BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6073

Length=597
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009630744.1|  PREDICTED: serine carboxypeptidase II-2            281   4e-89   Nicotiana tomentosiformis
ref|XP_009789305.1|  PREDICTED: serine carboxypeptidase II-2            279   4e-88   Nicotiana sylvestris
ref|XP_004242620.1|  PREDICTED: serine carboxypeptidase II-2            273   4e-86   Solanum lycopersicum
ref|XP_006343604.1|  PREDICTED: serine carboxypeptidase II-2-like       271   3e-85   Solanum tuberosum [potatoes]
ref|XP_002528403.1|  serine carboxypeptidase, putative                  267   1e-83   Ricinus communis
gb|EYU34325.1|  hypothetical protein MIMGU_mgv1a005646mg                267   1e-83   Erythranthe guttata [common monkey flower]
ref|XP_006453576.1|  hypothetical protein CICLE_v10008112mg             263   2e-83   
ref|XP_010531651.1|  PREDICTED: serine carboxypeptidase-like 29         256   6e-83   Tarenaya hassleriana [spider flower]
ref|XP_011079368.1|  PREDICTED: serine carboxypeptidase II-2            265   8e-83   Sesamum indicum [beniseed]
ref|XP_008243035.1|  PREDICTED: serine carboxypeptidase II-2            263   3e-82   Prunus mume [ume]
ref|XP_007202013.1|  hypothetical protein PRUPE_ppa005192mg             263   3e-82   Prunus persica
ref|XP_002275081.1|  PREDICTED: serine carboxypeptidase II-2            263   6e-82   Vitis vinifera
ref|XP_006453577.1|  hypothetical protein CICLE_v10008112mg             262   1e-81   Citrus clementina [clementine]
gb|KDO62275.1|  hypothetical protein CISIN_1g0418332mg                  257   1e-81   Citrus sinensis [apfelsine]
ref|XP_009358402.1|  PREDICTED: serine carboxypeptidase II-2            262   2e-81   Pyrus x bretschneideri [bai li]
ref|XP_006453578.1|  hypothetical protein CICLE_v10008112mg             262   2e-81   Citrus clementina [clementine]
ref|XP_010526302.1|  PREDICTED: serine carboxypeptidase-like 29         261   3e-81   Tarenaya hassleriana [spider flower]
ref|XP_012071557.1|  PREDICTED: serine carboxypeptidase II-2-like       259   1e-80   Jatropha curcas
emb|CDP02851.1|  unnamed protein product                                259   1e-80   Coffea canephora [robusta coffee]
ref|XP_010273729.1|  PREDICTED: serine carboxypeptidase II-2            259   3e-80   Nelumbo nucifera [Indian lotus]
emb|CBI36578.3|  unnamed protein product                                258   3e-80   Vitis vinifera
ref|XP_006474032.1|  PREDICTED: serine carboxypeptidase-like 29-like    258   3e-80   Citrus sinensis [apfelsine]
ref|XP_002273324.2|  PREDICTED: serine carboxypeptidase II-2            259   4e-80   Vitis vinifera
ref|XP_008394291.1|  PREDICTED: serine carboxypeptidase II-2            258   6e-80   
ref|XP_002324520.1|  serine carboxypeptidase S10 family protein         257   9e-80   
ref|XP_002324616.2|  hypothetical protein POPTR_0018s11210g             257   1e-79   
ref|XP_011018072.1|  PREDICTED: serine carboxypeptidase-like 29 i...    255   1e-79   Populus euphratica
ref|XP_008790133.1|  PREDICTED: serine carboxypeptidase II-2 isof...    256   1e-79   Phoenix dactylifera
ref|XP_009410194.1|  PREDICTED: serine carboxypeptidase II-2-like       257   1e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase II-2            256   3e-79   Fragaria vesca subsp. vesca
ref|XP_010040844.1|  PREDICTED: serine carboxypeptidase II-2-like       256   4e-79   Eucalyptus grandis [rose gum]
ref|XP_010048771.1|  PREDICTED: serine carboxypeptidase II-2            255   4e-79   Eucalyptus grandis [rose gum]
ref|XP_008790132.1|  PREDICTED: serine carboxypeptidase II-2 isof...    255   4e-79   Phoenix dactylifera
gb|KFK29659.1|  hypothetical protein AALP_AA7G162000                    254   1e-78   Arabis alpina [alpine rockcress]
ref|XP_011018071.1|  PREDICTED: serine carboxypeptidase II-2-like...    254   1e-78   Populus euphratica
gb|KJB76660.1|  hypothetical protein B456_012G098600                    251   3e-78   Gossypium raimondii
ref|XP_009395827.1|  PREDICTED: serine carboxypeptidase II-2-like       253   4e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004144720.1|  PREDICTED: serine carboxypeptidase II-2            253   4e-78   Cucumis sativus [cucumbers]
ref|XP_006845388.1|  PREDICTED: serine carboxypeptidase II-2            252   6e-78   Amborella trichopoda
ref|XP_008452541.1|  PREDICTED: serine carboxypeptidase II-2            252   9e-78   Cucumis melo [Oriental melon]
ref|XP_006387151.1|  hypothetical protein POPTR_1689s00200g             247   1e-77   
gb|KGN61064.1|  hypothetical protein Csa_2G036620                       254   1e-77   Cucumis sativus [cucumbers]
gb|KJB76659.1|  hypothetical protein B456_012G098600                    250   5e-77   Gossypium raimondii
ref|XP_007013884.1|  Serine carboxypeptidase-like 29                    250   7e-77   Theobroma cacao [chocolate]
ref|XP_006286217.1|  hypothetical protein CARUB_v10007783mg             249   9e-77   Capsella rubella
ref|XP_010905043.1|  PREDICTED: serine carboxypeptidase II-2            248   2e-76   Elaeis guineensis
gb|AFK34623.1|  unknown                                                 239   2e-76   Lotus japonicus
ref|XP_010687643.1|  PREDICTED: serine carboxypeptidase II-2            248   2e-76   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG11306.1|  Serine carboxypeptidase-like 29                         248   4e-76   Gossypium arboreum [tree cotton]
ref|XP_002869361.1|  hypothetical protein ARALYDRAFT_491673             247   7e-76   
ref|XP_010432944.1|  PREDICTED: serine carboxypeptidase-like 29         246   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_009127491.1|  PREDICTED: serine carboxypeptidase-like 29         246   3e-75   Brassica rapa
ref|XP_010447670.1|  PREDICTED: serine carboxypeptidase-like 29         246   3e-75   Camelina sativa [gold-of-pleasure]
emb|CDY28217.1|  BnaA01g06320D                                          245   4e-75   Brassica napus [oilseed rape]
gb|EPS71160.1|  hypothetical protein M569_03591                         244   6e-75   Genlisea aurea
emb|CAN75200.1|  hypothetical protein VITISV_014887                     246   7e-75   Vitis vinifera
ref|XP_009127511.1|  PREDICTED: serine carboxypeptidase-like 29         244   8e-75   Brassica rapa
ref|XP_010438130.1|  PREDICTED: serine carboxypeptidase-like 29         245   8e-75   Camelina sativa [gold-of-pleasure]
emb|CDY23258.1|  BnaA08g12880D                                          244   9e-75   Brassica napus [oilseed rape]
emb|CAA18212.1|  SERINE CARBOXYPEPTIDASE II-like protein                243   9e-75   Arabidopsis thaliana [mouse-ear cress]
emb|CDX68696.1|  BnaC01g07570D                                          245   1e-74   
ref|XP_003564183.1|  PREDICTED: serine carboxypeptidase II-2            244   1e-74   Brachypodium distachyon [annual false brome]
ref|NP_567854.1|  serine carboxypeptidase-like 29                       244   2e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108967.1|  PREDICTED: serine carboxypeptidase-like 29         243   4e-74   
ref|XP_010111113.1|  Serine carboxypeptidase-like 29                    243   4e-74   
emb|CDY28216.1|  BnaA01g06330D                                          242   7e-74   Brassica napus [oilseed rape]
emb|CDY55623.1|  BnaC03g77560D                                          242   8e-74   Brassica napus [oilseed rape]
ref|XP_006412667.1|  hypothetical protein EUTSA_v10025076mg             241   3e-73   Eutrema salsugineum [saltwater cress]
ref|XP_009137969.1|  PREDICTED: serine carboxypeptidase-like 29         240   4e-73   Brassica rapa
emb|CDY13387.1|  BnaA03g51050D                                          240   4e-73   Brassica napus [oilseed rape]
emb|CDX68695.1|  BnaC01g07580D                                          238   2e-72   
emb|CDX72270.1|  BnaC07g42920D                                          241   7e-72   
gb|KHN02055.1|  Serine carboxypeptidase II-2                            236   1e-71   Glycine soja [wild soybean]
ref|XP_004964646.1|  PREDICTED: serine carboxypeptidase II-2-like       236   1e-71   Setaria italica
ref|XP_003522937.2|  PREDICTED: serine carboxypeptidase II-2-like       236   2e-71   Glycine max [soybeans]
ref|XP_006655861.1|  PREDICTED: serine carboxypeptidase II-2-like       236   2e-71   Oryza brachyantha
dbj|BAJ99024.1|  predicted protein                                      235   3e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK02147.1|  predicted protein                                      235   3e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW85537.1|  hypothetical protein ZEAMMB73_208131                    231   4e-70   
ref|NP_001146398.1|  Serine carboxypeptidase K10B2.2 precursor          231   7e-70   Zea mays [maize]
ref|XP_004488608.1|  PREDICTED: serine carboxypeptidase II-2-like       231   2e-69   Cicer arietinum [garbanzo]
ref|NP_001057009.1|  Os06g0186400                                       230   3e-69   
sp|P55748.1|CBP22_HORVU  RecName: Full=Serine carboxypeptidase II...    228   5e-69   Hordeum vulgare [barley]
ref|XP_007138291.1|  hypothetical protein PHAVU_009G196000g             227   3e-68   Phaseolus vulgaris [French bean]
emb|CDY32091.1|  BnaC04g44750D                                          225   8e-68   Brassica napus [oilseed rape]
ref|XP_009141519.1|  PREDICTED: serine carboxypeptidase-like 26         224   2e-67   Brassica rapa
emb|CDP11023.1|  unnamed protein product                                226   2e-67   Coffea canephora [robusta coffee]
emb|CDY40438.1|  BnaA04g20790D                                          224   2e-67   Brassica napus [oilseed rape]
ref|XP_003595890.1|  Serine carboxypeptidase II-2                       224   4e-67   Medicago truncatula
ref|XP_006350225.1|  PREDICTED: serine carboxypeptidase-like 27-like    223   9e-67   Solanum tuberosum [potatoes]
ref|XP_003548016.1|  PREDICTED: serine carboxypeptidase-like 27-like    223   1e-66   Glycine max [soybeans]
emb|CDO99730.1|  unnamed protein product                                222   2e-66   Coffea canephora [robusta coffee]
gb|KFK36474.1|  hypothetical protein AALP_AA4G129400                    221   4e-66   Arabis alpina [alpine rockcress]
ref|NP_181121.1|  serine carboxypeptidase-like 26                       221   4e-66   Arabidopsis thaliana [mouse-ear cress]
gb|AES66787.2|  serine carboxypeptidase-like protein                    221   5e-66   Medicago truncatula
ref|XP_003595892.1|  Serine carboxypeptidase II-2                       221   8e-66   Medicago truncatula
ref|XP_011076996.1|  PREDICTED: serine carboxypeptidase-like 27         221   8e-66   Sesamum indicum [beniseed]
ref|XP_006589433.1|  PREDICTED: serine carboxypeptidase-like 27-like    220   1e-65   Glycine max [soybeans]
ref|XP_006410747.1|  hypothetical protein EUTSA_v10016650mg             220   1e-65   Eutrema salsugineum [saltwater cress]
ref|XP_007143689.1|  hypothetical protein PHAVU_007G093300g             220   1e-65   Phaseolus vulgaris [French bean]
ref|XP_004236634.1|  PREDICTED: serine carboxypeptidase-like 27         220   1e-65   Solanum lycopersicum
ref|XP_006294202.1|  hypothetical protein CARUB_v10023198mg             220   1e-65   Capsella rubella
ref|XP_010253608.1|  PREDICTED: serine carboxypeptidase-like 27         219   2e-65   Nelumbo nucifera [Indian lotus]
ref|XP_010505098.1|  PREDICTED: serine carboxypeptidase-like 26         219   2e-65   Camelina sativa [gold-of-pleasure]
gb|ACA61621.1|  hypothetical protein AP7_B10.1                          219   2e-65   Arabidopsis lyrata subsp. petraea
ref|XP_009802382.1|  PREDICTED: serine carboxypeptidase-like 27         219   2e-65   Nicotiana sylvestris
ref|XP_002881414.1|  hypothetical protein ARALYDRAFT_482550             219   2e-65   
ref|XP_003596536.1|  Serine carboxypeptidase                            222   2e-65   
ref|XP_012086498.1|  PREDICTED: serine carboxypeptidase-like 27         219   2e-65   Jatropha curcas
ref|XP_002312024.1|  serine carboxypeptidase S10 family protein         219   3e-65   Populus trichocarpa [western balsam poplar]
ref|XP_010509560.1|  PREDICTED: serine carboxypeptidase-like 26         219   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_011031767.1|  PREDICTED: serine carboxypeptidase-like 27         218   6e-65   Populus euphratica
ref|XP_009592854.1|  PREDICTED: serine carboxypeptidase-like 27         218   6e-65   Nicotiana tomentosiformis
gb|KJB78940.1|  hypothetical protein B456_013G026200                    216   7e-65   Gossypium raimondii
ref|XP_004307401.1|  PREDICTED: serine carboxypeptidase-like 27         218   8e-65   Fragaria vesca subsp. vesca
gb|KHN13367.1|  Serine carboxypeptidase-like 27                         219   9e-65   Glycine soja [wild soybean]
ref|XP_009378094.1|  PREDICTED: serine carboxypeptidase-like 27         218   9e-65   Pyrus x bretschneideri [bai li]
ref|XP_010516783.1|  PREDICTED: serine carboxypeptidase-like 26         218   9e-65   Camelina sativa [gold-of-pleasure]
ref|XP_003595891.1|  Serine carboxypeptidase-like protein               218   1e-64   Medicago truncatula
gb|EYU39591.1|  hypothetical protein MIMGU_mgv1a009171mg                214   1e-64   Erythranthe guttata [common monkey flower]
gb|KJB78942.1|  hypothetical protein B456_013G026200                    216   2e-64   Gossypium raimondii
gb|KHG25905.1|  Serine carboxypeptidase-like 27                         217   2e-64   Gossypium arboreum [tree cotton]
gb|KHN17121.1|  Serine carboxypeptidase-like 27                         217   2e-64   Glycine soja [wild soybean]
gb|KJB76564.1|  hypothetical protein B456_012G094900                    213   2e-64   Gossypium raimondii
ref|XP_002315292.2|  serine carboxypeptidase S10 family protein         216   3e-64   Populus trichocarpa [western balsam poplar]
gb|KJB78939.1|  hypothetical protein B456_013G026200                    216   3e-64   Gossypium raimondii
gb|KJB76565.1|  hypothetical protein B456_012G094900                    213   4e-64   Gossypium raimondii
ref|XP_003556225.1|  PREDICTED: serine carboxypeptidase-like 27-l...    216   4e-64   Glycine max [soybeans]
ref|XP_011469672.1|  PREDICTED: serine carboxypeptidase-like 27 i...    216   4e-64   Fragaria vesca subsp. vesca
ref|XP_010264739.1|  PREDICTED: serine carboxypeptidase-like 27         216   5e-64   Nelumbo nucifera [Indian lotus]
ref|XP_004307399.1|  PREDICTED: serine carboxypeptidase-like 27 i...    216   7e-64   Fragaria vesca subsp. vesca
ref|XP_004142401.1|  PREDICTED: serine carboxypeptidase-like 27         215   7e-64   Cucumis sativus [cucumbers]
ref|XP_010669644.1|  PREDICTED: serine carboxypeptidase-like 27         215   8e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002312023.1|  hypothetical protein POPTR_0008s04130g             216   8e-64   Populus trichocarpa [western balsam poplar]
gb|KJB78938.1|  hypothetical protein B456_013G026200                    216   8e-64   Gossypium raimondii
ref|XP_007009788.1|  Serine carboxypeptidase-like 27 isoform 2          214   9e-64   
ref|XP_002534550.1|  serine carboxypeptidase, putative                  213   9e-64   
ref|XP_008368824.1|  PREDICTED: serine carboxypeptidase-like 27         215   1e-63   Malus domestica [apple tree]
ref|XP_010067291.1|  PREDICTED: serine carboxypeptidase-like 28         215   1e-63   Eucalyptus grandis [rose gum]
gb|AFK37459.1|  unknown                                                 214   2e-63   Lotus japonicus
ref|XP_009333715.1|  PREDICTED: serine carboxypeptidase-like 27         214   2e-63   Pyrus x bretschneideri [bai li]
ref|XP_010547376.1|  PREDICTED: serine carboxypeptidase-like 27         214   2e-63   Tarenaya hassleriana [spider flower]
ref|XP_008381976.1|  PREDICTED: serine carboxypeptidase-like 27         214   2e-63   
ref|XP_008446902.1|  PREDICTED: serine carboxypeptidase-like 27         214   3e-63   Cucumis melo [Oriental melon]
ref|XP_009141517.1|  PREDICTED: serine carboxypeptidase-like 28         214   3e-63   Brassica rapa
gb|KDP38716.1|  hypothetical protein JCGZ_04069                         208   3e-63   Jatropha curcas
ref|XP_011040962.1|  PREDICTED: serine carboxypeptidase-like 27         214   3e-63   Populus euphratica
ref|XP_008233341.1|  PREDICTED: serine carboxypeptidase-like 27         213   5e-63   Prunus mume [ume]
gb|EPS66906.1|  hypothetical protein M569_07869                         212   6e-63   Genlisea aurea
gb|KFK38250.1|  hypothetical protein AALP_AA3G088900                    213   6e-63   Arabis alpina [alpine rockcress]
emb|CDY40439.1|  BnaA04g20780D                                          213   8e-63   Brassica napus [oilseed rape]
gb|KJB76563.1|  hypothetical protein B456_012G094900                    213   8e-63   Gossypium raimondii
ref|XP_006407773.1|  hypothetical protein EUTSA_v10020705mg             213   1e-62   Eutrema salsugineum [saltwater cress]
ref|XP_002315293.2|  hypothetical protein POPTR_0010s22700g             213   1e-62   
ref|XP_002274723.1|  PREDICTED: serine carboxypeptidase-like 27         212   1e-62   Vitis vinifera
gb|KJB76567.1|  hypothetical protein B456_012G094900                    213   1e-62   Gossypium raimondii
gb|KJB76571.1|  hypothetical protein B456_012G095000                    213   1e-62   Gossypium raimondii
gb|KJB76566.1|  hypothetical protein B456_012G094900                    213   2e-62   Gossypium raimondii
ref|XP_011031766.1|  PREDICTED: serine carboxypeptidase-like 27         212   2e-62   Populus euphratica
ref|XP_007009787.1|  Serine carboxypeptidase-like 27 isoform 1          214   3e-62   
ref|XP_009147010.1|  PREDICTED: serine carboxypeptidase-like 27 i...    211   3e-62   
emb|CDY35977.1|  BnaA05g29730D                                          211   3e-62   Brassica napus [oilseed rape]
ref|XP_010460785.1|  PREDICTED: serine carboxypeptidase-like 27         211   3e-62   Camelina sativa [gold-of-pleasure]
ref|XP_009147009.1|  PREDICTED: serine carboxypeptidase-like 27 i...    211   3e-62   Brassica rapa
emb|CDY28004.1|  BnaC05g44060D                                          211   4e-62   Brassica napus [oilseed rape]
ref|XP_007009790.1|  Serine carboxypeptidase-like 28                    211   4e-62   
ref|XP_004288721.2|  PREDICTED: serine carboxypeptidase 24              211   4e-62   Fragaria vesca subsp. vesca
ref|NP_187456.1|  serine carboxypeptidase-like 27                       211   4e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003591950.1|  Serine carboxypeptidase-like protein               211   4e-62   Medicago truncatula
ref|XP_003591949.1|  Serine carboxypeptidase-like protein               211   6e-62   
ref|XP_010260054.1|  PREDICTED: serine carboxypeptidase-like 25 i...    209   6e-62   Nelumbo nucifera [Indian lotus]
gb|AES62200.2|  serine carboxypeptidase-like protein                    211   9e-62   Medicago truncatula
gb|KCW65386.1|  hypothetical protein EUGRSUZ_G02816                     210   1e-61   Eucalyptus grandis [rose gum]
gb|KDO48447.1|  hypothetical protein CISIN_1g012819mg                   209   1e-61   Citrus sinensis [apfelsine]
emb|CAN74854.1|  hypothetical protein VITISV_028701                     209   2e-61   Vitis vinifera
ref|XP_002274699.1|  PREDICTED: serine carboxypeptidase-like 28         210   2e-61   Vitis vinifera
ref|XP_010260044.1|  PREDICTED: serine carboxypeptidase-like 25 i...    209   2e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010464446.1|  PREDICTED: serine carboxypeptidase-like 27         209   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_006436271.1|  hypothetical protein CICLE_v10031497mg             209   2e-61   Citrus clementina [clementine]
ref|XP_004496293.1|  PREDICTED: serine carboxypeptidase-like 27-l...    208   2e-61   
gb|EYU39590.1|  hypothetical protein MIMGU_mgv1a0101821mg               201   2e-61   Erythranthe guttata [common monkey flower]
emb|CBI31484.3|  unnamed protein product                                210   2e-61   Vitis vinifera
ref|XP_010486379.1|  PREDICTED: serine carboxypeptidase-like 27         209   2e-61   Camelina sativa [gold-of-pleasure]
gb|ACA61622.1|  hypothetical protein AP7_B10.2                          201   2e-61   Arabidopsis lyrata subsp. petraea
gb|KHG08205.1|  Serine carboxypeptidase-like 27                         209   2e-61   Gossypium arboreum [tree cotton]
ref|XP_010067290.1|  PREDICTED: serine carboxypeptidase-like 27         211   2e-61   Eucalyptus grandis [rose gum]
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         209   3e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386999.1|  PREDICTED: serine carboxypeptidase-like 27         209   4e-61   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB76569.1|  hypothetical protein B456_012G094900                    208   4e-61   Gossypium raimondii
ref|XP_011040963.1|  PREDICTED: serine carboxypeptidase-like 27         208   5e-61   Populus euphratica
ref|XP_010505097.1|  PREDICTED: serine carboxypeptidase-like 28         208   6e-61   Camelina sativa [gold-of-pleasure]
ref|XP_004496292.1|  PREDICTED: serine carboxypeptidase-like 27-l...    208   6e-61   Cicer arietinum [garbanzo]
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         208   7e-61   Vitis vinifera
emb|CBI21207.3|  unnamed protein product                                208   7e-61   Vitis vinifera
gb|AFK43035.1|  unknown                                                 207   7e-61   Medicago truncatula
ref|XP_006297634.1|  hypothetical protein CARUB_v10013654mg             207   8e-61   
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         207   1e-60   Nicotiana sylvestris
ref|XP_003591947.1|  Serine carboxypeptidase-like protein               207   1e-60   Medicago truncatula
ref|XP_006297635.1|  hypothetical protein CARUB_v10013654mg             207   2e-60   
ref|NP_181120.2|  serine carboxypeptidase-like 28                       207   2e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KDO48446.1|  hypothetical protein CISIN_1g016137mg                   204   2e-60   Citrus sinensis [apfelsine]
dbj|BAO04184.1|  hypothetical protein                                   206   4e-60   Delphinium grandiflorum
ref|XP_006294164.1|  hypothetical protein CARUB_v10023157mg             206   4e-60   Capsella rubella
ref|XP_002882565.1|  hypothetical protein ARALYDRAFT_478140             206   4e-60   Arabidopsis lyrata subsp. lyrata
ref|XP_006436272.1|  hypothetical protein CICLE_v10031437mg             206   5e-60   Citrus clementina [clementine]
gb|KJB75609.1|  hypothetical protein B456_012G048700                    202   6e-60   Gossypium raimondii
ref|XP_007139483.1|  hypothetical protein PHAVU_008G033300g             205   7e-60   Phaseolus vulgaris [French bean]
ref|XP_006410746.1|  hypothetical protein EUTSA_v10016610mg             205   8e-60   Eutrema salsugineum [saltwater cress]
ref|XP_006850617.1|  PREDICTED: serine carboxypeptidase-like 27         205   8e-60   Amborella trichopoda
ref|XP_010920885.1|  PREDICTED: serine carboxypeptidase-like 27         206   9e-60   Elaeis guineensis
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    204   1e-59   Nelumbo nucifera [Indian lotus]
gb|KJB77373.1|  hypothetical protein B456_012G134700                    205   1e-59   Gossypium raimondii
ref|XP_009414289.1|  PREDICTED: serine carboxypeptidase-like 27         205   1e-59   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB77375.1|  hypothetical protein B456_012G134700                    206   1e-59   Gossypium raimondii
ref|XP_006373363.1|  hypothetical protein POPTR_0017s12960g             204   1e-59   
emb|CDP10248.1|  unnamed protein product                                204   2e-59   Coffea canephora [robusta coffee]
gb|ABR16028.1|  unknown                                                 204   2e-59   Picea sitchensis
gb|KJB07560.1|  hypothetical protein B456_001G032600                    202   2e-59   Gossypium raimondii
emb|CDO99728.1|  unnamed protein product                                204   3e-59   Coffea canephora [robusta coffee]
ref|XP_010032541.1|  PREDICTED: serine carboxypeptidase-like 25         205   3e-59   Eucalyptus grandis [rose gum]
gb|AAM15112.1|  putative serine carboxypeptidase II                     203   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002324116.2|  serine carboxypeptidase S10 family protein         203   3e-59   Populus trichocarpa [western balsam poplar]
ref|XP_002529402.1|  serine carboxypeptidase, putative                  203   4e-59   Ricinus communis
ref|XP_010089631.1|  Serine carboxypeptidase-like 25                    203   4e-59   Morus notabilis
dbj|BAK05698.1|  predicted protein                                      201   4e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007032751.1|  Serine carboxypeptidase-like 25 isoform 4          200   5e-59   
ref|XP_002881413.1|  hypothetical protein ARALYDRAFT_321290             203   5e-59   
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         203   5e-59   Nelumbo nucifera [Indian lotus]
ref|XP_010509563.1|  PREDICTED: serine carboxypeptidase-like 28         203   6e-59   Camelina sativa [gold-of-pleasure]
ref|XP_009618061.1|  PREDICTED: serine carboxypeptidase-like 34         196   8e-59   Nicotiana tomentosiformis
ref|XP_010516781.1|  PREDICTED: serine carboxypeptidase-like 28         202   8e-59   Camelina sativa [gold-of-pleasure]
ref|XP_003552566.1|  PREDICTED: serine carboxypeptidase-like 25-l...    202   8e-59   Glycine max [soybeans]
ref|XP_003530438.1|  PREDICTED: serine carboxypeptidase-like 25-l...    202   9e-59   
ref|XP_012071522.1|  PREDICTED: serine carboxypeptidase 24 isofor...    201   1e-58   
ref|XP_003549539.1|  PREDICTED: serine carboxypeptidase 24-like         202   1e-58   Glycine max [soybeans]
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         202   1e-58   Nelumbo nucifera [Indian lotus]
gb|KJB07562.1|  hypothetical protein B456_001G032600                    202   1e-58   Gossypium raimondii
ref|XP_008789080.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    202   1e-58   
ref|XP_012086520.1|  PREDICTED: serine carboxypeptidase-like 28         202   1e-58   Jatropha curcas
emb|CDY43258.1|  BnaC05g48510D                                          202   1e-58   Brassica napus [oilseed rape]
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         202   2e-58   Solanum lycopersicum
gb|EYU44197.1|  hypothetical protein MIMGU_mgv1a005600mg                202   2e-58   Erythranthe guttata [common monkey flower]
ref|XP_009771074.1|  PREDICTED: serine carboxypeptidase-like 25         201   2e-58   Nicotiana sylvestris
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         201   2e-58   Populus euphratica
ref|XP_011623956.1|  PREDICTED: serine carboxypeptidase-like 25 i...    201   2e-58   
ref|XP_011623958.1|  PREDICTED: serine carboxypeptidase-like 25 i...    201   2e-58   
ref|XP_003519151.1|  PREDICTED: serine carboxypeptidase 24-like i...    201   2e-58   Glycine max [soybeans]
gb|KFK36473.1|  hypothetical protein AALP_AA4G129300                    201   2e-58   Arabis alpina [alpine rockcress]
gb|KHN41581.1|  Serine carboxypeptidase-like 25                         201   2e-58   Glycine soja [wild soybean]
ref|XP_011623955.1|  PREDICTED: serine carboxypeptidase-like 25 i...    201   2e-58   
ref|XP_009147382.1|  PREDICTED: serine carboxypeptidase-like 25         201   2e-58   Brassica rapa
gb|KJB07559.1|  hypothetical protein B456_001G032600                    202   3e-58   Gossypium raimondii
gb|KJB07564.1|  hypothetical protein B456_001G032600                    202   3e-58   Gossypium raimondii
ref|XP_006845845.1|  PREDICTED: serine carboxypeptidase-like 25 i...    201   3e-58   Amborella trichopoda
ref|XP_011079399.1|  PREDICTED: serine carboxypeptidase 24              201   3e-58   Sesamum indicum [beniseed]
ref|XP_011623957.1|  PREDICTED: serine carboxypeptidase-like 25 i...    201   3e-58   
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    201   3e-58   Populus euphratica
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         201   3e-58   Nicotiana tomentosiformis
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    201   3e-58   Solanum tuberosum [potatoes]
ref|XP_002275684.1|  PREDICTED: serine carboxypeptidase 24 isofor...    201   4e-58   Vitis vinifera
ref|XP_010938508.1|  PREDICTED: serine carboxypeptidase II-3-like...    199   4e-58   
emb|CDP02317.1|  unnamed protein product                                201   5e-58   Coffea canephora [robusta coffee]
ref|XP_011018041.1|  PREDICTED: serine carboxypeptidase 24-like i...    198   5e-58   Populus euphratica
gb|KHN42831.1|  Serine carboxypeptidase 24                              200   5e-58   Glycine soja [wild soybean]
gb|KJB75608.1|  hypothetical protein B456_012G048700                    201   6e-58   Gossypium raimondii
ref|XP_009420309.1|  PREDICTED: serine carboxypeptidase 24-like         200   6e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012071521.1|  PREDICTED: serine carboxypeptidase 24 isofor...    200   6e-58   Jatropha curcas
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25         200   6e-58   Fragaria vesca subsp. vesca
ref|XP_007146042.1|  hypothetical protein PHAVU_006G007800g             201   7e-58   Phaseolus vulgaris [French bean]
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         200   7e-58   Nicotiana tomentosiformis
ref|XP_006845380.2|  PREDICTED: serine carboxypeptidase 24              200   7e-58   Amborella trichopoda
ref|XP_006453595.1|  hypothetical protein CICLE_v10008182mg             197   8e-58   
gb|ERN07055.1|  hypothetical protein AMTR_s00019p00043630               199   8e-58   Amborella trichopoda
ref|XP_009365880.1|  PREDICTED: serine carboxypeptidase-like 25         200   8e-58   Pyrus x bretschneideri [bai li]
gb|KEH21654.1|  serine carboxypeptidase-like protein                    200   1e-57   Medicago truncatula
ref|XP_003570294.1|  PREDICTED: serine carboxypeptidase 24              200   1e-57   Brachypodium distachyon [annual false brome]
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                199   1e-57   Gossypium arboreum [tree cotton]
ref|XP_008221066.1|  PREDICTED: serine carboxypeptidase-like 34         200   1e-57   Prunus mume [ume]
ref|XP_002452974.1|  hypothetical protein SORBIDRAFT_04g035810          200   1e-57   Sorghum bicolor [broomcorn]
ref|XP_007032749.1|  Serine carboxypeptidase-like 25 isoform 2          199   1e-57   
gb|KHN13554.1|  Serine carboxypeptidase-like 25                         199   1e-57   
gb|KFK37671.1|  hypothetical protein AALP_AA3G013500                    199   1e-57   
ref|XP_008357779.1|  PREDICTED: serine carboxypeptidase-like 25 i...    199   1e-57   
ref|XP_011033395.1|  PREDICTED: serine carboxypeptidase 24-like         199   1e-57   
ref|XP_008394313.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    199   2e-57   
ref|XP_010315500.1|  PREDICTED: serine carboxypeptidase II-3-like       199   2e-57   
gb|KHN35601.1|  Serine carboxypeptidase II-3                            199   2e-57   
ref|XP_006343642.1|  PREDICTED: serine carboxypeptidase 24-like         199   2e-57   
ref|XP_010938507.1|  PREDICTED: serine carboxypeptidase II-3-like...    199   2e-57   
ref|XP_008800209.1|  PREDICTED: serine carboxypeptidase II-3-like       199   2e-57   
ref|XP_011098746.1|  PREDICTED: serine carboxypeptidase-like 25         199   2e-57   
ref|XP_009358427.1|  PREDICTED: serine carboxypeptidase 24              199   2e-57   
ref|XP_007204505.1|  hypothetical protein PRUPE_ppa019210mg             198   2e-57   
ref|XP_002308408.1|  BRI1 SUPPRESSOR 1 family protein                   198   2e-57   
ref|XP_006578498.1|  PREDICTED: serine carboxypeptidase II-3-like       200   2e-57   
ref|XP_010938742.1|  PREDICTED: serine carboxypeptidase II-3-like       199   3e-57   
ref|XP_008673013.1|  PREDICTED: LOC100285510 isoform X1                 198   3e-57   
ref|XP_010112534.1|  Serine carboxypeptidase-like 34                    199   3e-57   
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          199   4e-57   
ref|XP_010906017.1|  PREDICTED: serine carboxypeptidase II-3-like       198   4e-57   
ref|XP_007216267.1|  hypothetical protein PRUPE_ppa017321mg             198   4e-57   
ref|XP_006408447.1|  hypothetical protein EUTSA_v10020652mg             198   4e-57   
ref|XP_008677402.1|  PREDICTED: lysosomal protective protein isof...    198   4e-57   
ref|NP_001152245.1|  lysosomal protective protein precursor             198   5e-57   
dbj|BAJ92218.1|  predicted protein                                      199   5e-57   
dbj|BAJ85578.1|  predicted protein                                      198   5e-57   
ref|NP_001140896.1|  hypothetical protein precursor                     191   5e-57   
emb|CBI29056.3|  unnamed protein product                                198   6e-57   
ref|XP_004954211.1|  PREDICTED: serine carboxypeptidase 24-like         198   6e-57   
ref|XP_008783277.1|  PREDICTED: serine carboxypeptidase II-3-like       198   6e-57   
ref|XP_010655923.1|  PREDICTED: serine carboxypeptidase-like 34         198   7e-57   
ref|XP_004146676.1|  PREDICTED: serine carboxypeptidase 24              197   7e-57   
ref|XP_007223035.1|  hypothetical protein PRUPE_ppa005368mg             197   7e-57   
ref|XP_011018040.1|  PREDICTED: serine carboxypeptidase 24-like i...    197   7e-57   
gb|KHG16869.1|  Serine carboxypeptidase-like 25                         197   7e-57   
ref|XP_006474013.1|  PREDICTED: serine carboxypeptidase 24-like         197   7e-57   
ref|XP_009351733.1|  PREDICTED: serine carboxypeptidase-like 34         197   7e-57   
ref|XP_008243007.1|  PREDICTED: serine carboxypeptidase 24              197   8e-57   
ref|XP_004489523.1|  PREDICTED: serine carboxypeptidase-like 25-like    197   8e-57   
ref|XP_010916829.1|  PREDICTED: serine carboxypeptidase II-3-like       197   1e-56   
ref|XP_008813040.1|  PREDICTED: serine carboxypeptidase II-3-like       197   1e-56   
gb|KDO72764.1|  hypothetical protein CISIN_1g011426mg                   194   1e-56   
ref|XP_008443849.1|  PREDICTED: serine carboxypeptidase 24-like i...    197   1e-56   
ref|XP_010108549.1|  Serine carboxypeptidase 24                         197   1e-56   
ref|XP_009794620.1|  PREDICTED: putative serine carboxypeptidase-...    197   1e-56   
gb|EPS67442.1|  hypothetical protein M569_07330                         195   1e-56   
ref|NP_001151874.1|  LOC100285510 precursor                             197   1e-56   
gb|ABR16997.1|  unknown                                                 198   1e-56   
gb|ABR16596.1|  unknown                                                 198   2e-56   
gb|KDO75846.1|  hypothetical protein CISIN_1g0117382mg                  192   2e-56   
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          196   2e-56   
ref|XP_011022036.1|  PREDICTED: serine carboxypeptidase-like 34         197   2e-56   
ref|XP_008365144.1|  PREDICTED: serine carboxypeptidase II-3-like       194   2e-56   
ref|XP_009413121.1|  PREDICTED: serine carboxypeptidase-like 34         196   2e-56   
ref|XP_008361910.1|  PREDICTED: serine carboxypeptidase-like 34         196   2e-56   
ref|XP_009399958.1|  PREDICTED: serine carboxypeptidase II-3-like       197   2e-56   
ref|XP_006453596.1|  hypothetical protein CICLE_v10008182mg             196   2e-56   
gb|KJB76570.1|  hypothetical protein B456_012G095000                    196   2e-56   
ref|XP_008783276.1|  PREDICTED: serine carboxypeptidase II-3-like       196   2e-56   
gb|KHN05312.1|  Serine carboxypeptidase II-3                            196   3e-56   
ref|XP_006593897.1|  PREDICTED: serine carboxypeptidase II-3-like       196   4e-56   
gb|KJB79850.1|  hypothetical protein B456_013G069700                    196   4e-56   
ref|XP_006345489.1|  PREDICTED: serine carboxypeptidase-like 40-like    195   4e-56   
ref|XP_006595329.1|  PREDICTED: serine carboxypeptidase II-3-like       196   4e-56   
ref|XP_006830191.1|  PREDICTED: serine carboxypeptidase II-3            196   4e-56   
gb|KHN05141.1|  Serine carboxypeptidase II-3                            196   4e-56   
gb|KEH32355.1|  serine carboxypeptidase-like protein                    196   5e-56   
ref|XP_010463602.1|  PREDICTED: serine carboxypeptidase-like 25         195   5e-56   
ref|XP_010548637.1|  PREDICTED: serine carboxypeptidase 24              195   5e-56   
gb|KJB07563.1|  hypothetical protein B456_001G032600                    196   6e-56   
gb|AAQ63884.1|  putative serine carboxypeptidase                        196   6e-56   
ref|XP_010047069.1|  PREDICTED: serine carboxypeptidase 24-like         195   7e-56   
ref|XP_010546240.1|  PREDICTED: serine carboxypeptidase-like 34 i...    195   7e-56   
ref|NP_001141117.1|  uncharacterized protein LOC100273202 precursor     191   7e-56   
ref|XP_003592239.1|  Serine carboxypeptidase-like protein               195   7e-56   
ref|XP_010546241.1|  PREDICTED: serine carboxypeptidase-like 34 i...    195   7e-56   
emb|CDY68103.1|  BnaCnng57600D                                          187   7e-56   
ref|XP_011083949.1|  PREDICTED: serine carboxypeptidase 24-like i...    194   7e-56   
ref|XP_002463311.1|  hypothetical protein SORBIDRAFT_02g041610          196   8e-56   
gb|AAK44013.1|AF370198_1  putative serine carboxypeptidase II           194   8e-56   
ref|XP_002282331.1|  PREDICTED: serine carboxypeptidase II-3-like       195   8e-56   
gb|ACL53740.1|  unknown                                                 191   8e-56   
ref|XP_003572740.1|  PREDICTED: serine carboxypeptidase-like 34         195   8e-56   
ref|XP_010549997.1|  PREDICTED: serine carboxypeptidase-like 25         194   9e-56   
ref|XP_008643436.1|  PREDICTED: hypothetical protein isoform X2         195   9e-56   
gb|ERN09430.1|  hypothetical protein AMTR_s00029p00064790               195   9e-56   
ref|XP_008643435.1|  PREDICTED: hypothetical protein isoform X1         195   1e-55   
ref|XP_012071699.1|  PREDICTED: serine carboxypeptidase II-3-like       195   1e-55   
ref|XP_010937832.1|  PREDICTED: serine carboxypeptidase-like 27         194   1e-55   
ref|XP_010445019.1|  PREDICTED: serine carboxypeptidase-like 25         194   1e-55   
ref|XP_002520355.1|  serine carboxypeptidase, putative                  196   1e-55   
ref|XP_010551814.1|  PREDICTED: serine carboxypeptidase-like 25 i...    194   1e-55   
ref|XP_010942075.1|  PREDICTED: serine carboxypeptidase 24 isofor...    194   1e-55   
ref|XP_006297594.1|  hypothetical protein CARUB_v10013616mg             194   1e-55   
ref|XP_004297735.1|  PREDICTED: serine carboxypeptidase-like 34         194   1e-55   
ref|XP_006431295.1|  hypothetical protein CICLE_v10011605mg             194   1e-55   
ref|XP_002306020.2|  serine carboxypeptidase S10 family protein         194   1e-55   
ref|XP_010551812.1|  PREDICTED: serine carboxypeptidase-like 25 i...    194   1e-55   
gb|EEC69980.1|  hypothetical protein OsI_00486                          194   2e-55   
dbj|BAJ94105.1|  predicted protein                                      195   2e-55   
ref|XP_008654562.1|  PREDICTED: uncharacterized protein LOC100273...    190   2e-55   
ref|NP_194790.1|  serine carboxypeptidase 24                            194   2e-55   
sp|P52711.1|CBP23_HORVU  RecName: Full=Serine carboxypeptidase II...    194   2e-55   
ref|NP_186860.1|  serine carboxypeptidase-like 25                       194   2e-55   
gb|KCW51319.1|  hypothetical protein EUGRSUZ_J00874                     192   2e-55   
ref|XP_003592243.1|  Serine carboxypeptidase II-3                       194   2e-55   
ref|XP_006482747.1|  PREDICTED: serine carboxypeptidase-like 25-l...    194   2e-55   
ref|XP_006392051.1|  hypothetical protein EUTSA_v10023439mg             193   2e-55   
gb|EMT05424.1|  Serine carboxypeptidase II-3                            194   2e-55   
ref|XP_006392050.1|  hypothetical protein EUTSA_v10023439mg             193   2e-55   
ref|XP_010323187.1|  PREDICTED: serine carboxypeptidase 24 isofor...    192   2e-55   
gb|AES71591.2|  serine carboxypeptidase-like protein                    194   2e-55   
ref|NP_191213.1|  alpha/beta-Hydrolases superfamily protein             188   2e-55   
ref|XP_002458719.1|  hypothetical protein SORBIDRAFT_03g038940          193   3e-55   
gb|KFK27639.1|  hypothetical protein AALP_AA8G409500                    194   3e-55   
gb|ABK24285.1|  unknown                                                 193   3e-55   
ref|NP_001044713.1|  Os01g0833500                                       193   3e-55   
gb|EAY76388.1|  hypothetical protein OsI_04319                          193   3e-55   
ref|XP_004970465.1|  PREDICTED: serine carboxypeptidase-like 27-like    193   3e-55   
ref|XP_009601275.1|  PREDICTED: serine carboxypeptidase-like 40         194   3e-55   
gb|AAM65698.1|  putative serine carboxypeptidase II                     193   3e-55   
ref|XP_007043281.1|  Serine carboxypeptidase-like 34 isoform 1          193   3e-55   
ref|XP_004502015.1|  PREDICTED: serine carboxypeptidase-like 40-like    193   4e-55   
ref|XP_009391583.1|  PREDICTED: serine carboxypeptidase II-3            193   4e-55   
ref|NP_001042076.1|  Os01g0158200                                       193   4e-55   
ref|XP_011624788.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    193   5e-55   
ref|XP_006662015.1|  PREDICTED: serine carboxypeptidase-like 34-like    192   6e-55   
ref|NP_001150705.1|  LOC100284338 precursor                             192   6e-55   
dbj|BAB08188.1|  unnamed protein product                                193   6e-55   
gb|KCW51318.1|  hypothetical protein EUGRSUZ_J00874                     192   6e-55   
ref|XP_008805039.1|  PREDICTED: serine carboxypeptidase-like 27         192   6e-55   
ref|XP_009619884.1|  PREDICTED: serine carboxypeptidase 24-like         193   6e-55   
ref|XP_003592237.1|  Serine carboxypeptidase II-3                       193   7e-55   
ref|XP_002869369.1|  hypothetical protein ARALYDRAFT_491690             192   7e-55   
ref|XP_009777002.1|  PREDICTED: serine carboxypeptidase-like 40         192   7e-55   
ref|XP_006354981.1|  PREDICTED: serine carboxypeptidase-like 34-like    192   7e-55   
ref|XP_002452495.1|  hypothetical protein SORBIDRAFT_04g026900          192   7e-55   
ref|XP_006449285.1|  hypothetical protein CICLE_v10015093mg             192   8e-55   
ref|XP_003592238.1|  Serine carboxypeptidase II-3                       192   8e-55   
ref|XP_006434836.1|  hypothetical protein CICLE_v10000968mg             192   9e-55   
ref|XP_010447693.1|  PREDICTED: serine carboxypeptidase 24-like         192   9e-55   
ref|XP_010485446.1|  PREDICTED: serine carboxypeptidase-like 25         192   9e-55   
ref|XP_006467848.1|  PREDICTED: serine carboxypeptidase-like 31-like    192   9e-55   
ref|XP_006412683.1|  hypothetical protein EUTSA_v10025119mg             190   9e-55   
gb|EEC73659.1|  hypothetical protein OsI_08191                          192   1e-54   
ref|NP_001047514.1|  Os02g0634700                                       192   1e-54   
ref|XP_010031922.1|  PREDICTED: serine carboxypeptidase-like 34         192   1e-54   
gb|KCW66184.1|  hypothetical protein EUGRSUZ_F00022                     192   1e-54   
ref|XP_010041326.1|  PREDICTED: serine carboxypeptidase II-3-like       192   1e-54   
ref|XP_003564543.1|  PREDICTED: serine carboxypeptidase-like 27         191   1e-54   
ref|XP_002884303.1|  hypothetical protein ARALYDRAFT_477440             192   1e-54   
ref|XP_006473369.1|  PREDICTED: serine carboxypeptidase II-3-like       192   1e-54   
gb|ACJ85847.1|  unknown                                                 187   1e-54   
ref|XP_007220730.1|  hypothetical protein PRUPE_ppa023387mg             186   1e-54   
ref|XP_006853074.2|  PREDICTED: serine carboxypeptidase II-3            191   1e-54   
ref|XP_004505704.1|  PREDICTED: serine carboxypeptidase-like 34-like    191   1e-54   
gb|EPS67928.1|  hypothetical protein M569_06845                         191   1e-54   
ref|XP_011090479.1|  PREDICTED: serine carboxypeptidase II-3-like       191   2e-54   
ref|XP_004242603.2|  PREDICTED: serine carboxypeptidase 24 isofor...    192   2e-54   
ref|XP_008461360.1|  PREDICTED: serine carboxypeptidase-like 34         191   2e-54   
ref|XP_010432963.1|  PREDICTED: serine carboxypeptidase 24 isofor...    191   2e-54   
ref|XP_006373364.1|  hypothetical protein POPTR_0017s12960g             192   2e-54   
ref|NP_001078615.1|  serine carboxypeptidase-like 34                    191   2e-54   
ref|XP_002876371.1|  predicted protein                                  192   2e-54   
ref|XP_004508115.1|  PREDICTED: serine carboxypeptidase-like 33-like    191   2e-54   
ref|XP_010458486.1|  PREDICTED: serine carboxypeptidase-like 31         191   2e-54   
ref|XP_009370170.1|  PREDICTED: serine carboxypeptidase II-3-like...    191   2e-54   
ref|XP_008654561.1|  PREDICTED: uncharacterized protein LOC100273...    191   2e-54   
ref|XP_004231499.1|  PREDICTED: serine carboxypeptidase-like 34         191   2e-54   
ref|XP_012084825.1|  PREDICTED: serine carboxypeptidase-like 25         191   2e-54   
gb|ACN29008.1|  unknown                                                 192   3e-54   
gb|KEH32356.1|  serine carboxypeptidase-like protein                    191   3e-54   
ref|XP_010533891.1|  PREDICTED: serine carboxypeptidase-like 31 i...    191   3e-54   
ref|XP_002876119.1|  predicted protein                                  191   3e-54   
ref|XP_009370169.1|  PREDICTED: serine carboxypeptidase II-3-like...    191   3e-54   
ref|XP_002316057.2|  serine carboxypeptidase S10 family protein         191   3e-54   
ref|XP_007035881.1|  Serine carboxypeptidase-like 33                    190   3e-54   
ref|XP_006287580.1|  hypothetical protein CARUB_v10000790mg             191   4e-54   
gb|AFW73854.1|  hypothetical protein ZEAMMB73_784908                    191   4e-54   
ref|XP_003542323.2|  PREDICTED: serine carboxypeptidase-like 40-l...    191   4e-54   
ref|XP_006484531.1|  PREDICTED: serine carboxypeptidase-like 34-like    191   4e-54   
ref|XP_006437593.1|  hypothetical protein CICLE_v10031313mg             191   4e-54   
gb|ACF79757.1|  unknown                                                 190   5e-54   
ref|NP_001147904.1|  serine carboxypeptidase 1 precursor                191   5e-54   
ref|XP_008652806.1|  PREDICTED: serine carboxypeptidase II-3-like       190   5e-54   
dbj|BAK02399.1|  predicted protein                                      190   5e-54   
gb|ACG38162.1|  serine carboxypeptidase K10B2.2 precursor               190   5e-54   
ref|XP_008654560.1|  PREDICTED: uncharacterized protein LOC100273...    190   5e-54   
ref|XP_009801012.1|  PREDICTED: serine carboxypeptidase II-3-like       190   5e-54   
ref|NP_851062.2|  serine carboxypeptidase-like 34                       191   6e-54   
ref|XP_004959517.1|  PREDICTED: serine carboxypeptidase II-3-like       191   6e-54   
ref|XP_006346531.1|  PREDICTED: serine carboxypeptidase II-3-like       189   6e-54   
ref|XP_002983919.1|  serine carboxypeptidase-like enzyme                189   6e-54   
ref|XP_003592240.1|  Serine carboxypeptidase-like protein               190   7e-54   
ref|XP_002872043.1|  SCPL34                                             190   7e-54   
ref|XP_002960751.1|  serine carboxypeptidase-like enzyme                189   7e-54   
ref|XP_009400122.1|  PREDICTED: serine carboxypeptidase II-3-like       190   7e-54   
gb|ABF70080.1|  serine carboxypeptidase (carboxypeptidase D), put...    190   7e-54   
gb|ERN14540.1|  hypothetical protein AMTR_s00038p00085900               190   7e-54   
ref|XP_008461353.1|  PREDICTED: serine carboxypeptidase-like 40         191   7e-54   
ref|XP_002462502.1|  hypothetical protein SORBIDRAFT_02g026860          190   7e-54   
ref|XP_008802653.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    190   8e-54   
ref|XP_008809533.1|  PREDICTED: putative serine carboxypeptidase-...    193   8e-54   
gb|EMT20722.1|  Serine carboxypeptidase II-3                            190   8e-54   
ref|XP_007224802.1|  hypothetical protein PRUPE_ppa023729mg             190   8e-54   
gb|ACU18095.1|  unknown                                                 183   8e-54   
ref|XP_006657371.1|  PREDICTED: serine carboxypeptidase-like 34-like    189   9e-54   
ref|XP_004135953.1|  PREDICTED: serine carboxypeptidase-like 34         189   1e-53   
ref|XP_006412682.1|  hypothetical protein EUTSA_v10025119mg             189   1e-53   
emb|CBI19568.3|  unnamed protein product                                195   1e-53   
ref|XP_009130122.1|  PREDICTED: serine carboxypeptidase-like 34         190   1e-53   
gb|KHN03262.1|  Serine carboxypeptidase-like 33                         189   1e-53   
gb|KEH30582.1|  serine carboxypeptidase-like protein                    189   1e-53   
ref|XP_006303173.1|  hypothetical protein CARUB_v10008980mg             188   1e-53   
ref|XP_004137284.1|  PREDICTED: serine carboxypeptidase-like 25 i...    189   1e-53   
ref|XP_002457307.1|  hypothetical protein SORBIDRAFT_03g005360          189   1e-53   
ref|XP_003550568.2|  PREDICTED: serine carboxypeptidase-like 33-like    189   1e-53   
ref|XP_010231680.1|  PREDICTED: serine carboxypeptidase-like 33         189   1e-53   
ref|XP_003607259.1|  Serine carboxypeptidase-like protein               189   1e-53   
dbj|BAK01526.1|  predicted protein                                      190   1e-53   



>ref|XP_009630744.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana tomentosiformis]
Length=470

 Score =   281 bits (719),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 154/183 (84%), Gaps = 2/183 (1%)
 Frame = +2

Query  53   MSALSWGCLLFVLLLATSIDGGKG--SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  226
            MS L WG L+F L   T +  G    +S+V Q++LD V  LPG GFNV+F +Y+GYVTVN
Sbjct  1    MSNLKWGFLVFALFFITEVHLGSCFVNSNVVQKQLDKVTKLPGQGFNVNFENYAGYVTVN  60

Query  227  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  406
            +ES RALFYWFFEAV+DPSSKPLVLWLNGGPGCSSIA+GLAEE+GPFH+EKDGKTLYWNP
Sbjct  61   EESERALFYWFFEAVDDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHIEKDGKTLYWNP  120

Query  407  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREF  586
            YSWNLAANLLF+DSP GVGYSYSNTSSD L +GD RTA DSL FLLKW ERFP+ KGR+F
Sbjct  121  YSWNLAANLLFLDSPVGVGYSYSNTSSDHLNNGDARTAADSLAFLLKWLERFPEYKGRDF  180

Query  587  YIT  595
            YIT
Sbjct  181  YIT  183



>ref|XP_009789305.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana sylvestris]
Length=470

 Score =   279 bits (713),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 153/183 (84%), Gaps = 2/183 (1%)
 Frame = +2

Query  53   MSALSWGCLLFVLLLATSIDGGKG--SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  226
            MS L WG L+F L   T +  G     S+V Q++LD V  LPG GFNV+F +Y+GYVTVN
Sbjct  1    MSNLKWGFLVFALFFITEVHLGSCFVDSNVVQKQLDKVSKLPGQGFNVNFENYAGYVTVN  60

Query  227  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  406
            +ES RALFYWFFEAV++PSSKPLVLWLNGGPGCSSIA+GLAEE+GPFH+EKDGKTLYWNP
Sbjct  61   EESERALFYWFFEAVDEPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHIEKDGKTLYWNP  120

Query  407  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREF  586
            YSWNLAANLLF+DSP GVGYSYSNTSSD L +GD RTA DSL FLLKW ERFP+ KGR+F
Sbjct  121  YSWNLAANLLFLDSPVGVGYSYSNTSSDHLNNGDARTAADSLAFLLKWLERFPEYKGRDF  180

Query  587  YIT  595
            YIT
Sbjct  181  YIT  183



>ref|XP_004242620.1| PREDICTED: serine carboxypeptidase II-2 [Solanum lycopersicum]
Length=465

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = +2

Query  80   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  259
            +FV+L   SI G    +   Q++LD V  LPG GFNV+FAHYSGYVTVN++S RALFYWF
Sbjct  7    VFVVLGLFSISGSFSVNPNAQKQLDRVSKLPGQGFNVNFAHYSGYVTVNEDSERALFYWF  66

Query  260  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  439
            FEAV+DPSSKPLVLWLNGGPGCSSIAFGLAEE+GPFH+EKDGKTLYWNPYSWNLAAN+LF
Sbjct  67   FEAVDDPSSKPLVLWLNGGPGCSSIAFGLAEEIGPFHIEKDGKTLYWNPYSWNLAANVLF  126

Query  440  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +DSP GVGYSYSNTSSD L +GD RTA DSL FLLKW ERFP+ KGR+FYI+
Sbjct  127  LDSPVGVGYSYSNTSSDHLNNGDARTAADSLVFLLKWLERFPEYKGRDFYIS  178



>ref|XP_006343604.1| PREDICTED: serine carboxypeptidase II-2-like [Solanum tuberosum]
Length=465

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = +2

Query  80   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  259
            +FV+L    I G    +   Q+ LD V  LPG GFNV+FAHYSGYVTVN+ES RALFYWF
Sbjct  7    VFVVLGLFFISGSFSVTPNAQKLLDRVSKLPGQGFNVNFAHYSGYVTVNEESERALFYWF  66

Query  260  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  439
            FEAV+DPSSKPLVLWLNGGPGCSSIAFGLAEE+GPFH+EKDGKTLYWNPYSWNLAAN+LF
Sbjct  67   FEAVDDPSSKPLVLWLNGGPGCSSIAFGLAEELGPFHIEKDGKTLYWNPYSWNLAANVLF  126

Query  440  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +DSP GVGYSYSNTSSD L +GD RTA DSL FLLKW ERFP+ KGREFYI+
Sbjct  127  LDSPVGVGYSYSNTSSDHLNNGDTRTAADSLVFLLKWLERFPEYKGREFYIS  178



>ref|XP_002528403.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF33996.1| serine carboxypeptidase, putative [Ricinus communis]
Length=480

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 148/187 (79%), Gaps = 5/187 (3%)
 Frame = +2

Query  50   EMSALSWGCLLFVLL-----LATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGY  214
            EM  L     +F+L      +  S+     +  V QQ LD VL+LPG  FN+SFAHYSGY
Sbjct  7    EMGLLQLFITIFLLFSVNLYVGASVFESTLTDPVAQQGLDRVLELPGQTFNISFAHYSGY  66

Query  215  VTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTL  394
            VTVNQESGR LFYWF EAVEDP SKPL+LWLNGGPGCSSIA+G AEE+GPFH+++DGKTL
Sbjct  67   VTVNQESGRNLFYWFMEAVEDPDSKPLILWLNGGPGCSSIAYGEAEEIGPFHIQRDGKTL  126

Query  395  YWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKK  574
            Y NPYSWN  ANLLFVDSP GVG+SYSNTSSD+L +GDKRTA DSL FLLKWFERFP+ K
Sbjct  127  YLNPYSWNQVANLLFVDSPVGVGFSYSNTSSDLLNNGDKRTAADSLAFLLKWFERFPQFK  186

Query  575  GREFYIT  595
            GR+FYIT
Sbjct  187  GRDFYIT  193



>gb|EYU34325.1| hypothetical protein MIMGU_mgv1a005646mg [Erythranthe guttata]
Length=476

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 155/189 (82%), Gaps = 8/189 (4%)
 Frame = +2

Query  53   MSALSWGCLLFVLLLATS---IDGGKG-----SSSVDQQKLDAVLDLPGLGFNVSFAHYS  208
            MS  +W   L +++L +    I  G G     +SS +QQ+LD V  LPG  FNVSFAHYS
Sbjct  1    MSTFNWVFNLVLVILISELHLISCGAGLSSSKNSSYEQQQLDRVSKLPGQSFNVSFAHYS  60

Query  209  GYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGK  388
            GY TVN+ESGRALFYWFFEA  DPSSKP+VLWLNGGPGCSS+AFGLAEE+GPFH+EKDGK
Sbjct  61   GYATVNKESGRALFYWFFEAEVDPSSKPIVLWLNGGPGCSSVAFGLAEEIGPFHIEKDGK  120

Query  389  TLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPK  568
            ++Y NPYSWN AAN+LF+DSPAGVG+SYSNTSSD+ T+GDKRTA ++LEFLL+WF+RFP+
Sbjct  121  SIYLNPYSWNKAANILFLDSPAGVGFSYSNTSSDLFTNGDKRTAAENLEFLLQWFKRFPQ  180

Query  569  KKGREFYIT  595
             KG +FYIT
Sbjct  181  YKGNDFYIT  189



>ref|XP_006453576.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66816.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=352

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 144/174 (83%), Gaps = 6/174 (3%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFY
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  254  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
            WF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSWN  AN+
Sbjct  72   WFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWNQVANI  131

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            LF+DSP GVG+SYSNTSSDI T+GDKRTAEDSL+FLLKW ERF + KGR+FYI+
Sbjct  132  LFLDSPVGVGFSYSNTSSDITTNGDKRTAEDSLKFLLKWLERFSQFKGRDFYIS  185



>ref|XP_010531651.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=204

 Score =   256 bits (655),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 145/174 (83%), Gaps = 2/174 (1%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
             L+F  LLA +  G    SS  +Q+ D V  LPG GFNVSFAHYSGYVTV+++SGRALFY
Sbjct  12   ALIFFTLLANAHLGNCALSS--RQEQDRVSKLPGQGFNVSFAHYSGYVTVHEKSGRALFY  69

Query  254  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
            WFFEAVEDP SKPL+LWLNGGPGCSSI +GLAEE+GPFH++ DGKTLY NPYSWN  AN+
Sbjct  70   WFFEAVEDPDSKPLLLWLNGGPGCSSIGYGLAEEIGPFHIKPDGKTLYLNPYSWNQVANV  129

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            LF+D P GVG+SYSNTSSD+LT+GDKRTA+DSL+FLLKW +RFPK K R+FYI 
Sbjct  130  LFLDMPVGVGFSYSNTSSDLLTNGDKRTAQDSLKFLLKWLDRFPKYKERDFYIA  183



>ref|XP_011079368.1| PREDICTED: serine carboxypeptidase II-2 [Sesamum indicum]
Length=474

 Score =   265 bits (677),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 151/186 (81%), Gaps = 5/186 (3%)
 Frame = +2

Query  53   MSALSWGCLLFVLLLATSID--GGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYV  217
            M+ L+W   L +++    +     + S S D   QQ LD VL LPG  FNVSFAHY+GYV
Sbjct  1    MTTLNWVFNLSLIICVAKLHFISCRASFSPDPPNQQLLDRVLKLPGQNFNVSFAHYAGYV  60

Query  218  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  397
            TVN+ESGRALFYWFFEA EDPSSKPLVLWLNGGPGCSSIA+GLAEE+GPFHVEKDGKTLY
Sbjct  61   TVNKESGRALFYWFFEADEDPSSKPLVLWLNGGPGCSSIAYGLAEEIGPFHVEKDGKTLY  120

Query  398  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKG  577
             NPYSWN  AN+LF+DSP GVG+SYSNTSSD L +GDKRTA D+LEFLL+WFERFP+ +G
Sbjct  121  LNPYSWNKVANILFLDSPVGVGFSYSNTSSDSLNNGDKRTATDNLEFLLQWFERFPQYRG  180

Query  578  REFYIT  595
             +FYIT
Sbjct  181  SDFYIT  186



>ref|XP_008243035.1| PREDICTED: serine carboxypeptidase II-2 [Prunus mume]
Length=473

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 151/186 (81%), Gaps = 5/186 (3%)
 Frame = +2

Query  53   MSALSWGCLL--FVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYV  217
            M   SW  +L  F++LL     S+     + ++ QQKLD VL+LPG  FN+SFAHY+GY 
Sbjct  1    MVKPSWAFVLTYFIILLNLHLGSVFATIPTDALAQQKLDKVLELPGQTFNLSFAHYAGYA  60

Query  218  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  397
            TVN++SGRALFYW  EA EDP SKP+VLWLNGGPGCSSIA+G AEEVGPFH++ DGKTLY
Sbjct  61   TVNEDSGRALFYWLVEAAEDPGSKPIVLWLNGGPGCSSIAYGEAEEVGPFHIKADGKTLY  120

Query  398  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKG  577
             NPYSWN  AN+LF+DSP GVG+SYSNTSSD+L++GDKRTAEDSL FLLKWFERFP+ KG
Sbjct  121  LNPYSWNQVANILFLDSPVGVGFSYSNTSSDLLSNGDKRTAEDSLAFLLKWFERFPQYKG  180

Query  578  REFYIT  595
            REFYIT
Sbjct  181  REFYIT  186



>ref|XP_007202013.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
 gb|EMJ03212.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
Length=473

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 151/186 (81%), Gaps = 5/186 (3%)
 Frame = +2

Query  53   MSALSWGCLL--FVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYV  217
            M   SW  +L  F++LL     S+     + ++ QQKLD VL+LPG  FN+SFAHY+GY 
Sbjct  1    MVKPSWAFVLTYFIILLNLHLGSVFATIPTDALAQQKLDKVLELPGQTFNLSFAHYAGYA  60

Query  218  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  397
            TVN++SGRALFYW  EA EDP SKP+VLWLNGGPGCSSIA+G AEEVGPFH++ DGKTLY
Sbjct  61   TVNEDSGRALFYWLVEAAEDPGSKPIVLWLNGGPGCSSIAYGEAEEVGPFHIKADGKTLY  120

Query  398  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKG  577
             NPYSWN  AN+LF+DSP GVG+SYSNTSSD+L++GDKRTAEDSL FLLKWFERFP+ KG
Sbjct  121  LNPYSWNQVANILFLDSPVGVGFSYSNTSSDLLSNGDKRTAEDSLAFLLKWFERFPQYKG  180

Query  578  REFYIT  595
            REFYIT
Sbjct  181  REFYIT  186



>ref|XP_002275081.1| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
 emb|CBI36573.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   263 bits (671),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 148/182 (81%), Gaps = 1/182 (1%)
 Frame = +2

Query  53   MSALSWGCLLFVLLLATSIDGGKGSSS-VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  229
            M +L W  +L +L     ++    SS  + QQ+LD V  LPG  FN+SFAHYSGYVTVN+
Sbjct  1    MLSLKWVFVLQILFTLIYLNTPASSSDPLVQQRLDKVQHLPGQAFNISFAHYSGYVTVNE  60

Query  230  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  409
             SGRALFYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPY
Sbjct  61   NSGRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPY  120

Query  410  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFY  589
            SWN  AN+LF+DSP GVG+SYSNTSSD+ T+GD RTA+DSL FLLKWFERFP+ KGR+FY
Sbjct  121  SWNQVANILFLDSPVGVGFSYSNTSSDVSTNGDIRTAKDSLAFLLKWFERFPQYKGRDFY  180

Query  590  IT  595
            IT
Sbjct  181  IT  182



>ref|XP_006453577.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66817.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=474

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 144/174 (83%), Gaps = 6/174 (3%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFY
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  254  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
            WF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSWN  AN+
Sbjct  72   WFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWNQVANI  131

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            LF+DSP GVG+SYSNTSSDI T+GDKRTAEDSL+FLLKW ERF + KGR+FYI+
Sbjct  132  LFLDSPVGVGFSYSNTSSDITTNGDKRTAEDSLKFLLKWLERFSQFKGRDFYIS  185



>gb|KDO62275.1| hypothetical protein CISIN_1g0418332mg, partial [Citrus sinensis]
Length=320

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +2

Query  134  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  313
            V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFYWF EAVEDP SKPLVLWLNG
Sbjct  67   VAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFYWFVEAVEDPDSKPLVLWLNG  126

Query  314  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  493
            GPGCSSIA+G AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSP GVG+SYSNTSSDI
Sbjct  127  GPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPVGVGFSYSNTSSDI  186

Query  494  LTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
             T+GDKRTAEDSL+FLLKW ERF + KGR+FYI+
Sbjct  187  TTNGDKRTAEDSLKFLLKWLERFSQFKGRDFYIS  220



>ref|XP_009358402.1| PREDICTED: serine carboxypeptidase II-2 [Pyrus x bretschneideri]
Length=482

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 145/175 (83%), Gaps = 1/175 (1%)
 Frame = +2

Query  74   CLLFVLLLAT-SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  250
            CL+ +L L   S+     ++   QQKLD V +LPG  FN+SFAH+SGYV VN+E+GRALF
Sbjct  12   CLIILLNLHLGSVFSAPPANPFAQQKLDRVAELPGQSFNLSFAHFSGYVPVNEETGRALF  71

Query  251  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  430
            YWF EA EDP SKP+VLWLNGGPGCSSIA+G+AEE+GPFH+E DGKTLY NPYSWN  AN
Sbjct  72   YWFVEAAEDPHSKPIVLWLNGGPGCSSIAYGMAEEIGPFHIEADGKTLYLNPYSWNQVAN  131

Query  431  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +LF DSP GVG+SYSNTSSD+L++GDKRTA DSL FLLKWFERFP+ KGR+FYIT
Sbjct  132  VLFFDSPVGVGFSYSNTSSDLLSNGDKRTANDSLTFLLKWFERFPQYKGRDFYIT  186



>ref|XP_006453578.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66818.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=491

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 144/174 (83%), Gaps = 6/174 (3%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFY
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  254  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
            WF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSWN  AN+
Sbjct  72   WFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWNQVANI  131

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            LF+DSP GVG+SYSNTSSDI T+GDKRTAEDSL+FLLKW ERF + KGR+FYI+
Sbjct  132  LFLDSPVGVGFSYSNTSSDITTNGDKRTAEDSLKFLLKWLERFSQFKGRDFYIS  185



>ref|XP_010526302.1| PREDICTED: serine carboxypeptidase-like 29 [Tarenaya hassleriana]
Length=489

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 145/173 (84%), Gaps = 3/173 (2%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
             L+F+ LLA   +   G   + +Q+ D V  LPG  FNV+F HYSG+VTVN++ GRALFY
Sbjct  17   ALIFLTLLA---NAHLGICVLSRQQQDKVSKLPGQDFNVNFEHYSGFVTVNEKLGRALFY  73

Query  254  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
            WFFEAVEDP SKPLVLWLNGGPGCSSIAFGLAEE+GPFH++ DGKTLY NPYSWN  AN+
Sbjct  74   WFFEAVEDPDSKPLVLWLNGGPGCSSIAFGLAEEIGPFHIKPDGKTLYLNPYSWNQVANV  133

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            LF+D+P GVGYSYSNTSSD+LT+GDKRTA+DSL+FLLKW ERFPK KGREFYI
Sbjct  134  LFLDAPVGVGYSYSNTSSDLLTNGDKRTAQDSLKFLLKWLERFPKYKGREFYI  186



>ref|XP_012071557.1| PREDICTED: serine carboxypeptidase II-2-like [Jatropha curcas]
 gb|KDP38717.1| hypothetical protein JCGZ_04070 [Jatropha curcas]
Length=478

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  140  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  319
            QQ+LD V +LPG  FNVSFAHYSGYVTVN+ESGRALFYWF EAVEDP+SKPLVLWLNGGP
Sbjct  40   QQELDRVWELPGQNFNVSFAHYSGYVTVNEESGRALFYWFIEAVEDPASKPLVLWLNGGP  99

Query  320  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  499
            GCSSI FG AEE+GPFH+  DGKTLY NPYSWN  AN+LF+DSP GVG+SYSNTSSD++ 
Sbjct  100  GCSSIGFGEAEEIGPFHIHADGKTLYLNPYSWNQVANILFIDSPVGVGFSYSNTSSDLVN  159

Query  500  HGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +GDKRTA DSL FLLKW ERFP+ KGR+FYIT
Sbjct  160  NGDKRTAADSLIFLLKWVERFPQYKGRDFYIT  191



>emb|CDP02851.1| unnamed protein product [Coffea canephora]
Length=472

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 150/187 (80%), Gaps = 8/187 (4%)
 Frame = +2

Query  53   MSALSWGCLLFVLLLATSIDGGKGSS---SVD---QQKLDAVLDLPGLGFNVSFAHYSGY  214
            M+ L+W  +L +L+    ID    SS   S D   QQ+LD VL LPG  FNVSFAHY+G+
Sbjct  1    MATLNW--VLVILISTLLIDLTNCSSCGFSADPYAQQQLDRVLHLPGQNFNVSFAHYAGF  58

Query  215  VTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTL  394
            VTVN+E+GR LFYWFFEA EDP+SKPLVLWLNGGPGCSSIA+G+AEE+GPFHVEKDGK L
Sbjct  59   VTVNEEAGRTLFYWFFEAAEDPASKPLVLWLNGGPGCSSIAYGVAEEIGPFHVEKDGKHL  118

Query  395  YWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKK  574
            Y NPYSWN AAN+LF+DSP GVGYSYSNT SD L +GD RTA DS  FLLKWF+RFP+ K
Sbjct  119  YLNPYSWNQAANMLFLDSPVGVGYSYSNTPSDHLNNGDLRTAADSHAFLLKWFDRFPQYK  178

Query  575  GREFYIT  595
            GR+FYI+
Sbjct  179  GRDFYIS  185



>ref|XP_010273729.1| PREDICTED: serine carboxypeptidase II-2 [Nelumbo nucifera]
Length=485

 Score =   259 bits (661),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  140  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  319
            QQ+LD VL+LPG  FNVSFAHY+GYVTVN+ SGRALFYWFFEAVEDPSSKPLVLWLNGGP
Sbjct  48   QQQLDRVLELPGQTFNVSFAHYAGYVTVNEASGRALFYWFFEAVEDPSSKPLVLWLNGGP  107

Query  320  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  499
            GCSSIA+G AEE+GPFH++ DGKTLY N YSWN  AN+LF++SP GVG+SYSN S D+L 
Sbjct  108  GCSSIAYGEAEEIGPFHIKADGKTLYLNQYSWNQVANVLFLESPVGVGFSYSNNSLDVLN  167

Query  500  HGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +GDKRTAEDSL FLLKWFERFP+ KGR+FYIT
Sbjct  168  NGDKRTAEDSLMFLLKWFERFPQYKGRDFYIT  199



>emb|CBI36578.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 151/182 (83%), Gaps = 3/182 (2%)
 Frame = +2

Query  59   ALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  229
            ALS   +  V +L T I+  + +SS D   QQ+LD VL LPG  FN+SFAHY+GYVTVN+
Sbjct  2    ALSPKWVFVVQILLTLINLNRATSSSDPLVQQELDKVLQLPGQTFNISFAHYAGYVTVNE  61

Query  230  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  409
             +GRALFYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPY
Sbjct  62   YTGRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPY  121

Query  410  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFY  589
            SWN AAN+LF+D P GVG+SYSN+S DI ++GD RTA+DSL+FLL+WFERFP+ KGR+FY
Sbjct  122  SWNQAANILFLDFPVGVGFSYSNSSFDISSNGDLRTAKDSLKFLLEWFERFPQYKGRDFY  181

Query  590  IT  595
            IT
Sbjct  182  IT  183



>ref|XP_006474032.1| PREDICTED: serine carboxypeptidase-like 29-like [Citrus sinensis]
Length=474

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  304
            +  V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFYWF EAVEDP SKPLVLW
Sbjct  29   TDPVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFYWFVEAVEDPDSKPLVLW  88

Query  305  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  484
            LNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSP GVG+SYSNTS
Sbjct  89   LNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPVGVGFSYSNTS  148

Query  485  SDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            SDI T+GDKRTAEDSL+FLLKW ERF + KGR+FYI+
Sbjct  149  SDITTNGDKRTAEDSLKFLLKWLERFSQFKGRDFYIS  185



>ref|XP_002273324.2| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
Length=510

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 151/182 (83%), Gaps = 3/182 (2%)
 Frame = +2

Query  59   ALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  229
            ALS   +  V +L T I+  + +SS D   QQ+LD VL LPG  FN+SFAHY+GYVTVN+
Sbjct  42   ALSPKWVFVVQILLTLINLNRATSSSDPLVQQELDKVLQLPGQTFNISFAHYAGYVTVNE  101

Query  230  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  409
             +GRALFYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPY
Sbjct  102  YTGRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPY  161

Query  410  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFY  589
            SWN AAN+LF+D P GVG+SYSN+S DI ++GD RTA+DSL+FLL+WFERFP+ KGR+FY
Sbjct  162  SWNQAANILFLDFPVGVGFSYSNSSFDISSNGDLRTAKDSLKFLLEWFERFPQYKGRDFY  221

Query  590  IT  595
            IT
Sbjct  222  IT  223



>ref|XP_008394291.1| PREDICTED: serine carboxypeptidase II-2 [Malus domestica]
Length=482

 Score =   258 bits (659),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 147/186 (79%), Gaps = 5/186 (3%)
 Frame = +2

Query  53   MSALSWGCLLFVLLLATSIDGGKGSSS-----VDQQKLDAVLDLPGLGFNVSFAHYSGYV  217
            M+   W   L VL++  ++  G   S+     + QQ LD V  LPG  FN+SFAH+SGYV
Sbjct  1    MAKPRWDSALKVLIILLNLHLGSVFSAPPADPIAQQNLDRVAXLPGQSFNLSFAHFSGYV  60

Query  218  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  397
             VN++SGRALFYWF EA EDP SKP+VLWLNGGPGCSSIA+G+AEE+GPFH+E DGKTLY
Sbjct  61   PVNEDSGRALFYWFVEAAEDPHSKPVVLWLNGGPGCSSIAYGMAEEIGPFHIEADGKTLY  120

Query  398  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKG  577
             NPYSWN  AN+LF DSP GVG+SYSNTSSD+L++GDKRTA DSL FLL+WFERFP+ KG
Sbjct  121  LNPYSWNQVANVLFFDSPVGVGFSYSNTSSDLLSNGDKRTANDSLTFLLQWFERFPQYKG  180

Query  578  REFYIT  595
            R+FYIT
Sbjct  181  RDFYIT  186



>ref|XP_002324520.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF03085.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=470

 Score =   257 bits (657),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +2

Query  134  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  313
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALFYWF EAVEDP SKPL+LWLNG
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDPQSKPLLLWLNG  97

Query  314  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  493
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSP GVGYSYSNTSSD+
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPVGVGYSYSNTSSDL  157

Query  494  LTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            L +GDK+TA DSL FLL WFERFP+ KGR+FYIT
Sbjct  158  LNNGDKKTAADSLAFLLNWFERFPQYKGRDFYIT  191



>ref|XP_002324616.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
 gb|EEF03181.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
Length=466

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +2

Query  134  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  313
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALFYWF EAVEDP SKPL+LWLNG
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDPQSKPLLLWLNG  97

Query  314  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  493
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSP GVGYSYSNTSSD+
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPVGVGYSYSNTSSDL  157

Query  494  LTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            L +GDK+TA DSL FLL WFERFP+ KGR+FYIT
Sbjct  158  LNNGDKKTAADSLAFLLNWFERFPQYKGRDFYIT  191



>ref|XP_011018072.1| PREDICTED: serine carboxypeptidase-like 29 isoform X2 [Populus 
euphratica]
Length=410

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +2

Query  134  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  313
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALFYWF EAVEDP SKPL+L LNG
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDPQSKPLLLRLNG  97

Query  314  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  493
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSPAGVGYSYSNTSSD+
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPAGVGYSYSNTSSDL  157

Query  494  LTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            L +GDK+TA DSL FLL WFERFP+ KGR+FYIT
Sbjct  158  LNNGDKKTAADSLAFLLNWFERFPQYKGRDFYIT  191



>ref|XP_008790133.1| PREDICTED: serine carboxypeptidase II-2 isoform X2 [Phoenix dactylifera]
Length=441

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 145/172 (84%), Gaps = 3/172 (2%)
 Frame = +2

Query  80   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  259
            L   + +  +DGG   S  + Q+ D VL LPG  FNVSFAHY+GYVTVN++SGRALFYWF
Sbjct  17   LLFFVFSADVDGG---SPFECQERDRVLHLPGQSFNVSFAHYAGYVTVNEDSGRALFYWF  73

Query  260  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  439
            FEAVEDP+SKPLVLWLNGGPGCSSIA+GLAEE+GPFHV  +GK+LY NPYSWN AAN+LF
Sbjct  74   FEAVEDPASKPLVLWLNGGPGCSSIAYGLAEELGPFHVNANGKSLYLNPYSWNQAANILF  133

Query  440  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +DSP GVG+SYSN S D+L++GD+RTA+DSL FL KWFERFP+ KG++FY+T
Sbjct  134  LDSPVGVGFSYSNNSQDVLSNGDERTAKDSLVFLKKWFERFPQYKGQDFYLT  185



>ref|XP_009410194.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +2

Query  122  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVL  301
            G+S+ ++Q+ D VL LPG  FNVSFAHYSGYVTV+ + GRALFYWFFEAVEDP+SKPLVL
Sbjct  28   GASAFERQEKDRVLRLPGQSFNVSFAHYSGYVTVDDDPGRALFYWFFEAVEDPASKPLVL  87

Query  302  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  481
            WLNGGPGCSSIA+GLAEE+GPFH+  DGK+LY NPY+WN  AN+LF+DSP GVG+SYSN 
Sbjct  88   WLNGGPGCSSIAYGLAEELGPFHINADGKSLYLNPYTWNQVANILFLDSPVGVGFSYSNN  147

Query  482  SSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            S D+LT+GDKRTA+DSL FL KWF+RFP+ KGREFYIT
Sbjct  148  SQDVLTNGDKRTAKDSLTFLKKWFKRFPQYKGREFYIT  185



>ref|XP_004287151.1| PREDICTED: serine carboxypeptidase II-2 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 145/176 (82%), Gaps = 5/176 (3%)
 Frame = +2

Query  83   FVLLLATSIDGGKGSSSVD-----QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  247
            FVL+   ++  G   ++V      QQ+LD V  LPG  FNVSFAHY+GYV VN+++GRAL
Sbjct  8    FVLIFLLNLHLGSVFATVPTDPLVQQQLDRVHGLPGQTFNVSFAHYAGYVNVNEDAGRAL  67

Query  248  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  427
            FYWF EA EDP+SKPLVLWLNGGPGCSSIA+G+AEEVGPFH++ DGKTLY NPYSWN  A
Sbjct  68   FYWFVEAAEDPTSKPLVLWLNGGPGCSSIAYGMAEEVGPFHIQADGKTLYLNPYSWNQVA  127

Query  428  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            N+LF+DSP GVG+SYSNTSSD++++GDKRTA DSL FLLKW ER+P+ KGR+FYIT
Sbjct  128  NILFLDSPVGVGFSYSNTSSDLMSNGDKRTASDSLAFLLKWLERYPQYKGRDFYIT  183



>ref|XP_010040844.1| PREDICTED: serine carboxypeptidase II-2-like [Eucalyptus grandis]
 gb|KCW44872.1| hypothetical protein EUGRSUZ_L01547 [Eucalyptus grandis]
Length=473

 Score =   256 bits (653),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 134/152 (88%), Gaps = 1/152 (1%)
 Frame = +2

Query  140  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  319
            QQ+LD VL+LPG  FN+SF HYSGY TVN+ESGR+LFYWF EA EDP SKPLVLWLNGGP
Sbjct  36   QQELDRVLELPGQSFNISFPHYSGYATVNEESGRSLFYWFTEAAEDPDSKPLVLWLNGGP  95

Query  320  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  499
            GCSSIA+G+AEE+GPFH+  D  +LY NPYSWNL ANLLF+DSP GVG+SYSNTSSD+L 
Sbjct  96   GCSSIAYGMAEEIGPFHIRPD-MSLYLNPYSWNLVANLLFIDSPVGVGFSYSNTSSDLLN  154

Query  500  HGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +GDKRTAEDSL FLLKWFERFP+ KGREFYIT
Sbjct  155  NGDKRTAEDSLAFLLKWFERFPQFKGREFYIT  186



>ref|XP_010048771.1| PREDICTED: serine carboxypeptidase II-2 [Eucalyptus grandis]
 gb|KCW81143.1| hypothetical protein EUGRSUZ_C02514 [Eucalyptus grandis]
Length=473

 Score =   255 bits (652),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 134/152 (88%), Gaps = 1/152 (1%)
 Frame = +2

Query  140  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  319
            QQ+LD VL+LPG  FN+SF HYSGY TVN+ESGR+LFYWF EA EDP SKPLVLWLNGGP
Sbjct  36   QQELDRVLELPGQSFNISFPHYSGYATVNEESGRSLFYWFTEAAEDPDSKPLVLWLNGGP  95

Query  320  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  499
            GCSSIA+G+AEE+GPFH+  D  +LY NPYSWNL ANLLF+DSP GVG+SYSNTSSD+L 
Sbjct  96   GCSSIAYGMAEEIGPFHIRPD-MSLYLNPYSWNLVANLLFIDSPVGVGFSYSNTSSDLLN  154

Query  500  HGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +GDKRTAEDSL FLLKWFERFP+ KGREFYIT
Sbjct  155  NGDKRTAEDSLAFLLKWFERFPQFKGREFYIT  186



>ref|XP_008790132.1| PREDICTED: serine carboxypeptidase II-2 isoform X1 [Phoenix dactylifera]
Length=473

 Score =   255 bits (652),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 145/172 (84%), Gaps = 3/172 (2%)
 Frame = +2

Query  80   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  259
            L   + +  +DGG   S  + Q+ D VL LPG  FNVSFAHY+GYVTVN++SGRALFYWF
Sbjct  17   LLFFVFSADVDGG---SPFECQERDRVLHLPGQSFNVSFAHYAGYVTVNEDSGRALFYWF  73

Query  260  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  439
            FEAVEDP+SKPLVLWLNGGPGCSSIA+GLAEE+GPFHV  +GK+LY NPYSWN AAN+LF
Sbjct  74   FEAVEDPASKPLVLWLNGGPGCSSIAYGLAEELGPFHVNANGKSLYLNPYSWNQAANILF  133

Query  440  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +DSP GVG+SYSN S D+L++GD+RTA+DSL FL KWFERFP+ KG++FY+T
Sbjct  134  LDSPVGVGFSYSNNSQDVLSNGDERTAKDSLVFLKKWFERFPQYKGQDFYLT  185



>gb|KFK29659.1| hypothetical protein AALP_AA7G162000 [Arabis alpina]
Length=478

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 145/181 (80%), Gaps = 1/181 (1%)
 Frame = +2

Query  53   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  232
            M+     CL  + +LA +       + + Q++ D V  LPG  FNVSFAHYSGYVT N++
Sbjct  1    MAKTRGSCLFAITILAIA-HFCNCEAVLSQKEQDKVSTLPGQDFNVSFAHYSGYVTTNEK  59

Query  233  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  412
             GRALFYWFFEAVED +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YS
Sbjct  60   LGRALFYWFFEAVEDANSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQYS  119

Query  413  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            WN AAN+LF+D+P GVGYSYSNTSSD+L++GDKRTA+DSL+FLLKW ERFP+ KGREFYI
Sbjct  120  WNQAANILFLDAPVGVGYSYSNTSSDLLSNGDKRTAQDSLKFLLKWVERFPEYKGREFYI  179

Query  593  T  595
             
Sbjct  180  V  180



>ref|XP_011018071.1| PREDICTED: serine carboxypeptidase II-2-like isoform X1 [Populus 
euphratica]
Length=478

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +2

Query  134  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  313
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALFYWF EAVEDP SKPL+L LNG
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDPQSKPLLLRLNG  97

Query  314  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  493
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSPAGVGYSYSNTSSD+
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPAGVGYSYSNTSSDL  157

Query  494  LTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            L +GDK+TA DSL FLL WFERFP+ KGR+FYIT
Sbjct  158  LNNGDKKTAADSLAFLLNWFERFPQYKGRDFYIT  191



>gb|KJB76660.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=407

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 137/170 (81%), Gaps = 0/170 (0%)
 Frame = +2

Query  83   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFF  262
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALFYWFF
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNEHSGRALFYWFF  78

Query  263  EAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFV  442
            EA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NPYSWN  AN+LF+
Sbjct  79   EAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNPYSWNQVANILFL  138

Query  443  DSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            +SP GVG+SYSNTSSD+L +GDKRTA+DSL FLLKW ERFP+ K R+FYI
Sbjct  139  ESPVGVGFSYSNTSSDLLNNGDKRTAKDSLTFLLKWLERFPQYKERDFYI  188



>ref|XP_009395827.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 144/175 (82%), Gaps = 4/175 (2%)
 Frame = +2

Query  71   GCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  250
            G   F+L+LA+S++    +S  +QQ  + VL LPG  F+VSFAHYSGYVTVN+E+GRA F
Sbjct  17   GPFFFLLVLASSLE----ASVFEQQARERVLRLPGQSFDVSFAHYSGYVTVNEEAGRAFF  72

Query  251  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  430
            YWFFEA E+P+SKPLVLWLNGGPGCSSI  GLAEEVGPFHV  DGK+LY NPYSWN  AN
Sbjct  73   YWFFEATEEPASKPLVLWLNGGPGCSSIGLGLAEEVGPFHVNADGKSLYPNPYSWNQVAN  132

Query  431  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +LF+DSP G G++YSN S D+LT+GDKRTA+D+L FL +WF+RFP+ KGR+FYIT
Sbjct  133  ILFLDSPVGAGFAYSNNSQDVLTNGDKRTAKDNLTFLKRWFKRFPQYKGRDFYIT  187



>ref|XP_004144720.1| PREDICTED: serine carboxypeptidase II-2 [Cucumis sativus]
Length=468

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  140  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  319
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALFYWFFEA ED +SKPLVLWLNGGP
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNGGP  91

Query  320  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  499
            GCSSIA+G AEE+GPFH+  DGK +Y NPYSWN  AN+LF+DSPAGVG+SYSNTSSD++ 
Sbjct  92   GCSSIAYGEAEEIGPFHINADGKPVYLNPYSWNEVANVLFLDSPAGVGFSYSNTSSDLMN  151

Query  500  HGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +GDKRTAEDSL FLLKWFERFP+ KGR+FYIT
Sbjct  152  NGDKRTAEDSLAFLLKWFERFPQFKGRDFYIT  183



>ref|XP_006845388.1| PREDICTED: serine carboxypeptidase II-2 [Amborella trichopoda]
 gb|ERN07063.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
Length=473

 Score =   252 bits (644),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 145/182 (80%), Gaps = 12/182 (7%)
 Frame = +2

Query  74   CLLFVLLLATSI--------DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  229
            CLLF++ L   +        D  +G+S V+    D VL LPG  F+VSFAHYSGYVTVN+
Sbjct  7    CLLFLIHLHIFLQVKGTIVEDEDRGASQVN----DRVLKLPGQAFDVSFAHYSGYVTVNK  62

Query  230  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  409
            E+GRALFYWFFEAV+DPSSKPLV+WLNGGPGCSSIA+G AEE+GPFH+  DGKTLY NP 
Sbjct  63   EAGRALFYWFFEAVDDPSSKPLVVWLNGGPGCSSIAYGEAEEIGPFHIRPDGKTLYLNPD  122

Query  410  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFY  589
            SWN  ANLLFVDSP GVG+SYSNTS DI+++GDKRTAEDSL FL  W +RFP+ KGR+FY
Sbjct  123  SWNQVANLLFVDSPVGVGFSYSNTSEDIISNGDKRTAEDSLAFLHNWLKRFPQYKGRDFY  182

Query  590  IT  595
            +T
Sbjct  183  LT  184



>ref|XP_008452541.1| PREDICTED: serine carboxypeptidase II-2 [Cucumis melo]
Length=468

 Score =   252 bits (643),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  140  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  319
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALFYWFFEA ED +SKPLVLWLNGGP
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNGGP  91

Query  320  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  499
            GCSSIAFG AEE+GPFH+  DGK++Y NPYSWN  AN+LF+DSPAGVG+SYSNTSSD++ 
Sbjct  92   GCSSIAFGEAEEIGPFHINADGKSVYLNPYSWNEVANVLFLDSPAGVGFSYSNTSSDLMN  151

Query  500  HGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +GDKRTAEDSL FLLKWFERFP+ KG +FYIT
Sbjct  152  NGDKRTAEDSLAFLLKWFERFPQFKGSDFYIT  183



>ref|XP_006387151.1| hypothetical protein POPTR_1689s00200g [Populus trichocarpa]
 gb|ERP46065.1| hypothetical protein POPTR_1689s00200g [Populus trichocarpa]
Length=324

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 133/160 (83%), Gaps = 6/160 (4%)
 Frame = +2

Query  134  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  313
            V QQ LD V  LPG  F+V+FAHYSGYVTVN++ GRALFYW  EAVEDP SKPL+LWLNG
Sbjct  38   VAQQHLDRVQKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWLVEAVEDPQSKPLLLWLNG  97

Query  314  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN------LAANLLFVDSPAGVGYSYS  475
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSWN        AN+LF+DSP GVGYSYS
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWNQYFNQFAVANILFLDSPVGVGYSYS  157

Query  476  NTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            NTSSD+L +GDK+TA DSL FLL WFERFP+ KGR+FYIT
Sbjct  158  NTSSDLLNNGDKKTAADSLAFLLNWFERFPQYKGRDFYIT  197



>gb|KGN61064.1| hypothetical protein Csa_2G036620 [Cucumis sativus]
Length=542

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  140  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  319
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALFYWFFEA ED +SKPLVLWLNGGP
Sbjct  106  QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNGGP  165

Query  320  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  499
            GCSSIA+G AEE+GPFH+  DGK +Y NPYSWN  AN+LF+DSPAGVG+SYSNTSSD++ 
Sbjct  166  GCSSIAYGEAEEIGPFHINADGKPVYLNPYSWNEVANVLFLDSPAGVGFSYSNTSSDLMN  225

Query  500  HGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +GDKRTAEDSL FLLKWFERFP+ KGR+FYIT
Sbjct  226  NGDKRTAEDSLAFLLKWFERFPQFKGRDFYIT  257



>gb|KJB76659.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=487

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 137/170 (81%), Gaps = 0/170 (0%)
 Frame = +2

Query  83   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFF  262
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALFYWFF
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNEHSGRALFYWFF  78

Query  263  EAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFV  442
            EA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NPYSWN  AN+LF+
Sbjct  79   EAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNPYSWNQVANILFL  138

Query  443  DSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            +SP GVG+SYSNTSSD+L +GDKRTA+DSL FLLKW ERFP+ K R+FYI
Sbjct  139  ESPVGVGFSYSNTSSDLLNNGDKRTAKDSLTFLLKWLERFPQYKERDFYI  188



>ref|XP_007013884.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
 gb|EOY31503.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
Length=476

 Score =   250 bits (638),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 139/168 (83%), Gaps = 5/168 (3%)
 Frame = +2

Query  92   LLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAV  271
            ++ATS++      SV QQKLD V  LPG  FNVSFAHY+GYVTVN+ SGRALFYWFFEA 
Sbjct  27   VIATSLE-----DSVAQQKLDKVPKLPGQNFNVSFAHYAGYVTVNEGSGRALFYWFFEAA  81

Query  272  EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSP  451
            EDP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPYSWN  ANLLF++SP
Sbjct  82   EDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTLYLNPYSWNKVANLLFLESP  141

Query  452  AGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
             GVG+SYSNTS D+L +GDKRTA+DSL FLLKW ERFP+ K R+FYI 
Sbjct  142  IGVGFSYSNTSFDLLNNGDKRTAKDSLAFLLKWLERFPQYKERDFYIA  189



>ref|XP_006286217.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
 gb|EOA19115.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
Length=479

 Score =   249 bits (637),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 141/174 (81%), Gaps = 2/174 (1%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
             L+ + LLAT+    +   S  +Q  D V  LPG  FNVSFAHYSG++T N++ GRALFY
Sbjct  12   ALIAIALLATTAHLCEAGLSRKEQ--DKVSKLPGQNFNVSFAHYSGFITTNEKLGRALFY  69

Query  254  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
            WFFEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+
Sbjct  70   WFFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANI  129

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            LF+D+P GVGYSYSNTSSD+ T+GDKRTA+DSL+FLLKW ERFP+ KGR+FYI 
Sbjct  130  LFLDAPVGVGYSYSNTSSDLQTNGDKRTAQDSLKFLLKWVERFPEYKGRDFYIV  183



>ref|XP_010905043.1| PREDICTED: serine carboxypeptidase II-2 [Elaeis guineensis]
Length=471

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  119  KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLV  298
             G S   +Q+ D V  LPG  FNVSFAHY+GYVTVN++SGRALFYWFFEAVEDP SKPLV
Sbjct  25   NGGSPFVRQEGDRVQRLPGQSFNVSFAHYAGYVTVNEDSGRALFYWFFEAVEDPVSKPLV  84

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSSIA+GLAEEVGPFHV  DG++LY NPYSWN  AN+LF+DSP GVG+SYSN
Sbjct  85   LWLNGGPGCSSIAYGLAEEVGPFHVNADGQSLYLNPYSWNQVANILFLDSPVGVGFSYSN  144

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
             S D+L++GD+RTA+DSL FL KWFERFP+ KG++FY+T
Sbjct  145  NSQDVLSNGDERTAKDSLIFLKKWFERFPQYKGQDFYLT  183



>gb|AFK34623.1| unknown [Lotus japonicus]
Length=174

 Score =   239 bits (609),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 133/166 (80%), Gaps = 3/166 (2%)
 Frame = +2

Query  77   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  247
            +L + ++AT    I+    S    QQ  D V  LPG  FN SFAHYSGY+TVN ++GRAL
Sbjct  9    ILAIAIVATLFLCINFATSSDPFVQQHHDKVGRLPGQNFNTSFAHYSGYITVNDKAGRAL  68

Query  248  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  427
            FYWF EA +DP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPY+WN  A
Sbjct  69   FYWFMEADQDPQSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYAWNQVA  128

Query  428  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFP  565
            N+LFVD+PAGVG+SYSNTSSD+L HGD++TAEDSL FLLKWFERFP
Sbjct  129  NILFVDAPAGVGFSYSNTSSDLLNHGDRKTAEDSLIFLLKWFERFP  174



>ref|XP_010687643.1| PREDICTED: serine carboxypeptidase II-2 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = +2

Query  89   LLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA  268
            L L T       S  + QQK+D V  LPG  F+V+F HYSGY+TVN+E GRALFYWF EA
Sbjct  22   LQLGTCSSSSSSSDPITQQKIDRVNYLPGQNFDVAFTHYSGYITVNEEFGRALFYWFIEA  81

Query  269  VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDS  448
            VEDPSSKPL+LWLNGGPGCSSIAFG AEE+GPFH++KDGKTLY NP SWN  AN++F+D+
Sbjct  82   VEDPSSKPLLLWLNGGPGCSSIAFGEAEELGPFHIQKDGKTLYLNPNSWNKVANVIFLDA  141

Query  449  PAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            P GVG+SYSNT+SD+LT+GD RTA+DSL+FL+ WFERFP+ KGRE YI+
Sbjct  142  PVGVGFSYSNTTSDLLTNGDNRTAQDSLKFLVGWFERFPEYKGRELYIS  190



>gb|KHG11306.1| Serine carboxypeptidase-like 29 [Gossypium arboreum]
Length=487

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 136/170 (80%), Gaps = 0/170 (0%)
 Frame = +2

Query  83   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFF  262
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALFYWFF
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNKHSGRALFYWFF  78

Query  263  EAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFV  442
            EA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NPYSWN   N+LF+
Sbjct  79   EAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNPYSWNQVVNILFL  138

Query  443  DSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            +SP GVG+SYSNTSSD+L +GDKRTA+DSL FLLKW ERFP+ K R+FYI
Sbjct  139  ESPVGVGFSYSNTSSDLLNNGDKRTAKDSLTFLLKWLERFPQYKERDFYI  188



>ref|XP_002869361.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45620.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   247 bits (631),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 141/183 (77%), Gaps = 2/183 (1%)
 Frame = +2

Query  53   MSALSWGCLLFVLLLATSI--DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  226
            M+     C L   L+A +         + + Q++ D V  LPG  FNVSFAHYSG+VT N
Sbjct  1    MAKTRGSCCLVNALIAIAFLATAHLCEAGLSQKEQDKVSKLPGQNFNVSFAHYSGFVTTN  60

Query  227  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  406
            ++ GRALFYW FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N 
Sbjct  61   EKLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQ  120

Query  407  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREF  586
            YSWN AAN+LF+D+P GVGYSYSNTSSD+ T+GDKRTAEDSL+FLLKW ERFP+ KGR+F
Sbjct  121  YSWNQAANILFLDAPVGVGYSYSNTSSDLKTNGDKRTAEDSLKFLLKWVERFPEYKGRDF  180

Query  587  YIT  595
            YI 
Sbjct  181  YIV  183



>ref|XP_010432944.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=480

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 140/174 (80%), Gaps = 3/174 (2%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
             L+ +  LAT+     G S   Q++ D V  LPG  FNVSFAHYSG+VT N++ GRALFY
Sbjct  14   ALIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQDFNVSFAHYSGFVTTNEKLGRALFY  70

Query  254  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
            W FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+
Sbjct  71   WLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQYSWNQAANI  130

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            LF+D+P GVGYSYSNTSSD+ T+GDKRTA+DSL+FLLKW ERFP+ KGR+FYI 
Sbjct  131  LFLDAPVGVGYSYSNTSSDLQTNGDKRTAQDSLKFLLKWVERFPEYKGRDFYIV  184



>ref|XP_009127491.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=480

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 141/179 (79%), Gaps = 2/179 (1%)
 Frame = +2

Query  59   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  238
            A +  C ++ +++   +   +   S   Q  D V +LPG  FNV+FAHYSG+VT N++ G
Sbjct  16   AKTRSCFVYAIIVIAHLCNCEAVLSEKDQ--DKVWNLPGQNFNVNFAHYSGFVTTNEKMG  73

Query  239  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  418
            RALFYW FEA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N +SWN
Sbjct  74   RALFYWLFEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQHSWN  133

Query  419  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
             AAN+LF+D+P GVGYSYSNTSSD+LT+GDKRTA+DSL FLLKW ER+P+ KGREFYI 
Sbjct  134  QAANILFLDAPVGVGYSYSNTSSDLLTNGDKRTAQDSLTFLLKWVERYPEYKGREFYIV  192



>ref|XP_010447670.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=479

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +2

Query  134  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  313
            + Q++ D V  LPG  FNVSFAHYSG+VT N++ GRALFYW FEAVED  SKPLVLWLNG
Sbjct  30   LSQKEQDKVSKLPGQDFNVSFAHYSGFVTTNEKLGRALFYWLFEAVEDAKSKPLVLWLNG  89

Query  314  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  493
            GPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+LF+D+P GVGYSYSNTSSD+
Sbjct  90   GPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANILFLDAPVGVGYSYSNTSSDL  149

Query  494  LTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
             T+GDKRTA+DSL+FLLKW ERFP+ KGR+FYI 
Sbjct  150  QTNGDKRTAQDSLKFLLKWVERFPEYKGRDFYIV  183



>emb|CDY28217.1| BnaA01g06320D [Brassica napus]
Length=468

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 141/181 (78%), Gaps = 2/181 (1%)
 Frame = +2

Query  53   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  232
            M+     C ++ +L    +   +  + + Q++ D V  LPG  FNV+FAHYSG+VT N++
Sbjct  1    MAKTRRSCFVYAILAIAHLCNCE--AILSQKEQDKVSQLPGQNFNVNFAHYSGFVTTNEK  58

Query  233  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  412
             GRALFYW FEA EDP+ KPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N +S
Sbjct  59   MGRALFYWLFEAAEDPAYKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQHS  118

Query  413  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            WN AAN+LF+D+P GVGYSYSNTSSD+LT+GDKRTA+DSL FLLKW ER+P+ KGREFYI
Sbjct  119  WNQAANILFLDAPVGVGYSYSNTSSDLLTNGDKRTAQDSLTFLLKWVERYPEYKGREFYI  178

Query  593  T  595
             
Sbjct  179  V  179



>gb|EPS71160.1| hypothetical protein M569_03591, partial [Genlisea aurea]
Length=441

 Score =   244 bits (622),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = +2

Query  137  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  316
            +QQ+LD V  LPG  F+V+FA Y+GYVTVN+ESGRA FYWFFEA EDPSSKPL+LWLNGG
Sbjct  6    NQQELDRVSKLPGQNFDVNFASYAGYVTVNEESGRAYFYWFFEADEDPSSKPLLLWLNGG  65

Query  317  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  496
            PGCSSIA+GLAEEVGPFH+EKDGKTLY N +SWN  AN+LFVDSP GVG+SYSNTSSD+L
Sbjct  66   PGCSSIAYGLAEEVGPFHIEKDGKTLYLNQFSWNKVANVLFVDSPVGVGFSYSNTSSDLL  125

Query  497  THGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
             +GDKRTA ++LEFLL WF RFP+ K R+F+I+
Sbjct  126  NNGDKRTASENLEFLLGWFNRFPQYKERDFFIS  158



>emb|CAN75200.1| hypothetical protein VITISV_014887 [Vitis vinifera]
Length=524

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 147/210 (70%), Gaps = 29/210 (14%)
 Frame = +2

Query  53   MSALSWGCLLFVLLLATSIDGGKGSSS-VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  229
            M +L W  +L +L     ++    SS  + QQ+LD V  LPG  FN+SFAHYSGYVTVN+
Sbjct  1    MLSLKWVFVLQILFTLIYLNTPASSSDPLVQQRLDKVQHLPGQAFNISFAHYSGYVTVNE  60

Query  230  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  409
             SGRALFYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPY
Sbjct  61   NSGRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPY  120

Query  410  SWN----------------------------LAANLLFVDSPAGVGYSYSNTSSDILTHG  505
            SWN                              AN+LF+DSP GVG+SYSNTSSD+ T+G
Sbjct  121  SWNQDIDLQVKVYMFRRNNDVRFSIAERISITIANILFLDSPVGVGFSYSNTSSDVSTNG  180

Query  506  DKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            D RTA+DSL FLLKW ERFP+ KGR+FYIT
Sbjct  181  DIRTAKDSLAFLLKWLERFPQYKGRDFYIT  210



>ref|XP_009127511.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=481

 Score =   244 bits (624),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 140/184 (76%), Gaps = 3/184 (2%)
 Frame = +2

Query  53   MSALSWGCL---LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTV  223
            M+   W C    LF + +          S + +++ + V  LPG  FNV+FAHYSG+VT 
Sbjct  1    MAKTRWSCFVNALFAIAVLAIAHFSNCESVLSEKEQNKVSKLPGQNFNVNFAHYSGFVTT  60

Query  224  NQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  403
            N++ GRALFYW  EA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N
Sbjct  61   NEKLGRALFYWLIEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKPDGKTLYLN  120

Query  404  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGRE  583
             YSWN AAN+LF+D+P GVG+SYSNTSSD+LT+GDKRTA+DSL FLLKW ER+P+ KGRE
Sbjct  121  QYSWNQAANILFLDAPVGVGFSYSNTSSDLLTNGDKRTAQDSLTFLLKWVERYPEYKGRE  180

Query  584  FYIT  595
            FYI 
Sbjct  181  FYIV  184



>ref|XP_010438130.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=498

 Score =   245 bits (625),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 140/174 (80%), Gaps = 3/174 (2%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
             L+ +  LAT+     G S   Q++ D V  LPG  F+VSFAHYSG+VT N++ GRALFY
Sbjct  32   ALIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQNFDVSFAHYSGFVTTNEKLGRALFY  88

Query  254  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
            W FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+
Sbjct  89   WLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANI  148

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            LF+D+P GVGYSYSNTSSD+ T+GDKRTA+DSL+FLLKW ERFP+ KGR+FYI 
Sbjct  149  LFLDAPVGVGYSYSNTSSDLQTNGDKRTAQDSLKFLLKWVERFPEYKGRDFYIV  202



>emb|CDY23258.1| BnaA08g12880D [Brassica napus]
Length=478

 Score =   244 bits (624),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 138/174 (79%), Gaps = 0/174 (0%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
            C + V+ L          + + Q++ D V  LPG  FNV FAHYSG+VT N++ GRALFY
Sbjct  9    CFVVVVALLAITHLCICEALLSQKEQDKVTKLPGQNFNVDFAHYSGFVTTNEKLGRALFY  68

Query  254  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
            WFFEA +D +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+
Sbjct  69   WFFEATDDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANI  128

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            LF+D+P GVGYSYSNTSSD+ ++GDKRTA+DSL+FLLKW ER+P+ KGREFYI 
Sbjct  129  LFLDAPVGVGYSYSNTSSDLRSNGDKRTAQDSLKFLLKWVERYPEYKGREFYIV  182



>emb|CAA18212.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
 emb|CAB79799.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
Length=425

 Score =   243 bits (620),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 139/173 (80%), Gaps = 3/173 (2%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
            L+ +  LAT+     G S   Q++ D V  LPG  FNVSFAHYSG+V  N++ GRALFYW
Sbjct  14   LIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQNFNVSFAHYSGFVATNEQLGRALFYW  70

Query  257  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  436
             FEAVED  SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N YSWN AAN+L
Sbjct  71   LFEAVEDAKSKPLVLWLNGGPGCSSVAYGEAEEIGPFHIKADGKTLYLNQYSWNQAANIL  130

Query  437  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            F+D+P GVGYSYSNTSSD+ ++GDKRTAEDSL+FLLKW ERFP+ KGR+FYI 
Sbjct  131  FLDAPVGVGYSYSNTSSDLKSNGDKRTAEDSLKFLLKWVERFPEYKGRDFYIV  183



>emb|CDX68696.1| BnaC01g07570D [Brassica napus]
Length=504

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = +2

Query  134  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  313
            + Q++ D V  LPG  FNV+FAHYSG+VT N++ GRALFYW FEA EDP+SKPLVLWLNG
Sbjct  63   LSQKEQDKVSQLPGQNFNVNFAHYSGFVTTNEKMGRALFYWLFEAAEDPASKPLVLWLNG  122

Query  314  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  493
            GPGCSS+ FG AEE+GPFH++ DGKTLY N +SWN AAN+LF+D+P GVGYSYSNTSSD 
Sbjct  123  GPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQHSWNQAANILFLDAPVGVGYSYSNTSSDF  182

Query  494  LTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            LT+GDKRTA+DSL FLLKW ER+P+ KGREFYI 
Sbjct  183  LTNGDKRTAQDSLTFLLKWVERYPEYKGREFYIV  216



>ref|XP_003564183.1| PREDICTED: serine carboxypeptidase II-2 [Brachypodium distachyon]
Length=474

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 145/184 (79%), Gaps = 3/184 (2%)
 Frame = +2

Query  53   MSALSWGCLLFVL-LLATS-IDGGKGSSS-VDQQKLDAVLDLPGLGFNVSFAHYSGYVTV  223
            MS  S   +L VL LLA S     +GSSS   +Q+ D V  +PG GFN SFAHY+GYVTV
Sbjct  1    MSGASRCAVLAVLFLLAVSGAAAAEGSSSWRGEQERDRVPRVPGQGFNASFAHYAGYVTV  60

Query  224  NQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  403
            ++E G ALFYWFFEA  +P+SKPLVLWLNGGPGCSSIAFGL EEVGPFH+  DGK ++ N
Sbjct  61   SEERGAALFYWFFEAAHEPASKPLVLWLNGGPGCSSIAFGLGEEVGPFHINADGKGVHMN  120

Query  404  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGRE  583
            PYSWN  AN+LF+DSP GVGYSYSNTS DIL++GD++TA+DSL FL KW ERFP+ KGRE
Sbjct  121  PYSWNRVANILFLDSPVGVGYSYSNTSGDILSNGDEKTAKDSLVFLTKWLERFPQYKGRE  180

Query  584  FYIT  595
            FY+T
Sbjct  181  FYLT  184



>ref|NP_567854.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
 sp|Q949Q7.1|SCP29_ARATH RecName: Full=Serine carboxypeptidase-like 29; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK93635.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM91708.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEE85811.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
Length=479

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 140/183 (77%), Gaps = 2/183 (1%)
 Frame = +2

Query  53   MSALSWGCLLFVLLLATSI--DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  226
            M+     C L   L+A +         + + Q++ D V  LPG  FNVSFAHYSG+V  N
Sbjct  1    MAKTRGSCCLVNALIAIAFLATAHLCEAGLSQKEQDKVSKLPGQNFNVSFAHYSGFVATN  60

Query  227  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  406
            ++ GRALFYW FEAVED  SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N 
Sbjct  61   EQLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAYGEAEEIGPFHIKADGKTLYLNQ  120

Query  407  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREF  586
            YSWN AAN+LF+D+P GVGYSYSNTSSD+ ++GDKRTAEDSL+FLLKW ERFP+ KGR+F
Sbjct  121  YSWNQAANILFLDAPVGVGYSYSNTSSDLKSNGDKRTAEDSLKFLLKWVERFPEYKGRDF  180

Query  587  YIT  595
            YI 
Sbjct  181  YIV  183



>ref|XP_009108967.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=477

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 140/174 (80%), Gaps = 1/174 (1%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
            C + V LLA +      ++ + Q++ D V  LPG  FNV F HYSG+VT N++ GRALFY
Sbjct  9    CFVVVALLAIT-HLCICAALLSQKEQDKVSKLPGQNFNVDFTHYSGFVTTNEKLGRALFY  67

Query  254  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
            WFFEA +D +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+
Sbjct  68   WFFEATDDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANI  127

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            LF+D+P GVGYSYSNTSSD+ ++GDKRTA+DSL+FLLKW ER+P+ KGREFYI 
Sbjct  128  LFLDAPVGVGYSYSNTSSDLRSNGDKRTAQDSLKFLLKWVERYPEYKGREFYIV  181



>ref|XP_010111113.1| Serine carboxypeptidase-like 29 [Morus notabilis]
 gb|EXC30159.1| Serine carboxypeptidase-like 29 [Morus notabilis]
Length=495

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 133/170 (78%), Gaps = 19/170 (11%)
 Frame = +2

Query  140  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG-  316
            QQ+LD V  LPG  F VSF HYSGYV VN+ESGRALFYWFFEA EDP+SKP+VLWLNGG 
Sbjct  38   QQRLDRVEKLPGQNFIVSFEHYSGYVRVNEESGRALFYWFFEAAEDPASKPIVLWLNGGL  97

Query  317  ------------------PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFV  442
                              PGCSSIA+G AEE+GPFH++ D KTLY NPYSWN  AN+LF+
Sbjct  98   PALLVFHLLCLVTMKSLGPGCSSIAYGEAEEIGPFHIKPDAKTLYLNPYSWNQVANILFI  157

Query  443  DSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            DSP GVG+SYSN SSD+L++GDKRTA+D+LEFLLKWFERFP+ KGREFYI
Sbjct  158  DSPVGVGFSYSNASSDLLSNGDKRTAKDNLEFLLKWFERFPQYKGREFYI  207



>emb|CDY28216.1| BnaA01g06330D [Brassica napus]
Length=481

 Score =   242 bits (618),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  128  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWL  307
            S + +++ D V  LPG  FNV+FAHYSG+VT N++ GRALFYW  EA EDP+SKPLVLWL
Sbjct  29   SVLSEKEQDKVSKLPGQNFNVNFAHYSGFVTTNEKLGRALFYWLIEAAEDPASKPLVLWL  88

Query  308  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  487
            NGGPGCSS+ FG AEE+GPFH++ DGKTLY N YSWN AAN+LF+D+P GVG+SYSNTSS
Sbjct  89   NGGPGCSSVGFGEAEEIGPFHIKPDGKTLYLNQYSWNQAANILFLDAPVGVGFSYSNTSS  148

Query  488  DILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            D+LT+GDKRTA+DSL FLLKW ER+P+ KGREFYI 
Sbjct  149  DLLTNGDKRTAQDSLTFLLKWVERYPEYKGREFYIV  184



>emb|CDY55623.1| BnaC03g77560D [Brassica napus]
Length=477

 Score =   242 bits (617),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 140/174 (80%), Gaps = 1/174 (1%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
            C + V LLA +       + + Q++ D V  LPG  FNV FAHYSG+VT N++ GRALFY
Sbjct  9    CFVVVALLAIT-HLCICEALLSQKEQDKVTKLPGQNFNVDFAHYSGFVTTNEKLGRALFY  67

Query  254  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
            WFFEA +D +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+
Sbjct  68   WFFEAADDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANI  127

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            LF+D+P GVGYSYSNTS+D+ ++GDKRTA+DSL+FLLKW ER+P+ KGR+FYI 
Sbjct  128  LFLDAPVGVGYSYSNTSTDLRSNGDKRTAQDSLKFLLKWVERYPEYKGRDFYIV  181



>ref|XP_006412667.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
 gb|ESQ54120.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
Length=480

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  134  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  313
            + Q+  D V  LPG  FNV FAHYSG+VT N++ GRALFYW FEA ED  SKPLVLWLNG
Sbjct  31   LSQKAQDKVSILPGQNFNVDFAHYSGFVTTNEKLGRALFYWLFEATEDAESKPLVLWLNG  90

Query  314  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  493
            GPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+LF+D+P GVGYSYSNTSSD+
Sbjct  91   GPGCSSVAFGEAEEIGPFHIKADGKTLYLNQYSWNQAANILFLDAPVGVGYSYSNTSSDL  150

Query  494  LTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
             ++GDKRTA+DSL+FLLKW ER+P+ KGREFYI 
Sbjct  151  RSNGDKRTAQDSLKFLLKWVERYPEYKGREFYIV  184



>ref|XP_009137969.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=476

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 139/181 (77%), Gaps = 1/181 (1%)
 Frame = +2

Query  53   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  232
            M+   W C    LL+       +  + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWFCFAIALLVIARFCNCE-EAVLSQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  233  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  412
             GRALFYWFFEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N YS
Sbjct  60   LGRALFYWFFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQYS  119

Query  413  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            WN  AN+LF+D+P GVGYSYSNTSSD+LT+GD+RTA+DSL+FLLKW E +P+ KGREFYI
Sbjct  120  WNQVANILFLDAPVGVGYSYSNTSSDLLTNGDQRTAKDSLKFLLKWVELYPEYKGREFYI  179

Query  593  T  595
             
Sbjct  180  A  180



>emb|CDY13387.1| BnaA03g51050D [Brassica napus]
Length=476

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 139/181 (77%), Gaps = 1/181 (1%)
 Frame = +2

Query  53   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  232
            M+   W C    LL+       +  + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWFCFAIALLVIARFCNCE-EAVLSQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  233  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  412
             GRALFYWFFEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N YS
Sbjct  60   LGRALFYWFFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQYS  119

Query  413  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            WN  AN+LF+D+P GVGYSYSNTSSD+LT+GD+RTA+DSL+FLLKW E +P+ KGREFYI
Sbjct  120  WNQVANILFLDAPVGVGYSYSNTSSDLLTNGDQRTAKDSLKFLLKWVELYPEYKGREFYI  179

Query  593  T  595
             
Sbjct  180  A  180



>emb|CDX68695.1| BnaC01g07580D [Brassica napus]
Length=481

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 142/185 (77%), Gaps = 5/185 (3%)
 Frame = +2

Query  53   MSALSWGCLLFVLLLATSIDG----GKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVT  220
            M+     C ++VL  A ++ G        + + +++ D V  LPG  FNV+FA YSG+VT
Sbjct  1    MAKTRGSCFVYVLF-AIAVLGIAHFCNCEAVLSEKEQDKVSKLPGQNFNVNFAQYSGFVT  59

Query  221  VNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  400
             N++ GRALFYW  EA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY 
Sbjct  60   TNEKLGRALFYWLIEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKPDGKTLYL  119

Query  401  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGR  580
            N YSWN AAN+LF+D+P GVG+SYSNTSSD++T+GDKRTA+DSL FLLKW ER+P+ KGR
Sbjct  120  NQYSWNQAANILFLDAPVGVGFSYSNTSSDLVTNGDKRTAQDSLTFLLKWVERYPEYKGR  179

Query  581  EFYIT  595
            EFYI 
Sbjct  180  EFYIV  184



>emb|CDX72270.1| BnaC07g42920D [Brassica napus]
Length=667

 Score =   241 bits (616),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 140/181 (77%), Gaps = 1/181 (1%)
 Frame = +2

Query  53   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  232
            M+   W CL  + LLA +       + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWSCLA-IALLAIARFCNCEEAVLCQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  233  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  412
             GRALFYW FEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N YS
Sbjct  60   LGRALFYWLFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQYS  119

Query  413  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            WN  AN+LF+D+P GVGYSYSNTSSD+LT+GD+RTA+DSL+FLLKW E +P+ KGREFYI
Sbjct  120  WNQVANILFLDAPVGVGYSYSNTSSDLLTNGDQRTAKDSLQFLLKWVELYPEFKGREFYI  179

Query  593  T  595
             
Sbjct  180  V  180



>gb|KHN02055.1| Serine carboxypeptidase II-2 [Glycine soja]
Length=469

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 139/183 (76%), Gaps = 2/183 (1%)
 Frame = +2

Query  47   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  226
            +E     W  +L ++ L    D    +S   +Q+ D V  LPG GFN+SFAHY+GY+TVN
Sbjct  1    MEWRMALWSQILCIVTLLLCSDCA--ASFAKEQQKDRVGRLPGQGFNISFAHYAGYITVN  58

Query  227  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  406
            +++GR LFYWF EA+EDP SKPLVLWLNGGPGCSSIAFG +EEVGPFH+  D KTL++NP
Sbjct  59   EKAGRTLFYWFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEVGPFHINSDSKTLHFNP  118

Query  407  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREF  586
            YSWN  AN+LF+D+P GVG+SYSN  SD+L +GD+RTAED+L FLL WFERFP+ K   F
Sbjct  119  YSWNRVANILFLDTPVGVGFSYSNNKSDMLINGDERTAEDNLVFLLNWFERFPQYKRSNF  178

Query  587  YIT  595
            +I+
Sbjct  179  FIS  181



>ref|XP_004964646.1| PREDICTED: serine carboxypeptidase II-2-like [Setaria italica]
Length=474

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = +2

Query  137  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  316
            ++Q  D V  +PG  F+ S+AHY+GYVTV++  G ALFYWFFEA +DP SKPLVLWLNGG
Sbjct  32   EEQARDRVPRVPGQAFDTSYAHYAGYVTVSEPRGAALFYWFFEAEKDPGSKPLVLWLNGG  91

Query  317  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  496
            PGCSSIA+GL EEVGPFHV  DGK ++ NPYSWN  ANLLFVDSP GVGYSYSNTS DIL
Sbjct  92   PGCSSIAYGLGEEVGPFHVNADGKGVHVNPYSWNKVANLLFVDSPVGVGYSYSNTSDDIL  151

Query  497  THGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
             +GD RTA+DSL FLLKW ERFP+ KGREFY+T
Sbjct  152  RNGDARTAKDSLAFLLKWLERFPQYKGREFYLT  184



>ref|XP_003522937.2| PREDICTED: serine carboxypeptidase II-2-like [Glycine max]
Length=483

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 139/183 (76%), Gaps = 2/183 (1%)
 Frame = +2

Query  47   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  226
            +E     W  +L ++ L    D    +S   +Q+ D V  LPG GFN+SFAHY+GY+TVN
Sbjct  15   MEWRMALWSQILCIVTLLLCSDCA--ASFAKEQQKDRVGRLPGQGFNISFAHYAGYITVN  72

Query  227  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  406
            +++GR LFYWF EA+EDP SKPLVLWLNGGPGCSSIAFG +EEVGPFH+  D KTL++NP
Sbjct  73   EKAGRTLFYWFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEVGPFHINSDSKTLHFNP  132

Query  407  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREF  586
            YSWN  AN+LF+D+P GVG+SYSN  SD+L +GD+RTAED+L FLL WFERFP+ K   F
Sbjct  133  YSWNRVANILFLDTPVGVGFSYSNNKSDMLINGDERTAEDNLVFLLNWFERFPQYKRSNF  192

Query  587  YIT  595
            +I+
Sbjct  193  FIS  195



>ref|XP_006655861.1| PREDICTED: serine carboxypeptidase II-2-like [Oryza brachyantha]
Length=484

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 129/162 (80%), Gaps = 0/162 (0%)
 Frame = +2

Query  110  DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSK  289
            DG   ++   +Q+ D V  +PG  F+V FA Y+GYVTV++E G ALFYWFFEA EDP+SK
Sbjct  33   DGEAAATWRAEQEWDRVARVPGQDFDVGFAQYAGYVTVSEERGAALFYWFFEAAEDPASK  92

Query  290  PLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYS  469
            PLVLWLNGGPGCSSIA+G+AEEVGPFHV  DG+ ++ NPYSWN  AN+LF+DSP GVGYS
Sbjct  93   PLVLWLNGGPGCSSIAYGVAEEVGPFHVNADGQGVHLNPYSWNQVANILFLDSPVGVGYS  152

Query  470  YSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            YSN S DIL +GD RTA DSL FL KW ERFP+ KGREFY+T
Sbjct  153  YSNVSDDILNNGDARTANDSLTFLTKWIERFPQYKGREFYVT  194



>dbj|BAJ99024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  140  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  319
            +Q+ D V  +PG  FN SFAHY+GYVTV+++ G ALFYWFFEA  DP+SKPL+LWLNGGP
Sbjct  28   EQERDRVPRVPGQAFNASFAHYAGYVTVSEDRGAALFYWFFEAAHDPASKPLLLWLNGGP  87

Query  320  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  499
            GCSSIAFG+ EEVGPFHV  DGK ++ NPYSWN  AN+LF+DSP GVGYSYSNTS+DIL+
Sbjct  88   GCSSIAFGVGEEVGPFHVNADGKGVHMNPYSWNQVANILFLDSPVGVGYSYSNTSADILS  147

Query  500  HGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +GD+RTA+DSL FL KW ERFP+ K REFY+T
Sbjct  148  NGDERTAKDSLVFLTKWLERFPQYKEREFYLT  179



>dbj|BAK02147.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  140  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  319
            +Q+ D V  +PG  FN SFAHY+GYVTV+++ G ALFYWFFEA  DP+SKPL+LWLNGGP
Sbjct  28   EQERDRVPRVPGQAFNASFAHYAGYVTVSEDRGAALFYWFFEAAHDPASKPLLLWLNGGP  87

Query  320  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  499
            GCSSIAFG+ EEVGPFHV  DGK ++ NPYSWN  AN+LF+DSP GVGYSYSNTS+DIL+
Sbjct  88   GCSSIAFGVGEEVGPFHVNADGKGVHMNPYSWNQVANILFLDSPVGVGYSYSNTSADILS  147

Query  500  HGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +GD+RTA+DSL FL KW ERFP+ K REFY+T
Sbjct  148  NGDERTAKDSLVFLTKWLERFPQYKEREFYLT  179



>gb|AFW85537.1| hypothetical protein ZEAMMB73_208131 [Zea mays]
Length=432

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 123/153 (80%), Gaps = 0/153 (0%)
 Frame = +2

Query  137  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  316
            ++Q  D V  +PG  FN SFA Y+GYVTV+++ G ALFYWFFEA +DP SKPLVLWLNGG
Sbjct  32   EEQARDRVPRVPGQAFNTSFAQYAGYVTVSEQRGAALFYWFFEAEKDPGSKPLVLWLNGG  91

Query  317  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  496
            PGCSSIAFGL EEVGPFHV  DGK ++ NPYSWN  ANLLF+DSP GVGYSYSNTS D L
Sbjct  92   PGCSSIAFGLGEEVGPFHVNADGKGVHVNPYSWNKVANLLFLDSPVGVGYSYSNTSDDAL  151

Query  497  THGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
             +GD RTA DSL FLLKW ERFP+ K REFY+T
Sbjct  152  KNGDARTATDSLAFLLKWLERFPQYKEREFYLT  184



>ref|NP_001146398.1| Serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG39493.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACL53886.1| unknown [Zea mays]
 gb|AFW85536.1| Serine carboxypeptidase K10B2.2 [Zea mays]
Length=474

 Score =   231 bits (590),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 123/153 (80%), Gaps = 0/153 (0%)
 Frame = +2

Query  137  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  316
            ++Q  D V  +PG  FN SFA Y+GYVTV+++ G ALFYWFFEA +DP SKPLVLWLNGG
Sbjct  32   EEQARDRVPRVPGQAFNTSFAQYAGYVTVSEQRGAALFYWFFEAEKDPGSKPLVLWLNGG  91

Query  317  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  496
            PGCSSIAFGL EEVGPFHV  DGK ++ NPYSWN  ANLLF+DSP GVGYSYSNTS D L
Sbjct  92   PGCSSIAFGLGEEVGPFHVNADGKGVHVNPYSWNKVANLLFLDSPVGVGYSYSNTSDDAL  151

Query  497  THGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
             +GD RTA DSL FLLKW ERFP+ K REFY+T
Sbjct  152  KNGDARTATDSLAFLLKWLERFPQYKEREFYLT  184



>ref|XP_004488608.1| PREDICTED: serine carboxypeptidase II-2-like [Cicer arietinum]
Length=485

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 141/190 (74%), Gaps = 8/190 (4%)
 Frame = +2

Query  50   EMSALSWGCLLF--VLLLAT----SIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAHYS  208
            EM+   W  +    +L+LAT    SI     +    QQ  D +   LPG  FN++F HYS
Sbjct  10   EMARFEWSQIWVTDILILATLFLCSISFAIATDPFVQQGKDRIGRALPGQNFNINFEHYS  69

Query  209  GYVTVNQESGRALFYWFFEAV-EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDG  385
            GY+TVN+++GR LFYWF EA  +DP+SKPL+LW NGGPGCSSIAFG AEE+GPFH+  DG
Sbjct  70   GYITVNEDTGRNLFYWFIEAEHQDPTSKPLLLWFNGGPGCSSIAFGEAEEIGPFHINPDG  129

Query  386  KTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFP  565
             TLY NPYSWN  AN+LFVDSP GVG+SYSNTSS++L +GDKRTAEDSL FLLKWFERFP
Sbjct  130  NTLYLNPYSWNQVANILFVDSPVGVGFSYSNTSSELLNNGDKRTAEDSLIFLLKWFERFP  189

Query  566  KKKGREFYIT  595
            + K  +F+I+
Sbjct  190  QYKKTDFFIS  199



>ref|NP_001057009.1| Os06g0186400 [Oryza sativa Japonica Group]
 dbj|BAD72445.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAD72446.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAF18923.1| Os06g0186400 [Oryza sativa Japonica Group]
 gb|EAZ36073.1| hypothetical protein OsJ_20382 [Oryza sativa Japonica Group]
 dbj|BAG90330.1| unnamed protein product [Oryza sativa Japonica Group]
Length=484

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = +2

Query  140  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  319
            +Q+ D V  +PG  F+V FA Y+GYV V++E G +LFYWFFEA +DP+SKPLVLWLNGGP
Sbjct  43   EQERDRVARVPGQDFDVGFAQYAGYVAVSEERGASLFYWFFEAADDPASKPLVLWLNGGP  102

Query  320  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  499
            GCSSIA+G+AEEVGPFHV  DG+ ++ NPYSWN  AN+LF+DSP GVGYSYSN S DIL 
Sbjct  103  GCSSIAYGVAEEVGPFHVNADGQGVHLNPYSWNQVANILFLDSPVGVGYSYSNASDDILN  162

Query  500  HGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +GD RTA DSL FL KW ERFP+ KGREFY+T
Sbjct  163  NGDARTANDSLTFLTKWIERFPQYKGREFYVT  194



>sp|P55748.1|CBP22_HORVU RecName: Full=Serine carboxypeptidase II-2; AltName: Full=CP-MII.2; 
Contains: RecName: Full=Serine carboxypeptidase II-2 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-2 
chain B; Flags: Precursor, partial [Hordeum vulgare]
 gb|AAB31590.1| CP-MII.2=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 436 aa]
 emb|CAB59202.1| serine carboxylase II-2 [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   228 bits (582),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +2

Query  158  VLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIA  337
            V  +PG  F+ SFAHY+GYVTV+++ G ALFYWFFEA  DP+SKPL+LWLNGGPGCSSIA
Sbjct  1    VPRVPGQAFDASFAHYAGYVTVSEDRGAALFYWFFEAAHDPASKPLLLWLNGGPGCSSIA  60

Query  338  FGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRT  517
            FG+ EEVGPFHV  DGK ++ NPYSWN  AN+LF+DSP GVGYSYSNTS+DIL++GD+RT
Sbjct  61   FGVGEEVGPFHVNADGKGVHMNPYSWNQVANILFLDSPVGVGYSYSNTSADILSNGDERT  120

Query  518  AEDSLEFLLKWFERFPKKKGREFYIT  595
            A+DSL FL KW ERFP+ K REFY+T
Sbjct  121  AKDSLVFLTKWLERFPQYKEREFYLT  146



>ref|XP_007138291.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
 gb|ESW10285.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
Length=472

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 130/174 (75%), Gaps = 0/174 (0%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
            C   +LL +           + QQ  D V  LPG  FNVSFAHY+GY+TV + +GR LFY
Sbjct  10   CFATLLLCSAFATSFSTDPPLLQQHKDRVGRLPGQNFNVSFAHYAGYITVEENAGRTLFY  69

Query  254  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
            WF EA+EDP SKPLVLWLNGGPGCSSIAFG +EE+GPFH+  DGKTL+ NPYSWN  AN+
Sbjct  70   WFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEIGPFHINPDGKTLHPNPYSWNRVANI  129

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            LF+D+P GVG+SYSN  S++L +GD RTA+D+L FLLKWFERFP+ +  +F I+
Sbjct  130  LFLDTPVGVGFSYSNNGSELLNNGDNRTAKDNLVFLLKWFERFPQYRSNDFLIS  183



>emb|CDY32091.1| BnaC04g44750D [Brassica napus]
Length=447

 Score =   225 bits (574),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  304
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALFYW  E+ + P SKPLVLW
Sbjct  18   SSCRDAQENDRISHLPGEPNDVSFSHYSGYVTVNESAGRALFYWLTESSDHPESKPLVLW  77

Query  305  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  484
            LNGGPGCSS+AFG AEE+GPF +  DGKTLY NPY+WN  ANLLF++SPAGVG+SYSNT+
Sbjct  78   LNGGPGCSSLAFGAAEEIGPFRINPDGKTLYHNPYAWNKLANLLFLESPAGVGFSYSNTT  137

Query  485  SDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            SD+ T GD+RTAED+  FL+KWFERFP+ K REFYI
Sbjct  138  SDLYTAGDQRTAEDAYVFLVKWFERFPQYKHREFYI  173



>ref|XP_009141519.1| PREDICTED: serine carboxypeptidase-like 26 [Brassica rapa]
Length=447

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  304
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALFYW  E+ + P SKPLVLW
Sbjct  18   SSCRDAQEKDRISRLPGEPNDVSFSHYSGYVTVNESAGRALFYWLTESSQHPESKPLVLW  77

Query  305  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  484
            LNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  ANLLF++SPAGVG+SYSNT+
Sbjct  78   LNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYAWNKLANLLFLESPAGVGFSYSNTT  137

Query  485  SDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            SD+ T GD+RTAED+  FL+KWFERFP+ K REFYI
Sbjct  138  SDLYTAGDQRTAEDAYVFLVKWFERFPQYKHREFYI  173



>emb|CDP11023.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  304
            +  + +QKLD VL LPG  FN+SFAHYSGY+TVN  +G+A FYWF E+ EDPSSKPL LW
Sbjct  47   ADKIIEQKLDQVLKLPGQNFNLSFAHYSGYITVNASAGKAFFYWFVESAEDPSSKPLALW  106

Query  305  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  484
            LNGGP CSSIAFG AEE+GPF    DGK++Y NPY+WN  AN++FV+SPAG G+SYSNTS
Sbjct  107  LNGGPACSSIAFGEAEEIGPFRPTADGKSVYLNPYAWNQVANIIFVESPAGTGFSYSNTS  166

Query  485  SDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            SD+   GD+ T +D+L F+L W ERFP+ KGR+FY+
Sbjct  167  SDLYNTGDRSTGKDNLAFILGWLERFPQYKGRDFYL  202



>emb|CDY40438.1| BnaA04g20790D [Brassica napus]
Length=447

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  304
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALFYW  E+ + P SKPLVLW
Sbjct  18   SSCRDSQENDRISHLPGEPNDVSFSHYSGYVTVNESAGRALFYWLTESSDHPESKPLVLW  77

Query  305  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  484
            LNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  ANLLF++SPAGVG+SYSNT+
Sbjct  78   LNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYAWNKLANLLFLESPAGVGFSYSNTT  137

Query  485  SDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            SD+ T GD+RTAED+  FL+KWFERFP+ K REFYI
Sbjct  138  SDLYTAGDQRTAEDAYVFLVKWFERFPQYKHREFYI  173



>ref|XP_003595890.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|ACJ85268.1| unknown [Medicago truncatula]
 gb|AES66141.1| serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AFK36219.1| unknown [Medicago truncatula]
Length=473

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 136/186 (73%), Gaps = 5/186 (3%)
 Frame = +2

Query  53   MSALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAV-LDLPGLGFNVSFAHYSGYVT  220
            M+   W  +  + L    +     + + D   QQ+ D +   LPG  FN+SF HYSGY+T
Sbjct  1    MANSEWSQIFAITLATIFLCNNNFTFATDPFVQQEQDRIDRPLPGQNFNISFEHYSGYIT  60

Query  221  VNQESGRALFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  397
            VN+++GR LFYWF +A   DP+S PL+LWLNGGPGCSSIAFG AEE+GPFH+  D KTLY
Sbjct  61   VNEDAGRNLFYWFIQADHVDPTSMPLLLWLNGGPGCSSIAFGEAEEIGPFHINSDSKTLY  120

Query  398  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKG  577
             NPYSWN  AN+L++DSP GVG+SYS  SSDILT+GDKRTAED+L FLLKWFERFP+ K 
Sbjct  121  LNPYSWNQVANILYIDSPVGVGFSYSKNSSDILTNGDKRTAEDNLIFLLKWFERFPQYKN  180

Query  578  REFYIT  595
             +F+I+
Sbjct  181  TDFFIS  186



>ref|XP_006350225.1| PREDICTED: serine carboxypeptidase-like 27-like [Solanum tuberosum]
Length=456

 Score =   223 bits (568),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 133/174 (76%), Gaps = 2/174 (1%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
            L +V+ L+    G   S S  +Q+ D +  LPG   NV F+ YSGYVTVNQ++GRALFYW
Sbjct  5    LCYVIFLSFLFVGSCYSFSNVEQENDRITYLPGQPENVQFSQYSGYVTVNQQAGRALFYW  64

Query  257  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  430
              E+    +P  +PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPYSWN  AN
Sbjct  65   LIESPSNRNPEKRPLVLWLNGGPGCSSVAYGAAEEIGPFHINADGKTLYLNPYSWNNLAN  124

Query  431  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            LLF++SPAGVG+SY+NTSSD+   GD+RTAED+ +FL+KWFERFP+ K REFYI
Sbjct  125  LLFLESPAGVGFSYTNTSSDLYDAGDQRTAEDTYQFLIKWFERFPQYKHREFYI  178



>ref|XP_003548016.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=493

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 133/175 (76%), Gaps = 2/175 (1%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
            C  F + L  SI  G   +S ++Q+ D +  LPG   NV FAHYSGYVTVN+E+GRALFY
Sbjct  3    CSQFSVFLLLSIFVGICLASTEEQERDRIAKLPGQPENVLFAHYSGYVTVNEEAGRALFY  62

Query  254  WFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  427
            W  E  A  +PSS+PLVLWLNGGPGCSSI +G AEE+GPF +  DG +LY NPY+WN  A
Sbjct  63   WLVETPASIEPSSRPLVLWLNGGPGCSSIGYGAAEEIGPFRINSDGNSLYSNPYAWNNLA  122

Query  428  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            N+LF+DSPAGVG+SYSNT+SD+ T GD+RTAED+  FL+ WFERFP+ K R+FYI
Sbjct  123  NILFLDSPAGVGFSYSNTTSDLYTAGDQRTAEDAYTFLVNWFERFPQYKHRDFYI  177



>emb|CDO99730.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 135/175 (77%), Gaps = 3/175 (2%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQ-QKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
            L FV++L   +  G   S ++Q Q+ D +  LPG   NV F  YSGYVTVN+++GRALFY
Sbjct  8    LFFVVVLPLFLLFGTCYSRINQDQERDRIKSLPGQPANVDFDQYSGYVTVNKKAGRALFY  67

Query  254  WFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  427
            WF E  A   P S+PL+LWLNGGPGCSS+A+G  EE+GPF V+ DGKTL++NPYSWN  A
Sbjct  68   WFIESPASRAPESRPLLLWLNGGPGCSSVAYGATEEIGPFRVKPDGKTLFFNPYSWNKLA  127

Query  428  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            NLLFV+SPAGVG+SYSNTSSD+ T GD+RTAED+  FL++WFERFP+ K REFYI
Sbjct  128  NLLFVESPAGVGFSYSNTSSDLYTAGDQRTAEDAYTFLVQWFERFPQYKHREFYI  182



>gb|KFK36474.1| hypothetical protein AALP_AA4G129400 [Arabis alpina]
Length=449

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 129/159 (81%), Gaps = 2/159 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  298
            SSS+  Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   ++P SKPLV
Sbjct  18   SSSIYDQENDRITHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKPLV  77

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYSN
Sbjct  78   LWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYSWNKLANLLFLESPAGVGFSYSN  137

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            T+SD+ T GDKRTAED+  FL+KWFERFP+ K REFYI 
Sbjct  138  TTSDLYTAGDKRTAEDAYVFLVKWFERFPQYKHREFYIA  176



>ref|NP_181121.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
 sp|Q9ZQQ0.1|SCP26_ARATH RecName: Full=Serine carboxypeptidase-like 26; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD21479.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM15111.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM65590.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|ABJ17113.1| At2g35780 [Arabidopsis thaliana]
 gb|AEC09160.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
Length=452

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = +2

Query  122  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPL  295
             S S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   E+P SKPL
Sbjct  18   ASCSRHEQEKDRIFHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSENPESKPL  77

Query  296  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  475
            VLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYS
Sbjct  78   VLWLNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHNPYSWNKLANLLFLESPAGVGFSYS  137

Query  476  NTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            NT+SD+ T GD+RTAED+  FL+KWFERFP+ K REFYI 
Sbjct  138  NTTSDLYTAGDQRTAEDAYVFLVKWFERFPQYKHREFYIA  177



>gb|AES66787.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=474

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = +2

Query  140  QQKLDAV-LDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE-DPSSKPLVLWLNG  313
            QQ+ D +   LPG  FN++F HYSGY+TVN++ GR LFYWF EA   DP+SKPL+LW NG
Sbjct  34   QQEQDRIGTALPGQNFNINFEHYSGYITVNKDVGRTLFYWFIEADHIDPTSKPLLLWFNG  93

Query  314  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  493
            GPGCSSIA+G AEE+GPFH+  DG TL+ NPYSWN  AN+L +DSP GVG+SYSN SSDI
Sbjct  94   GPGCSSIAYGEAEEIGPFHINSDGNTLHLNPYSWNQVANILLIDSPVGVGFSYSNASSDI  153

Query  494  LTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            L +GDKRT EDSL FLLKWFERFP+ K  +F+I+
Sbjct  154  LNNGDKRTTEDSLIFLLKWFERFPRYKETDFFIS  187



>ref|XP_003595892.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|AES66143.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=472

 Score =   221 bits (563),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 137/187 (73%), Gaps = 6/187 (3%)
 Frame = +2

Query  53   MSALSWGCLLFVLL--LATSIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAHYSGYVTV  223
            M+   W  +LF+++  LA        +    QQ  D +   LPG  FN+SF HYSGY+TV
Sbjct  1    MANSKWSQILFIVIITLANLFQCNIATDPFVQQGQDNIGRALPGQNFNISFEHYSGYITV  60

Query  224  NQESGRALFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  400
            N++ GR LFYWF +A   DP+SKPL+LW NGGPGCSSIA+G AEE+GPFH+  DGK L++
Sbjct  61   NEDVGRNLFYWFIQADHVDPTSKPLLLWFNGGPGCSSIAYGEAEEIGPFHINSDGKNLHF  120

Query  401  NPYSWNLAANLLFVDSPAGVGYSYS--NTSSDILTHGDKRTAEDSLEFLLKWFERFPKKK  574
            NPYSWN  AN+L++DSP GVG+SYS  N+S DIL +GDKRTAED+L FLLKWFERFP+ K
Sbjct  121  NPYSWNQVANILYIDSPVGVGFSYSTKNSSDDILNNGDKRTAEDNLIFLLKWFERFPQYK  180

Query  575  GREFYIT  595
              +F+I+
Sbjct  181  KTDFFIS  187



>ref|XP_011076996.1| PREDICTED: serine carboxypeptidase-like 27 [Sesamum indicum]
Length=461

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 133/175 (76%), Gaps = 3/175 (2%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
            C + +L L + +  G   S++DQ++ D +  LPG   NV F  YSGY+TVNQ+SGRALFY
Sbjct  10   CAICILWLNSFVGIGYSLSNLDQER-DRITYLPGQPQNVGFNQYSGYITVNQQSGRALFY  68

Query  254  WFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  427
            W  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  A
Sbjct  69   WLTEAPAYRGPDSRPLVLWLNGGPGCSSVAYGAAEEIGPFRINSDGKTLYLNPYSWNKLA  128

Query  428  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            NLLF++SPAGVG+SYSNTSSD+ T GD+RTAED+  FL+ WFERFP+ K R+FYI
Sbjct  129  NLLFLESPAGVGFSYSNTSSDLYTVGDQRTAEDAYAFLVGWFERFPQYKYRDFYI  183



>ref|XP_006589433.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=460

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 132/173 (76%), Gaps = 2/173 (1%)
 Frame = +2

Query  80   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  259
            L+++LL +       +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LFYW 
Sbjct  8    LYLVLLLSICGVVSLASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWL  67

Query  260  FEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
             EA     P S+PLVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN  AN+
Sbjct  68   VEAPVKRGPKSRPLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWNNLANV  127

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            LF+DSPAGVG+SYSN S+D+ T GD++TAED+  FL+ WFERFP+ K REFYI
Sbjct  128  LFLDSPAGVGFSYSNKSTDLYTFGDQKTAEDAYTFLVNWFERFPQYKHREFYI  180



>ref|XP_006410747.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
 gb|ESQ52200.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
Length=449

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 127/159 (80%), Gaps = 2/159 (1%)
 Frame = +2

Query  122  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPL  295
             S   D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   + P SKPL
Sbjct  17   ASCCRDEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQHPESKPL  76

Query  296  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  475
            VLWLNGGPGCSSIAFG AEE+GPF +  DGKTLY NPY+WN  ANLLF++SPAGVG+SYS
Sbjct  77   VLWLNGGPGCSSIAFGAAEEIGPFRINPDGKTLYHNPYAWNQLANLLFLESPAGVGFSYS  136

Query  476  NTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            NT+SD+ T GD+RTAED+  FL+KWFERFP+ K REFYI
Sbjct  137  NTTSDLYTAGDQRTAEDAYVFLVKWFERFPQYKHREFYI  175



>ref|XP_007143689.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
 gb|ESW15683.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
Length=459

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 131/173 (76%), Gaps = 3/173 (2%)
 Frame = +2

Query  83   FVLLLATSIDGGKG-SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  259
            F L+L  SI G    +S ++ QK D +  LPG   NV FA YSGYVTVN++S RALFYW 
Sbjct  8    FYLVLLLSICGVVSLASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSERALFYWL  67

Query  260  FEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
             EA     P S+PLVLWLNGGPGCSSIA+G +EE+GPFH+  DG++LY NPY+WN  AN+
Sbjct  68   VEAPVSRGPRSRPLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGRSLYLNPYAWNKLANI  127

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            LF+DSPAGVG+SYSN ++D+ T GD+RTAED+  FL+ WFERFP+ K REFYI
Sbjct  128  LFLDSPAGVGFSYSNKTADLYTFGDQRTAEDAYAFLVNWFERFPQYKHREFYI  180



>ref|XP_004236634.1| PREDICTED: serine carboxypeptidase-like 27 [Solanum lycopersicum]
Length=456

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 132/174 (76%), Gaps = 2/174 (1%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
            L +V+ L+    G   S    +Q+ D +  LPG   NV F+ YSGYVTVNQ++GRALFYW
Sbjct  5    LCYVMFLSFLFVGSCYSFYNVEQENDRITYLPGQPENVQFSQYSGYVTVNQQAGRALFYW  64

Query  257  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  430
              E+    +P  +PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPYSWN  AN
Sbjct  65   LIESPSTRNPEKRPLVLWLNGGPGCSSVAYGAAEEIGPFHINADGKTLYLNPYSWNNLAN  124

Query  431  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            LLF++SPAGVG+SY+NT+SD+   GD+RTAED+ +F++KWFERFP+ K REFYI
Sbjct  125  LLFLESPAGVGFSYTNTTSDLYDAGDQRTAEDTYQFVIKWFERFPQYKHREFYI  178



>ref|XP_006294202.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
 gb|EOA27100.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
Length=451

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 127/155 (82%), Gaps = 2/155 (1%)
 Frame = +2

Query  137  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWLN  310
            D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   ++P SKPLVLWLN
Sbjct  22   DEQEKDRIYHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKPLVLWLN  81

Query  311  GGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSD  490
            GGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYSNT+SD
Sbjct  82   GGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYSWNKLANLLFLESPAGVGFSYSNTTSD  141

Query  491  ILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            + T GDKRTAED+  FLLKWFERFP+ K R+FYI 
Sbjct  142  LYTAGDKRTAEDAYVFLLKWFERFPQYKHRDFYIA  176



>ref|XP_010253608.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 126/158 (80%), Gaps = 2/158 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLV  298
            SS +  Q+ D ++ LPG   NV F+ YSGYVTVNQ++GRALFYW  EA  +  P S+PLV
Sbjct  23   SSPLQDQERDRIIQLPGQPNNVGFSQYSGYVTVNQQAGRALFYWLVEAPANRRPESRPLV  82

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSS+A+G AEE+GPFH+  DGKTL+ NPY+WN  ANLLF++SPAGVG+SYSN
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFHIRSDGKTLFLNPYAWNNLANLLFLESPAGVGFSYSN  142

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            TSSD+ T GD+RTAED+  FL+ W ERFP+ K R+FYI
Sbjct  143  TSSDLYTAGDQRTAEDAYAFLVNWIERFPQYKHRDFYI  180



>ref|XP_010505098.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=453

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 127/160 (79%), Gaps = 2/160 (1%)
 Frame = +2

Query  122  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE--DPSSKPL  295
             S   D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+    +P SKPL
Sbjct  19   ASCCRDEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALFYWLTESPPSLNPDSKPL  78

Query  296  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  475
            VLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYS
Sbjct  79   VLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYSWNQLANLLFLESPAGVGFSYS  138

Query  476  NTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            NT+SD+ T GDKRTAED+  FL+KWFERFP+ K REFYI 
Sbjct  139  NTTSDLYTAGDKRTAEDAYVFLVKWFERFPQYKHREFYIA  178



>gb|ACA61621.1| hypothetical protein AP7_B10.1 [Arabidopsis lyrata subsp. petraea]
Length=450

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = +2

Query  131  SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLW  304
            S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   ++P SKPLVLW
Sbjct  19   SRHEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKPLVLW  78

Query  305  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  484
            LNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYSNT+
Sbjct  79   LNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHNPYSWNKVANLLFLESPAGVGFSYSNTT  138

Query  485  SDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            SD+ T GDKRTAED+  FL+KWFERFP+ K REFYI
Sbjct  139  SDLYTAGDKRTAEDAYVFLVKWFERFPQYKHREFYI  174



>ref|XP_009802382.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana sylvestris]
Length=456

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 130/174 (75%), Gaps = 2/174 (1%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
            L FV+ L+    G    S   +Q  D +  LPG   NV F  YSGYVTVN+++GRALFYW
Sbjct  5    LPFVICLSLLFLGSCYCSINVEQLRDKITYLPGQPANVEFNQYSGYVTVNEQAGRALFYW  64

Query  257  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  430
              E+    +P  +PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPYSWN  AN
Sbjct  65   LIESPMSRNPEKRPLILWLNGGPGCSSVAYGAAEEIGPFHINSDGKTLYLNPYSWNNLAN  124

Query  431  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            LLF++SPAGVG+SY+NTSSD+   GD+RTAED+ +FL+KWFERFP+ K REFYI
Sbjct  125  LLFLESPAGVGFSYTNTSSDLYNAGDQRTAEDTYQFLVKWFERFPQYKHREFYI  178



>ref|XP_002881414.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57673.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = +2

Query  131  SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLW  304
            S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   ++P SKPLVLW
Sbjct  19   SRHEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKPLVLW  78

Query  305  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  484
            LNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYSNT+
Sbjct  79   LNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHNPYSWNKVANLLFLESPAGVGFSYSNTT  138

Query  485  SDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            SD+ T GDKRTAED+  FL+KWFERFP+ K REFYI
Sbjct  139  SDLYTAGDKRTAEDAYVFLVKWFERFPQYKHREFYI  174



>ref|XP_003596536.1| Serine carboxypeptidase [Medicago truncatula]
Length=562

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = +2

Query  140  QQKLDAV-LDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE-DPSSKPLVLWLNG  313
            QQ+ D +   LPG  FN++F HYSGY+TVN++ GR LFYWF EA   DP+SKPL+LW NG
Sbjct  34   QQEQDRIGTALPGQNFNINFEHYSGYITVNKDVGRTLFYWFIEADHIDPTSKPLLLWFNG  93

Query  314  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  493
            GPGCSSIA+G AEE+GPFH+  DG TL+ NPYSWN  AN+L +DSP GVG+SYSN SSDI
Sbjct  94   GPGCSSIAYGEAEEIGPFHINSDGNTLHLNPYSWNQVANILLIDSPVGVGFSYSNASSDI  153

Query  494  LTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            L +GDKRT EDSL FLLKWFERFP+ K  +F+I+
Sbjct  154  LNNGDKRTTEDSLIFLLKWFERFPRYKETDFFIS  187



>ref|XP_012086498.1| PREDICTED: serine carboxypeptidase-like 27 [Jatropha curcas]
 gb|KDP25725.1| hypothetical protein JCGZ_23946 [Jatropha curcas]
Length=456

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 127/159 (80%), Gaps = 2/159 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  298
            SS+++ Q+ D +  LPG   NV F  YSGYVTVNQ++GRALFYW  E  A   P S+PLV
Sbjct  21   SSTLEDQERDKITYLPGQPTNVEFNQYSGYVTVNQQAGRALFYWLIESPASRGPESRPLV  80

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSS+A+G AEE+GPF ++ DGKTL++NPY+WN  ANLLF++SPAGVG+SYSN
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIKPDGKTLFFNPYAWNKLANLLFLESPAGVGFSYSN  140

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            T+SD+ T GD+RTAEDS  FL+ WFERFP+ K R+FYI 
Sbjct  141  TTSDLYTAGDQRTAEDSYAFLVNWFERFPQYKHRDFYIV  179



>ref|XP_002312024.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE89391.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 124/157 (79%), Gaps = 2/157 (1%)
 Frame = +2

Query  128  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVL  301
            S ++ Q+ D +  LPG   NV F  YSGYVTVNQ++GRALFYW  EA     P S+PLVL
Sbjct  23   SPLEDQQRDKITSLPGQPVNVEFNQYSGYVTVNQQAGRALFYWLVEAPTSRSPESRPLVL  82

Query  302  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  481
            WLNGGPGCSS+A+G AEE+GPF +  DGKTLY+NPY+WN  ANLLF++SPAGVG+SYSNT
Sbjct  83   WLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNPYAWNKLANLLFLESPAGVGFSYSNT  142

Query  482  SSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            SSD+ T GD+RTAED+  FL+ WFERFP+ K R+FYI
Sbjct  143  SSDLYTAGDQRTAEDAYTFLVNWFERFPQYKYRDFYI  179



>ref|XP_010509560.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=451

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 126/155 (81%), Gaps = 2/155 (1%)
 Frame = +2

Query  137  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE--DPSSKPLVLWLN  310
            D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+    +P SKPLVLWLN
Sbjct  22   DEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALFYWLTESPPSLNPESKPLVLWLN  81

Query  311  GGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSD  490
            GGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYSNT+SD
Sbjct  82   GGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYSWNQLANLLFLESPAGVGFSYSNTTSD  141

Query  491  ILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            + T GDKRTAED+  FL+KWFERFP+ K REFYI 
Sbjct  142  LYTAGDKRTAEDAYVFLVKWFERFPQYKHREFYIA  176



>ref|XP_011031767.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   218 bits (556),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 124/157 (79%), Gaps = 2/157 (1%)
 Frame = +2

Query  128  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVL  301
            S ++ Q+ D +  LPG   NV F  YSGYVTVNQ++GRALFYW  EA     P ++PLVL
Sbjct  23   SPLEDQQRDKITSLPGQPVNVEFNQYSGYVTVNQQAGRALFYWLVEAPTSRSPEARPLVL  82

Query  302  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  481
            WLNGGPGCSS+A+G AEE+GPF +  DGKTLY+NPY+WN  ANLLF++SPAGVG+SYSNT
Sbjct  83   WLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNPYAWNKLANLLFLESPAGVGFSYSNT  142

Query  482  SSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            SSD+ T GD+RTAED+  FL+ WFERFP+ K R+FYI
Sbjct  143  SSDLYTAGDQRTAEDAYTFLVNWFERFPQYKYRDFYI  179



>ref|XP_009592854.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana tomentosiformis]
Length=456

 Score =   218 bits (556),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 139/189 (74%), Gaps = 13/189 (7%)
 Frame = +2

Query  32   LTKIPLEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSG  211
            + KIP  +  LS   LLF+     SI+       V+Q + D +  LPG   NV F  YSG
Sbjct  1    MEKIPPFVICLS---LLFLSSCYCSIN-------VEQLR-DKITYLPGQPANVQFNQYSG  49

Query  212  YVTVNQESGRALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDG  385
            YVTVN+++GRALFYW  E+    +P  +PL+LWLNGGPGCSS+A+G AEE+GPFH++ DG
Sbjct  50   YVTVNEQAGRALFYWLIESPVSRNPEKRPLILWLNGGPGCSSVAYGAAEEIGPFHIDSDG  109

Query  386  KTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFP  565
            KTLY NPYSWN  ANLLF++SPAGVG+SY+NTSSD+   GD+RTAED+ +FL+KWFERFP
Sbjct  110  KTLYLNPYSWNNLANLLFLESPAGVGFSYTNTSSDLYNAGDQRTAEDTYQFLVKWFERFP  169

Query  566  KKKGREFYI  592
            + K REFYI
Sbjct  170  QYKHREFYI  178



>gb|KJB78940.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
 gb|KJB78941.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=375

 Score =   216 bits (549),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 129/174 (74%), Gaps = 6/174 (3%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  257  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  430
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  AN
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPYAWNKLAN  124

Query  431  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
             LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ W ERFP+ K R+FYI
Sbjct  125  TLFLESPAGVGFSYTNTTSDLYTSGDKRTAEDAYVFLVNWLERFPQYKYRDFYI  178



>ref|XP_004307401.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469671.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
Length=458

 Score =   218 bits (555),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 122/158 (77%), Gaps = 2/158 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  298
            +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALFYW  E  A   P S+PLV
Sbjct  23   ASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLVESPAQRGPESRPLV  82

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY+WN  ANLLF++SPAGVG+SYSN
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPYAWNNLANLLFLESPAGVGFSYSN  142

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            TSSD+ T GD+RTAED+  FL+ WFERFP+ K R FYI
Sbjct  143  TSSDLYTAGDQRTAEDAYTFLVNWFERFPQYKHRNFYI  180



>gb|KHN13367.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=493

 Score =   219 bits (557),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 132/175 (75%), Gaps = 2/175 (1%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
            C  F + L  SI  G   +S ++Q+ D +  LPG   NV FAHYSGYVTVN+E+GRALFY
Sbjct  3    CSQFSVFLLLSIFVGICLASTEEQERDRIAKLPGQPENVLFAHYSGYVTVNEEAGRALFY  62

Query  254  WFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  427
            W  E  A  +PSS+PLVLWLNGGPGCSSI +G AEE+GPF +  DG +LY NPY+WN + 
Sbjct  63   WLVETPASIEPSSRPLVLWLNGGPGCSSIGYGAAEEIGPFRINSDGNSLYSNPYAWNNSV  122

Query  428  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
             ++F+DSPAGVG+SYSNT+SD+ T GD+RTAED+  FL+ WFERFP+ K R+FYI
Sbjct  123  VIVFLDSPAGVGFSYSNTTSDLYTAGDQRTAEDAYTFLVNWFERFPQYKHRDFYI  177



>ref|XP_009378094.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   218 bits (554),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 138/181 (76%), Gaps = 10/181 (6%)
 Frame = +2

Query  56   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  235
            S  ++ C+L + L      GG  +S+ DQ + D +  LPG   NV FA YSGYVTVN+++
Sbjct  5    SPFAFLCILLLFL------GGCFASNQDQVR-DRITQLPGQP-NVGFAQYSGYVTVNRKA  56

Query  236  GRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  409
            GRALFYW  E+ E+  P S+PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY
Sbjct  57   GRALFYWLTESPENRQPESRPLVLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPY  116

Query  410  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFY  589
            +WN  ANLLF++SPAGVG+SY+NTSSD+ T GD+RTA+D+  FL+ WFERFP+ K R+FY
Sbjct  117  AWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQRTAQDAYAFLVNWFERFPQYKHRDFY  176

Query  590  I  592
            I
Sbjct  177  I  177



>ref|XP_010516783.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=454

 Score =   218 bits (554),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 126/160 (79%), Gaps = 2/160 (1%)
 Frame = +2

Query  122  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE--DPSSKPL  295
             S   D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+    +P SKPL
Sbjct  20   ASCCRDEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALFYWLTESPPSLNPESKPL  79

Query  296  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  475
            VLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYS
Sbjct  80   VLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYSWNQLANLLFLESPAGVGFSYS  139

Query  476  NTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            NT+SD+ T GDKRTAED+  FL+ WFERFP+ K REFYI 
Sbjct  140  NTTSDLYTAGDKRTAEDAYVFLVNWFERFPQYKQREFYIA  179



>ref|XP_003595891.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES66142.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=473

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 135/186 (73%), Gaps = 5/186 (3%)
 Frame = +2

Query  53   MSALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAV-LDLPGLGFNVSFAHYSGYVT  220
            M+   W  +  + L    +     + + D   QQ+ D +   LPG  FN+SF HYSGY+T
Sbjct  1    MANSEWSQIFAITLATIFLCNNNFTFATDPFVQQEHDRIDRPLPGQNFNISFEHYSGYIT  60

Query  221  VNQESGRALFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  397
            VN+++GR LFYWF +A   DP+SKPL+LWLNGGPGCSSIA+G AEE+GPFH+  DGK L+
Sbjct  61   VNEDAGRNLFYWFIQADHVDPTSKPLLLWLNGGPGCSSIAYGEAEEIGPFHINSDGKNLH  120

Query  398  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKG  577
            +NPY WN  AN L+++SP GVG+SYS  SSDIL +GDKRTAED+L FLLKWFERFP+ K 
Sbjct  121  FNPYYWNQVANFLYIESPVGVGFSYSKNSSDILNNGDKRTAEDNLIFLLKWFERFPQYKK  180

Query  578  REFYIT  595
             +F+I+
Sbjct  181  TDFFIS  186



>gb|EYU39591.1| hypothetical protein MIMGU_mgv1a009171mg [Erythranthe guttata]
Length=350

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 130/178 (73%), Gaps = 3/178 (2%)
 Frame = +2

Query  65   SWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRA  244
            S  C + +L L   +  G    + DQ+  D +  LPG   N+ F  YSGYVTVNQ+SGRA
Sbjct  7    SISCSICLLWLNLFVGIGYSLYNADQEN-DRITYLPGQPENIGFDQYSGYVTVNQQSGRA  65

Query  245  LFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  418
            LFYW  EA  +  P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N YSWN
Sbjct  66   LFYWLTEAPTNRGPDSRPLVLWLNGGPGCSSVAYGAAEEIGPFRINSDGKTLYSNSYSWN  125

Query  419  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
              ANLLF++SPAGVGYSYSNTSSD+ T GD+RTAED+  FL+ WFERFP+ K R+FYI
Sbjct  126  KLANLLFLESPAGVGYSYSNTSSDLYTVGDQRTAEDAYAFLVNWFERFPQYKHRDFYI  183



>gb|KJB78942.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=422

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 129/174 (74%), Gaps = 6/174 (3%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  257  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  430
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  AN
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPYAWNKLAN  124

Query  431  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
             LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ W ERFP+ K R+FYI
Sbjct  125  TLFLESPAGVGFSYTNTTSDLYTSGDKRTAEDAYVFLVNWLERFPQYKYRDFYI  178



>gb|KHG25905.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=470

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 130/174 (75%), Gaps = 6/174 (3%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  257  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  430
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY+NPY+WN  AN
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNPYAWNKLAN  124

Query  431  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
             LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ W ERFP+ K R+FYI
Sbjct  125  TLFLESPAGVGFSYTNTTSDLYTSGDKRTAEDAYVFLVNWLERFPQYKYRDFYI  178



>gb|KHN17121.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=459

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 131/173 (76%), Gaps = 2/173 (1%)
 Frame = +2

Query  80   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  259
            L+++LL +       +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LFYW 
Sbjct  7    LYLVLLLSICGVVSLASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWL  66

Query  260  FEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
             EA     P S+ LVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN  AN+
Sbjct  67   VEAPVRRGPRSRSLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWNNLANV  126

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            LF+DSPAGVG+SYSN S+D+ T GD++TAED+  FL+ WFERFP+ K REFYI
Sbjct  127  LFLDSPAGVGFSYSNKSTDLYTFGDQKTAEDAYTFLVNWFERFPQYKHREFYI  179



>gb|KJB76564.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=333

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 122/158 (77%), Gaps = 2/158 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  298
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            T+SD+ T GDKRTAED+  FL+ WFERFP+ K R+FYI
Sbjct  137  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYI  174



>ref|XP_002315292.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF01463.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 132/181 (73%), Gaps = 7/181 (4%)
 Frame = +2

Query  56   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  235
            S LS  CLL  L + + I      + ++ Q  D +  LPG   +V F  YSGYVTVNQ+S
Sbjct  4    SLLSILCLLVSLFVYSCI-----CAPLEDQGRDKITYLPGQPGSVEFNQYSGYVTVNQQS  58

Query  236  GRALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  409
            GRALFYW  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  59   GRALFYWLVEAPTSRRPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPY  118

Query  410  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFY  589
            +WN  ANLLF++SPAGVG+SYSNTSSD+ T GD+RTAED+  FL+ WFERFP+ K R+FY
Sbjct  119  AWNKLANLLFLESPAGVGFSYSNTSSDLYTAGDQRTAEDAYTFLVNWFERFPQYKYRDFY  178

Query  590  I  592
            I
Sbjct  179  I  179



>gb|KJB78939.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=432

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 129/174 (74%), Gaps = 6/174 (3%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  257  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  430
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  AN
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPYAWNKLAN  124

Query  431  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
             LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ W ERFP+ K R+FYI
Sbjct  125  TLFLESPAGVGFSYTNTTSDLYTSGDKRTAEDAYVFLVNWLERFPQYKYRDFYI  178



>gb|KJB76565.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=342

 Score =   213 bits (542),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 122/158 (77%), Gaps = 2/158 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  298
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            T+SD+ T GDKRTAED+  FL+ WFERFP+ K R+FYI
Sbjct  137  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYI  174



>ref|XP_003556225.1| PREDICTED: serine carboxypeptidase-like 27-like isoform 1 [Glycine 
max]
 gb|KHN00830.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=460

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 131/173 (76%), Gaps = 2/173 (1%)
 Frame = +2

Query  80   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  259
            L+++LL +       +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LFYW 
Sbjct  8    LYLVLLLSICGVVSLASPIEDQKKDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWL  67

Query  260  FEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
             EA     P S+ LVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN  AN+
Sbjct  68   VEAPVRRGPRSRSLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWNNLANV  127

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            LF+DSPAGVG+SYSN ++D+ T GD++TAED+  FL+ WFERFP+ K REFYI
Sbjct  128  LFLDSPAGVGFSYSNKTTDLYTFGDQKTAEDAYTFLVNWFERFPQYKHREFYI  180



>ref|XP_011469672.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 122/158 (77%), Gaps = 2/158 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  298
            +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALFYW  E  A   P S+PLV
Sbjct  23   ASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLVESPAQRGPESRPLV  82

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWL GGPGCSS+A+G AEE+GPFH+  DGKTLY NPY+WN  ANLLF++SPAGVG+SY+N
Sbjct  83   LWLTGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPYAWNNLANLLFLESPAGVGFSYTN  142

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            TSSD+ T GD+RTAED+  FL+ WFERFP+ K R+FYI
Sbjct  143  TSSDLYTAGDQRTAEDAYTFLVNWFERFPQYKHRDFYI  180



>ref|XP_010264739.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   216 bits (549),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 126/158 (80%), Gaps = 2/158 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  298
            +S +  Q+ D + +LPG   NV FA YSGYVTV+Q++GRALFYW  EA     P S+PLV
Sbjct  23   TSPLQDQERDKITELPGQPTNVGFAQYSGYVTVDQQAGRALFYWLTEAPASRRPESRPLV  82

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTL++NPY+WN  AN+LF++SPAGVG+SYSN
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFRIHPDGKTLFFNPYAWNNLANILFLESPAGVGFSYSN  142

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            TSSD+ T GD+RTAED+  F++ WFERFP+ K R+FYI
Sbjct  143  TSSDLYTAGDQRTAEDAYTFIVNWFERFPQYKHRDFYI  180



>ref|XP_004307399.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=458

 Score =   216 bits (549),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 122/158 (77%), Gaps = 2/158 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  298
            +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALFYW  E  A   P S+PLV
Sbjct  23   ASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLVESPAQRGPESRPLV  82

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWL GGPGCSS+A+G AEE+GPFH+  DGKTLY NPY+WN  ANLLF++SPAGVG+SY+N
Sbjct  83   LWLTGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPYAWNNLANLLFLESPAGVGFSYTN  142

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            TSSD+ T GD+RTAED+  FL+ WFERFP+ K R+FYI
Sbjct  143  TSSDLYTAGDQRTAEDAYTFLVNWFERFPQYKHRDFYI  180



>ref|XP_004142401.1| PREDICTED: serine carboxypeptidase-like 27 [Cucumis sativus]
 gb|KGN52285.1| hypothetical protein Csa_5G623490 [Cucumis sativus]
Length=455

 Score =   215 bits (548),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 134/174 (77%), Gaps = 3/174 (2%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
              ++ LL + +    GS + +Q++ D +  LPG   NV FA YSGYVTV++++GRALFYW
Sbjct  5    FFYLCLLLSLVAISYGSYNAEQER-DRITQLPGQPKNVDFAQYSGYVTVDKQAGRALFYW  63

Query  257  FFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  430
              E      P+S+PLVLWLNGGPGCSS+A+G AEE+GPFH++ DG+TLY NPY+WN  AN
Sbjct  64   LTETPTSRVPNSRPLVLWLNGGPGCSSVAYGAAEEIGPFHIKPDGRTLYLNPYAWNKLAN  123

Query  431  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            LLF++SPAGVG+SYSNT+SD+ T GD++TAED+  FL+ WFERFP+ K R+FYI
Sbjct  124  LLFLESPAGVGFSYSNTTSDLYTAGDQKTAEDAHRFLVNWFERFPQYKHRDFYI  177



>ref|XP_010669644.1| PREDICTED: serine carboxypeptidase-like 27 [Beta vulgaris subsp. 
vulgaris]
Length=456

 Score =   215 bits (548),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  304
            S+++  Q  D +  LPG   N +FA YSGYVTV++ +GR LFYW  E+  +P +KPLVLW
Sbjct  20   SAAIANQNNDRITWLPGQPENTNFAQYSGYVTVDKSAGRTLFYWLTESPSNPETKPLVLW  79

Query  305  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  484
            LNGGPGCSSIA+G AEE+GPFH++ DGKTL+ NPYSWN  ANLLF++SPAGVG+SYSN S
Sbjct  80   LNGGPGCSSIAYGAAEEIGPFHIQSDGKTLFLNPYSWNNEANLLFLESPAGVGFSYSNRS  139

Query  485  SDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            SD+ T GD RTA+DS +FL++WF RFP+ K REFYI
Sbjct  140  SDLYTVGDSRTAKDSYKFLVRWFNRFPQYKYREFYI  175



>ref|XP_002312023.1| hypothetical protein POPTR_0008s04130g [Populus trichocarpa]
 gb|EEE89390.1| hypothetical protein POPTR_0008s04130g [Populus trichocarpa]
Length=466

 Score =   216 bits (549),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 131/186 (70%), Gaps = 6/186 (3%)
 Frame = +2

Query  53   MSALSWGCLLFVLL----LATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVT  220
            M   S  C LF +L    L  S         +++Q+ D ++ LPG   NVSF+ +SGY+T
Sbjct  1    MRIKSSSCFLFSVLNFAILLLSTPAVTTHDHLEEQRRDRIMKLPGQPPNVSFSQFSGYIT  60

Query  221  VNQESGRALFYWFFEAVE--DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTL  394
            V+   GRALFYW  EA +   P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DG+TL
Sbjct  61   VDPVEGRALFYWLIEAPKTVKPRSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGETL  120

Query  395  YWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKK  574
            + NPY+WN  ANLLF+DSPAGVG+SYSNTSSDI T GD+RTAED+  FL+ W ERFP+ K
Sbjct  121  HLNPYAWNKVANLLFLDSPAGVGFSYSNTSSDIYTVGDERTAEDAYTFLINWLERFPRYK  180

Query  575  GREFYI  592
             R FYI
Sbjct  181  HRSFYI  186



>gb|KJB78938.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=470

 Score =   216 bits (549),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 129/174 (74%), Gaps = 6/174 (3%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  257  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  430
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  AN
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPYAWNKLAN  124

Query  431  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
             LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ W ERFP+ K R+FYI
Sbjct  125  TLFLESPAGVGFSYTNTTSDLYTSGDKRTAEDAYVFLVNWLERFPQYKYRDFYI  178



>ref|XP_007009788.1| Serine carboxypeptidase-like 27 isoform 2 [Theobroma cacao]
 gb|EOY18598.1| Serine carboxypeptidase-like 27 isoform 2 [Theobroma cacao]
Length=423

 Score =   214 bits (545),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 122/157 (78%), Gaps = 2/157 (1%)
 Frame = +2

Query  128  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVL  301
            SS   Q LD + +LPG   NV F  YSGYVTVN+++GRALFYW  E      P ++PLVL
Sbjct  22   SSFGDQNLDKITELPGQPKNVEFNQYSGYVTVNEQAGRALFYWLIELPVSRSPETRPLVL  81

Query  302  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  481
            WLNGGPGCSS+A+G AEE+GPFH+  DG+TLY N Y+WN  AN+LF++SPAGVG+SYSNT
Sbjct  82   WLNGGPGCSSLAYGAAEEIGPFHIRPDGRTLYLNRYAWNNLANMLFLESPAGVGFSYSNT  141

Query  482  SSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            +SD+ T GD+RTAED+  FL+ WFERFP+ K R+FYI
Sbjct  142  TSDLYTAGDRRTAEDAYAFLVNWFERFPQYKHRDFYI  178



>ref|XP_002534550.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF27834.1| serine carboxypeptidase, putative [Ricinus communis]
Length=385

 Score =   213 bits (543),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 131/175 (75%), Gaps = 3/175 (2%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
            L F  LL ++I   +  S+ ++Q+ D ++ LPG   NV F+ YSGYVTV+  +GRALFYW
Sbjct  16   LSFATLLLSTI-SARLISNKEEQERDRIIKLPGQPPNVYFSQYSGYVTVDPLAGRALFYW  74

Query  257  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  430
              EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DGKTLY NPY+WN  AN
Sbjct  75   LIEAPKMARPKSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRSDGKTLYLNPYTWNKVAN  134

Query  431  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            LLF+DSPAGVG+SYSNTSSDI   GDKRT++D+ +FL+ WF+RFP+   R FYI 
Sbjct  135  LLFLDSPAGVGFSYSNTSSDIYAVGDKRTSQDAHKFLINWFKRFPQYNHRPFYIA  189



>ref|XP_008368824.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 134/181 (74%), Gaps = 10/181 (6%)
 Frame = +2

Query  56   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  235
            S  ++ C+L + L       G   +S+  Q  D +  LPG   NV FA YSGYVTVN+++
Sbjct  5    SPFAFLCILLLFL-------GGCFASIQDQVRDRITQLPGQP-NVGFAQYSGYVTVNRKA  56

Query  236  GRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  409
            GRALFYW  E+ E+  P S+PLVLWLNGGPGCSS+A+G AEE+G FH+  DGKTLY NPY
Sbjct  57   GRALFYWLTESPENRQPESRPLVLWLNGGPGCSSVAYGAAEEIGAFHIRPDGKTLYLNPY  116

Query  410  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFY  589
            +WN  ANLLF++SPAGVG+SY+NTSSD+ T GD+RTAED+  FL+ WFERFP+ K R+FY
Sbjct  117  AWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQRTAEDAYAFLVNWFERFPQYKHRDFY  176

Query  590  I  592
            I
Sbjct  177  I  177



>ref|XP_010067291.1| PREDICTED: serine carboxypeptidase-like 28 [Eucalyptus grandis]
 gb|KCW65387.1| hypothetical protein EUGRSUZ_G02817 [Eucalyptus grandis]
Length=467

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 120/153 (78%), Gaps = 2/153 (1%)
 Frame = +2

Query  140  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLVLWLNG  313
            QQK D ++ LPG   NV+F+ Y+GYVTV+  +GRALFYW  E      P+SKPLVLWLNG
Sbjct  33   QQKKDKIVKLPGQPANVTFSQYAGYVTVDPSAGRALFYWLIEVPRHLRPASKPLVLWLNG  92

Query  314  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  493
            GPGCSS+A+G +EEVGPF V  +GKTLY NPY+WN  ANLLF+DSPAGVG+SYSNTSSD+
Sbjct  93   GPGCSSVAYGASEEVGPFRVRPNGKTLYLNPYAWNREANLLFLDSPAGVGFSYSNTSSDV  152

Query  494  LTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
             T GDKRTA+D+  FL+ W ERFP+ K R FYI
Sbjct  153  YTPGDKRTAQDAFTFLMNWLERFPQYKHRPFYI  185



>gb|AFK37459.1| unknown [Lotus japonicus]
Length=463

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 133/182 (73%), Gaps = 1/182 (1%)
 Frame = +2

Query  47   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  226
            + M   + G LLF+  L  S      SS   +Q+LD +  LPG    V+FA +SGYVTVN
Sbjct  1    MSMVFQTKGLLLFLCALIFSFSCILASSVPKEQELDRISALPGQP-PVTFAQFSGYVTVN  59

Query  227  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  406
            +E GRALFYWF EA   P +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +L+ N 
Sbjct  60   EEHGRALFYWFTEATTSPQNKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLFLNK  119

Query  407  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREF  586
            Y+WN  AN+LF++SPAGVG+SY+NTSSD+ T GDKRTA+D+L FLL+W  RFP+ K REF
Sbjct  120  YAWNKEANILFLESPAGVGFSYTNTSSDLTTSGDKRTAQDALIFLLRWMARFPQYKYREF  179

Query  587  YI  592
            YI
Sbjct  180  YI  181



>ref|XP_009333715.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 132/181 (73%), Gaps = 10/181 (6%)
 Frame = +2

Query  56   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  235
            S  ++ C+L + L       G   +SV  Q  D +  LPG    V FA YSGYVTVN+++
Sbjct  5    SPFAFPCILLLFL-------GGCFASVQDQVRDRITQLPGQP-TVGFAQYSGYVTVNRKA  56

Query  236  GRALFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  409
            GRALFYW  E  A   P S+PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY
Sbjct  57   GRALFYWLTESPANRRPESRPLMLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPY  116

Query  410  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFY  589
            +WN  ANLLF++SPAGVG+SY+NTSSD+ T GD+RTAED+  FL+ WFERFP+ K R+FY
Sbjct  117  AWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQRTAEDAYAFLVNWFERFPQYKHRDFY  176

Query  590  I  592
            I
Sbjct  177  I  177



>ref|XP_010547376.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547377.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547378.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
Length=457

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 127/159 (80%), Gaps = 2/159 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLV  298
            +S ++ QK D + +LPG   NVSF+ YSGYVTVN++ GRALFYW  E+  +  P ++PLV
Sbjct  21   ASYLEDQKRDRIRELPGQPRNVSFSQYSGYVTVNEQRGRALFYWLTESPVNRVPKARPLV  80

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSS+A+G AEE+GPF +  DGK+LY NPY+WN  ANLLF++SPAGVG+SY+N
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKSLYLNPYAWNKLANLLFLESPAGVGFSYTN  140

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            T+SD+ T GD+RTAED+  FL+KWFERFP+ K R+ YI 
Sbjct  141  TTSDLYTTGDERTAEDAYTFLVKWFERFPQYKHRDLYIV  179



>ref|XP_008381976.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 132/181 (73%), Gaps = 10/181 (6%)
 Frame = +2

Query  56   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  235
            S  ++ C+L + L       G   +SV  Q  D +  LPG    V FA YSGYVTVN+++
Sbjct  5    SPFAFPCILLLFL-------GGCFASVQDQVRDRITQLPGQP-TVGFAQYSGYVTVNRKA  56

Query  236  GRALFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  409
            GRALFYW  E  A   P S+PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY
Sbjct  57   GRALFYWLTESPANRRPESRPLMLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPY  116

Query  410  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFY  589
            +WN  ANLLF++SPAGVG+SY+NTSSD+ T GD+RTAED+  FL+ WFERFP+ K R+FY
Sbjct  117  AWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQRTAEDAYAFLVNWFERFPQYKHRDFY  176

Query  590  I  592
            I
Sbjct  177  I  177



>ref|XP_008446902.1| PREDICTED: serine carboxypeptidase-like 27 [Cucumis melo]
Length=457

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 129/159 (81%), Gaps = 3/159 (2%)
 Frame = +2

Query  122  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPL  295
            GS + +Q++ D +  LPG   NV FA YSGYVTV++++GRALFYW  E      P+S+PL
Sbjct  22   GSYNAEQER-DRITQLPGQPKNVDFAQYSGYVTVDKQAGRALFYWLTETPTSRVPNSRPL  80

Query  296  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  475
            VLWLNGGPGCSS+A+G AEE+GPFH++ DG+TLY NPY+WN  ANLLF++SPAGVG+SYS
Sbjct  81   VLWLNGGPGCSSVAYGAAEEIGPFHIKPDGRTLYLNPYAWNKLANLLFLESPAGVGFSYS  140

Query  476  NTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            NT+SD+ T GD++TAED+ +FL+ WFERFP+ K R+FYI
Sbjct  141  NTTSDLYTAGDQKTAEDAHKFLVNWFERFPQYKHRDFYI  179



>ref|XP_009141517.1| PREDICTED: serine carboxypeptidase-like 28 [Brassica rapa]
Length=469

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 130/175 (74%), Gaps = 2/175 (1%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSS--SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  247
            C+  + ++   +D    SS  + +Q+  D +L LPG   N++F+ +SGYVTVN  +GRAL
Sbjct  16   CIFLLSMIIALLDVVMSSSEDAKEQKMRDRILSLPGQPPNLNFSQFSGYVTVNSAAGRAL  75

Query  248  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  427
            FYW  EA +   +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  NPY+WNL A
Sbjct  76   FYWLTEAPKPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNPYAWNLEA  135

Query  428  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            NLLF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+ K R FYI
Sbjct  136  NLLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWMERFPEYKERPFYI  190



>gb|KDP38716.1| hypothetical protein JCGZ_04069 [Jatropha curcas]
Length=266

 Score =   208 bits (529),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 119/153 (78%), Gaps = 9/153 (6%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKG-----SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  238
            CL F++ L      G G     S  + QQ+LD VL LPG  F+VSFAHYSGYVTVN+ESG
Sbjct  21   CLFFLINLYV----GTGVAFSLSDPIAQQELDRVLGLPGQTFDVSFAHYSGYVTVNEESG  76

Query  239  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  418
            RA FYWF EAVEDP SKPLVLWLNG PGCSSI +G AEEVG F+++ DGKTLY NPYSWN
Sbjct  77   RAFFYWFMEAVEDPESKPLVLWLNGRPGCSSIGYGEAEEVGLFYIQADGKTLYLNPYSWN  136

Query  419  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRT  517
              AN+LF+DSP GVG+SYSNTSSD+L +GDKRT
Sbjct  137  NVANILFIDSPVGVGFSYSNTSSDVLNNGDKRT  169



>ref|XP_011040962.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=468

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 130/177 (73%), Gaps = 5/177 (3%)
 Frame = +2

Query  77   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  247
            LL+VL LAT   S         +++Q+ D ++ L G   NVSF+ +SGY+TV+  +GRAL
Sbjct  12   LLYVLNLATLLLSTIAATNHGHLEEQRRDKIIKLHGQPPNVSFSQFSGYITVDPLAGRAL  71

Query  248  FYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  421
            FYW  E   +  P SKPL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NPY+WN 
Sbjct  72   FYWLIEVPKIVKPKSKPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPYAWNK  131

Query  422  AANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
             ANLLF+DSPAGVG+SYSNTSSD  T GDKRTA+D+  FL+ WFERFP+ K R FYI
Sbjct  132  VANLLFLDSPAGVGFSYSNTSSDTYTVGDKRTAKDAYTFLVNWFERFPQYKHRPFYI  188



>ref|XP_008233341.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
 ref|XP_008233342.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
Length=455

 Score =   213 bits (542),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 136/183 (74%), Gaps = 10/183 (5%)
 Frame = +2

Query  50   EMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  229
            + S  ++ C+L +         G   +S+  Q  D + +LPG   NV FA +SGYVTVN+
Sbjct  3    DHSPFAFLCILLLFF-------GACFASIQDQVRDRITNLPGQP-NVGFAQFSGYVTVNK  54

Query  230  ESGRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  403
            ++GRALFYW  E+ ++  P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N
Sbjct  55   KAGRALFYWLIESPKNRGPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYLN  114

Query  404  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGRE  583
            PY+WN  ANLLF++SPAGVG+SYSNT++D+ T+GD+RTAED+  FL+ WFERFP+ K R+
Sbjct  115  PYTWNNLANLLFLESPAGVGFSYSNTTTDLYTNGDQRTAEDAYAFLINWFERFPQYKHRD  174

Query  584  FYI  592
            FYI
Sbjct  175  FYI  177



>gb|EPS66906.1| hypothetical protein M569_07869, partial [Genlisea aurea]
Length=410

 Score =   212 bits (539),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 120/156 (77%), Gaps = 2/156 (1%)
 Frame = +2

Query  131  SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLVLW  304
            SV  Q+ D +  LPG   N++F  YSGYVTVN  +GRALFYW  EA  D  P S+PL+LW
Sbjct  20   SVQDQESDRITYLPGQPENIAFNQYSGYVTVNHTAGRALFYWLTEASVDSVPDSRPLLLW  79

Query  305  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  484
            LNGGPGCSSIA+G AEE+GPF +  +GKTLY N YSWN   NLLF++SPAGVGYSYSNTS
Sbjct  80   LNGGPGCSSIAYGAAEEIGPFRINSNGKTLYLNSYSWNKLVNLLFLESPAGVGYSYSNTS  139

Query  485  SDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            SD+ T GD+RTAEDS  FL+ WFE+FPK K R+FYI
Sbjct  140  SDLYTAGDRRTAEDSYAFLVSWFEKFPKYKHRDFYI  175



>gb|KFK38250.1| hypothetical protein AALP_AA3G088900 [Arabis alpina]
Length=461

 Score =   213 bits (542),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 123/161 (76%), Gaps = 2/161 (1%)
 Frame = +2

Query  119  KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKP  292
              S+ V++QK D +++LPG   N+ F  YSGY+TVNQE GRALFYW  E+     P S+P
Sbjct  23   NASTYVEEQKRDRIIELPGQPSNIDFRQYSGYITVNQEHGRALFYWLVESPLTRVPKSRP  82

Query  293  LVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSY  472
            LVLWLNGGPGCSS+A+G AEE+GPF V  DGKTLY   Y+WN  ANLLF++SPAGVG+SY
Sbjct  83   LVLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLYSKLYAWNKLANLLFLESPAGVGFSY  142

Query  473  SNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +NT+SD+   GD+RTAEDS  FL+ WFERFP+ K R+FYI 
Sbjct  143  TNTTSDLYITGDQRTAEDSYRFLVNWFERFPQYKHRDFYIV  183



>emb|CDY40439.1| BnaA04g20780D [Brassica napus]
Length=469

 Score =   213 bits (542),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 129/175 (74%), Gaps = 2/175 (1%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSS--SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  247
            C+  + ++   +D    SS  + +Q+  D +L LPG   N++F+ +SGYVTVN  +GRAL
Sbjct  16   CIFLLSMIIALLDVVMSSSEDAKEQKMRDRILSLPGQPPNLNFSQFSGYVTVNSAAGRAL  75

Query  248  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  427
            FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  NPY+WNL A
Sbjct  76   FYWLTEAPTPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNPYAWNLDA  135

Query  428  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            NLLF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+ K R FYI
Sbjct  136  NLLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWMERFPEYKERPFYI  190



>gb|KJB76563.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=452

 Score =   213 bits (541),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 122/158 (77%), Gaps = 2/158 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  298
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            T+SD+ T GDKRTAED+  FL+ WFERFP+ K R+FYI
Sbjct  137  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYI  174



>ref|XP_006407773.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
 gb|ESQ49226.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
Length=456

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 123/160 (77%), Gaps = 2/160 (1%)
 Frame = +2

Query  122  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPL  295
             SS V++QK D + +LPG   NV F  YSGY+TVN+E GRALFYW  E  A  DP S+PL
Sbjct  19   ASSYVEEQKRDRISELPGQPSNVDFRQYSGYITVNEERGRALFYWLVESPATRDPKSRPL  78

Query  296  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  475
            VLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SY+
Sbjct  79   VLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYT  138

Query  476  NTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            NT+SD+ T GD+RTAED+  FL+ W ERFP+ K R+FYI 
Sbjct  139  NTTSDLYTTGDQRTAEDAYRFLVNWLERFPQYKHRDFYIV  178



>ref|XP_002315293.2| hypothetical protein POPTR_0010s22700g [Populus trichocarpa]
 gb|EEF01464.2| hypothetical protein POPTR_0010s22700g [Populus trichocarpa]
Length=469

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 130/177 (73%), Gaps = 5/177 (3%)
 Frame = +2

Query  77   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  247
            LL+VL LAT   S         +++Q+ D ++ L G   NVSF+ +SGY+TV+  +GRAL
Sbjct  12   LLYVLNLATLLLSTIAATNHGHLEEQRRDKIIKLQGQPPNVSFSQFSGYITVDPLAGRAL  71

Query  248  FYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  421
            FYW  EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NPY+WN 
Sbjct  72   FYWLIEAPKIVKPKSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPYAWNK  131

Query  422  AANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
             ANLLF+DSPAGVG+SYSNTSSD  T GDKRTA+D+  FL+ WFERF + K R FYI
Sbjct  132  VANLLFLDSPAGVGFSYSNTSSDTYTVGDKRTAKDAYTFLVNWFERFTQYKHRPFYI  188



>ref|XP_002274723.1| PREDICTED: serine carboxypeptidase-like 27 [Vitis vinifera]
 emb|CBI31485.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 125/158 (79%), Gaps = 2/158 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  298
            SS ++ Q+ D + +LPG   N+ FA YSGYVTVN+++GRALFYW  +  A     S+PLV
Sbjct  21   SSYLEDQERDRITELPGQPKNIGFAQYSGYVTVNKQAGRALFYWLVQSPASRGAESRPLV  80

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTL+ NPY+WN  ANLLF++SPAGVG+SYSN
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLFINPYAWNNLANLLFLESPAGVGFSYSN  140

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            T+SD+ T GD+RTAED+  FL+ WFERFP+ K R+FYI
Sbjct  141  TTSDLYTAGDQRTAEDAYTFLINWFERFPQYKHRDFYI  178



>gb|KJB76567.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=482

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 122/158 (77%), Gaps = 2/158 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  298
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            T+SD+ T GDKRTAED+  FL+ WFERFP+ K R+FYI
Sbjct  137  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYI  174



>gb|KJB76571.1| hypothetical protein B456_012G095000 [Gossypium raimondii]
Length=472

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 126/174 (72%), Gaps = 2/174 (1%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
            L++ L++ + +          +Q  D ++ LPG   NV F+ YSGY+TV  ++GRALFYW
Sbjct  15   LVYFLVIGSLVVWSAEGGHRKEQARDRIVKLPGQPRNVKFSQYSGYITVEAKAGRALFYW  74

Query  257  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  430
              EA     P +KPLVLWLNGGPGCSSIA+G +EEVGPF V +DGK+L  NPY+WN  AN
Sbjct  75   LTEAPAKSRPETKPLVLWLNGGPGCSSIAYGASEEVGPFRVREDGKSLRLNPYAWNQEAN  134

Query  431  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            LLF+DSPAGVG+SYSNTSSDI T GDKRTAED+  FL+KW ERFP  K R FYI
Sbjct  135  LLFLDSPAGVGFSYSNTSSDIYTAGDKRTAEDAYTFLMKWLERFPNYKHRPFYI  188



>gb|KJB76566.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=484

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 122/158 (77%), Gaps = 2/158 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  298
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            T+SD+ T GDKRTAED+  FL+ WFERFP+ K R+FYI
Sbjct  137  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYI  174



>ref|XP_011031766.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=466

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 130/186 (70%), Gaps = 6/186 (3%)
 Frame = +2

Query  53   MSALSWGCLLFVLL----LATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVT  220
            M   S  C LF +L    L  S         +++Q+ D ++ LPG   NVSF+ +SGY+T
Sbjct  1    MRIKSSSCFLFSVLNFATLLLSTPAVTNHDHLEEQRRDRIIKLPGQPPNVSFSQFSGYIT  60

Query  221  VNQESGRALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTL  394
            V+   GRALFYW  EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DG+TL
Sbjct  61   VDPVEGRALFYWLNEAPKIVKPRSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGETL  120

Query  395  YWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKK  574
            + NPY+WN  ANLLF+DSPAGVG+SYSNTSSD+ T GD RTA+D+  FL+ W ERFP+ K
Sbjct  121  HLNPYAWNKVANLLFLDSPAGVGFSYSNTSSDVYTVGDGRTAKDAYTFLINWLERFPRYK  180

Query  575  GREFYI  592
             R FYI
Sbjct  181  HRPFYI  186



>ref|XP_007009787.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
 gb|EOY18597.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
Length=552

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 122/157 (78%), Gaps = 2/157 (1%)
 Frame = +2

Query  128  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVL  301
            SS   Q LD + +LPG   NV F  YSGYVTVN+++GRALFYW  E      P ++PLVL
Sbjct  85   SSFGDQNLDKITELPGQPKNVEFNQYSGYVTVNEQAGRALFYWLIELPVSRSPETRPLVL  144

Query  302  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  481
            WLNGGPGCSS+A+G AEE+GPFH+  DG+TLY N Y+WN  AN+LF++SPAGVG+SYSNT
Sbjct  145  WLNGGPGCSSLAYGAAEEIGPFHIRPDGRTLYLNRYAWNNLANMLFLESPAGVGFSYSNT  204

Query  482  SSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            +SD+ T GD+RTAED+  FL+ WFERFP+ K R+FYI
Sbjct  205  TSDLYTAGDRRTAEDAYAFLVNWFERFPQYKHRDFYI  241



>ref|XP_009147010.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Brassica 
rapa]
Length=450

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 120/155 (77%), Gaps = 2/155 (1%)
 Frame = +2

Query  134  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  307
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWL  85

Query  308  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  487
            NGGPGCSS+A+G  EEVGPF V  DGKTLY   Y+WN  ANLLF++SPAGVG+SY+N++S
Sbjct  86   NGGPGCSSVAYGATEEVGPFRVGSDGKTLYNKLYAWNKLANLLFLESPAGVGFSYTNSTS  145

Query  488  DILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            D+ T GD+RTAEDS  FL+ WFERFP+ K R+FYI
Sbjct  146  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYI  180



>emb|CDY35977.1| BnaA05g29730D [Brassica napus]
Length=459

 Score =   211 bits (538),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 121/155 (78%), Gaps = 2/155 (1%)
 Frame = +2

Query  134  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  307
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWL  85

Query  308  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  487
            NGGPGCSS+A+G AEEVGPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SY+N++S
Sbjct  86   NGGPGCSSVAYGAAEEVGPFRVGSDGKTLHNKLYAWNKLANLLFLESPAGVGFSYTNSTS  145

Query  488  DILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            D+ T GD+RTAEDS  FL+ WFERFP+ K R+FYI
Sbjct  146  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYI  180



>ref|XP_010460785.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=457

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 128/174 (74%), Gaps = 2/174 (1%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
             L ++LL T       SS V++Q  D +  LPG   NV F  YSGYVTVN+E GRALFYW
Sbjct  5    FLVIILLFTISSSWSASSYVEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYW  64

Query  257  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  430
              E+    DP S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  AN
Sbjct  65   LVESPLTRDPKSRPLVLWLNGGPGCSSVAYGGAEEIGPFRVGSDGKTLHPKLYAWNKLAN  124

Query  431  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            LLF+++PAGVG+SYSNTSSD+ T GD+RTAEDS  FL+ WFERFP+ K R+FYI
Sbjct  125  LLFLEAPAGVGFSYSNTSSDLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYI  178



>ref|XP_009147009.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Brassica 
rapa]
Length=459

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 120/155 (77%), Gaps = 2/155 (1%)
 Frame = +2

Query  134  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  307
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWL  85

Query  308  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  487
            NGGPGCSS+A+G  EEVGPF V  DGKTLY   Y+WN  ANLLF++SPAGVG+SY+N++S
Sbjct  86   NGGPGCSSVAYGATEEVGPFRVGSDGKTLYNKLYAWNKLANLLFLESPAGVGFSYTNSTS  145

Query  488  DILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            D+ T GD+RTAEDS  FL+ WFERFP+ K R+FYI
Sbjct  146  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYI  180



>emb|CDY28004.1| BnaC05g44060D [Brassica napus]
Length=459

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 121/155 (78%), Gaps = 2/155 (1%)
 Frame = +2

Query  134  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  307
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWL  85

Query  308  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  487
            NGGPGCSS+A+G AEEVGPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SY+N++S
Sbjct  86   NGGPGCSSVAYGAAEEVGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYTNSTS  145

Query  488  DILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            D+ T GD+RTAEDS  FL+ WFERFP+ K R+FYI
Sbjct  146  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYI  180



>ref|XP_007009790.1| Serine carboxypeptidase-like 28 [Theobroma cacao]
 gb|EOY18600.1| Serine carboxypeptidase-like 28 [Theobroma cacao]
Length=464

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 122/159 (77%), Gaps = 2/159 (1%)
 Frame = +2

Query  122  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAV--EDPSSKPL  295
            G +   +Q+ D ++ LPG    V+F+ YSGY+TV+ ++GRALFYW  +A     P+SKPL
Sbjct  22   GGNHRKEQERDRIVKLPGQPPKVNFSQYSGYITVDPKAGRALFYWLIKAPFKSQPASKPL  81

Query  296  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  475
            VLWLNGGPGCSS+A+G +EEVGPF V  DGKTL  NPY+WN  ANLLF+DSPAGVG+SYS
Sbjct  82   VLWLNGGPGCSSVAYGASEEVGPFRVRSDGKTLRLNPYAWNQEANLLFLDSPAGVGFSYS  141

Query  476  NTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            NTSSDI T GDKRTAED+  FL+KW ERFP  K R FYI
Sbjct  142  NTSSDIYTVGDKRTAEDAYTFLIKWLERFPNYKHRPFYI  180



>ref|XP_004288721.2| PREDICTED: serine carboxypeptidase 24 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 133/176 (76%), Gaps = 3/176 (2%)
 Frame = +2

Query  68   WGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  247
            +  L+F+L L T+      +++  +Q+LD +  LPG    VSF+ YSGYVTVN++ GRAL
Sbjct  17   YSILVFMLSLTTTTINV--AATAKEQELDRITALPGQP-PVSFSQYSGYVTVNKKHGRAL  73

Query  248  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  427
            FYWF EA   P +KPLVLW NGGPGCSS+A+G +EE+GPF + + G +LY N YSWN  A
Sbjct  74   FYWFTEATASPHNKPLVLWFNGGPGCSSVAYGASEEIGPFRINRTGSSLYLNKYSWNREA  133

Query  428  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            N+LF++SPAGVG+SY+NTS+D++  GDKRTA+D+L FLL+W  RFP+ K REFYI+
Sbjct  134  NILFLESPAGVGFSYTNTSADLIDSGDKRTAQDALTFLLQWLSRFPQYKYREFYIS  189



>ref|NP_187456.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
 sp|Q9SFB5.1|SCP27_ARATH RecName: Full=Serine carboxypeptidase-like 27; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF21209.1|AC013483_33 putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAT71955.1| At3g07990 [Arabidopsis thaliana]
 gb|AAU95440.1| At3g07990 [Arabidopsis thaliana]
 gb|AEE74628.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
Length=459

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 123/159 (77%), Gaps = 2/159 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  298
            SS V++Q  D + +LPG   NV F  YSGYVTV++E GRALFYW  E+    DP S+PLV
Sbjct  23   SSYVEEQLRDRISNLPGQPSNVDFRQYSGYVTVHEERGRALFYWLVESPLARDPKSRPLV  82

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYSN
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHSKLYAWNKLANLLFLESPAGVGFSYSN  142

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            T+SD+ T GD+RTAEDS  FL+ WFERFP+ K REFYI 
Sbjct  143  TTSDLYTTGDQRTAEDSYIFLVNWFERFPQYKHREFYIV  181



>ref|XP_003591950.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62201.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=459

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 130/179 (73%), Gaps = 2/179 (1%)
 Frame = +2

Query  62   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  241
            + +     VL ++    G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGR
Sbjct  1    MGYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGR  60

Query  242  ALFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  415
            ALFYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y+W
Sbjct  61   ALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRYAW  120

Query  416  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            N  AN+LF+DSPAGVG+SY N ++D+ T GD++TAED+  FL+ WFERFP+ K REFYI
Sbjct  121  NNLANILFLDSPAGVGFSYCNKTTDLYTFGDQKTAEDAYIFLVNWFERFPQYKHREFYI  179



>ref|XP_003591949.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 ref|XP_003638560.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=461

 Score =   211 bits (536),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 130/179 (73%), Gaps = 2/179 (1%)
 Frame = +2

Query  62   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  241
            + +     VL ++    G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGR
Sbjct  1    MGYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGR  60

Query  242  ALFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  415
            ALFYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y+W
Sbjct  61   ALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRYAW  120

Query  416  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            N  AN+LF+DSPAGVG+SY N ++D+ T GD++TAED+  FL+ WFERFP+ K REFYI
Sbjct  121  NNLANILFLDSPAGVGFSYCNKTTDLYTFGDQKTAEDAYIFLVNWFERFPQYKHREFYI  179



>ref|XP_010260054.1| PREDICTED: serine carboxypeptidase-like 25 isoform X2 [Nelumbo 
nucifera]
Length=421

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 127/157 (81%), Gaps = 1/157 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  304
            SSS ++++ D +  LPG   NVSF  +SGYVTV+Q +GRALFYW  EAV+DP SKPLV+W
Sbjct  22   SSSHEEEEADRITALPGQP-NVSFQQFSGYVTVDQVAGRALFYWLTEAVQDPVSKPLVVW  80

Query  305  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  484
            LNGGPGCSS+A+G +EE+GPF + + G  LY N +SWN+ ANLLF+++PAGVG+SY+N S
Sbjct  81   LNGGPGCSSVAYGASEEIGPFRLNRSGSGLYINKFSWNILANLLFLETPAGVGFSYTNRS  140

Query  485  SDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            SD+L  GD+RTA+DSLEFL++W +RFP+ K RE Y+T
Sbjct  141  SDLLDTGDQRTAKDSLEFLIRWLDRFPRYKNREVYLT  177



>gb|AES62200.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=491

 Score =   211 bits (536),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 130/179 (73%), Gaps = 2/179 (1%)
 Frame = +2

Query  62   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  241
            + +     VL ++    G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGR
Sbjct  1    MGYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGR  60

Query  242  ALFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  415
            ALFYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y+W
Sbjct  61   ALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRYAW  120

Query  416  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            N  AN+LF+DSPAGVG+SY N ++D+ T GD++TAED+  FL+ WFERFP+ K REFYI
Sbjct  121  NNLANILFLDSPAGVGFSYCNKTTDLYTFGDQKTAEDAYIFLVNWFERFPQYKHREFYI  179



>gb|KCW65386.1| hypothetical protein EUGRSUZ_G02816 [Eucalyptus grandis]
Length=467

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 123/153 (80%), Gaps = 2/153 (1%)
 Frame = +2

Query  140  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVLWLNG  313
            +++ D + +LPG   N  FA YSGYVTVN+++GRALFYW  E  A   P S+PLVLWLNG
Sbjct  37   ERERDRIGELPGQPPNAGFAQYSGYVTVNRQAGRALFYWLVESPASRRPESRPLVLWLNG  96

Query  314  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  493
            GPGCSS+A+GLAEE+GPF +  DGKTLY NPY+W+  ANLLF++SPAG+G+SY+NT+SD+
Sbjct  97   GPGCSSVAYGLAEEIGPFRIRPDGKTLYSNPYAWSKLANLLFLESPAGIGFSYTNTTSDL  156

Query  494  LTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
             T GD+RTAED+  FL+ WFERFP+ K R+FYI
Sbjct  157  YTTGDQRTAEDAYAFLVNWFERFPEYKHRDFYI  189



>gb|KDO48447.1| hypothetical protein CISIN_1g012819mg [Citrus sinensis]
Length=456

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 120/158 (76%), Gaps = 2/158 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  298
            S S+  Q  D +  LPG   NV F  YSGYV+VNQ++GRALFYW  E  A   P S+PL+
Sbjct  21   SYSLADQDKDKITVLPGQPTNVDFNQYSGYVSVNQQAGRALFYWLIESPASRKPESRPLI  80

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SY+N
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYLNPYSWNKLANLLFLESPAGVGFSYTN  140

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            T+SD+ T GD RTAED+  FL+ WFERFP+ K  +FYI
Sbjct  141  TTSDLYTAGDGRTAEDAYTFLVNWFERFPQYKHTDFYI  178



>emb|CAN74854.1| hypothetical protein VITISV_028701 [Vitis vinifera]
Length=452

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 121/152 (80%), Gaps = 2/152 (1%)
 Frame = +2

Query  143  QKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVLWLNGG  316
            Q+ D + +LPG   N+ FA YSGYVTVN+++GRALFYW  +  A     S+PLVLWLNGG
Sbjct  23   QERDRITELPGQPKNIGFAQYSGYVTVNKQAGRALFYWLVQSPASRGAESRPLVLWLNGG  82

Query  317  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  496
            PGCSS+A+G AEE+GPF +  DGKTL+ NPY+WN  ANLLF++SPAGVG+SYSNT+SD+ 
Sbjct  83   PGCSSVAYGAAEEIGPFRIRPDGKTLFINPYAWNNLANLLFLESPAGVGFSYSNTTSDLY  142

Query  497  THGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            T GD+RTAED+  FL+ WFERFP+ K R+FYI
Sbjct  143  TAGDQRTAEDAYTFLINWFERFPQYKHRDFYI  174



>ref|XP_002274699.1| PREDICTED: serine carboxypeptidase-like 28 [Vitis vinifera]
Length=472

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 134/182 (74%), Gaps = 5/182 (3%)
 Frame = +2

Query  56   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  235
            S+L +  L F +LL +S   G  + + + Q  D ++ LPG   NV F+ YSGY+TV+  +
Sbjct  11   SSLFFCVLGFFILLVSS---GATAGNREDQVRDRIVKLPGEPPNVGFSQYSGYITVDPRA  67

Query  236  GRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  409
            GRALFYW  EA +   P+S+PL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NPY
Sbjct  68   GRALFYWLIEAPKSRGPASRPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPY  127

Query  410  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFY  589
            +WN  ANLLF+DSPAGVG+SYSNTSSD+   GDKRTA+D+ +FL+ W +RFP+ K R FY
Sbjct  128  AWNAEANLLFLDSPAGVGFSYSNTSSDLPNVGDKRTAKDAYKFLINWLQRFPQYKHRPFY  187

Query  590  IT  595
            I 
Sbjct  188  IA  189



>ref|XP_010260044.1| PREDICTED: serine carboxypeptidase-like 25 isoform X1 [Nelumbo 
nucifera]
Length=462

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 127/157 (81%), Gaps = 1/157 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  304
            SSS ++++ D +  LPG   NVSF  +SGYVTV+Q +GRALFYW  EAV+DP SKPLV+W
Sbjct  22   SSSHEEEEADRITALPGQP-NVSFQQFSGYVTVDQVAGRALFYWLTEAVQDPVSKPLVVW  80

Query  305  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  484
            LNGGPGCSS+A+G +EE+GPF + + G  LY N +SWN+ ANLLF+++PAGVG+SY+N S
Sbjct  81   LNGGPGCSSVAYGASEEIGPFRLNRSGSGLYINKFSWNILANLLFLETPAGVGFSYTNRS  140

Query  485  SDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            SD+L  GD+RTA+DSLEFL++W +RFP+ K RE Y+T
Sbjct  141  SDLLDTGDQRTAKDSLEFLIRWLDRFPRYKNREVYLT  177



>ref|XP_010464446.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 120/155 (77%), Gaps = 2/155 (1%)
 Frame = +2

Query  134  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  307
            V++Q  D +  LPG   NV F  YSGYVTVN+E GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYWLVESPLTRDPKSRPLVLWL  85

Query  308  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  487
            NGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYSNTSS
Sbjct  86   NGGPGCSSVAYGGAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYSNTSS  145

Query  488  DILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            D+ T GD+RTAEDS  FL+ WFERFP+ K R+FYI
Sbjct  146  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYI  180



>ref|XP_006436271.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
 ref|XP_006485878.1| PREDICTED: serine carboxypeptidase-like 27-like [Citrus sinensis]
 gb|ESR49511.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
Length=456

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 120/158 (76%), Gaps = 2/158 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  298
            S S+  Q  D +  LPG   NV F  YSGYV+VNQ++GRALFYW  E  A   P S+PL+
Sbjct  21   SYSLADQDKDKITVLPGQPTNVDFNQYSGYVSVNQQAGRALFYWLIESPASRKPESRPLI  80

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SY+N
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYLNPYSWNKLANLLFLESPAGVGFSYTN  140

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            T+SD+ T GD RTAED+  FL+ WFERFP+ K  +FYI
Sbjct  141  TTSDLYTAGDGRTAEDAYTFLVNWFERFPQYKHTDFYI  178



>ref|XP_004496293.1| PREDICTED: serine carboxypeptidase-like 27-like isoform X2 [Cicer 
arietinum]
Length=419

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 124/158 (78%), Gaps = 2/158 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLV  298
            S+S++ Q+ D +  LPG   NV F  YSGYVTVN+E+ RALFYW  E+  +  P+ +PLV
Sbjct  24   SASMEDQRRDKIKLLPGQPKNVGFEQYSGYVTVNEENERALFYWLIESPMNRGPNLRPLV  83

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN  AN+LF+DSPAGVG+SY N
Sbjct  84   LWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWNNLANILFLDSPAGVGFSYCN  143

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
             ++D+ T GD++TAED+  FL+ WFERFP+ K REFYI
Sbjct  144  KTTDLYTFGDQKTAEDAYVFLVNWFERFPQYKHREFYI  181



>gb|EYU39590.1| hypothetical protein MIMGU_mgv1a0101821mg, partial [Erythranthe 
guttata]
Length=183

 Score =   201 bits (511),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 126/178 (71%), Gaps = 7/178 (4%)
 Frame = +2

Query  71   GCLLFVLLL----ATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  238
            G L+F L L    ATSI          QQ LD +  LPG   +V F+ YSGY+ VN+   
Sbjct  3    GQLIFALFLLPIIATSIS--TTPPYPKQQALDKITKLPGQPSSVKFSQYSGYIKVNENPI  60

Query  239  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  418
            RALFYWF EA + P SKPLVLWLNGGPGCSSIA+G +EEVGPF V  DG+TL  +  SWN
Sbjct  61   RALFYWFIEATKKPESKPLVLWLNGGPGCSSIAYGASEEVGPFRVGADGRTLSLSHTSWN  120

Query  419  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
              ANL+F+DSPAGVG+SYSN SSD+ T GD+RTA+D+ +FL KWF+RFP+ K R FY+
Sbjct  121  KEANLVFLDSPAGVGFSYSNDSSDLKT-GDQRTAKDAYKFLTKWFQRFPQYKYRSFYL  177



>emb|CBI31484.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 134/182 (74%), Gaps = 5/182 (3%)
 Frame = +2

Query  56   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  235
            S+L +  L F +LL +S   G  + + + Q  D ++ LPG   NV F+ YSGY+TV+  +
Sbjct  22   SSLFFCVLGFFILLVSS---GATAGNREDQVRDRIVKLPGEPPNVGFSQYSGYITVDPRA  78

Query  236  GRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  409
            GRALFYW  EA +   P+S+PL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NPY
Sbjct  79   GRALFYWLIEAPKSRGPASRPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPY  138

Query  410  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFY  589
            +WN  ANLLF+DSPAGVG+SYSNTSSD+   GDKRTA+D+ +FL+ W +RFP+ K R FY
Sbjct  139  AWNAEANLLFLDSPAGVGFSYSNTSSDLPNVGDKRTAKDAYKFLINWLQRFPQYKHRPFY  198

Query  590  IT  595
            I 
Sbjct  199  IA  200



>ref|XP_010486379.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 120/155 (77%), Gaps = 2/155 (1%)
 Frame = +2

Query  134  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  307
            V++Q  D +  LPG   NV F  YSGYVTVN+E GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYWLVESPLTRDPKSRPLVLWL  85

Query  308  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  487
            NGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYSNTSS
Sbjct  86   NGGPGCSSVAYGGAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYSNTSS  145

Query  488  DILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            D+ T GD+RTAEDS  FL+ WFERFP+ K R+FYI
Sbjct  146  DLYTTGDQRTAEDSYRFLVSWFERFPQYKHRDFYI  180



>gb|ACA61622.1| hypothetical protein AP7_B10.2 [Arabidopsis lyrata subsp. petraea]
Length=200

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = +2

Query  137  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  316
            +Q+  D ++ LPG   N++F+ +SGYVTV+  +GR LFYW  EA     +KPLVLWLNGG
Sbjct  16   EQKMKDKIISLPGQPPNLNFSQFSGYVTVDSAAGRNLFYWLTEAPRPSGTKPLVLWLNGG  75

Query  317  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  496
            PGCSSIA+G +EEVGPF +  DGKTL  N Y+WN  AN+LF+DSPAGVG+SY+NTSSD L
Sbjct  76   PGCSSIAYGASEEVGPFRINPDGKTLRLNLYAWNKVANVLFLDSPAGVGFSYTNTSSDKL  135

Query  497  THGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            T GDKRT ED+  FL++W ERFP+ K R FYI
Sbjct  136  TVGDKRTGEDAYRFLVRWMERFPEYKERPFYI  167



>gb|KHG08205.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=452

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 121/158 (77%), Gaps = 2/158 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  298
            S+    Q  D + +LPG   NV F  YSGYVT+NQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTSDKITELPGQPKNVGFNQYSGYVTLNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            T+SD+ T GDKRTAED+  FL+ WFERFP+ K R+FYI
Sbjct  137  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYI  174



>ref|XP_010067290.1| PREDICTED: serine carboxypeptidase-like 27 [Eucalyptus grandis]
Length=528

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 123/153 (80%), Gaps = 2/153 (1%)
 Frame = +2

Query  140  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVLWLNG  313
            +++ D + +LPG   N  FA YSGYVTVN+++GRALFYW  E  A   P S+PLVLWLNG
Sbjct  98   ERERDRIGELPGQPPNAGFAQYSGYVTVNRQAGRALFYWLVESPASRRPESRPLVLWLNG  157

Query  314  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  493
            GPGCSS+A+GLAEE+GPF +  DGKTLY NPY+W+  ANLLF++SPAG+G+SY+NT+SD+
Sbjct  158  GPGCSSVAYGLAEEIGPFRIRPDGKTLYSNPYAWSKLANLLFLESPAGIGFSYTNTTSDL  217

Query  494  LTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
             T GD+RTAED+  FL+ WFERFP+ K R+FYI
Sbjct  218  YTTGDQRTAEDAYAFLVNWFERFPEYKHRDFYI  250



>ref|XP_009399563.1| PREDICTED: serine carboxypeptidase 24-like [Musa acuminata subsp. 
malaccensis]
Length=458

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 124/156 (79%), Gaps = 1/156 (1%)
 Frame = +2

Query  128  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWL  307
            ++ D+Q LD +  LPG    VSFA ++GYVTVNQE GRALFYW  EAV D + KPLVLWL
Sbjct  22   AAADRQALDRISALPGQP-RVSFAQFAGYVTVNQERGRALFYWLTEAVTDAAKKPLVLWL  80

Query  308  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  487
            NGGPGCSS+A+G +EE+GPF +++ G +LY N +SWN  ANLLF++SPAGVG+SY+N SS
Sbjct  81   NGGPGCSSVAYGASEEIGPFRIDRTGSSLYLNKFSWNREANLLFLESPAGVGFSYANVSS  140

Query  488  DILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            D+ + GD+RTA+D+L FL++W  RFP+ K REFYI+
Sbjct  141  DLQSVGDERTAQDALAFLIRWMSRFPEYKHREFYIS  176



>ref|XP_009386999.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=474

 Score =   209 bits (531),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 117/155 (75%), Gaps = 1/155 (1%)
 Frame = +2

Query  128  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWL  307
            S  +QQ+ D V  LPG    V FA YSGYVTV   +GRALFYW  EA       PLVLWL
Sbjct  40   SPAEQQEQDRVARLPGQP-RVDFAQYSGYVTVEARAGRALFYWLVEAPPSAQPAPLVLWL  98

Query  308  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  487
            NGGPGCSSIA+G +EE+GPF ++ DGKTLY NPY+WN  AN+LF+DSPAGVG+SY+NTSS
Sbjct  99   NGGPGCSSIAYGASEELGPFRIDSDGKTLYLNPYAWNTVANVLFLDSPAGVGFSYTNTSS  158

Query  488  DILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            D+ T GD RTA D+  FL+KWFERFP+ K REFYI
Sbjct  159  DLHTSGDHRTAVDAYNFLVKWFERFPQYKHREFYI  193



>gb|KJB76569.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=451

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 122/158 (77%), Gaps = 3/158 (2%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  298
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  +N+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWN-NSNVLFLESPAGVGFSYTN  135

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            T+SD+ T GDKRTAED+  FL+ WFERFP+ K R+FYI
Sbjct  136  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYI  173



>ref|XP_011040963.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   208 bits (529),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 128/179 (72%), Gaps = 7/179 (4%)
 Frame = +2

Query  62   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  241
            LS  CLL    + + I      +  + Q  D +  LPG   +  F  YSGYVTV ++SGR
Sbjct  6    LSILCLLVSPFVYSCI-----CAPFEDQGRDKITYLPGQPGSAEFNQYSGYVTVKKQSGR  60

Query  242  ALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  415
            ALFYW  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF + +DGKTLY NPY+W
Sbjct  61   ALFYWLVEAPTSRRPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRRDGKTLYSNPYAW  120

Query  416  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            N  ANLLF++SPAGVG+SYSNTSSD+ T GD+RTAED+  FL+ WFERFP+ K R+FYI
Sbjct  121  NKLANLLFLESPAGVGFSYSNTSSDLYTAGDQRTAEDAYTFLVNWFERFPQYKYRDFYI  179



>ref|XP_010505097.1| PREDICTED: serine carboxypeptidase-like 28 [Camelina sativa]
Length=469

 Score =   208 bits (530),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 127/177 (72%), Gaps = 2/177 (1%)
 Frame = +2

Query  68   WGCLLFVLLLATSIDGGKGSSSVD--QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  241
            + C+  V ++   +D    S   D  Q+  D ++ LPG   N++F+ +SGYVTV+  +GR
Sbjct  10   YQCMFLVCMMIALLDVVSSSDDADKEQKTKDKIISLPGQPPNLNFSQFSGYVTVDSTAGR  69

Query  242  ALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  421
            ALFYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF +  DGKTL +N Y+WN 
Sbjct  70   ALFYWLTEAPRPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRINPDGKTLRFNIYAWNK  129

Query  422  AANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
             AN+LF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+ K R FYI
Sbjct  130  VANVLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWMERFPEYKERPFYI  186



>ref|XP_004496292.1| PREDICTED: serine carboxypeptidase-like 27-like isoform X1 [Cicer 
arietinum]
Length=462

 Score =   208 bits (529),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 124/158 (78%), Gaps = 2/158 (1%)
 Frame = +2

Query  125  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLV  298
            S+S++ Q+ D +  LPG   NV F  YSGYVTVN+E+ RALFYW  E+  +  P+ +PLV
Sbjct  24   SASMEDQRRDKIKLLPGQPKNVGFEQYSGYVTVNEENERALFYWLIESPMNRGPNLRPLV  83

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN  AN+LF+DSPAGVG+SY N
Sbjct  84   LWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWNNLANILFLDSPAGVGFSYCN  143

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
             ++D+ T GD++TAED+  FL+ WFERFP+ K REFYI
Sbjct  144  KTTDLYTFGDQKTAEDAYVFLVNWFERFPQYKHREFYI  181



>ref|XP_002280058.1| PREDICTED: serine carboxypeptidase-like 25 [Vitis vinifera]
Length=473

 Score =   208 bits (529),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 128/182 (70%), Gaps = 5/182 (3%)
 Frame = +2

Query  62   LSWGCLLFVLLLATSIDGG----KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  229
            +S   +L  LLL   +D G     G    ++++ D +  LPG    VSF  YSGYVTVN 
Sbjct  8    ISASMVLLSLLLIAVVDAGSHGVNGVRGGEEEEADRITALPGQP-KVSFQQYSGYVTVNH  66

Query  230  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  409
             +GRALFYW  EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +
Sbjct  67   VAGRALFYWLNEAVHDPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKF  126

Query  410  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFY  589
            SWN  ANLLF+++PAGVG+SYSN SSD+L  GD+RTA+DSL FL++W ERFP+ K RE Y
Sbjct  127  SWNTLANLLFLETPAGVGFSYSNKSSDLLDTGDRRTAKDSLVFLVRWLERFPRYKHREVY  186

Query  590  IT  595
            I 
Sbjct  187  IN  188



>emb|CBI21207.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   208 bits (529),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 128/182 (70%), Gaps = 5/182 (3%)
 Frame = +2

Query  62   LSWGCLLFVLLLATSIDGG----KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  229
            +S   +L  LLL   +D G     G    ++++ D +  LPG    VSF  YSGYVTVN 
Sbjct  6    ISASMVLLSLLLIAVVDAGSHGVNGVRGGEEEEADRITALPGQP-KVSFQQYSGYVTVNH  64

Query  230  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  409
             +GRALFYW  EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +
Sbjct  65   VAGRALFYWLNEAVHDPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKF  124

Query  410  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFY  589
            SWN  ANLLF+++PAGVG+SYSN SSD+L  GD+RTA+DSL FL++W ERFP+ K RE Y
Sbjct  125  SWNTLANLLFLETPAGVGFSYSNKSSDLLDTGDRRTAKDSLVFLVRWLERFPRYKHREVY  184

Query  590  IT  595
            I 
Sbjct  185  IN  186



>gb|AFK43035.1| unknown [Medicago truncatula]
Length=459

 Score =   207 bits (528),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 129/179 (72%), Gaps = 2/179 (1%)
 Frame = +2

Query  62   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  241
            + +     VL ++    G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGR
Sbjct  1    MGYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGR  60

Query  242  ALFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  415
            ALFYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y+W
Sbjct  61   ALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRYAW  120

Query  416  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            N  AN+LF+DSPAGVG+SY N ++D+ T GD++TAE +  FL+ WFERFP+ K REFYI
Sbjct  121  NNLANILFLDSPAGVGFSYCNKTTDLYTFGDQKTAEGAYIFLVNWFERFPQYKHREFYI  179



>ref|XP_006297634.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30532.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=434

 Score =   207 bits (526),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 120/156 (77%), Gaps = 2/156 (1%)
 Frame = +2

Query  134  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  307
            V++Q  D + +LPG   NV F  YSGYVTVN++ GRALFYW  E+     P S+PLVLWL
Sbjct  29   VEEQLRDRISELPGQPSNVDFRQYSGYVTVNEKRGRALFYWLVESPLTRSPKSRPLVLWL  88

Query  308  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  487
            NGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYSNT+S
Sbjct  89   NGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYSNTTS  148

Query  488  DILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            D+ T GD+RTAEDS  FL+ WFERFP+ K R+FYI 
Sbjct  149  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIV  184



>ref|XP_009792407.1| PREDICTED: serine carboxypeptidase 24-like [Nicotiana sylvestris]
Length=468

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 128/173 (74%), Gaps = 2/173 (1%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
            LL +L L  +I+    +S   +Q+ D ++ LPG    V+F+ +SGYVTVN+  GRALFYW
Sbjct  16   LLIILSLTITINN-VAASLTKEQEFDRIISLPGQP-PVTFSQFSGYVTVNENHGRALFYW  73

Query  257  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  436
              EA   P  KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSWN  AN+L
Sbjct  74   LTEATTQPEKKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSWNKVANIL  133

Query  437  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            F++SPAGVG+SY+NTSSD+   GDKRTA+D+L FL++W  RFP+ K R+FYI+
Sbjct  134  FLESPAGVGFSYTNTSSDLKDSGDKRTAQDALIFLIRWMSRFPQYKYRDFYIS  186



>ref|XP_003591947.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62198.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=458

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 128/179 (72%), Gaps = 2/179 (1%)
 Frame = +2

Query  62   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  241
            +S      VL L     G   +SS+ +QK D +  LPG    V F  YSGYVTVN+ESGR
Sbjct  1    MSHSIFCVVLFLTIFCVGISLASSIKEQKRDKIKWLPGQPKIVGFEQYSGYVTVNEESGR  60

Query  242  ALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  415
            ALFYW  EA     P+SKPLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+LY NPY+W
Sbjct  61   ALFYWLTEAPLSHGPNSKPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLYLNPYAW  120

Query  416  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            N  AN+LF++SPAGVG+SY N ++D+   GD++TAED+  FL+ WFERFP+ K REFY+
Sbjct  121  NNLANILFLESPAGVGFSYCNKTTDMQNFGDQKTAEDAYIFLVNWFERFPQYKHREFYM  179



>ref|XP_006297635.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30533.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=460

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 120/156 (77%), Gaps = 2/156 (1%)
 Frame = +2

Query  134  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  307
            V++Q  D + +LPG   NV F  YSGYVTVN++ GRALFYW  E+     P S+PLVLWL
Sbjct  27   VEEQLRDRISELPGQPSNVDFRQYSGYVTVNEKRGRALFYWLVESPLTRSPKSRPLVLWL  86

Query  308  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  487
            NGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYSNT+S
Sbjct  87   NGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYSNTTS  146

Query  488  DILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            D+ T GD+RTAEDS  FL+ WFERFP+ K R+FYI 
Sbjct  147  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIV  182



>ref|NP_181120.2| serine carboxypeptidase-like 28 [Arabidopsis thaliana]
 sp|Q8S8K6.2|SCP28_ARATH RecName: Full=Serine carboxypeptidase-like 28; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEC09159.1| serine carboxypeptidase-like 28 [Arabidopsis thaliana]
Length=462

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 125/173 (72%), Gaps = 5/173 (3%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
            C++  LL   S D  K     +Q+  D ++ LPG   N++F+ +SGYVTV+  +GRALFY
Sbjct  15   CMVIALLDVVSSDDAK-----EQKMKDKIISLPGQPPNLNFSQFSGYVTVDPAAGRALFY  69

Query  254  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
            W  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+WN  AN+
Sbjct  70   WLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAWNKVANV  129

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            LF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+ K R FYI
Sbjct  130  LFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWLERFPEYKERAFYI  182



>gb|KDO48446.1| hypothetical protein CISIN_1g016137mg [Citrus sinensis]
Length=394

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 128/175 (73%), Gaps = 2/175 (1%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
            LL VL LA  +     S+   +Q+ D ++ LPG   NV+F+ YSGY+TV++++GRALFYW
Sbjct  12   LLCVLGLAIVLFPSPVSAIFKEQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYW  71

Query  257  FFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  430
              EA  D  P+SKPLVLWLNGGPGCSS+A+G +EEVGPF V +DGK L  NPY+WN  AN
Sbjct  72   LVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWNKEAN  131

Query  431  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +LF+DSPAGVG+SY+ T  DI T GDKRT +D+  FL+ WF RFP+ K R FY+ 
Sbjct  132  ILFLDSPAGVGFSYTKTREDIYTVGDKRTGKDAYTFLVNWFVRFPQYKHRPFYLA  186



>dbj|BAO04184.1| hypothetical protein [Delphinium grandiflorum]
Length=456

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 121/153 (79%), Gaps = 0/153 (0%)
 Frame = +2

Query  137  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  316
            + ++ D + +LPG   NV F+ YSGYVTV+Q++GRALFYW  EA    ++ PL+LWLNGG
Sbjct  27   EDEEGDKISELPGQPGNVGFSQYSGYVTVDQDAGRALFYWLVEAEAAAATAPLILWLNGG  86

Query  317  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  496
            PGCSSIA+G AEE+GPF +  +G+TL+ NPYSWN  ANLLF+DSPAGVGYSY+NT+SD+ 
Sbjct  87   PGCSSIAYGSAEEIGPFRIHPNGRTLFSNPYSWNKLANLLFLDSPAGVGYSYTNTTSDLY  146

Query  497  THGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            T GD+RTAEDS  FLL W ERFP+ K REFYI 
Sbjct  147  TTGDQRTAEDSYAFLLNWLERFPRYKHREFYIV  179



>ref|XP_006294164.1| hypothetical protein CARUB_v10023157mg [Capsella rubella]
 gb|EOA27062.1| hypothetical protein CARUB_v10023157mg [Capsella rubella]
Length=464

 Score =   206 bits (524),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 129/184 (70%), Gaps = 2/184 (1%)
 Frame = +2

Query  47   LEMSALSWGCLLFVLLLATSIDGGKGSSSVD--QQKLDAVLDLPGLGFNVSFAHYSGYVT  220
            + ++   + C+  V ++   +D    S   D  Q+  D ++ LPG   N++F+ +SGYVT
Sbjct  1    MMITKKQYQCVFLVCMVIALLDQVSSSDDGDKVQKMKDKIISLPGQPPNLNFSQFSGYVT  60

Query  221  VNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  400
            V+  +GRALFYW  EA     +KPLVLWLNGGPGCSSIA+G +EE+GPF V  DGKTL  
Sbjct  61   VDSTAGRALFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEIGPFRVNPDGKTLRL  120

Query  401  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGR  580
            N Y+WN  AN+LF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+ K R
Sbjct  121  NIYAWNKVANVLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWMERFPEYKER  180

Query  581  EFYI  592
             FYI
Sbjct  181  PFYI  184



>ref|XP_002882565.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58824.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 120/160 (75%), Gaps = 2/160 (1%)
 Frame = +2

Query  122  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPL  295
             +S V++Q  D +  LPG   NV F  YSGYVTVN+  GRALFYW  E+    DP  +PL
Sbjct  19   NASYVEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEVRGRALFYWLVESPSTRDPKFRPL  78

Query  296  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  475
            VLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYS
Sbjct  79   VLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLYAWNQLANLLFLESPAGVGFSYS  138

Query  476  NTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            NT+SD+ T GD+RTAEDS  FL+ WFERFP+ K R+FYI 
Sbjct  139  NTTSDLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIV  178



>ref|XP_006436272.1| hypothetical protein CICLE_v10031437mg [Citrus clementina]
 ref|XP_006485877.1| PREDICTED: serine carboxypeptidase-like 28-like [Citrus sinensis]
 gb|ESR49512.1| hypothetical protein CICLE_v10031437mg [Citrus clementina]
Length=468

 Score =   206 bits (523),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 128/175 (73%), Gaps = 2/175 (1%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
            LL VL LA  +     S+   +Q+ D ++ LPG   NV+F+ YSGY+TV++++GRALFYW
Sbjct  12   LLCVLGLAIVLFPSPVSAIFKEQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYW  71

Query  257  FFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  430
              EA  D  P+SKPLVLWLNGGPGCSS+A+G +EEVGPF V +DGK L  NPY+WN  AN
Sbjct  72   LVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWNREAN  131

Query  431  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +LF+DSPAGVG+SY+ T  DI T GDKRT +D+  FL+ WF RFP+ K R FY+ 
Sbjct  132  ILFLDSPAGVGFSYTKTREDIYTVGDKRTGKDAYTFLVNWFVRFPQYKHRPFYLA  186



>gb|KJB75609.1| hypothetical protein B456_012G048700 [Gossypium raimondii]
Length=327

 Score =   202 bits (513),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 127/173 (73%), Gaps = 2/173 (1%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
            L+ + LL   +   +G S+ +++  D +  LPG    VSF  +SGYVTVN+ +GRALFYW
Sbjct  26   LISMALLLLFVSNSEGYSAAEEEA-DRISALPGQP-KVSFPQFSGYVTVNEVAGRALFYW  83

Query  257  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  436
              E+   PSSKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLL
Sbjct  84   LTESPNSPSSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKSASGLYLNKFSWNNVANLL  143

Query  437  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            F+++PAGVG+SY+N SSD+L  GD+RTA DSLEFL++W +RFP+ K RE YIT
Sbjct  144  FLETPAGVGFSYTNRSSDLLDTGDRRTAMDSLEFLIRWLDRFPRYKNREVYIT  196



>ref|XP_007139483.1| hypothetical protein PHAVU_008G033300g [Phaseolus vulgaris]
 gb|ESW11477.1| hypothetical protein PHAVU_008G033300g [Phaseolus vulgaris]
Length=465

 Score =   205 bits (522),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 128/173 (74%), Gaps = 7/173 (4%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
            +L VL+ A+    G+G ++      D +L LPG    VSF  +SGYVTVN+ +GRALFYW
Sbjct  14   VLMVLVGASCAKAGEGEAA------DRILALPGQP-KVSFQQFSGYVTVNKLAGRALFYW  66

Query  257  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  436
              EA ++P +KPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLL
Sbjct  67   LTEAAQNPLTKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYINKFSWNTVANLL  126

Query  437  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            F+++PAGVG+SY+N SSD+L  GD RTA+DSLEF+L+W ERFP+ K RE YIT
Sbjct  127  FLEAPAGVGFSYTNRSSDLLDTGDHRTAQDSLEFVLQWLERFPRYKNRELYIT  179



>ref|XP_006410746.1| hypothetical protein EUTSA_v10016610mg [Eutrema salsugineum]
 gb|ESQ52199.1| hypothetical protein EUTSA_v10016610mg [Eutrema salsugineum]
Length=465

 Score =   205 bits (522),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 126/175 (72%), Gaps = 1/175 (1%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQKL-DAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  250
            C+  + ++   +D    S    +QK+ D ++ LPG    ++F+ +SGYVTV+  +GRALF
Sbjct  15   CMCLLCMVIALLDVVTSSDDAKEQKMKDKIISLPGQPPQLNFSQFSGYVTVDSAAGRALF  74

Query  251  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  430
            YW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+WN  AN
Sbjct  75   YWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNIYAWNKVAN  134

Query  431  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +LF+DSPAGVG+SY+NTSSD LT GDKRT ED+ +FL++W ERFP+ K R FYI 
Sbjct  135  VLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDTYKFLVRWIERFPEYKERPFYIA  189



>ref|XP_006850617.1| PREDICTED: serine carboxypeptidase-like 27 [Amborella trichopoda]
 gb|ERN12198.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
Length=461

 Score =   205 bits (521),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 127/174 (73%), Gaps = 1/174 (1%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNV-SFAHYSGYVTVNQESGRALFY  253
            L+F+       +   G SS D Q+ D +++LPG   NV  F+ YSGYVTV+Q +GRALFY
Sbjct  10   LMFLGFCLLIWEAEAGISSSDDQERDRIIELPGEPANVVDFSQYSGYVTVDQNAGRALFY  69

Query  254  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
            W  E+   PS +PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGK+L+ NPY+WN  AN+
Sbjct  70   WLTESPTRPSLRPLVLWLNGGPGCSSVAYGAAEELGPFHINPDGKSLFLNPYAWNKLANI  129

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            LF+DSPAGVG+SYSN+SSD+   GD +TA D+  FL+ W  RFP+ K REFYI 
Sbjct  130  LFLDSPAGVGFSYSNSSSDLKHPGDNQTAADAYAFLVNWLGRFPQYKYREFYIA  183



>ref|XP_010920885.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=506

 Score =   206 bits (524),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 124/173 (72%), Gaps = 1/173 (1%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
            L F L LA  ++ G        +  D +  LPG    V F+ YSGYVTVN  +GRALFYW
Sbjct  29   LSFSLTLALVLNYGVVGGLAASRASDRIYRLPGQP-PVGFSQYSGYVTVNARAGRALFYW  87

Query  257  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  436
            F EA       PLVLWLNGGPGCSSIA+G +EE+GPF +  DGKTL+ NPY+WN  ANLL
Sbjct  88   FIEAPPATQPAPLVLWLNGGPGCSSIAYGASEEIGPFRIHPDGKTLFLNPYAWNSEANLL  147

Query  437  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            F+DSPAGVG+SYSNTSSD+ T GD+RTA D+ +FLL WFERFP+ K R+FYI+
Sbjct  148  FLDSPAGVGFSYSNTSSDLYTAGDQRTAIDAYKFLLNWFERFPQYKYRDFYIS  200



>ref|XP_010265559.1| PREDICTED: serine carboxypeptidase 24-like isoform X1 [Nelumbo 
nucifera]
Length=456

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 131/179 (73%), Gaps = 5/179 (3%)
 Frame = +2

Query  59   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  238
            A  W  +L +L ++     G G S+ +Q+ LD +  LPG    V+F+ YSGY+TV+   G
Sbjct  2    ASQWRTILMILFISLI---GVGESATEQE-LDRISALPGQP-QVTFSQYSGYITVDSTHG  56

Query  239  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  418
            RALFYWF EA  DP +KPLVLWLNGGPGCSSIA+G +EE+GPF + KDG +LY N YSWN
Sbjct  57   RALFYWFTEATTDPQNKPLVLWLNGGPGCSSIAYGASEEIGPFRINKDGSSLYLNKYSWN  116

Query  419  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
              AN+LF++SPAGVG+SY+NTSS++   GD+RTA ++  F+++W  RFP+ K R+FYI+
Sbjct  117  KEANILFLESPAGVGFSYTNTSSELKHSGDRRTAREAFLFMVRWMTRFPQYKYRDFYIS  175



>gb|KJB77373.1| hypothetical protein B456_012G134700 [Gossypium raimondii]
Length=483

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 131/188 (70%), Gaps = 7/188 (4%)
 Frame = +2

Query  47   LEMSALSWGCLLFVLLLATSIDGGKG------SSSVDQQKLDAVLDLPGLGFNVSFAHYS  208
            +  +A  W     ++LL+ + +G +       S  + QQ+ D V++LPG    V F  Y+
Sbjct  1    MASNAAVWLGFFVLVLLSVNSEGSRHGGELSHSDVLRQQEADRVVELPGQP-AVEFKQYA  59

Query  209  GYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGK  388
            GYVTVN+  GRALFYWFFEA   P  KPL+LWLNGGPGCSSI +G AEE+GPF  +KD +
Sbjct  60   GYVTVNESHGRALFYWFFEATSKPEKKPLLLWLNGGPGCSSIGYGEAEELGPFFTQKDEQ  119

Query  389  TLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPK  568
            TL  NP+ WN AANLLF++SP GVG+SY+NTSSDI   GDK TAEDS  FL+ WF+RFP+
Sbjct  120  TLKLNPHRWNKAANLLFLESPVGVGFSYTNTSSDIHQLGDKITAEDSYIFLVNWFKRFPQ  179

Query  569  KKGREFYI  592
             K R+FYI
Sbjct  180  FKSRDFYI  187



>ref|XP_009414289.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 125/171 (73%), Gaps = 1/171 (1%)
 Frame = +2

Query  80   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  259
            + +LLL  S+      +  +QQ+LD +  LPG    V FA YSGYVTV+  +GRALFYW 
Sbjct  25   MCLLLLVGSLAAAAACTPAEQQELDRIARLPGQP-PVDFAQYSGYVTVDARAGRALFYWL  83

Query  260  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  439
             EA       PLVLWLNGGPGCSS+A+G +EE+GPF +  DGKTLY NPY+WN  AN+LF
Sbjct  84   VEAAPAAQPAPLVLWLNGGPGCSSVAYGASEELGPFRIRSDGKTLYLNPYAWNTVANVLF  143

Query  440  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            ++SPAGVG+SYSNTSSD+ T GD RTA D+ +FL+ WFERFP+ K REFYI
Sbjct  144  LESPAGVGFSYSNTSSDLYTAGDNRTAADAYKFLVNWFERFPQYKHREFYI  194



>gb|KJB77375.1| hypothetical protein B456_012G134700 [Gossypium raimondii]
Length=509

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 131/188 (70%), Gaps = 7/188 (4%)
 Frame = +2

Query  47   LEMSALSWGCLLFVLLLATSIDGGKG------SSSVDQQKLDAVLDLPGLGFNVSFAHYS  208
            +  +A  W     ++LL+ + +G +       S  + QQ+ D V++LPG    V F  Y+
Sbjct  1    MASNAAVWLGFFVLVLLSVNSEGSRHGGELSHSDVLRQQEADRVVELPGQP-AVEFKQYA  59

Query  209  GYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGK  388
            GYVTVN+  GRALFYWFFEA   P  KPL+LWLNGGPGCSSI +G AEE+GPF  +KD +
Sbjct  60   GYVTVNESHGRALFYWFFEATSKPEKKPLLLWLNGGPGCSSIGYGEAEELGPFFTQKDEQ  119

Query  389  TLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPK  568
            TL  NP+ WN AANLLF++SP GVG+SY+NTSSDI   GDK TAEDS  FL+ WF+RFP+
Sbjct  120  TLKLNPHRWNKAANLLFLESPVGVGFSYTNTSSDIHQLGDKITAEDSYIFLVNWFKRFPQ  179

Query  569  KKGREFYI  592
             K R+FYI
Sbjct  180  FKSRDFYI  187



>ref|XP_006373363.1| hypothetical protein POPTR_0017s12960g [Populus trichocarpa]
 gb|ERP51160.1| hypothetical protein POPTR_0017s12960g [Populus trichocarpa]
Length=432

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 123/173 (71%), Gaps = 1/173 (1%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
            ++FVLLL          +  ++++ D +  LPG    VSF  +SGYVTVN+  GRALFYW
Sbjct  12   IVFVLLLVVFSSASHHHAVNEEEEADRISSLPGQP-KVSFQQFSGYVTVNKAVGRALFYW  70

Query  257  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  436
              EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLL
Sbjct  71   LTEAVHDPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNSVANLL  130

Query  437  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            F+++PAGVG+SYSN SSD+L  GD RTA DSLEFLL W  RFP+ K RE Y+T
Sbjct  131  FLETPAGVGFSYSNRSSDVLDTGDVRTAMDSLEFLLGWMNRFPRFKHREVYLT  183



>emb|CDP10248.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = +2

Query  137  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  316
            +QQ++D +L+LPG    VSF+ +SGYV VN++ GRALFYW  EA   P  KPLVLWLNGG
Sbjct  24   EQQEMDRILELPGQP-PVSFSQFSGYVPVNEDHGRALFYWLTEATSSPEKKPLVLWLNGG  82

Query  317  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  496
            PGCSS+A+G +EE+GPF + K   +LY N +SWN  AN+LF++SPAGVG+SY+NTSSD+ 
Sbjct  83   PGCSSVAYGASEEIGPFRISKTASSLYLNKHSWNREANILFLESPAGVGFSYTNTSSDLK  142

Query  497  THGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
              GDKRTA+D+L FLL+W  RFP+ K R+FYI+
Sbjct  143  DSGDKRTAQDALIFLLRWMSRFPQYKDRDFYIS  175



>gb|ABR16028.1| unknown [Picea sitchensis]
Length=479

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 127/173 (73%), Gaps = 4/173 (2%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
            C+ F+ +L  + D   G ++   Q+ D V +LPG     SFAHY+GY+TVN+  GRALFY
Sbjct  19   CIYFLFMLVVNGDHKDGLTA---QQADRVYNLPGQP-KASFAHYAGYITVNESHGRALFY  74

Query  254  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
            WFFEA +  S KPLVLWLNGGPGCSS+ +G A+E+GPF V+ +G  L  N YSWN  ANL
Sbjct  75   WFFEAEDKSSKKPLVLWLNGGPGCSSVGYGAAQELGPFQVKTNGTGLSLNTYSWNKEANL  134

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            LF++SP GVG+SY+NTSSD+L   D+ TAEDS EFLL+WF+RFP+ K  +FYI
Sbjct  135  LFLESPVGVGFSYTNTSSDLLELNDQFTAEDSYEFLLRWFKRFPQYKTHDFYI  187



>gb|KJB07560.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=405

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 127/178 (71%), Gaps = 9/178 (5%)
 Frame = +2

Query  59   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  238
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  239  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  418
            RALFYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSWN
Sbjct  87   RALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSWN  146

Query  419  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            + AN+LF++SPAGVG+SY+NTSSD+   GD RTA+D+L FL +W  RFP  + REFYI
Sbjct  147  MEANILFLESPAGVGFSYTNTSSDLKDSGDDRTAQDALIFLTRWMSRFPAYRHREFYI  204



>emb|CDO99728.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 127/175 (73%), Gaps = 3/175 (2%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
             L FV L   S      +     Q+ D ++ LPG   N++F+ YSGYVTV++ +GRALFY
Sbjct  14   VLCFVTLHLASPIFVANAKQGRHQESDRIIRLPGQPANITFSQYSGYVTVDKIAGRALFY  73

Query  254  WFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  427
            W  E  A E P +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  +PY+WN  A
Sbjct  74   WLIESPASEKPETKPLVLWLNGGPGCSSIAYGASEEVGPFRVSPDGKTLGLSPYAWNKVA  133

Query  428  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            NLLF+DSPAGVG+SYSNTS D++T GDKRTA+D+  FL +W+ERFP+ K R FYI
Sbjct  134  NLLFLDSPAGVGFSYSNTSFDMVT-GDKRTAKDAYNFLKRWYERFPQYKNRPFYI  187



>ref|XP_010032541.1| PREDICTED: serine carboxypeptidase-like 25 [Eucalyptus grandis]
 gb|KCW51926.1| hypothetical protein EUGRSUZ_J01381 [Eucalyptus grandis]
Length=520

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 128/174 (74%), Gaps = 5/174 (3%)
 Frame = +2

Query  86   VLLLATSIDGGKGSSS----VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
            V++L + ++   G  S       ++ D ++ LPG    V F  +SGYVTV++ +GRALFY
Sbjct  59   VVILISRLNATSGHDSREAAAAAEEADRIVSLPGQP-KVPFRQFSGYVTVHEAAGRALFY  117

Query  254  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
            W  EA  DPSSKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANL
Sbjct  118  WLTEAYSDPSSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNTEANL  177

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            LF+++PAGVG+SYSN SSD+L  GD+RTAEDSLEFL++W ERFP+ KGRE ++T
Sbjct  178  LFLETPAGVGFSYSNRSSDLLDTGDRRTAEDSLEFLVRWMERFPRYKGREVFLT  231



>gb|AAM15112.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
Length=447

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 124/172 (72%), Gaps = 5/172 (3%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
            ++  LL   S D  K     +Q+  D ++ LPG   N++F+ +SGYVTV+  +GRALFYW
Sbjct  1    MVIALLDVVSSDDAK-----EQKMKDKIISLPGQPPNLNFSQFSGYVTVDPAAGRALFYW  55

Query  257  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  436
              EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+WN  AN+L
Sbjct  56   LTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAWNKVANVL  115

Query  437  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            F+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+ K R FYI
Sbjct  116  FLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWLERFPEYKERAFYI  167



>ref|XP_002324116.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF04249.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=468

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 123/173 (71%), Gaps = 1/173 (1%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
            ++FVLLL          +  ++++ D +  LPG    VSF  +SGYVTVN+  GRALFYW
Sbjct  12   IVFVLLLVVFSSASHHHAVNEEEEADRISSLPGQP-KVSFQQFSGYVTVNKAVGRALFYW  70

Query  257  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  436
              EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLL
Sbjct  71   LTEAVHDPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNSVANLL  130

Query  437  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            F+++PAGVG+SYSN SSD+L  GD RTA DSLEFLL W  RFP+ K RE Y+T
Sbjct  131  FLETPAGVGFSYSNRSSDVLDTGDVRTAMDSLEFLLGWMNRFPRFKHREVYLT  183



>ref|XP_002529402.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF32998.1| serine carboxypeptidase, putative [Ricinus communis]
Length=469

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 129/177 (73%), Gaps = 6/177 (3%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVD-----QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  241
            + F+ L+     G   ++ VD     +Q+LD +  LPG    V+F+ +SGYVTVN++ GR
Sbjct  9    VFFLSLILVVFSGMDTTTIVDALANKEQELDRISALPGQP-PVTFSQFSGYVTVNEKHGR  67

Query  242  ALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  421
            ALFYW  EA   P  KPLVLWLNGGPGCSS+A+G +EE+GPF + + G +LY N YSWN 
Sbjct  68   ALFYWLTEATSSPHHKPLVLWLNGGPGCSSVAYGASEEIGPFRINRTGSSLYLNKYSWNT  127

Query  422  AANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
             AN+LF++SPAGVG+SY+NTSSD+   GDKRTA+D+L FLL+WF RFP+ K R+F+I
Sbjct  128  EANILFLESPAGVGFSYTNTSSDLKDSGDKRTAQDALVFLLRWFSRFPQYKYRDFFI  184



>ref|XP_010089631.1| Serine carboxypeptidase-like 25 [Morus notabilis]
 gb|EXB38102.1| Serine carboxypeptidase-like 25 [Morus notabilis]
Length=479

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 129/178 (72%), Gaps = 5/178 (3%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQK----LDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  241
            C+L   L   +  G K      QQ+     D +++LPG    VSF  +SGYVTV++ +GR
Sbjct  15   CVLPFGLQVRASHGVKEEREKRQQREEEARDRIVELPGQP-KVSFQQFSGYVTVSRVAGR  73

Query  242  ALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  421
            ALFYW  EAV +P S+PLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN 
Sbjct  74   ALFYWLTEAVHEPLSRPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNT  133

Query  422  AANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
             ANLLF+++PAGVG+SYSN SSD+L  GD+RTA+DSLEFL++W +RFP+ KGRE ++T
Sbjct  134  VANLLFLETPAGVGFSYSNRSSDLLDTGDRRTAKDSLEFLIRWLDRFPRYKGREVFLT  191



>dbj|BAK05698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score =   201 bits (510),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 125/180 (69%), Gaps = 6/180 (3%)
 Frame = +2

Query  71   GCLLFV--LLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  235
            GC L +  LLL  ++ GG G+   +   QQ  D V  LPG    V FA Y+GYVTV++  
Sbjct  18   GCFLGLAFLLLCGAVRGGGGAPDAEAARQQAADRVGRLPGQP-AVKFAQYAGYVTVDEAH  76

Query  236  GRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  415
            GRALFYWFFEA    + KPLVLWLNGGPGCSSI +G AEE+GPF V+K    L WNPYSW
Sbjct  77   GRALFYWFFEATAGAAKKPLVLWLNGGPGCSSIGYGEAEELGPFLVQKGKPELKWNPYSW  136

Query  416  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            N  ANL+F++SP GVG+SY+NTSSD+   GDK TA D+  FLL WF+RFP+ K  EFYI 
Sbjct  137  NKEANLMFLESPVGVGFSYTNTSSDLGKLGDKITAADAYVFLLNWFKRFPQYKHHEFYIA  196



>ref|XP_007032751.1| Serine carboxypeptidase-like 25 isoform 4 [Theobroma cacao]
 gb|EOY03677.1| Serine carboxypeptidase-like 25 isoform 4 [Theobroma cacao]
Length=363

 Score =   200 bits (509),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 118/156 (76%), Gaps = 1/156 (1%)
 Frame = +2

Query  128  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWL  307
            S  ++++ D +  LPG    VSF  +SGYVTVN+ +GRALFYW  EA  DP SKPLV+WL
Sbjct  27   SVREEEEADRISALPGQP-KVSFQQFSGYVTVNKAAGRALFYWLTEAANDPLSKPLVIWL  85

Query  308  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  487
            NGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLLF+++PAGVG+SYSN SS
Sbjct  86   NGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNNVANLLFLETPAGVGFSYSNHSS  145

Query  488  DILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            D+   GD+RTA DSLEFL++W +RFP+ K R+ YIT
Sbjct  146  DLFDTGDRRTAMDSLEFLIRWLDRFPRYKNRDIYIT  181



>ref|XP_002881413.1| hypothetical protein ARALYDRAFT_321290 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57672.1| hypothetical protein ARALYDRAFT_321290 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score =   203 bits (516),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 123/173 (71%), Gaps = 0/173 (0%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
            C+  + ++   +D      + +Q+  D ++ LPG   N++F+ +SGYVTV+  +GR LFY
Sbjct  10   CMCLLCMVIAILDVVSSDDAKEQKMKDKIISLPGQPPNLNFSQFSGYVTVDSAAGRNLFY  69

Query  254  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
            W  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+WN  AN+
Sbjct  70   WLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAWNKVANV  129

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            LF+DSPAGVG+SY+NTSSD LT GDKR  ED+  FL++W ERFP+ K R FYI
Sbjct  130  LFLDSPAGVGFSYTNTSSDELTVGDKRAGEDAYRFLVRWMERFPEYKERPFYI  182



>ref|XP_010258045.1| PREDICTED: serine carboxypeptidase-like 25 [Nelumbo nucifera]
Length=471

 Score =   203 bits (516),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 128/173 (74%), Gaps = 3/173 (2%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
            +LF  LL  S+    G+ +  +++ D +  LPG    VSF  +SGYVTVNQ +GRALFYW
Sbjct  17   VLFAFLLLVSVGASHGAGA--EEEADRIKALPGQP-KVSFQQFSGYVTVNQVAGRALFYW  73

Query  257  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  436
              EAV +P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K G  LY N +SWN  ANLL
Sbjct  74   LTEAVHEPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRLNKSGSGLYLNKFSWNTVANLL  133

Query  437  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            F+++PAGVG+SYSN SSD+L  GD+RTA+DSLEFL++W  RF + K RE ++T
Sbjct  134  FLETPAGVGFSYSNRSSDLLDTGDRRTAKDSLEFLIRWLGRFLRYKNREVFLT  186



>ref|XP_010509563.1| PREDICTED: serine carboxypeptidase-like 28 [Camelina sativa]
Length=467

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 127/175 (73%), Gaps = 2/175 (1%)
 Frame = +2

Query  74   CLLFVLLLATSID--GGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  247
            C+L V ++   +D    +  ++ +Q+  D ++ LPG    ++F+ +SGYVTV+  +GRAL
Sbjct  12   CMLVVCMVIALVDVVSSRDDANKEQKIKDKIIALPGQPPKLNFSQFSGYVTVDSTAGRAL  71

Query  248  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  427
            FYW  E      +KPLVLWLNGGPGCSSIA+G +EE+GPF +  DGKTL +N Y+WN  A
Sbjct  72   FYWLTETPRPSDTKPLVLWLNGGPGCSSIAYGASEEIGPFRINPDGKTLRFNIYAWNKVA  131

Query  428  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            N+LF+DSPAGVG+SY+NTSSD +T GDKRT ED+  FL++W ERFP+ K R FYI
Sbjct  132  NVLFLDSPAGVGFSYTNTSSDEVTVGDKRTGEDAYRFLVRWMERFPEYKERPFYI  186



>ref|XP_009618061.1| PREDICTED: serine carboxypeptidase-like 34 [Nicotiana tomentosiformis]
Length=232

 Score =   196 bits (498),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 119/172 (69%), Gaps = 1/172 (1%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
            LL VL             ++ QQ+ D V  LPG    VSF  Y+GYVTVN+  GRALFYW
Sbjct  9    LLLVLNFGVLARSHISEKALAQQEADRVNRLPGQP-PVSFKQYAGYVTVNETHGRALFYW  67

Query  257  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  436
            FFEA  +P  KPL+LWLNGGPGCSSI +G AEE+GPF  +K+   L +N +SWN AANLL
Sbjct  68   FFEATTNPEKKPLLLWLNGGPGCSSIGYGEAEELGPFFTQKNKPELKFNNFSWNKAANLL  127

Query  437  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            F++SP GVG+SY+NTSSDI   GD  TA+DS +FL+ WF RFP+ K  EFYI
Sbjct  128  FLESPVGVGFSYTNTSSDITELGDTVTAQDSYKFLVNWFRRFPQFKTHEFYI  179



>ref|XP_010516781.1| PREDICTED: serine carboxypeptidase-like 28 [Camelina sativa]
Length=465

 Score =   202 bits (515),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 126/175 (72%), Gaps = 2/175 (1%)
 Frame = +2

Query  74   CLLFVLLLATSID--GGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  247
            C+L V ++   +D       ++ +Q+  D ++ LPG    ++F+ +SGYVTV+  +GRAL
Sbjct  10   CMLLVCMVIALLDVVSSSDDANKEQKMKDKIISLPGQPPKLNFSQFSGYVTVDSTAGRAL  69

Query  248  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  427
            FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  + Y+WN  A
Sbjct  70   FYWLTEAPSPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNTDGKTLRLSIYAWNKVA  129

Query  428  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            N+LF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+ K R FYI
Sbjct  130  NVLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWMERFPEYKERPFYI  184



>ref|XP_003552566.1| PREDICTED: serine carboxypeptidase-like 25-like isoform 1 [Glycine 
max]
Length=467

 Score =   202 bits (515),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 119/151 (79%), Gaps = 1/151 (1%)
 Frame = +2

Query  143  QKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPG  322
            +  D +L+LPG    VSF  +SGYVTVN+ +GRALFYW  EA ++P +KPLV+WLNGGPG
Sbjct  31   EAADRILELPGQP-KVSFQQFSGYVTVNKVAGRALFYWLTEAAQNPLTKPLVIWLNGGPG  89

Query  323  CSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTH  502
            CSS+A+G +EE+GPF + K    LY N +SWN  ANLLF+++PAGVG+SY+N SSD+L  
Sbjct  90   CSSVAYGASEEIGPFRINKTASGLYINKFSWNTVANLLFLEAPAGVGFSYANRSSDLLNT  149

Query  503  GDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            GD+RTA+DSLEF+++W ERFP+ K RE YIT
Sbjct  150  GDRRTAQDSLEFVIQWLERFPRYKNRELYIT  180



>ref|XP_003530438.1| PREDICTED: serine carboxypeptidase-like 25-like isoform X1 [Glycine 
max]
 ref|XP_006585779.1| PREDICTED: serine carboxypeptidase-like 25-like isoform X2 [Glycine 
max]
 ref|XP_006585780.1| PREDICTED: serine carboxypeptidase-like 25-like isoform X3 [Glycine 
max]
Length=471

 Score =   202 bits (515),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 129/172 (75%), Gaps = 3/172 (2%)
 Frame = +2

Query  86   VLLLATSIDGGKGSSSVD--QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  259
            V+LL   + G + + + +  ++  D +L LPG    VSF  +SGYVTVN+ +GRALFYW 
Sbjct  11   VILLLMFLVGARFAKAKEGGEEAADRILKLPGQP-KVSFKQFSGYVTVNKVAGRALFYWL  69

Query  260  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  439
             EA ++P +KPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLLF
Sbjct  70   AEAAQNPLTKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYKNKFSWNSVANLLF  129

Query  440  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +++PAGVG+SY+N SSD+L  GD+RTA+DSLEF+++W ERFP+ K RE YIT
Sbjct  130  LEAPAGVGFSYTNRSSDLLDTGDRRTAQDSLEFVIQWLERFPRYKTRELYIT  181



>ref|XP_012071522.1| PREDICTED: serine carboxypeptidase 24 isoform X2 [Jatropha curcas]
Length=407

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 128/173 (74%), Gaps = 2/173 (1%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
            LLFV+   ++I+       + +Q+ D +  LPG    V+F+ +SGYVTVN++ GRALFYW
Sbjct  12   LLFVVFWFSAINAIVAFRKLQEQEEDRITALPGQP-AVTFSQFSGYVTVNEKHGRALFYW  70

Query  257  FFEAVED-PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
              EA    P  KPLVLWLNGGPGCSS+A+G +EEVGPF +++ G +LY N YSWN  AN+
Sbjct  71   LTEAATSFPDKKPLVLWLNGGPGCSSVAYGASEEVGPFRIDRTGSSLYLNKYSWNTEANI  130

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            LF++SPAGVG+SY+N SSD+   GD+RTAED+L FL++WF RFP+ K R+FYI
Sbjct  131  LFLESPAGVGFSYTNKSSDLKDSGDERTAEDALIFLIRWFSRFPQYKYRDFYI  183



>ref|XP_003549539.1| PREDICTED: serine carboxypeptidase 24-like [Glycine max]
 gb|KHN17498.1| Serine carboxypeptidase 24 [Glycine soja]
Length=460

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 132/181 (73%), Gaps = 2/181 (1%)
 Frame = +2

Query  53   MSALSWGCLLFVLLLATSIDGGKGSSSV-DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  229
            M+  S   + F+ LL  +      + +V  +Q+ D +L LPG    V+F+ +SGYVTVN+
Sbjct  2    MTFQSKAGIFFLCLLIIAFSSINLAVAVPKEQEQDRILALPGQP-RVAFSQFSGYVTVNE  60

Query  230  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  409
            + GRALFYW  E+   P +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N Y
Sbjct  61   QHGRALFYWLTESPTSPQNKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKY  120

Query  410  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFY  589
            +WN  A++LF++SPAGVG+SY+NTSSD+ T GDKRTA+D+L FL++W  RFP+ K REFY
Sbjct  121  AWNKEASILFLESPAGVGFSYTNTSSDLKTSGDKRTAQDALVFLIRWMSRFPQYKYREFY  180

Query  590  I  592
            I
Sbjct  181  I  181



>ref|XP_010273635.1| PREDICTED: serine carboxypeptidase 24-like [Nelumbo nucifera]
Length=458

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 124/172 (72%), Gaps = 7/172 (4%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
            ++F+ L+  +ID  K      +Q+LD +  LPG    V F  YSGYVTV+   GRALFYW
Sbjct  11   IIFISLVGITIDAAK------EQELDRIWALPGQP-QVEFLQYSGYVTVDPVRGRALFYW  63

Query  257  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  436
              EA  +P  KPLVLWLNGGPGCSSIA+G +EE+GPF + KDG +LY N YSWN  AN+L
Sbjct  64   LTEATAEPEKKPLVLWLNGGPGCSSIAYGASEEIGPFRINKDGSSLYLNEYSWNKEANIL  123

Query  437  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            F++SP GVG+SY+NTSSD+   GD+RTA ++  F+++W ERFP+ K R+FYI
Sbjct  124  FLESPVGVGFSYTNTSSDLKHSGDRRTAREAFVFMVRWMERFPQYKYRDFYI  175



>gb|KJB07562.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=448

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 127/178 (71%), Gaps = 9/178 (5%)
 Frame = +2

Query  59   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  238
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  239  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  418
            RALFYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSWN
Sbjct  87   RALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSWN  146

Query  419  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            + AN+LF++SPAGVG+SY+NTSSD+   GD RTA+D+L FL +W  RFP  + REFYI
Sbjct  147  MEANILFLESPAGVGFSYTNTSSDLKDSGDDRTAQDALIFLTRWMSRFPAYRHREFYI  204



>ref|XP_008789080.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
27 [Phoenix dactylifera]
Length=473

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 125/171 (73%), Gaps = 1/171 (1%)
 Frame = +2

Query  83   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFF  262
            F L LA  ++ G        Q+ D +  LPG    V F+ YSGYVTV+  +GRALFYWF 
Sbjct  25   FFLSLALVLNYGVAGGLAASQESDRITWLPGQP-PVGFSQYSGYVTVDARAGRALFYWFI  83

Query  263  EAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFV  442
            EA       PL+LWLNGGPGCSSIA+G +EE+GPFH+  DGKTL+ NPY+WN AANLLF+
Sbjct  84   EAPPAAQPAPLILWLNGGPGCSSIAYGASEELGPFHIHPDGKTLFLNPYAWNSAANLLFL  143

Query  443  DSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +SPAGVG+SYSNTSSD+ T GD+RTA D+  FL+ WFERFP+ K R+FYIT
Sbjct  144  ESPAGVGFSYSNTSSDLYTAGDRRTAMDAYNFLVNWFERFPQYKYRDFYIT  194



>ref|XP_012086520.1| PREDICTED: serine carboxypeptidase-like 28 [Jatropha curcas]
 gb|KDP25724.1| hypothetical protein JCGZ_23945 [Jatropha curcas]
Length=467

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 120/156 (77%), Gaps = 2/156 (1%)
 Frame = +2

Query  134  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE--DPSSKPLVLWL  307
            + +Q+ D ++ LPG   NV+F+ YSGY++V+  +GRALFYW  EA +   P  KPLVLWL
Sbjct  32   LKEQEKDRIIKLPGQPSNVNFSQYSGYISVDPVAGRALFYWLTEAPKTVQPKLKPLVLWL  91

Query  308  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  487
            NGGPGCSSIA+G +EEVGPF V  DGKTL+ NPY+WN  ANLLF+DSPAGVG+SYSNTSS
Sbjct  92   NGGPGCSSIAYGASEEVGPFRVRPDGKTLHLNPYAWNKEANLLFLDSPAGVGFSYSNTSS  151

Query  488  DILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            DI   GDKRTA+D+  FL+ W +RFP+ K R F+I 
Sbjct  152  DISNVGDKRTAKDAYTFLVNWLKRFPQYKHRPFFIA  187



>emb|CDY43258.1| BnaC05g48510D [Brassica napus]
Length=473

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 125/178 (70%), Gaps = 5/178 (3%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSV----DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  241
            C+LF  L+A  I   +G S       Q + D +  LPG   NV+F  +SGYVTV + SGR
Sbjct  6    CVLFTTLMAILIMTSQGRSQAREGEKQAEADRITSLPGQP-NVTFEQFSGYVTVAKHSGR  64

Query  242  ALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  421
            +LFYW  EA   P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K G  LY N ++WN 
Sbjct  65   SLFYWLTEASHLPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRIRKGGSGLYLNKFAWNS  124

Query  422  AANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
             ANLLF+++PAGVG+SY+N SSD+   GD RTA+DSL+FL+KW +RFP+   RE YIT
Sbjct  125  IANLLFLEAPAGVGFSYTNRSSDLFNTGDIRTAKDSLQFLIKWLQRFPRYNRREIYIT  182



>ref|XP_004232164.1| PREDICTED: serine carboxypeptidase-like 25 [Solanum lycopersicum]
Length=464

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 121/163 (74%), Gaps = 1/163 (1%)
 Frame = +2

Query  107  IDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSS  286
            +   K +   D++  D ++ LPG    VSF  YSGYVTVNQ +GRALFYW  EA+++P +
Sbjct  18   VSAAKLNKYQDEEDADRIISLPGQP-KVSFHQYSGYVTVNQFAGRALFYWLTEAIDEPLT  76

Query  287  KPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGY  466
            KPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLLF+++PAGVG+
Sbjct  77   KPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNKLANLLFLETPAGVGF  136

Query  467  SYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            SYSN SSD+L  GD RTA+DSL+FL+ W  RFP+ + RE YIT
Sbjct  137  SYSNRSSDLLDTGDIRTAKDSLQFLIHWMNRFPRYRNREVYIT  179



>gb|EYU44197.1| hypothetical protein MIMGU_mgv1a005600mg [Erythranthe guttata]
Length=477

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 128/170 (75%), Gaps = 1/170 (1%)
 Frame = +2

Query  86   VLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE  265
            ++LL   ++    ++ +++++ D +  LPG    V+F  +SGYVTV+Q  GRALFYW  E
Sbjct  20   IVLLLHGVNSAASATHLEEEEADRITGLPGQP-KVNFQQFSGYVTVSQVPGRALFYWLTE  78

Query  266  AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVD  445
            +V+ P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN+ ANLLF++
Sbjct  79   SVQQPLSKPLVVWLNGGPGCSSVAYGASEEIGPFKISKTSSGLYLNKFSWNILANLLFLE  138

Query  446  SPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +PAGVG+SYSN SSD+   GD+RTA+DSLEFL++W +RFP+ + RE Y+T
Sbjct  139  TPAGVGFSYSNRSSDLFDTGDRRTAKDSLEFLVRWLDRFPRYRNREVYLT  188



>ref|XP_009771074.1| PREDICTED: serine carboxypeptidase-like 25 [Nicotiana sylvestris]
Length=463

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 126/172 (73%), Gaps = 1/172 (1%)
 Frame = +2

Query  80   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  259
            + +L+L  ++     ++  +++++D ++ LPG    VSF  YSGYVTVNQ  GRALFYW 
Sbjct  8    VVLLILVAAVCTVNATNYKEEEEVDRIISLPGQP-KVSFQQYSGYVTVNQIVGRALFYWL  66

Query  260  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  439
             EA  +P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLLF
Sbjct  67   TEADNEPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTSSGLYLNKFSWNKLANLLF  126

Query  440  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            +++PAGVG+SYSN SSD+L  GD RTA+DSL+FL+ W  RFP+ K RE YIT
Sbjct  127  LETPAGVGFSYSNRSSDLLDTGDYRTAKDSLQFLIHWMNRFPRYKHREVYIT  178



>ref|XP_011000079.1| PREDICTED: serine carboxypeptidase-like 25 [Populus euphratica]
Length=469

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 124/174 (71%), Gaps = 2/174 (1%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSV-DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  253
            ++FVLLL           +V ++++ D +  LPG    VSF  +SGYVTVN+  GRALFY
Sbjct  12   IVFVLLLFVFSSSASHHHAVSEEEEADRISSLPGQP-KVSFQQFSGYVTVNKAVGRALFY  70

Query  254  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  433
            W  EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANL
Sbjct  71   WLTEAVHDPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNTVANL  130

Query  434  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
            LF+++PAGVG+SYSN SSD+L  GD RTA DSLEFLL W  RFP+ K RE Y+T
Sbjct  131  LFLETPAGVGFSYSNRSSDLLDTGDVRTAMDSLEFLLGWMNRFPRYKHREVYLT  184



>ref|XP_011623956.1| PREDICTED: serine carboxypeptidase-like 25 isoform X3 [Amborella 
trichopoda]
Length=472

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 127/182 (70%), Gaps = 11/182 (6%)
 Frame = +2

Query  80   LFVLLLATSIDGGKGSSSVDQQ----------KLDAVLDLPGLGFNVSFAHYSGYVTVNQ  229
            L ++L   SI G       +QQ          + D +L LPG    VSF  +SGYVTVN+
Sbjct  7    LLLVLCVASITGEVLGVQREQQSTASGVEREEEQDRILRLPGQP-EVSFKQFSGYVTVNE  65

Query  230  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  409
            + GRALFYW  EA  +P S+PLVLWLNGGPGCSSIA+G +EE+GPF ++K    LY N +
Sbjct  66   QVGRALFYWLTEAELEPESRPLVLWLNGGPGCSSIAYGASEEIGPFRIKKSASGLYLNKF  125

Query  410  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFY  589
            SWN  ANLLF++SP GVGYSY+NTSSD+   GD +TA+DSL+FLL+WF+RFP+ K RE Y
Sbjct  126  SWNKVANLLFLESPVGVGYSYTNTSSDLTNFGDLQTAKDSLQFLLRWFDRFPRYKNRELY  185

Query  590  IT  595
            +T
Sbjct  186  LT  187



>ref|XP_011623958.1| PREDICTED: serine carboxypeptidase-like 25 isoform X5 [Amborella 
trichopoda]
Length=471

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 127/182 (70%), Gaps = 11/182 (6%)
 Frame = +2

Query  80   LFVLLLATSIDGGKGSSSVDQQ----------KLDAVLDLPGLGFNVSFAHYSGYVTVNQ  229
            L ++L   SI G       +QQ          + D +L LPG    VSF  +SGYVTVN+
Sbjct  7    LLLVLCVASITGEVLGVQREQQSTASGVEREEEQDRILRLPGQP-EVSFKQFSGYVTVNE  65

Query  230  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  409
            + GRALFYW  EA  +P S+PLVLWLNGGPGCSSIA+G +EE+GPF ++K    LY N +
Sbjct  66   QVGRALFYWLTEAELEPESRPLVLWLNGGPGCSSIAYGASEEIGPFRIKKSASGLYLNKF  125

Query  410  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFY  589
            SWN  ANLLF++SP GVGYSY+NTSSD+   GD +TA+DSL+FLL+WF+RFP+ K RE Y
Sbjct  126  SWNKVANLLFLESPVGVGYSYTNTSSDLTNFGDLQTAKDSLQFLLRWFDRFPRYKNRELY  185

Query  590  IT  595
            +T
Sbjct  186  LT  187



>ref|XP_003519151.1| PREDICTED: serine carboxypeptidase 24-like isoform 1 [Glycine 
max]
Length=461

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 128/172 (74%), Gaps = 1/172 (1%)
 Frame = +2

Query  77   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  256
             L +L+ A S      ++   +Q+ D +  LPG    V+F+ +SGYVTVN++ GR+LFYW
Sbjct  12   FLCLLIFAFSSINILAAAVPKEQEQDRISALPGQP-RVAFSQFSGYVTVNEQHGRSLFYW  70

Query  257  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  436
            F E+   P +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N Y+WN  AN+L
Sbjct  71   FTESPTSPQNKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYAWNREANVL  130

Query  437  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYI  592
            F++SPAGVG+SY+NTSSD+ T GDKRTA+D+L F+++W  RFP+ K REFYI
Sbjct  131  FLESPAGVGFSYTNTSSDLKTSGDKRTAQDALIFVIRWMSRFPQYKYREFYI  182



>gb|KFK36473.1| hypothetical protein AALP_AA4G129300 [Arabis alpina]
Length=439

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = +2

Query  119  KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLV  298
            + + + +Q+  D ++ LPG   +++F+ YSGYVTV+  +GRALFYW  EA     +KPLV
Sbjct  3    RNNDAKEQKMKDKIISLPGQPPHLNFSQYSGYVTVDSAAGRALFYWLTEAPSPSGTKPLV  62

Query  299  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  478
            LWLNGGPGCSSIA+G +EEVGPF V  DGK+L+ N Y+WN  ANLLF+DSPAGVG+SY+N
Sbjct  63   LWLNGGPGCSSIAYGASEEVGPFRVNPDGKSLHLNLYAWNKVANLLFLDSPAGVGFSYTN  122

Query  479  TSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
             SSD LT GDKRT ED+  FL++W ERFP+ K R FYI 
Sbjct  123  ASSDELTVGDKRTGEDAYRFLVRWMERFPEYKQRPFYIA  161



>gb|KHN41581.1| Serine carboxypeptidase-like 25 [Glycine soja]
Length=453

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = +2

Query  140  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  319
            ++  D +L LPG    VSF  +SGYVTVN+ +GRALFYW  EA ++P +KPLV+WLNGGP
Sbjct  16   EEAADRILKLPGQP-KVSFKQFSGYVTVNKVAGRALFYWLAEAAQNPLTKPLVIWLNGGP  74

Query  320  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  499
            GCSS+A+G +EE+GPF + K    LY N +SWN  ANLLF+++PAGVG+SY+N SSD+L 
Sbjct  75   GCSSVAYGASEEIGPFRINKTASGLYKNKFSWNSVANLLFLEAPAGVGFSYTNRSSDLLD  134

Query  500  HGDKRTAEDSLEFLLKWFERFPKKKGREFYIT  595
             GD+RTA+DSLEF+++W ERFP+ K RE YIT
Sbjct  135  TGDRRTAQDSLEFVIQWLERFPRYKTRELYIT  166



>ref|XP_011623955.1| PREDICTED: serine carboxypeptidase-like 25 isoform X2 [Amborella 
trichopoda]
Length=474

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 129/184 (70%), Gaps = 12/184 (7%)
 Frame = +2

Query  74   CLLFVLLLATSIDGGKGSSSVDQQ----------KLDAVLDLPGLGFNVSFAHYSGYVTV  223
             LL VL +A SI G       +QQ          + D +L LPG    VSF  +SGYVTV
Sbjct  6    ALLLVLCVA-SITGEVLGVQREQQSTASGVEREEEQDRILRLPGQP-EVSFKQFSGYVTV  63

Query  224  NQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  403
            N++ GRALFYW  EA  +P S+PLVLWLNGGPGCSSIA+G +EE+GPF ++K    LY N
Sbjct  64   NEQVGRALFYWLTEAELEPESRPLVLWLNGGPGCSSIAYGASEEIGPFRIKKSASGLYLN  123

Query  404  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPKKKGRE  583
             +SWN  ANLLF++SP GVGYSY+NTSSD+   GD +TA+DSL+FLL+WF+RFP+ K RE
Sbjct  124  KFSWNKVANLLFLESPVGVGYSYTNTSSDLTNFGDLQTAKDSLQFLLRWFDRFPRYKNRE  183

Query  584  FYIT  595
             Y+T
Sbjct  184  LYLT  187



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 805030520163