAYFYMVSSWG  214



>ref|XP_011177440.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Bactrocera cucurbitae]
Length=715

 Score =   235 bits (599),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 162/215 (75%), Gaps = 5/215 (2%)
 Frame = +1

Query  106  EAVPGSAATLR-----QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYR  270
            +AV  +A+  R     +   ++  L ILIL  V++F+ RLFSV+++ESVIHEFDPYFNYR
Sbjct  4    DAVSATASRSRISLTWEKQEHLIKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYR  63

Query  271  VTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETV  450
             T+FL + G Y F NWFDDR WYPLGR+IGGT+YPGL +TA  L+ ++  LNI + +  V
Sbjct  64   TTRFLAEQGFYQFHNWFDDRAWYPLGRIIGGTIYPGLMVTAAALYRLMWLLNITIEIRNV  123

Query  451  CVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFA  630
            CVF AP FS+  +  TY LTKE+  TGAGL+AAAL+ +VP YISRSVAGSYDNE +AIF 
Sbjct  124  CVFLAPFFSSLTTLVTYALTKEIHSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFC  183

Query  631  LIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            ++ T+YL+IK + +G++F++T++A+AYFYMV S G
Sbjct  184  MLLTYYLWIKAVKSGAIFWSTMSALAYFYMVSSWG  218



>gb|ACD81859.1| LD39332p [Drosophila melanogaster]
Length=721

 Score =   235 bits (599),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 154/195 (79%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
            ++  L ILIL  V++F+ RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  28   HLVKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFYKFHNWFDDR  87

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL LT+  L+ ++  LN+ + +  VCVF AP FS+  +  TY LT
Sbjct  88   AWYPLGRIIGGTIYPGLMLTSAALYRLMWLLNVTIDIRNVCVFLAPFFSSLTTLVTYALT  147

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+  TGAGL+AAAL+ +VP YISRSVAGSYDNE +AIF ++FT+YL+IK + TG++F++
Sbjct  148  KEIHSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFCMLFTYYLWIKAVKTGTIFWS  207

Query  691  TLNAIAYFYMVGSLG  735
             ++A+AYFYMV S G
Sbjct  208  AMSALAYFYMVSSWG  222



>ref|XP_002055439.1| GJ18789 [Drosophila virilis]
 gb|EDW65640.1| GJ18789 [Drosophila virilis]
Length=719

 Score =   234 bits (598),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 154/195 (79%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
            ++  L ILIL  V++F+ RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  27   HLVKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFYKFHNWFDDR  86

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+  L+ ++  LNI + +  VCVF AP FS+  +  TY LT
Sbjct  87   AWYPLGRIIGGTIYPGLMVTSAALYRLMWMLNITIDIRNVCVFLAPFFSSLTTLVTYALT  146

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+  TGAGL+AAAL+ +VP YISRSVAGSYDNE +AIF ++FT+YL+IK + TG++F++
Sbjct  147  KEIHSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFCMLFTYYLWIKAVKTGTIFWS  206

Query  691  TLNAIAYFYMVGSLG  735
             ++A+AYFYMV S G
Sbjct  207  AMSALAYFYMVSSWG  221



>ref|XP_009529396.1| hypothetical protein PHYSODRAFT_302104 [Phytophthora sojae]
 gb|EGZ15647.1| hypothetical protein PHYSODRAFT_302104 [Phytophthora sojae]
Length=888

 Score =   236 bits (603),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 156/208 (75%), Gaps = 1/208 (0%)
 Frame = +1

Query  115  PGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKN  294
            P  A     A   V    IL +I +M+FSIRLF+V++YESVIHEFDPYFN+R T++L   
Sbjct  51   PRDAEDDETALAPVAKYAILAMICLMSFSIRLFAVVRYESVIHEFDPYFNFRTTKYLASE  110

Query  295  GIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIF  474
            G  +F +WFDDR WYPLGR+IGGT+YPGL  TA  ++W+LN  NI ++V   CVF AP+F
Sbjct  111  GFLEFLDWFDDRAWYPLGRIIGGTIYPGLMYTAALVYWVLNLFNISINVRNTCVFLAPLF  170

Query  475  SAFASWATYLLTKEV-KGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYL  651
            +A  + A+YLLTKEV K + AGL+AAA  G+VPSYISRSV GSYDNE VAIFALIF FYL
Sbjct  171  AANTAIASYLLTKEVTKRSSAGLLAAAFAGIVPSYISRSVGGSYDNEGVAIFALIFVFYL  230

Query  652  YIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            +IK ++TGS+F++   A+AYFYMV + G
Sbjct  231  WIKAVHTGSMFWSAACALAYFYMVAAWG  258



>ref|XP_010868983.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Esox lucius]
Length=705

 Score =   234 bits (597),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 154/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  +++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y+F NWFDDR 
Sbjct  17   LLKLLILSMAAILSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLVEEGFYNFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  L+ +LN  +I + +  VCVF AP+FS+F +  TY  TK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAALYHVLNFFHITIDIRNVCVFLAPLFSSFTAIVTYHFTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK +NTGS++++ 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVNTGSIYWSA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|NP_001135197.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Salmo salar]
 gb|ACI33169.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Salmo salar]
Length=705

 Score =   234 bits (597),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 154/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  +++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y+F NWFDDR 
Sbjct  17   LLKLLILSMAAILSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLVEEGFYNFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  L+ +LN  +I + +  VCVF AP+FS+F +  TY  TK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAALYHVLNFFHITIDIRNVCVFLAPLFSSFTAIVTYHFTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK +NTGS++++ 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVNTGSIYWSA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>emb|CDQ66412.1| unnamed protein product [Oncorhynchus mykiss]
Length=705

 Score =   234 bits (597),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 154/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  +++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y+F NWFDDR 
Sbjct  17   LLKLLILSMAAILSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLVEEGFYNFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  L+ +LN  +I + +  VCVF AP+FS+F +  TY  TK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAALYHVLNFFHITIDIRNVCVFLAPLFSSFTAIVTYHFTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK +NTGS++++ 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVNTGSIYWSA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>gb|ETI52837.1| hypothetical protein F443_04108 [Phytophthora parasitica P1569]
Length=885

 Score =   236 bits (603),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 156/208 (75%), Gaps = 1/208 (0%)
 Frame = +1

Query  115  PGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKN  294
            P  A     A   V    IL +I +M+FSIRLF+V++YESVIHEFDPYFN+R T++L   
Sbjct  48   PRDAEDDENALAPVAKYAILSMICLMSFSIRLFAVVRYESVIHEFDPYFNFRTTKYLASE  107

Query  295  GIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIF  474
            G   F +WFDDR WYPLGR+IGGT+YPGL  TA  ++W+LN LNI ++V   CVF AP+F
Sbjct  108  GFLKFLDWFDDRAWYPLGRIIGGTIYPGLMYTAALVYWVLNLLNISINVRNTCVFLAPLF  167

Query  475  SAFASWATYLLTKEV-KGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYL  651
            +A  + A+YLLTKEV K + AGL+AAA  G+VPSYISRSV GSYDNE VAIFALIF FYL
Sbjct  168  AANTAIASYLLTKEVTKRSSAGLLAAAFAGIVPSYISRSVGGSYDNEGVAIFALIFVFYL  227

Query  652  YIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            +IK ++TGS+F++   A+AYFYMV + G
Sbjct  228  WIKAVHTGSMFWSAGCALAYFYMVAAWG  255



>gb|ACN10714.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Salmo salar]
Length=713

 Score =   234 bits (597),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 154/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  +++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y+F NWFDDR 
Sbjct  17   LLKLLILSMAAILSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLVEEGFYNFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  L+ +LN  +I + +  VCVF AP+FS+F +  TY  TK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAALYHVLNFFHITIDIRNVCVFLAPLFSSFTAIVTYHFTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK +NTGS++++ 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVNTGSIYWSA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_001967075.1| GF21857 [Drosophila ananassae]
 gb|EDV38394.1| GF21857 [Drosophila ananassae]
Length=713

 Score =   234 bits (597),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 154/195 (79%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
            ++  L ILIL  V++F+ RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  20   HLVKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFYKFHNWFDDR  79

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+  L+ ++  LNI + +  VCVF AP FS+  +  TY LT
Sbjct  80   AWYPLGRIIGGTIYPGLMVTSAALYRLMWLLNITIDIRNVCVFLAPFFSSLTTLVTYALT  139

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+  TGAGL+AAAL+ +VP YISRSVAGSYDNE +AIF ++FT+YL+IK + TG++F++
Sbjct  140  KEIHSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFCMLFTYYLWIKAVKTGTIFWS  199

Query  691  TLNAIAYFYMVGSLG  735
             ++A+AYFYMV S G
Sbjct  200  AMSALAYFYMVSSWG  214



>emb|CAF90157.1| unnamed protein product [Tetraodon nigroviridis]
Length=511

 Score =   229 bits (585),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 153/195 (78%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
             +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  16   TLLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDR  75

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+  L+ IL+  +I + +  VCVF AP+FS+F +  TY  T
Sbjct  76   AWYPLGRIIGGTIYPGLMITSAVLYHILHFFHITIDIRNVCVFLAPLFSSFTAIVTYHFT  135

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            +E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS++++
Sbjct  136  RELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSVYWS  195

Query  691  TLNAIAYFYMVGSLG  735
            ++ A+AYFYMV S G
Sbjct  196  SVCALAYFYMVSSWG  210



>ref|XP_008609258.1| dolichyl-diphosphooligosaccharide-protein glycosyltransferase 
[Saprolegnia diclina VS20]
 gb|EQC37096.1| dolichyl-diphosphooligosaccharide-protein glycosyltransferase 
[Saprolegnia diclina VS20]
Length=886

 Score =   236 bits (602),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 152/190 (80%), Gaps = 1/190 (1%)
 Frame = +1

Query  169  ILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLG  348
            +L  I +M+FSIRLFS+++YESVIHEFDPYFN+R T++L   G  +F +WFDDR WYPLG
Sbjct  65   LLAAICLMSFSIRLFSIVRYESVIHEFDPYFNFRTTKYLASEGFLEFLDWFDDRAWYPLG  124

Query  349  RVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEV-KG  525
            R+IGGT+YPGL  TA  ++W+LN LNI ++V   CVF AP+F+A  + A+Y+LTKEV K 
Sbjct  125  RIIGGTIYPGLMYTAALVYWVLNWLNISINVRNTCVFLAPMFAANTAIASYMLTKEVTKR  184

Query  526  TgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNAI  705
            T AGL+AAA  G+VPSYISRSV GSYDNE VAIFALIF FYL+IK +NTGS+F+A   ++
Sbjct  185  TSAGLLAAAFAGVVPSYISRSVGGSYDNEGVAIFALIFVFYLWIKAVNTGSMFWAAACSL  244

Query  706  AYFYMVGSLG  735
            AYFYMV + G
Sbjct  245  AYFYMVAAWG  254



>ref|XP_009582365.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Fulmarus glacialis]
Length=608

 Score =   232 bits (591),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 153/195 (78%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
             +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  16   TLLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDR  75

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LT
Sbjct  76   AWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLT  135

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A
Sbjct  136  KELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWA  195

Query  691  TLNAIAYFYMVGSLG  735
             + A+AYFYMV S G
Sbjct  196  AMCALAYFYMVSSWG  210



>dbj|BAE00677.1| unnamed protein product [Macaca fascicularis]
Length=297

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 148/195 (76%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
            ++ S  IL L  +  FS RLF+VI++ES+IHEFDP+FNYR T  L  +G Y+F NWFD+R
Sbjct  69   SLLSFTILFLAWLAGFSSRLFAVIRFESIIHEFDPWFNYRSTHHLASHGFYEFLNWFDER  128

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR++GGTVYPGL +TAG + WILN+LNI + +  VCVF AP FS   S +T+LLT
Sbjct  129  AWYPLGRIVGGTVYPGLMITAGLIHWILNTLNITVHIRDVCVFLAPTFSGLTSISTFLLT  188

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            +E+   GAGL+AA  + +VP YISRSVAGS+DNE +AIFAL FT+YL++K++ TGS+F+ 
Sbjct  189  RELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWT  248

Query  691  TLNAIAYFYMVGSLG  735
                ++YFYMV + G
Sbjct  249  MCCCLSYFYMVSAWG  263



>gb|EHJ63188.1| oligosaccharyl transferase [Danaus plexippus]
Length=697

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 151/192 (79%), Gaps = 0/192 (0%)
 Frame = +1

Query  160  SLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWY  339
             L +L +  +++F  RLFSV+++ESVIHEFDPYFNYR T++LT+ G Y F NWFDDR WY
Sbjct  14   KLAVLSMAAILSFGTRLFSVLRFESVIHEFDPYFNYRTTRYLTEEGFYKFHNWFDDRAWY  73

Query  340  PLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEV  519
            PLGR+IGGT+YPGL +T+ TL+ I+  LNI + +  VCVF AP FS+  +  TYLLTKE+
Sbjct  74   PLGRIIGGTIYPGLMVTSATLYNIMQFLNITIDIRNVCVFLAPFFSSLTTIVTYLLTKEL  133

Query  520  KGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLN  699
            K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y +IK +NTG++ +AT+ 
Sbjct  134  KDEGAGLVAAAMIAIVPGYISRSVAGSYDNEGIAIFCMLLTYYFWIKAVNTGTILWATMT  193

Query  700  AIAYFYMVGSLG  735
            A+AYFYMV S G
Sbjct  194  ALAYFYMVSSWG  205



>ref|XP_002607356.1| hypothetical protein BRAFLDRAFT_69762 [Branchiostoma floridae]
 gb|EEN63366.1| hypothetical protein BRAFLDRAFT_69762, partial [Branchiostoma 
floridae]
Length=644

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 148/194 (76%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  L +L +  V++FS RLFSV+++ESVIHEFDPYFNYR T FLT+ G Y F NWFDDR 
Sbjct  90   LLKLFVLSIAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTWFLTEEGFYSFHNWFDDRA  149

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+ TL+ +L+  NI + +  VCVF AP+FS+  +  TY LTK
Sbjct  150  WYPLGRIIGGTIYPGLMVTSATLYHVLHFFNITIDIRNVCVFLAPLFSSLTTLVTYHLTK  209

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K   +GL+AAA++  VP YISRSVAGSYDNE +AIF ++ T+ L+IK + TGSLF+  
Sbjct  210  ELKDVSSGLVAAAMIAAVPGYISRSVAGSYDNEGIAIFCMLLTYLLWIKAVKTGSLFWGA  269

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  270  MCALAYFYMVSSWG  283



>emb|CEI99383.1| Putative Oligosaccharyl transferase STT3 subunit [Rhizopus microsporus]
Length=612

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = +1

Query  169  ILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLG  348
            IL LI V+AF+ RLFS+++YES+IHEFDP+FNYR T+ L K+G Y+FWNWFDDR+WYPLG
Sbjct  17   ILGLIAVVAFASRLFSIVRYESIIHEFDPWFNYRATRMLVKDGFYEFWNWFDDRSWYPLG  76

Query  349  RVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKGT  528
            RV+GGTVYPGL +TA  +  +L+ LN P+ +  +CV  AP+FS   + ATYLLT E+K +
Sbjct  77   RVVGGTVYPGLMVTAAIIHNVLHFLNFPVDIRNICVLLAPMFSGLTALATYLLTSELKDS  136

Query  529  gaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNAIA  708
             AGL+AAA +G+ P YISRSVAGSYDNEA+AIF L+FTFYL+IK L  GS  +A+ +A  
Sbjct  137  SAGLLAAAFIGIAPGYISRSVAGSYDNEAIAIFLLMFTFYLWIKALKLGSALWASASAFF  196

Query  709  YFYMVGSLG  735
            YFYMV + G
Sbjct  197  YFYMVAAWG  205



>gb|KFP56370.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Cathartes aura]
Length=595

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 153/195 (78%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
             +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  21   TLLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDR  80

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+  ++ +L+  ++ + +  VCVF AP+FS+F +  TY LT
Sbjct  81   AWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHVTIDIRNVCVFLAPLFSSFTTIVTYHLT  140

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A
Sbjct  141  KELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWA  200

Query  691  TLNAIAYFYMVGSLG  735
             + A+AYFYMV S G
Sbjct  201  AMCALAYFYMVSSWG  215



>gb|KFV95152.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Fulmarus glacialis]
Length=613

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 153/195 (78%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
             +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  20   TLLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDR  79

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LT
Sbjct  80   AWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLT  139

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A
Sbjct  140  KELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWA  199

Query  691  TLNAIAYFYMVGSLG  735
             + A+AYFYMV S G
Sbjct  200  AMCALAYFYMVSSWG  214



>ref|XP_011268921.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Camponotus floridanus]
 ref|XP_011268922.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Camponotus floridanus]
 ref|XP_011268923.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Camponotus floridanus]
 gb|EFN72934.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Camponotus floridanus]
Length=705

 Score =   233 bits (594),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 155/199 (78%), Gaps = 0/199 (0%)
 Frame = +1

Query  139  QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNW  318
            Q    +  L +L L  +++F+ RLFSV+++ESVIHEFDPYFNYR T++L +NG Y F NW
Sbjct  15   QKQETLLKLTVLSLAAILSFATRLFSVLRFESVIHEFDPYFNYRTTKYLAENGFYSFHNW  74

Query  319  FDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWAT  498
            FDDR WYPLGR+IGGT+YPGL +T+ TL+ +   LNI L++  +CVF AP+FS+  +  T
Sbjct  75   FDDRVWYPLGRIIGGTIYPGLMITSATLYRLSWLLNITLNIRNICVFLAPLFSSLTTIIT  134

Query  499  YLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGS  678
            YLLTKE+K + +GL AAA++ +VP YISRSVAGSYDNE +AIF ++FT+Y++IK + TG+
Sbjct  135  YLLTKELKDSASGLFAAAMIAIVPGYISRSVAGSYDNEGIAIFCMLFTYYMWIKAVKTGA  194

Query  679  LFYATLNAIAYFYMVGSLG  735
            + +AT +A+AYFYMV S G
Sbjct  195  ISWATCSALAYFYMVSSWG  213



>gb|KFQ60087.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Pelecanus crispus]
Length=642

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  18   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  77

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  78   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  137

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  138  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  197

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  198  MCALAYFYMVSSWG  211



>ref|XP_011200722.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Bactrocera dorsalis]
 ref|XP_011200723.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Bactrocera dorsalis]
Length=715

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 154/195 (79%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
            ++  L ILI+  V++F+ RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  24   HLIKLAILIIAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFYQFHNWFDDR  83

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +TA  L+ ++  LNI + +  VCVF AP FS+  +  TY LT
Sbjct  84   AWYPLGRIIGGTIYPGLMVTAAALYRLMWLLNITIEIRNVCVFLAPFFSSLTTLVTYALT  143

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+  TGAGL+AAAL+ +VP YISRSVAGSYDNE +AIF ++ T+YL+IK + +G++F++
Sbjct  144  KEIHSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFCMLLTYYLWIKAVKSGAIFWS  203

Query  691  TLNAIAYFYMVGSLG  735
            T++A+AYFYMV S G
Sbjct  204  TMSALAYFYMVSSWG  218



>ref|XP_003691905.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Apis florea]
Length=705

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 153/199 (77%), Gaps = 0/199 (0%)
 Frame = +1

Query  139  QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNW  318
            Q    +  L +L L  +++F+ RLFSV+++ESVIHEFDPYFNYR T++L +NG Y F NW
Sbjct  15   QKQETLLKLTVLSLAAILSFATRLFSVLRFESVIHEFDPYFNYRTTKYLAENGFYSFHNW  74

Query  319  FDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWAT  498
            FDDR WYPLGR+IGGT+YPGL +T+  L+ +   LNI L + T+CVF AP+FS+  +  T
Sbjct  75   FDDRVWYPLGRIIGGTIYPGLMITSAALYHLSWLLNITLDIRTICVFLAPLFSSLTTIIT  134

Query  499  YLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGS  678
            YLLTKE+K + +GL AAA++ +VP YISRSVAGSYDNE +AIF ++FT+Y++IK + TG+
Sbjct  135  YLLTKELKDSASGLFAAAMIAIVPGYISRSVAGSYDNEGIAIFCMLFTYYMWIKAVKTGA  194

Query  679  LFYATLNAIAYFYMVGSLG  735
            + +AT  A+AYFYMV S G
Sbjct  195  ICWATCAALAYFYMVSSWG  213



>gb|AAI72202.1| source of immunodominant MHC-associated peptides [synthetic construct]
Length=320

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 148/195 (76%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
            ++ S  IL L  +  FS RLF+VI++ES+IHEFDP+FNYR T  L  +G Y+F NWFD+R
Sbjct  70   SLLSFTILFLAWLAGFSSRLFAVIRFESIIHEFDPWFNYRSTHHLASHGFYEFLNWFDER  129

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR++GGTVYPGL +TAG + WILN+LNI + +  VCVF AP FS   S +T+LLT
Sbjct  130  AWYPLGRIVGGTVYPGLMITAGLIHWILNTLNITVHIRDVCVFLAPTFSGLTSISTFLLT  189

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            +E+   GAGL+AA  + +VP YISRSVAGS+DNE +AIFAL FT+YL++K++ TGS+F+ 
Sbjct  190  RELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWT  249

Query  691  TLNAIAYFYMVGSLG  735
                ++YFYMV + G
Sbjct  250  MCCCLSYFYMVSAWG  264



>ref|XP_392786.2| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoformX1 [Apis mellifera]
 ref|XP_006570342.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform X2 [Apis mellifera]
 ref|XP_006570343.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform X3 [Apis mellifera]
 ref|XP_006621616.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Apis dorsata]
Length=705

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 153/199 (77%), Gaps = 0/199 (0%)
 Frame = +1

Query  139  QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNW  318
            Q    +  L +L L  +++F+ RLFSV+++ESVIHEFDPYFNYR T++L +NG Y F NW
Sbjct  15   QKQETLLKLTVLSLAAILSFATRLFSVLRFESVIHEFDPYFNYRTTKYLAENGFYSFHNW  74

Query  319  FDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWAT  498
            FDDR WYPLGR+IGGT+YPGL +T+  L+ +   LNI L + T+CVF AP+FS+  +  T
Sbjct  75   FDDRVWYPLGRIIGGTIYPGLMITSAALYHLSWLLNITLDIRTICVFLAPLFSSLTTIIT  134

Query  499  YLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGS  678
            YLLTKE+K + +GL AAA++ +VP YISRSVAGSYDNE +AIF ++FT+Y++IK + TG+
Sbjct  135  YLLTKELKDSASGLFAAAMIAIVPGYISRSVAGSYDNEGIAIFCMLFTYYMWIKAVKTGA  194

Query  679  LFYATLNAIAYFYMVGSLG  735
            + +AT  A+AYFYMV S G
Sbjct  195  ICWATCAALAYFYMVSSWG  213



>ref|XP_001648748.1| AAEL004228-PA [Aedes aegypti]
 gb|EAT44394.1| AAEL004228-PA [Aedes aegypti]
Length=710

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 154/195 (79%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
            ++  L IL    +++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y+F NWFDDR
Sbjct  16   SLVKLGILTTAAILSFSTRLFSVLRFESVIHEFDPYFNYRTTKFLAEQGFYNFHNWFDDR  75

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+ TL+ I+  LNI + +  VCVF AP FS+  +  TYLLT
Sbjct  76   AWYPLGRIIGGTIYPGLMVTSATLYRIMWLLNITVDIRNVCVFLAPFFSSLTTIVTYLLT  135

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+  TGAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TG++F+A
Sbjct  136  KEIYTTGAGLVAAAMISIVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGAIFWA  195

Query  691  TLNAIAYFYMVGSLG  735
            T+ A+AYFYMV S G
Sbjct  196  TMAALAYFYMVSSWG  210



>ref|XP_003487818.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Bombus impatiens]
Length=705

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 153/199 (77%), Gaps = 0/199 (0%)
 Frame = +1

Query  139  QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNW  318
            Q    +  L +L L  +++F+ RLFSV+++ESVIHEFDPYFNYR T++L +NG Y F NW
Sbjct  15   QKQETLLKLTVLSLAAILSFATRLFSVLRFESVIHEFDPYFNYRTTKYLAENGFYSFHNW  74

Query  319  FDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWAT  498
            FDDR WYPLGR+IGGT+YPGL +T+  L+ +   LNI L + T+CVF AP+FS+  +  T
Sbjct  75   FDDRVWYPLGRIIGGTIYPGLMITSAALYRLSWLLNITLDIRTICVFLAPLFSSLTTIIT  134

Query  499  YLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGS  678
            YLLTKE+K + +GL AAA++ +VP YISRSVAGSYDNE +AIF ++FT+Y++IK + TG+
Sbjct  135  YLLTKELKDSASGLFAAAMIAIVPGYISRSVAGSYDNEGIAIFCMLFTYYMWIKAVKTGA  194

Query  679  LFYATLNAIAYFYMVGSLG  735
            + +AT  A+AYFYMV S G
Sbjct  195  ICWATCAALAYFYMVSSWG  213



>ref|XP_009478720.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Pelecanus crispus]
Length=640

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 153/195 (78%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
             +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  16   TLLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDR  75

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LT
Sbjct  76   AWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLT  135

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A
Sbjct  136  KELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWA  195

Query  691  TLNAIAYFYMVGSLG  735
             + A+AYFYMV S G
Sbjct  196  AMCALAYFYMVSSWG  210



>gb|KFV84946.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Struthio camelus australis]
Length=658

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 153/195 (78%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
             +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  21   TLLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDR  80

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LT
Sbjct  81   AWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLT  140

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A
Sbjct  141  KELKDAGAGLLAAAMISVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWA  200

Query  691  TLNAIAYFYMVGSLG  735
             + A+AYFYMV S G
Sbjct  201  AMCALAYFYMVSSWG  215



>ref|XP_009059058.1| hypothetical protein LOTGIDRAFT_164315 [Lottia gigantea]
 gb|ESO90389.1| hypothetical protein LOTGIDRAFT_164315 [Lottia gigantea]
Length=695

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 154/199 (77%), Gaps = 0/199 (0%)
 Frame = +1

Query  139  QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNW  318
            Q    +  L+IL +  ++AFS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y+F NW
Sbjct  4    QKQDTLLKLMILTIAAILAFSTRLFSVLQFESVIHEFDPYFNYRTTKFLAEKGFYNFHNW  63

Query  319  FDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWAT  498
            FDDR WYPLGR+IGGT+YPGL +T+  ++  LN L+I + V  VCVF AP+F++F +  T
Sbjct  64   FDDRAWYPLGRIIGGTIYPGLMVTSAMIYNFLNFLHITIDVRNVCVFLAPLFASFTTIVT  123

Query  499  YLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGS  678
            Y+ TKE+K  GAGL+AA++L +VP YISRSVAGSYDNE +AIF ++ T+ L++K   TGS
Sbjct  124  YMFTKELKDAGAGLVAASMLAIVPGYISRSVAGSYDNEGIAIFCMLLTYTLWVKAAKTGS  183

Query  679  LFYATLNAIAYFYMVGSLG  735
            +F+A+L A+AYFYMV S G
Sbjct  184  VFWASLCALAYFYMVSSWG  202



>gb|KFP55644.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Cariama cristata]
 gb|KFV45376.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Tyto alba]
 gb|KFV48478.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Gavia stellata]
Length=663

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 153/195 (78%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
             +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  21   TLLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDR  80

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LT
Sbjct  81   AWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLT  140

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A
Sbjct  141  KELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWA  200

Query  691  TLNAIAYFYMVGSLG  735
             + A+AYFYMV S G
Sbjct  201  AMCALAYFYMVSSWG  215



>ref|XP_009916234.1| PREDICTED: LOW QUALITY PROTEIN: dolichyl-diphosphooligosaccharide--protein 
glycosyltransferase subunit STT3A [Haliaeetus 
albicilla]
Length=650

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 153/195 (78%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
             +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  16   TLLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDR  75

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LT
Sbjct  76   AWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLT  135

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A
Sbjct  136  KELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWA  195

Query  691  TLNAIAYFYMVGSLG  735
             + A+AYFYMV S G
Sbjct  196  AMCALAYFYMVSSWG  210



>ref|XP_010282506.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Phaethon lepturus]
Length=654

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 153/195 (78%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
             +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  16   TLLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDR  75

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LT
Sbjct  76   AWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLT  135

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A
Sbjct  136  KELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWA  195

Query  691  TLNAIAYFYMVGSLG  735
             + A+AYFYMV S G
Sbjct  196  AMCALAYFYMVSSWG  210



>ref|XP_006116753.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A isoform X1 [Pelodiscus sinensis]
 ref|XP_006116754.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A isoform X2 [Pelodiscus sinensis]
Length=705

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ IL+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHILHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>gb|KFQ72349.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Phaethon lepturus]
Length=663

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 153/195 (78%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
             +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  21   TLLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDR  80

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LT
Sbjct  81   AWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLT  140

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A
Sbjct  141  KELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWA  200

Query  691  TLNAIAYFYMVGSLG  735
             + A+AYFYMV S G
Sbjct  201  AMCALAYFYMVSSWG  215



>ref|NP_001083986.1| STT3A, subunit of the oligosaccharyltransferase complex (catalytic) 
[Xenopus laevis]
 gb|AAH85031.1| Itm1 protein [Xenopus laevis]
Length=705

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 154/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  +++FS RLFSV+++ESVIHEFDPYFNYR T+FLT+ G Y+F NWFDDR 
Sbjct  17   LLKLLILSMAAILSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLTEEGFYNFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+   + +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAFYHLLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_009819540.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Gavia stellata]
 ref|XP_009704282.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Cariama cristata]
 ref|XP_009975260.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Tyto alba]
Length=654

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 153/195 (78%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
             +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  16   TLLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDR  75

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LT
Sbjct  76   AWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLT  135

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A
Sbjct  136  KELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWA  195

Query  691  TLNAIAYFYMVGSLG  735
             + A+AYFYMV S G
Sbjct  196  AMCALAYFYMVSSWG  210



>ref|XP_003225760.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Anolis carolinensis]
Length=705

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 154/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL++ G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLSEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>gb|KFZ57236.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Podiceps cristatus]
Length=667

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  22   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  81

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  82   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  141

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  142  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  201

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  202  MCALAYFYMVSSWG  215



>ref|XP_010006392.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Chaetura pelagica]
Length=705

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+YL+IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYLWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_001865872.1| oligosaccharyl transferase [Culex quinquefasciatus]
 gb|EDS42369.1| oligosaccharyl transferase [Culex quinquefasciatus]
Length=715

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 154/195 (79%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
            ++  L IL    +++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y+F NWFD+R
Sbjct  16   SLVKLGILTTAAILSFSTRLFSVLRFESVIHEFDPYFNYRTTKFLAEQGFYNFHNWFDER  75

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+ TL+ I+  LNI + +  VCVF AP FS+  +  TYLLT
Sbjct  76   AWYPLGRIIGGTIYPGLMVTSATLYRIMWLLNITVDIRNVCVFLAPFFSSLTTIVTYLLT  135

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+  TGAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TG++F+A
Sbjct  136  KEIHSTGAGLVAAAMISIVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGAIFWA  195

Query  691  TLNAIAYFYMVGSLG  735
            T+ A+AYFYMV S G
Sbjct  196  TMAALAYFYMVSSWG  210



>ref|XP_008478222.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Diaphorina citri]
Length=442

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 151/194 (78%), Gaps = 2/194 (1%)
 Frame = +1

Query  166  LILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPL  345
            L++I    + FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR WYPL
Sbjct  47   LLVIHRADLTFSTRLFSVLRFESVIHEFDPYFNYRTTKFLVEEGYYKFHNWFDDRAWYPL  106

Query  346  GRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKG  525
            GR+IGGT+YPGL +T+  L+ ++  LNI + +  VCVF AP FS+  +  TYLLTKEVK 
Sbjct  107  GRIIGGTIYPGLMVTSAVLYHLMWLLNITIDIRNVCVFLAPFFSSLTTIVTYLLTKEVKD  166

Query  526  TgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNAI  705
            TG+GL+AAA++ +VP YISRSVAGSYDNEA+AIF ++ T+Y +IK + TGS+ ++ L A+
Sbjct  167  TGSGLVAAAMISIVPGYISRSVAGSYDNEAIAIFCMLLTYYSWIKAVKTGSILWSALTAL  226

Query  706  AYFYMV--GSLGRV  741
            AYFYMV   S+G++
Sbjct  227  AYFYMVKEDSVGKI  240



>ref|NP_001154172.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Oncorhynchus mykiss]
 gb|ACO08142.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Oncorhynchus mykiss]
Length=235

 Score =   220 bits (561),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
             +  LLIL +  +++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y+F NWFDDR
Sbjct  16   TLLKLLILSMAAILSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLVEEGFYNFHNWFDDR  75

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+  L+ +LN  +I + +  VCVF AP+FS+F +  TY  T
Sbjct  76   AWYPLGRIIGGTIYPGLMITSAALYHVLNFFHITIDIRNVCVFLAPLFSSFTATVTYHFT  135

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK +NTGS++++
Sbjct  136  KELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVNTGSIYWS  195

Query  691  TLNAIA  708
             + A+A
Sbjct  196  AMCALA  201



>dbj|BAE87452.1| unnamed protein product [Macaca fascicularis]
Length=471

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 151/195 (77%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
             +  LLIL +  V++FS RLF+V+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR
Sbjct  16   TLLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDR  75

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LT
Sbjct  76   AWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLT  135

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            KE+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+ +A
Sbjct  136  KELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSICWA  195

Query  691  TLNAIAYFYMVGSLG  735
               A+AYFYMV S G
Sbjct  196  AKCALAYFYMVSSWG  210



>ref|XP_002197814.2| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Taeniopygia guttata]
Length=705

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_011068113.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Acromyrmex echinatior]
 gb|EGI69724.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Acromyrmex echinatior]
Length=705

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 152/199 (76%), Gaps = 0/199 (0%)
 Frame = +1

Query  139  QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNW  318
            Q    +  L +L L  +++F+ RLFSV+++ESVIHEFDPYFNYR T++L +NG Y F NW
Sbjct  15   QKQETLLKLTVLSLAAILSFATRLFSVLRFESVIHEFDPYFNYRTTKYLAENGFYSFHNW  74

Query  319  FDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWAT  498
            FDDR WYPLGR+IGGT+YPGL +T+  L+ I   LNI L +  +CVF AP+FS+  +  T
Sbjct  75   FDDRVWYPLGRIIGGTIYPGLMITSAALYRISWLLNITLDIRNICVFLAPLFSSLTTIIT  134

Query  499  YLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGS  678
            YLLTKE+K + +GL AAA++ +VP YISRSVAGSYDNE +AIF ++FT+Y++IK + TG+
Sbjct  135  YLLTKELKDSASGLFAAAMIAIVPGYISRSVAGSYDNEGIAIFCMLFTYYMWIKAVKTGA  194

Query  679  LFYATLNAIAYFYMVGSLG  735
            + +AT  A+AYFYMV S G
Sbjct  195  ICWATCAALAYFYMVSSWG  213



>gb|KFU85517.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Chaetura pelagica]
Length=711

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  23   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  82

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  83   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  142

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+YL+IK + TGS+++A 
Sbjct  143  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYLWIKAVKTGSIYWAA  202

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  203  MCALAYFYMVSSWG  216



>ref|XP_012055663.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Atta cephalotes]
Length=705

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 152/199 (76%), Gaps = 0/199 (0%)
 Frame = +1

Query  139  QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNW  318
            Q    +  L +L L  +++F+ RLFSV+++ESVIHEFDPYFNYR T++L +NG Y F NW
Sbjct  15   QKQETLLKLTVLSLAAILSFATRLFSVLRFESVIHEFDPYFNYRTTKYLAENGFYSFHNW  74

Query  319  FDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWAT  498
            FDDR WYPLGR+IGGT+YPGL +T+  L+ I   LNI L +  +CVF AP+FS+  +  T
Sbjct  75   FDDRVWYPLGRIIGGTIYPGLMITSAALYRISWLLNITLDIRNICVFLAPLFSSLTTIIT  134

Query  499  YLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGS  678
            YLLTKE+K + +GL AAA++ +VP YISRSVAGSYDNE +AIF ++FT+Y++IK + TG+
Sbjct  135  YLLTKELKDSASGLFAAAMIAIVPGYISRSVAGSYDNEGIAIFCMLFTYYMWIKAVKTGA  194

Query  679  LFYATLNAIAYFYMVGSLG  735
            + +AT  A+AYFYMV S G
Sbjct  195  ICWATCAALAYFYMVSSWG  213



>ref|XP_011875506.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Vollenhovia emeryi]
 ref|XP_011875507.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Vollenhovia emeryi]
 ref|XP_011875508.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Vollenhovia emeryi]
 ref|XP_011875509.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Vollenhovia emeryi]
Length=705

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 152/199 (76%), Gaps = 0/199 (0%)
 Frame = +1

Query  139  QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNW  318
            Q    +  L +L L  +++F+ RLFSV+++ESVIHEFDPYFNYR T++L +NG Y F NW
Sbjct  15   QKQETLLKLTVLSLAAILSFATRLFSVLRFESVIHEFDPYFNYRTTKYLAENGFYSFHNW  74

Query  319  FDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWAT  498
            FDDR WYPLGR+IGGT+YPGL +T+  L+ I   LNI L +  +CVF AP+FS+  +  T
Sbjct  75   FDDRVWYPLGRIIGGTIYPGLMITSAALYRISWLLNITLDIRNICVFLAPLFSSLTTIIT  134

Query  499  YLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGS  678
            YLLTKE+K + +GL AAA++ +VP YISRSVAGSYDNE +AIF ++FT+Y++IK + TG+
Sbjct  135  YLLTKELKDSASGLFAAAMIAIVPGYISRSVAGSYDNEGIAIFCMLFTYYMWIKAVKTGA  194

Query  679  LFYATLNAIAYFYMVGSLG  735
            + +AT  A+AYFYMV S G
Sbjct  195  ICWATCAALAYFYMVSSWG  213



>ref|XP_005294744.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Chrysemys picta bellii]
Length=705

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_009680262.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Struthio camelus australis]
Length=730

 Score =   233 bits (593),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMISVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_005019699.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A isoform X7 [Anas platyrhynchos]
 ref|XP_005242977.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Falco peregrinus]
 ref|XP_005437674.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Falco cherrug]
 ref|XP_009467852.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Nipponia nippon]
 ref|XP_009566883.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Cuculus canorus]
 ref|XP_009640412.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Egretta garzetta]
 ref|XP_010079388.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Pterocles gutturalis]
 ref|XP_010303180.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Balearica regulorum gibbericeps]
 ref|XP_011587546.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Aquila chrysaetos canadensis]
 gb|EOB01317.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Anas platyrhynchos]
Length=705

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_003642654.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform X1 [Gallus gallus]
 ref|XP_004948012.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform X7 [Gallus gallus]
 emb|CAG31486.1| hypothetical protein RCJMB04_6o16 [Gallus gallus]
Length=705

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_008496706.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Calypte anna]
Length=705

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_003459018.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Oreochromis niloticus]
 ref|XP_004561676.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Maylandia zebra]
 ref|XP_005740439.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Pundamilia nyererei]
 ref|XP_005926843.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Haplochromis burtoni]
Length=705

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 154/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  L+ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAVLYHVLHFFHITIDIRNVCVFLAPLFSSFTAIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++++
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSVYWSS  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_009070476.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Acanthisitta chloris]
Length=693

 Score =   232 bits (591),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_008635110.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Corvus brachyrhynchos]
 ref|XP_010402253.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Corvus cornix cornix]
 ref|XP_010402254.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Corvus cornix cornix]
 ref|XP_010402255.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Corvus cornix cornix]
Length=705

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>gb|KFP77925.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Acanthisitta chloris]
Length=704

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  23   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  82

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  83   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  142

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  143  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  202

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  203  MCALAYFYMVSSWG  216



>ref|XP_011703340.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Wasmannia auropunctata]
 ref|XP_011703341.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Wasmannia auropunctata]
 ref|XP_011703342.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Wasmannia auropunctata]
 ref|XP_011703343.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Wasmannia auropunctata]
 ref|XP_011703344.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Wasmannia auropunctata]
 ref|XP_011703345.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Wasmannia auropunctata]
Length=705

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 152/199 (76%), Gaps = 0/199 (0%)
 Frame = +1

Query  139  QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNW  318
            Q    +  L +L L  +++F+ RLFSV+++ESVIHEFDPYFNYR T++L +NG Y F NW
Sbjct  15   QKQETLLKLTVLSLAAILSFATRLFSVLRFESVIHEFDPYFNYRTTKYLAENGFYSFHNW  74

Query  319  FDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWAT  498
            FDDR WYPLGR+IGGT+YPGL +T+  L+ I   LNI L +  +CVF AP+FS+  +  T
Sbjct  75   FDDRVWYPLGRIIGGTIYPGLMITSAALYRISWLLNITLDIRNICVFLAPLFSSLTTIIT  134

Query  499  YLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGS  678
            YLLTKE+K + +GL AAA++ +VP YISRSVAGSYDNE +AIF ++FT+Y++IK + TG+
Sbjct  135  YLLTKELKDSASGLFAAAMIAIVPGYISRSVAGSYDNEGIAIFCMLFTYYMWIKAVKTGA  194

Query  679  LFYATLNAIAYFYMVGSLG  735
            + +AT  A+AYFYMV S G
Sbjct  195  ICWATCAALAYFYMVSSWG  213



>gb|EIE80503.1| hypothetical protein RO3G_05208 [Rhizopus delemar RA 99-880]
Length=748

 Score =   233 bits (593),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = +1

Query  169  ILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLG  348
            IL LI V+AFS RLFS+++YES+IHEFDP+FNYR T+ L K+G YDFWNWFDDR+WYPLG
Sbjct  17   ILGLIAVVAFSSRLFSIVRYESIIHEFDPWFNYRATRMLVKDGFYDFWNWFDDRSWYPLG  76

Query  349  RVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKGT  528
            RV+GGTVYPGL +TA  +  +L+ L+ P+ +  +CV  AP+FS   S ATYLLT E+K +
Sbjct  77   RVVGGTVYPGLMVTAAIIHNMLHFLHFPVDIRNICVLLAPMFSGLTSLATYLLTSELKDS  136

Query  529  gaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNAIA  708
             AGL+AAA +G+ P YISRSVAGSYDNEA+AIF L+FTFYL+IK L  GS  +A+  A  
Sbjct  137  AAGLLAAAFIGIAPGYISRSVAGSYDNEAIAIFLLMFTFYLWIKALKLGSALWASAAAFF  196

Query  709  YFYMVGSLG  735
            YFYMV + G
Sbjct  197  YFYMVAAWG  205



>ref|XP_011638122.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Pogonomyrmex barbatus]
 ref|XP_011638123.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Pogonomyrmex barbatus]
 ref|XP_011638124.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Pogonomyrmex barbatus]
 ref|XP_011638125.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Pogonomyrmex barbatus]
Length=705

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 152/199 (76%), Gaps = 0/199 (0%)
 Frame = +1

Query  139  QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNW  318
            Q    +  L +L L  +++F+ RLFSV+++ESVIHEFDPYFNYR T++L +NG Y F NW
Sbjct  15   QKQETLLKLTVLSLAAILSFATRLFSVLRFESVIHEFDPYFNYRTTKYLAENGFYSFHNW  74

Query  319  FDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWAT  498
            FDDR WYPLGR+IGGT+YPGL +T+  L+ I   LNI L +  +CVF AP+FS+  +  T
Sbjct  75   FDDRVWYPLGRIIGGTIYPGLMITSAALYRISWLLNITLDIRNICVFLAPLFSSLTTIIT  134

Query  499  YLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGS  678
            YLLTKE+K + +GL AAA++ +VP YISRSVAGSYDNE +AIF ++FT+Y++IK + TG+
Sbjct  135  YLLTKELKDSASGLFAAAMIAIVPGYISRSVAGSYDNEGIAIFCMLFTYYMWIKAVKTGA  194

Query  679  LFYATLNAIAYFYMVGSLG  735
            + +AT  A+AYFYMV S G
Sbjct  195  ICWATCAALAYFYMVSSWG  213



>ref|XP_005058753.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Ficedula albicollis]
 ref|XP_005494986.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Zonotrichia albicollis]
 ref|XP_005429380.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Geospiza fortis]
 ref|XP_005528499.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Pseudopodoces humilis]
 ref|XP_009096060.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Serinus canaria]
Length=705

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_002909211.1| dolichyl-diphosphooligosaccharide-protein glycosyltransferase 
subunit STT3A, putative [Phytophthora infestans T30-4]
 gb|EEY58025.1| dolichyl-diphosphooligosaccharide-protein glycosyltransferase 
subunit STT3A, putative [Phytophthora infestans T30-4]
Length=850

 Score =   234 bits (596),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 155/208 (75%), Gaps = 1/208 (0%)
 Frame = +1

Query  115  PGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKN  294
            P        A   V    IL +I +M+FSIRLF+V++YESVIHEFDPYFN+R T++L   
Sbjct  48   PRDVEDDENAVAPVAKYAILAMICLMSFSIRLFAVVRYESVIHEFDPYFNFRTTKYLASE  107

Query  295  GIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIF  474
            G  +F +WFDDR WYPLGR+IGGT+YPGL  TA  ++W+LN LNI ++V   CVF AP+F
Sbjct  108  GFLEFLDWFDDRAWYPLGRIIGGTIYPGLMYTAALVYWVLNLLNISINVRNTCVFLAPLF  167

Query  475  SAFASWATYLLTKEV-KGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYL  651
            +A  + A+YLLTKEV K + AGL+AAA  G+VPSYISRSV GSYDNE VAIFALIF FYL
Sbjct  168  AANTAIASYLLTKEVTKRSSAGLLAAAFAGIVPSYISRSVGGSYDNEGVAIFALIFVFYL  227

Query  652  YIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            +IK ++TGS+F++   A+ YFYMV + G
Sbjct  228  WIKAVHTGSMFWSAGCALTYFYMVAAWG  255



>ref|XP_009503240.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Phalacrocorax carbo]
Length=693

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>gb|KFW96584.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Phalacrocorax carbo]
Length=697

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  21   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  80

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  81   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  140

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  141  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  200

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  201  MCALAYFYMVSSWG  214



>ref|XP_010721863.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Meleagris gallopavo]
Length=705

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_011172616.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Solenopsis invicta]
Length=705

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 152/199 (76%), Gaps = 0/199 (0%)
 Frame = +1

Query  139  QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNW  318
            Q    +  L +L L  +++F+ RLFSV+++ESVIHEFDPYFNYR T++L +NG Y F NW
Sbjct  15   QKQETLLKLTVLSLAAILSFATRLFSVLRFESVIHEFDPYFNYRTTKYLAENGFYSFHNW  74

Query  319  FDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWAT  498
            FDDR WYPLGR+IGGT+YPGL +T+  L+ I   LNI L +  +CVF AP+FS+  +  T
Sbjct  75   FDDRVWYPLGRIIGGTIYPGLMITSAALYRISWLLNITLDIRNICVFLAPLFSSLTTIIT  134

Query  499  YLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGS  678
            YLLTKE+K + +GL AAA++ +VP YISRSVAGSYDNE +AIF ++FT+Y++IK + TG+
Sbjct  135  YLLTKELKDSASGLFAAAMIAIVPGYISRSVAGSYDNEGIAIFCMLFTYYMWIKAVKTGA  194

Query  679  LFYATLNAIAYFYMVGSLG  735
            + +AT  A+AYFYMV S G
Sbjct  195  ICWATCAALAYFYMVSSWG  213



>ref|NP_001001202.1| STT3A, subunit of the oligosaccharyltransferase complex (catalytic) 
[Xenopus (Silurana) tropicalis]
 gb|AAH67313.1| hypothetical protein MGC76056 [Xenopus (Silurana) tropicalis]
 emb|CAJ82849.1| Integral membrane protein 1 [Xenopus (Silurana) tropicalis]
Length=705

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  +++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y+F NWFDDR 
Sbjct  17   LLKLLILSMAAILSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYNFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+   + IL+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAFYHILHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>gb|KFP04495.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Calypte anna]
Length=710

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  22   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  81

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  82   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  141

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  142  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  201

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  202  MCALAYFYMVSSWG  215



>gb|KFR01965.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Nipponia nippon]
Length=710

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  22   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  81

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  82   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  141

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  142  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  201

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  202  MCALAYFYMVSSWG  215



>gb|KFO81837.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Cuculus canorus]
Length=710

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  22   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  81

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  82   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  141

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  142  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  201

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  202  MCALAYFYMVSSWG  215



>ref|XP_007427479.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Python bivittatus]
Length=705

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  ICALAYFYMVSSWG  210



>ref|XP_005142858.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Melopsittacus undulatus]
Length=705

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMISVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>gb|KFO61594.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Corvus brachyrhynchos]
Length=711

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  23   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  82

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  83   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  142

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  143  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  202

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  203  MCALAYFYMVSSWG  216



>gb|KGL99280.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Charadrius vociferus]
Length=700

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  22   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  81

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  82   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  141

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  142  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  201

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  202  MCALAYFYMVSSWG  215



>ref|XP_010010547.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Nestor notabilis]
Length=699

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMISVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_004379409.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A isoform 1 [Trichechus manatus latirostris]
Length=705

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLF+V+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL LT+  ++ +L+ L+I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMLTSAAIYHVLHFLHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
              A+AYFYMV S G
Sbjct  197  KCALAYFYMVSSWG  210



>gb|KFO12039.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Balearica regulorum gibbericeps]
 gb|KFP18740.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Egretta garzetta]
Length=710

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  22   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  81

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  82   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  141

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  142  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  201

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  202  MCALAYFYMVSSWG  215



>gb|KFQ47423.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Nestor notabilis]
Length=705

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  23   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  82

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  83   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  142

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  143  ELKDAGAGLLAAAMISVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  202

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  203  MCALAYFYMVSSWG  216



>ref|XP_009982575.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Tauraco erythrolophus]
Length=676

 Score =   231 bits (590),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  ++ + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHVTIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>gb|KFV00546.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Pterocles gutturalis]
Length=709

 Score =   232 bits (591),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  21   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  80

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  81   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  140

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  141  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  200

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  201  MCALAYFYMVSSWG  214



>gb|KFV16358.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Tauraco erythrolophus]
Length=684

 Score =   231 bits (590),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  23   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  82

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  ++ + +  VCVF AP+FS+F +  TY LTK
Sbjct  83   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHVTIDIRNVCVFLAPLFSSFTTIVTYHLTK  142

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  143  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  202

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  203  MCALAYFYMVSSWG  216



>ref|XP_005185991.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Musca domestica]
Length=715

 Score =   232 bits (591),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 160/217 (74%), Gaps = 1/217 (0%)
 Frame = +1

Query  85   MAVPSDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFN  264
            MAV + + A      T  +   ++  + ILI+  V++F+ RLFSV+++ESVIHEFDPYFN
Sbjct  1    MAVETANPAAKTKFLTWEKQ-EHLVKMAILIIAAVLSFATRLFSVLRFESVIHEFDPYFN  59

Query  265  YRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVE  444
            YR T+FL +NG Y F NWFDDR WYPLGR+IGGT+YPGL +T+  L+ IL  LN  + + 
Sbjct  60   YRTTRFLAENGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMVTSAALYRILWLLNFTVDIR  119

Query  445  TVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAI  624
             VCVF AP FS+  +  TY LTKE+  TGAGL+A AL+ +VP YISRSVAGSYDNE +AI
Sbjct  120  NVCVFLAPFFSSLTTLVTYALTKEIHSTGAGLVAGALISIVPGYISRSVAGSYDNEGIAI  179

Query  625  FALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            F ++ T+YL+IK + TG++F++ ++A+AYFYMV S G
Sbjct  180  FCMLLTYYLWIKAVKTGAIFWSAMSALAYFYMVSSWG  216



>ref|XP_004948011.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform X6 [Gallus gallus]
Length=753

 Score =   233 bits (593),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_007558076.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Poecilia formosa]
 ref|XP_008426475.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Poecilia reticulata]
 ref|XP_008426477.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Poecilia reticulata]
Length=705

 Score =   231 bits (590),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 154/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  L+ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMVTSAVLYHVLHFFHITIDIRNVCVFLAPLFSSFTAIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++++
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSVYWSS  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_010579661.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Haliaeetus leucocephalus]
Length=727

 Score =   232 bits (591),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  39   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  98

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  99   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  158

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  159  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  218

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  219  MCALAYFYMVSSWG  232



>ref|XP_003764397.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Sarcophilus harrisii]
Length=705

 Score =   231 bits (590),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLF+V+++ESVIHEFDPYFNYR T+FLT+ G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFLTEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+ T++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSATIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS ++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSTYWAA  196

Query  694  LNAIAYFYMVGSLG  735
              A+AYFYMV S G
Sbjct  197  KCALAYFYMVSSWG  210



>ref|XP_001365210.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A isoform X1 [Monodelphis domestica]
 ref|XP_007495137.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A isoform X2 [Monodelphis domestica]
Length=705

 Score =   231 bits (590),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLF+V+++ESVIHEFDPYFNYR T+FLT+ G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFLTEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+ T++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSATIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS ++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSTYWAA  196

Query  694  LNAIAYFYMVGSLG  735
              A+AYFYMV S G
Sbjct  197  KCALAYFYMVSSWG  210



>ref|XP_006788770.1| PREDICTED: LOW QUALITY PROTEIN: dolichyl-diphosphooligosaccharide--protein 
glycosyltransferase subunit STT3A-like [Neolamprologus 
brichardi]
Length=700

 Score =   231 bits (590),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 154/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  L+ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAVLYHVLHFFHITIDIRNVCVFLAPLFSSFTAIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++++
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSVYWSS  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_005806733.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Xiphophorus maculatus]
Length=705

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 154/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  L+ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMVTSAVLYHVLHFFHITIDIRNVCVFLAPLFSSFTAIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++++
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSVYWSS  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_003700582.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Megachile rotundata]
Length=705

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 153/199 (77%), Gaps = 0/199 (0%)
 Frame = +1

Query  139  QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNW  318
            Q    +  L +L L  +++F+ RLFSV+++ESVIHEFDPYFNYR T++L +NG Y F NW
Sbjct  15   QKQETLLKLTVLSLAAILSFATRLFSVLRFESVIHEFDPYFNYRTTKYLAENGFYSFHNW  74

Query  319  FDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWAT  498
            FDDR WYPLGR+IGGT+YPGL +T+  L+ +   LNI L + T+CVF AP+FS+  +  T
Sbjct  75   FDDRVWYPLGRIIGGTIYPGLMITSAALYRLSWLLNITLDIRTICVFLAPLFSSLTTIIT  134

Query  499  YLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGS  678
            YLLTKE+K + +GL AAA++ +VP YISRSVAGSYDNE +AIF ++FT+Y++IK + TG+
Sbjct  135  YLLTKELKDSASGLFAAAMIAIVPGYISRSVAGSYDNEGIAIFCMLFTYYMWIKAVKTGA  194

Query  679  LFYATLNAIAYFYMVGSLG  735
            + ++T  A+AYFYMV S G
Sbjct  195  ICWSTCAALAYFYMVSSWG  213



>ref|XP_004469308.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A isoform 1 [Dasypus novemcinctus]
Length=715

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL + GV++FS RLF+V+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAGVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
              A+AYFYMV S G
Sbjct  197  KCALAYFYMVSSWG  210



>ref|XP_006021419.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Alligator sinensis]
Length=705

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  ++ + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHVTIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_005509242.1| PREDICTED: LOW QUALITY PROTEIN: dolichyl-diphosphooligosaccharide--protein 
glycosyltransferase subunit STT3A, partial [Columba 
livia]
Length=691

 Score =   231 bits (589),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  ++ + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHVTIDIRNVCVFLAPLFSSFTTVVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>gb|KFM03307.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Aptenodytes forsteri]
Length=701

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  22   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  81

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  ++ + +  VCVF AP+FS+F +  TY LTK
Sbjct  82   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHVTIDIRNVCVFLAPLFSSFTTIVTYHLTK  141

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  142  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  201

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  202  MCALAYFYMVSSWG  215



>ref|XP_011344412.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Cerapachys biroi]
 ref|XP_011344413.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Cerapachys biroi]
 gb|EZA50852.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Cerapachys biroi]
Length=705

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 153/199 (77%), Gaps = 0/199 (0%)
 Frame = +1

Query  139  QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNW  318
            Q    +  L +L L  +++F+ RLFSV+++ESVIHEFDPYFNYR T++L +NG Y F NW
Sbjct  15   QKQETLLKLSVLSLAAILSFATRLFSVLRFESVIHEFDPYFNYRTTKYLAENGFYSFHNW  74

Query  319  FDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWAT  498
            FDDR WYPLGR+IGGT+YPGL +T+  L+ +   LNI L +  +CVF AP+FS+  +  T
Sbjct  75   FDDRVWYPLGRIIGGTIYPGLMVTSAALYRMSWLLNITLDIRNICVFLAPLFSSLTTIIT  134

Query  499  YLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGS  678
            YLLTKE+K + +GL AAA++ +VP YISRSVAGSYDNE +AIF ++FT+Y++IK + TG+
Sbjct  135  YLLTKELKDSASGLFAAAMIAIVPGYISRSVAGSYDNEGIAIFCMLFTYYMWIKAVKTGA  194

Query  679  LFYATLNAIAYFYMVGSLG  735
            + +AT +A+AYFYMV S G
Sbjct  195  ICWATCSALAYFYMVSSWG  213



>ref|XP_004469309.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A isoform 2 [Dasypus novemcinctus]
Length=705

 Score =   231 bits (590),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL + GV++FS RLF+V+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAGVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
              A+AYFYMV S G
Sbjct  197  KCALAYFYMVSSWG  210



>gb|EPB81833.1| dolichyl-diphosphooligosaccharide-protein glycosyltransferase 
[Mucor circinelloides f. circinelloides 1006PhL]
 gb|EPB85796.1| dolichyl-diphosphooligosaccharide-protein glycosyltransferase 
[Mucor circinelloides f. circinelloides 1006PhL]
Length=748

 Score =   232 bits (591),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = +1

Query  169  ILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLG  348
            IL LI V+AFS RLFS+++YES+IHEFDP+FNYR T+ L K+G Y+FWNWFDDR+WYPLG
Sbjct  17   ILGLIAVVAFSSRLFSIVRYESIIHEFDPWFNYRATRMLVKDGFYEFWNWFDDRSWYPLG  76

Query  349  RVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKGT  528
            RV+GGT+YPGL +TA  +  IL+  + P+ +  +CV  AP+FS   ++ATYLLTKE+K +
Sbjct  77   RVVGGTIYPGLMVTAAIIHNILHYFHFPVDIRNICVLLAPMFSGLTAFATYLLTKELKDS  136

Query  529  gaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNAIA  708
             AGL+AA  +G+ P YISRSVAGSYDNEA+AIF L+FTFYL+IK L  GS  +A+  A  
Sbjct  137  SAGLLAAVFMGIAPGYISRSVAGSYDNEAIAIFLLMFTFYLWIKALKLGSALWASAAAFF  196

Query  709  YFYMVGSLG  735
            YFYMV + G
Sbjct  197  YFYMVAAWG  205



>gb|AAB05994.1| putative transmembrane protein precursor [Homo sapiens]
 prf||2208301B integral membrane protein
Length=705

 Score =   231 bits (589),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 152/194 (78%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLF+V+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F S  TYLLTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTSIVTYLLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+ +A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSICWAA  196

Query  694  LNAIAYFYMVGSLG  735
              A+AYFYMV S G
Sbjct  197  KCALAYFYMVSSWG  210



>emb|CEG83090.1| Putative Oligosaccharyl transferase STT3 subunit [Rhizopus microsporus]
Length=750

 Score =   232 bits (591),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = +1

Query  169  ILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLG  348
            IL LI V+AF+ RLFS+++YES+IHEFDP+FNYR T+ L K+G Y+FWNWFDDR+WYPLG
Sbjct  17   ILGLIAVVAFASRLFSIVRYESIIHEFDPWFNYRATRMLVKDGFYEFWNWFDDRSWYPLG  76

Query  349  RVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKGT  528
            RV+GGTVYPGL +TA  +  +L+ LN P+ +  +CV  AP+FS   + ATYLLT E+K +
Sbjct  77   RVVGGTVYPGLMVTAAIIHNVLHFLNFPVDIRNICVLLAPMFSGLTALATYLLTSELKDS  136

Query  529  gaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNAIA  708
             AGL+AAA +G+ P YISRSVAGSYDNEA+AIF L+FTFYL+IK L  GS  +A+ +A  
Sbjct  137  SAGLLAAAFIGIAPGYISRSVAGSYDNEAIAIFLLMFTFYLWIKALKLGSALWASASAFF  196

Query  709  YFYMVGSLG  735
            YFYMV + G
Sbjct  197  YFYMVAAWG  205



>dbj|GAN09602.1| oligosaccharyl transferase STT3 subunit [Mucor ambiguus]
Length=752

 Score =   232 bits (591),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = +1

Query  169  ILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLG  348
            IL LI V+AFS RLFS+++YES+IHEFDP+FNYR T+ L K+G Y+FWNWFDDR+WYPLG
Sbjct  17   ILGLIAVVAFSSRLFSIVRYESIIHEFDPWFNYRATRMLVKDGFYEFWNWFDDRSWYPLG  76

Query  349  RVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKGT  528
            RV+GGT+YPGL +TA  +  IL+  + P+ +  +CV  AP+FS   ++ATYLLTKE+K +
Sbjct  77   RVVGGTIYPGLMVTAAIIHNILHYFHFPVDIRNICVLLAPMFSGLTAFATYLLTKELKDS  136

Query  529  gaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNAIA  708
             AGL+AA  +G+ P YISRSVAGSYDNEA+AIF L+FTFYL+IK L  GS  +A+  A  
Sbjct  137  SAGLLAAVFMGIAPGYISRSVAGSYDNEAIAIFLLMFTFYLWIKALKLGSALWASAAAFF  196

Query  709  YFYMVGSLG  735
            YFYMV + G
Sbjct  197  YFYMVAAWG  205



>dbj|GAA52497.1| dolichyl-diphosphooligosaccharide--protein glycosyltransferase, 
partial [Clonorchis sinensis]
Length=290

 Score =   221 bits (562),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +1

Query  196  FSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYP  375
            F IRLF+VI+YESVIHEFDPYFNYR T+++TK G Y F +WFD+  WYPLGR+IGGT+YP
Sbjct  1    FCIRLFAVIRYESVIHEFDPYFNYRTTRYMTKEGFYSFHDWFDEMAWYPLGRIIGGTIYP  60

Query  376  GLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKGTgaglmaaal  555
            GL +T+  L+  L +L++ + +  +CVF AP+FS+  + AT+LLT EV  T AGL+AA +
Sbjct  61   GLMVTSSLLYNTLRALHVTVDIRNICVFLAPLFSSLTTIATFLLTSEVMDTRAGLLAAGM  120

Query  556  lgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
            + +VP YISRSVAGSYDNE +AIF +IFTFYL++K++ TGS+ +A+  ++AYFYMV S G
Sbjct  121  IAIVPGYISRSVAGSYDNEGIAIFCMIFTFYLWVKSVKTGSVIWASACSLAYFYMVSSWG  180



>ref|XP_001601974.2| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Nasonia vitripennis]
 ref|XP_008208523.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Nasonia vitripennis]
Length=705

 Score =   231 bits (589),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 151/199 (76%), Gaps = 0/199 (0%)
 Frame = +1

Query  139  QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNW  318
            Q    +  L +L    +++F+ RLFSV+++ESVIHEFDPYFNYR T+FL + G Y+F NW
Sbjct  15   QKQETLLKLTVLSFAAILSFATRLFSVLRFESVIHEFDPYFNYRTTKFLAEEGFYNFLNW  74

Query  319  FDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWAT  498
            FDDR WYPLGR+IGGT+YPGL +T+   + +   LNI + +  VCVF AP+FS+F +  T
Sbjct  75   FDDRVWYPLGRIIGGTIYPGLMVTSAAFYHLAQLLNISIDIRNVCVFLAPLFSSFTTIIT  134

Query  499  YLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGS  678
            YLLTKE+K + +GL AA+++ +VP YISRSVAGSYDNE +AIF ++FT+Y++IK + TG+
Sbjct  135  YLLTKELKDSASGLFAASMIAIVPGYISRSVAGSYDNEGIAIFCMLFTYYMWIKAVKTGT  194

Query  679  LFYATLNAIAYFYMVGSLG  735
            +F++T   ++YFYMV S G
Sbjct  195  IFWSTCTVLSYFYMVSSWG  213



>ref|XP_011149388.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Harpegnathos saltator]
Length=705

 Score =   231 bits (589),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 153/199 (77%), Gaps = 0/199 (0%)
 Frame = +1

Query  139  QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNW  318
            Q    +  L +L L  +++F+ RLFSV+++ESVIHEFDPYFNYR T++L +NG Y F NW
Sbjct  15   QKQETLLKLTVLSLAAILSFATRLFSVLRFESVIHEFDPYFNYRTTKYLAENGFYSFHNW  74

Query  319  FDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWAT  498
            FDDR WYPLGR+IGGT+YPGL +T+  L+ +   LNI L +  +CVF AP+FS+  +  T
Sbjct  75   FDDRVWYPLGRIIGGTIYPGLMITSAALYRLSWLLNITLDIRNICVFLAPLFSSLTTIIT  134

Query  499  YLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGS  678
            YLLTKE+K + +GL AAA++ +VP YISRSVAGSYDNE +AIF ++FT+Y++IK + TG+
Sbjct  135  YLLTKELKDSASGLFAAAMIAIVPGYISRSVAGSYDNEGIAIFCMLFTYYMWIKAVKTGA  194

Query  679  LFYATLNAIAYFYMVGSLG  735
            + ++T +A+AYFYMV S G
Sbjct  195  ICWSTCSALAYFYMVSSWG  213



>gb|EFX84969.1| hypothetical protein DAPPUDRAFT_300830 [Daphnia pulex]
Length=711

 Score =   231 bits (589),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 153/195 (78%), Gaps = 0/195 (0%)
 Frame = +1

Query  151  NVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDR  330
             +  L IL +  +++FS RLFSV+++ESVIHEFDPYFNYR T++L + G Y F NWFD+R
Sbjct  20   TLLKLAILTVAAILSFSTRLFSVLRFESVIHEFDPYFNYRTTKYLAEEGFYKFHNWFDER  79

Query  331  TWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLT  510
             WYPLGR+IGGT+YPGL LT+  L+ ++N L+I + V  VCVF AP+FS+  +  T+ LT
Sbjct  80   AWYPLGRIIGGTIYPGLMLTSAVLYHVMNFLHISIDVRNVCVFLAPLFSSLTTIVTFFLT  139

Query  511  KEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYA  690
            +E+KGTGAGL+AA+++ +VP YISRSVAGSYDNE +AIF ++ T++ +IK++ TGSL ++
Sbjct  140  RELKGTGAGLVAASMIAIVPGYISRSVAGSYDNEGIAIFCMLLTYFFWIKSVKTGSLLWS  199

Query  691  TLNAIAYFYMVGSLG  735
             L A+AYFYMV S G
Sbjct  200  ALCALAYFYMVSSWG  214



>ref|XP_004992971.1| hypothetical protein PTSG_06075 [Salpingoeca rosetta]
 gb|EGD74714.1| hypothetical protein PTSG_06075 [Salpingoeca rosetta]
Length=564

 Score =   228 bits (581),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 155/200 (78%), Gaps = 1/200 (1%)
 Frame = +1

Query  139  QAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNW  318
            Q  G +  ++IL L+  +AFS RLF+V+++ES+IHEFDP+FNYR T  LT+NG Y+FWNW
Sbjct  4    QYVGPLLKVVILALVAAVAFSSRLFAVVRFESIIHEFDPWFNYRATAQLTENGFYEFWNW  63

Query  319  FDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNS-LNIPLSVETVCVFTAPIFSAFASWA  495
            FD+R WYPLGR++GGTVYPGL +T+GT+ ++LNS L+IP+ +  +CVF AP+FS   + A
Sbjct  64   FDERAWYPLGRIVGGTVYPGLMVTSGTIHFVLNSLLHIPVHIRDICVFLAPLFSGLTALA  123

Query  496  TYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTG  675
            T+  TKEV    AGL AAA +G+VP YISRSVAGSYDNE +AI  L+ T+YL+IK + TG
Sbjct  124  TFAFTKEVWNDAAGLFAAAFIGIVPGYISRSVAGSYDNEGIAICLLMTTYYLWIKGVKTG  183

Query  676  SLFYATLNAIAYFYMVGSLG  735
            S+ +A L A+ YFYMVG+ G
Sbjct  184  SVAWAALCALVYFYMVGAWG  203



>ref|XP_009017952.1| hypothetical protein HELRODRAFT_111950 [Helobdella robusta]
 gb|ESO04016.1| hypothetical protein HELRODRAFT_111950 [Helobdella robusta]
Length=819

 Score =   233 bits (593),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 157/205 (77%), Gaps = 0/205 (0%)
 Frame = +1

Query  121  SAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGI  300
            SA + R  + ++   ++L L  +  FS RLF+VI++ES+IHEFDP+FNYR T ++ K+G 
Sbjct  3    SALSYRGGWKSLIIFIVLTLAWLAGFSSRLFAVIRFESIIHEFDPWFNYRATHYMVKHGF  62

Query  301  YDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSA  480
            Y+F NWFD+R WYPLGR++GGTVYPGL +T+G + W+L++L+IP+ +  +CVF APIFS 
Sbjct  63   YNFLNWFDERAWYPLGRIVGGTVYPGLMITSGAIHWVLHALHIPVHIRDICVFLAPIFSG  122

Query  481  FASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIK  660
              + ATY LTKEV  +GAGL AA  + +VP YISRSVAGSYDNE +AIFAL+FT++L++K
Sbjct  123  LTAMATYFLTKEVWNSGAGLFAACFIAIVPGYISRSVAGSYDNEGIAIFALMFTYFLWVK  182

Query  661  TLNTGSLFYATLNAIAYFYMVGSLG  735
             + TGS+++    A++YFYMV + G
Sbjct  183  AVKTGSVYWGVCTALSYFYMVSAWG  207



>ref|XP_005019697.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A isoform X5 [Anas platyrhynchos]
Length=726

 Score =   231 bits (589),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  ++ +L+  +I + +  VCVF AP+FS+F +  TY LTK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++A 
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAA  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_007244780.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Astyanax mexicanus]
Length=705

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  154  VFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRT  333
            +  LLIL +  V++FS RLFSV+++ESVIHEFDPYFNYR T+FL + G Y F NWFDDR 
Sbjct  17   LLKLLILSMAAVLSFSTRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRA  76

Query  334  WYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTK  513
            WYPLGR+IGGT+YPGL +T+  L+ +L+  +I + +  VCVF AP+FS+F +  TY  TK
Sbjct  77   WYPLGRIIGGTIYPGLMITSAALYHVLHFFHITIDIRNVCVFLAPLFSSFTAIVTYHFTK  136

Query  514  EVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYAT  693
            E+K  GAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+Y++IK + TGS+++++
Sbjct  137  ELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWSS  196

Query  694  LNAIAYFYMVGSLG  735
            + A+AYFYMV S G
Sbjct  197  MCALAYFYMVSSWG  210



>ref|XP_012145182.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B isoform X2 [Megachile rotundata]
Length=783

 Score =   232 bits (591),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 162/213 (76%), Gaps = 0/213 (0%)
 Frame = +1

Query  97   SDSEAVPGSAATLRQAFGNVFSLLILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVT  276
            S S+ +  S  T      ++ +  +L+L  +  F+ RLF+VI++ES+IHEFDP+FNYR T
Sbjct  21   STSKQMKTSTLTNAAGLSSLITFTVLLLAWISGFASRLFAVIRFESIIHEFDPWFNYRAT  80

Query  277  QFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCV  456
             ++ ++G Y+F NWFD+R WYPLGR++GGTVYPGL +T+G++ +IL+SLNIP+ +  +CV
Sbjct  81   AYMVQHGFYNFLNWFDERAWYPLGRIVGGTVYPGLMITSGSIHYILHSLNIPVHIRDICV  140

Query  457  FTAPIFSAFASWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALI  636
            F APIFS   + +TYLLTKE+   GAGL AA  + +VP YISRSVAGSYDNE +AIFAL 
Sbjct  141  FLAPIFSGLTAISTYLLTKEIWSAGAGLFAACFIAIVPGYISRSVAGSYDNEGIAIFALQ  200

Query  637  FTFYLYIKTLNTGSLFYATLNAIAYFYMVGSLG  735
             T+YL++K++ TGS+F+A++ A++YFYMV + G
Sbjct  201  ITYYLWVKSVKTGSIFWASMTALSYFYMVSAWG  233



>ref|XP_001175790.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Strongylocentrotus purpuratus]
Length=710

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 156/203 (77%), Gaps = 3/203 (1%)
 Frame = +1

Query  136  RQAFGNVFSLL---ILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYD  306
            R +F    +LL   IL+   +++FS RLFSV+++ESVIHEFDPYFNYR T +L + G Y 
Sbjct  14   RMSFEKQETLLKLSILVFCMILSFSTRLFSVLRFESVIHEFDPYFNYRTTLYLAEKGFYQ  73

Query  307  FWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFA  486
            F NWFDDR WYPLGR+IGGT+YPGL LT+  ++  LN L+I + V  VCVF AP+FS+  
Sbjct  74   FHNWFDDRAWYPLGRIIGGTIYPGLMLTSAVIYHALNFLHISIDVRNVCVFLAPLFSSLT  133

Query  487  SWATYLLTKEVKGTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTL  666
            + ATY LTKE+K TGAGL+AAA++ +VP YISRSVAGSYDNE +AIF ++ T+ L+IK++
Sbjct  134  TLATYHLTKELKDTGAGLVAAAMISIVPGYISRSVAGSYDNEGIAIFCMLLTYALWIKSV  193

Query  667  NTGSLFYATLNAIAYFYMVGSLG  735
             TGS+F+A L ++AYFYMV S G
Sbjct  194  KTGSVFWAALCSLAYFYMVSSWG  216



>emb|CEP10613.1| hypothetical protein [Parasitella parasitica]
Length=744

 Score =   231 bits (590),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = +1

Query  169  ILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLG  348
            IL LI V+AFS RLFS+++YES+IHEFDP+FNYR T+ L K+G Y+FWNWFDDR+WYPLG
Sbjct  17   ILGLIAVVAFSSRLFSIVRYESIIHEFDPWFNYRATRMLVKDGFYEFWNWFDDRSWYPLG  76

Query  349  RVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEVKGT  528
            RV+GGT+YPGL +TA  +  IL+  + P+ +  +CV  AP+FS   ++ATYLLTKE+K +
Sbjct  77   RVVGGTIYPGLMVTAAVIHNILHYFHFPVDIRNICVLLAPMFSGLTAFATYLLTKELKDS  136

Query  529  gaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNAIA  708
             AGL+AA  +G+ P YISRSVAGSYDNEA+AIF L+FTFYL+IK L  GS  +A+  A  
Sbjct  137  SAGLLAAVFMGIAPGYISRSVAGSYDNEAIAIFLLMFTFYLWIKALKLGSALWASGAAFF  196

Query  709  YFYMVGSLG  735
            YFYMV + G
Sbjct  197  YFYMVAAWG  205



>emb|CCI41730.1| unnamed protein product [Albugo candida]
Length=827

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 152/191 (80%), Gaps = 1/191 (1%)
 Frame = +1

Query  166  LILILIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPL  345
            +IL +I +++FSIRLF+V++YESVIHEFDPYFN+R T++L   G  +F NWFDDR WYPL
Sbjct  9    VILAMICLLSFSIRLFAVVRYESVIHEFDPYFNFRTTKYLASEGFLEFLNWFDDRAWYPL  68

Query  346  GRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVFTAPIFSAFASWATYLLTKEV-K  522
            GR+IGGT+YPGL  TA  ++W+LN  N+ ++V   CVF AP+F+A  + ATYLLTKEV K
Sbjct  69   GRIIGGTIYPGLMFTAACIYWLLNLFNLSINVRNTCVFLAPLFAAITAIATYLLTKEVTK  128

Query  523  GTgaglmaaallgmVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNA  702
             + AGL+AAA +G+VPSYISRSV GSYDNE VAIFALIF FYL+IK ++TGS+ ++   A
Sbjct  129  RSSAGLIAAAFIGIVPSYISRSVGGSYDNEGVAIFALIFVFYLWIKAVHTGSMLWSATCA  188

Query  703  IAYFYMVGSLG  735
            + YFYMV + G
Sbjct  189  LFYFYMVAAWG  199



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1586636554460