BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5999

Length=695
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006464914.1|  PREDICTED: amino acid permease 2-like              311   3e-100   Citrus sinensis [apfelsine]
ref|XP_011099674.1|  PREDICTED: amino acid permease 2-like              310   1e-99    Sesamum indicum [beniseed]
ref|XP_010270272.1|  PREDICTED: amino acid permease 3                   308   5e-99    Nelumbo nucifera [Indian lotus]
emb|CDY21569.1|  BnaC09g47230D                                          308   6e-99    Brassica napus [oilseed rape]
ref|XP_010674405.1|  PREDICTED: amino acid permease 4                   306   2e-98    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007019168.1|  Amino acid permease isoform 2                      306   3e-98    Theobroma cacao [chocolate]
ref|XP_006432100.1|  hypothetical protein CICLE_v10000986mg             306   3e-98    Citrus clementina [clementine]
ref|XP_010652912.1|  PREDICTED: amino acid permease 3 isoform X1        306   8e-98    Vitis vinifera
ref|XP_008219592.1|  PREDICTED: amino acid permease 3-like isofor...    305   8e-98    Prunus mume [ume]
ref|XP_006386354.1|  hypothetical protein POPTR_0002s07960g             304   3e-97    Populus trichocarpa [western balsam poplar]
ref|XP_006386360.1|  hypothetical protein POPTR_0002s08040g             304   3e-97    
ref|XP_008219591.1|  PREDICTED: amino acid permease 3-like isofor...    304   3e-97    Prunus mume [ume]
gb|KHG20963.1|  Amino acid permease 3 -like protein                     304   4e-97    Gossypium arboreum [tree cotton]
ref|XP_007019167.1|  Amino acid permease isoform 1                      304   4e-97    
ref|XP_011002450.1|  PREDICTED: amino acid permease 3-like              304   4e-97    Populus euphratica
ref|XP_011003418.1|  PREDICTED: amino acid permease 3-like              303   4e-97    Populus euphratica
ref|XP_007222588.1|  hypothetical protein PRUPE_ppa004920mg             303   6e-97    
emb|CDX69918.1|  BnaA10g22670D                                          303   7e-97    
emb|CBI21586.3|  unnamed protein product                                300   7e-97    Vitis vinifera
ref|XP_011022870.1|  PREDICTED: amino acid permease 4-like              303   1e-96    Populus euphratica
ref|XP_011027479.1|  PREDICTED: amino acid permease 3-like isofor...    302   1e-96    Populus euphratica
ref|XP_008338673.1|  PREDICTED: amino acid permease 3-like              302   1e-96    
ref|XP_002306650.2|  hypothetical protein POPTR_0005s20400g             302   1e-96    Populus trichocarpa [western balsam poplar]
ref|XP_002302223.1|  hypothetical protein POPTR_0002s07960g             302   2e-96    
ref|XP_002520322.1|  amino acid transporter, putative                   301   3e-96    
ref|XP_009339426.1|  PREDICTED: amino acid permease 3-like              301   3e-96    Pyrus x bretschneideri [bai li]
ref|XP_009122500.1|  PREDICTED: amino acid permease 2                   301   4e-96    Brassica rapa
ref|XP_002275881.1|  PREDICTED: amino acid permease 3 isoform X2        301   4e-96    
emb|CAF22024.1|  amino acid permease                                    301   6e-96    Brassica napus [oilseed rape]
ref|XP_008444195.1|  PREDICTED: amino acid permease 3-like              300   7e-96    Cucumis melo [Oriental melon]
ref|XP_011653779.1|  PREDICTED: amino acid permease 3-like              300   1e-95    Cucumis sativus [cucumbers]
ref|XP_011458812.1|  PREDICTED: amino acid permease 3-like isofor...    299   2e-95    Fragaria vesca subsp. vesca
ref|XP_011027478.1|  PREDICTED: amino acid permease 3-like isofor...    299   3e-95    Populus euphratica
ref|XP_002520323.1|  amino acid transporter, putative                   298   4e-95    
ref|XP_007048506.1|  Amino acid permease 2 isoform 1                    298   6e-95    
ref|XP_010095435.1|  hypothetical protein L484_013392                   298   7e-95    
ref|XP_010452897.1|  PREDICTED: amino acid permease 2                   298   8e-95    Camelina sativa [gold-of-pleasure]
ref|XP_006399392.1|  hypothetical protein EUTSA_v10013363mg             298   1e-94    Eutrema salsugineum [saltwater cress]
ref|XP_004290907.1|  PREDICTED: amino acid permease 3-like isofor...    297   1e-94    Fragaria vesca subsp. vesca
ref|XP_010491540.1|  PREDICTED: amino acid permease 2-like              297   1e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010546306.1|  PREDICTED: amino acid permease 4 isoform X1        296   1e-94    Tarenaya hassleriana [spider flower]
ref|XP_006434261.1|  hypothetical protein CICLE_v10000991mg             296   2e-94    Citrus clementina [clementine]
emb|CDX81121.1|  BnaC03g03750D                                          297   2e-94    
gb|AAO40028.1|  amino acid transporter AAP2                             286   2e-94    Brassica napus [oilseed rape]
ref|XP_002302224.2|  hypothetical protein POPTR_0002s08000g             296   3e-94    
ref|XP_002871360.1|  hypothetical protein ARALYDRAFT_487723             296   3e-94    
ref|XP_010269036.1|  PREDICTED: amino acid permease 3-like              295   5e-94    Nelumbo nucifera [Indian lotus]
emb|CAA54631.1|  amino acid transporter                                 295   5e-94    Arabidopsis thaliana [mouse-ear cress]
ref|NP_201190.1|  amino acid permease 4                                 295   6e-94    Arabidopsis thaliana [mouse-ear cress]
gb|AAM13223.1|  amino acid transporter AAP4                             295   6e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423021.1|  PREDICTED: amino acid permease 2-like              296   6e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010484145.1|  PREDICTED: amino acid permease 4                   294   1e-93    
ref|XP_006390096.1|  hypothetical protein EUTSA_v10018484mg             294   1e-93    Eutrema salsugineum [saltwater cress]
ref|NP_196484.1|  amino acid permease 2                                 295   1e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279782.1|  hypothetical protein CARUB_v10027867mg             294   1e-93    Capsella rubella
ref|XP_010444306.1|  PREDICTED: amino acid permease 4-like              294   2e-93    Camelina sativa [gold-of-pleasure]
ref|XP_007213109.1|  hypothetical protein PRUPE_ppa023539mg             294   2e-93    Prunus persica
gb|AAM61320.1|  amino acid transporter AAP4                             293   3e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011074825.1|  PREDICTED: amino acid permease 3-like              293   3e-93    Sesamum indicum [beniseed]
ref|XP_002864872.1|  hypothetical protein ARALYDRAFT_496573             293   4e-93    
gb|AFK34945.1|  unknown                                                 284   5e-93    Lotus japonicus
emb|CAN65437.1|  hypothetical protein VITISV_038918                     292   1e-92    Vitis vinifera
ref|XP_008227520.1|  PREDICTED: amino acid permease 4 isoform X3        292   1e-92    Prunus mume [ume]
ref|XP_008227518.1|  PREDICTED: amino acid permease 4 isoform X1        292   1e-92    Prunus mume [ume]
gb|AAM61227.1|  amino acid transport protein AAP2                       292   1e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008227519.1|  PREDICTED: amino acid permease 4 isoform X2        292   1e-92    Prunus mume [ume]
emb|CDX78353.1|  BnaA03g02650D                                          292   2e-92    
ref|XP_009131105.1|  PREDICTED: amino acid permease 2                   292   2e-92    Brassica rapa
ref|XP_010461080.1|  PREDICTED: amino acid permease 4-like              291   2e-92    Camelina sativa [gold-of-pleasure]
emb|CDX88365.1|  BnaC06g38090D                                          291   2e-92    
emb|CDX88364.1|  BnaC06g38080D                                          291   3e-92    
ref|XP_008219594.1|  PREDICTED: amino acid permease 3-like              291   4e-92    Prunus mume [ume]
gb|KJB59301.1|  hypothetical protein B456_009G248600                    290   4e-92    Gossypium raimondii
ref|XP_009106399.1|  PREDICTED: amino acid permease 3                   290   5e-92    Brassica rapa
gb|KFK42132.1|  hypothetical protein AALP_AA2G215300                    290   6e-92    Arabis alpina [alpine rockcress]
ref|XP_002307053.2|  hypothetical protein POPTR_0005s06990g             290   7e-92    Populus trichocarpa [western balsam poplar]
ref|XP_007222611.1|  hypothetical protein PRUPE_ppa004936mg             290   8e-92    Prunus persica
emb|CDX87522.1|  BnaA07g33510D                                          290   1e-91    
gb|KJB75356.1|  hypothetical protein B456_012G038000                    290   1e-91    Gossypium raimondii
ref|XP_010537371.1|  PREDICTED: amino acid permease 3                   289   2e-91    Tarenaya hassleriana [spider flower]
ref|XP_009130275.1|  PREDICTED: amino acid permease 4                   288   2e-91    Brassica rapa
ref|XP_011027477.1|  PREDICTED: amino acid permease 3-like              289   2e-91    Populus euphratica
emb|CDY39844.1|  BnaC02g42740D                                          288   2e-91    Brassica napus [oilseed rape]
emb|CDY31348.1|  BnaA02g33930D                                          288   2e-91    Brassica napus [oilseed rape]
emb|CDP10973.1|  unnamed protein product                                288   2e-91    Coffea canephora [robusta coffee]
ref|XP_006380397.1|  hypothetical protein POPTR_0007s04710g             289   2e-91    
ref|XP_006394236.1|  hypothetical protein EUTSA_v10004152mg             288   2e-91    Eutrema salsugineum [saltwater cress]
ref|XP_011031113.1|  PREDICTED: amino acid permease 4-like isofor...    289   3e-91    Populus euphratica
gb|ERN18219.1|  hypothetical protein AMTR_s00055p00034230               283   3e-91    Amborella trichopoda
ref|XP_006287587.1|  hypothetical protein CARUB_v10000805mg             288   4e-91    Capsella rubella
ref|NP_177862.1|  amino acid permease 3                                 288   5e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010025744.1|  PREDICTED: amino acid permease 4-like              288   5e-91    Eucalyptus grandis [rose gum]
ref|XP_011102302.1|  PREDICTED: amino acid permease 3 isoform X2        288   6e-91    Sesamum indicum [beniseed]
gb|AAM62803.1|  amino acid carrier, putative                            288   6e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_012078267.1|  PREDICTED: amino acid permease 3-like              288   6e-91    Jatropha curcas
ref|XP_003634405.1|  PREDICTED: amino acid permease 3                   287   8e-91    Vitis vinifera
emb|CAN61092.1|  hypothetical protein VITISV_005276                     287   8e-91    Vitis vinifera
ref|XP_003522571.1|  PREDICTED: amino acid permease 3-like isofor...    287   1e-90    Glycine max [soybeans]
ref|XP_009377726.1|  PREDICTED: amino acid permease 3-like              286   2e-90    Pyrus x bretschneideri [bai li]
ref|XP_006386355.1|  amino acid permease which transports basic a...    286   2e-90    Populus trichocarpa [western balsam poplar]
ref|XP_008338672.1|  PREDICTED: amino acid permease 3-like              286   3e-90    
ref|XP_006382883.1|  amino acid permease AAP1 family protein            286   4e-90    Populus trichocarpa [western balsam poplar]
gb|KJB16325.1|  hypothetical protein B456_002G223200                    285   5e-90    Gossypium raimondii
ref|XP_011102300.1|  PREDICTED: amino acid permease 3 isoform X1        286   5e-90    Sesamum indicum [beniseed]
ref|XP_004290905.1|  PREDICTED: amino acid permease 3-like              285   5e-90    Fragaria vesca subsp. vesca
ref|XP_007137459.1|  hypothetical protein PHAVU_009G128500g             285   6e-90    Phaseolus vulgaris [French bean]
emb|CDY43761.1|  BnaA06g22970D                                          285   6e-90    Brassica napus [oilseed rape]
ref|XP_002889140.1|  hypothetical protein ARALYDRAFT_476902             285   6e-90    
ref|XP_010912574.1|  PREDICTED: amino acid permease 3-like              285   6e-90    Elaeis guineensis
gb|EYU23867.1|  hypothetical protein MIMGU_mgv1a005496mg                285   1e-89    Erythranthe guttata [common monkey flower]
ref|XP_010063420.1|  PREDICTED: amino acid permease 3-like              284   1e-89    Eucalyptus grandis [rose gum]
gb|EYU32509.1|  hypothetical protein MIMGU_mgv1a005226mg                284   2e-89    Erythranthe guttata [common monkey flower]
gb|KHN44307.1|  Amino acid permease 3                                   283   3e-89    Glycine soja [wild soybean]
gb|KJB33339.1|  hypothetical protein B456_006G007300                    283   3e-89    Gossypium raimondii
emb|CBI21597.3|  unnamed protein product                                279   3e-89    Vitis vinifera
gb|KHG16478.1|  Amino acid permease 2 -like protein                     283   3e-89    Gossypium arboreum [tree cotton]
emb|CDX84450.1|  BnaC03g50500D                                          282   6e-89    
ref|XP_003527948.1|  PREDICTED: amino acid permease 3                   283   6e-89    Glycine max [soybeans]
ref|XP_008799058.1|  PREDICTED: amino acid permease 3-like              283   6e-89    Phoenix dactylifera
ref|XP_009150448.1|  PREDICTED: amino acid permease 4                   282   7e-89    Brassica rapa
ref|XP_010653015.1|  PREDICTED: amino acid permease 4-like              283   7e-89    
ref|XP_008781630.1|  PREDICTED: amino acid permease 3                   283   7e-89    Phoenix dactylifera
ref|XP_012078266.1|  PREDICTED: amino acid permease 3-like              282   7e-89    Jatropha curcas
ref|XP_006383588.1|  hypothetical protein POPTR_0005s20390g             282   7e-89    Populus trichocarpa [western balsam poplar]
ref|XP_011031114.1|  PREDICTED: amino acid permease 4-like isofor...    282   9e-89    Populus euphratica
ref|XP_004149429.1|  PREDICTED: amino acid permease 3-like              282   9e-89    Cucumis sativus [cucumbers]
ref|XP_004498350.1|  PREDICTED: amino acid permease 3-like isofor...    281   1e-88    Cicer arietinum [garbanzo]
gb|KDP32819.1|  hypothetical protein JCGZ_12111                         281   1e-88    Jatropha curcas
gb|EYU32508.1|  hypothetical protein MIMGU_mgv1a005226mg                281   2e-88    Erythranthe guttata [common monkey flower]
ref|XP_009379863.1|  PREDICTED: amino acid permease 4-like              282   2e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008466753.1|  PREDICTED: amino acid permease 3-like              281   2e-88    Cucumis melo [Oriental melon]
ref|XP_010684694.1|  PREDICTED: amino acid permease 3-like              281   3e-88    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003524313.1|  PREDICTED: amino acid permease 2-like              281   3e-88    Glycine max [soybeans]
ref|XP_009389175.1|  PREDICTED: amino acid permease 4-like              281   4e-88    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDO96925.1|  unnamed protein product                                281   6e-88    Coffea canephora [robusta coffee]
gb|KGN47695.1|  hypothetical protein Csa_6G381850                       279   1e-87    Cucumis sativus [cucumbers]
ref|XP_009390075.1|  PREDICTED: amino acid permease 4-like isofor...    279   1e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010063423.1|  PREDICTED: amino acid permease 3-like              279   2e-87    Eucalyptus grandis [rose gum]
ref|XP_009414606.1|  PREDICTED: amino acid permease 3-like              279   2e-87    Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW70650.1|  hypothetical protein EUGRSUZ_F03824                     278   2e-87    Eucalyptus grandis [rose gum]
ref|XP_010920126.1|  PREDICTED: amino acid permease 4-like              279   2e-87    Elaeis guineensis
ref|XP_011627960.1|  PREDICTED: LOW QUALITY PROTEIN: amino acid p...    279   3e-87    
ref|XP_006662801.1|  PREDICTED: amino acid permease 3-like              278   3e-87    Oryza brachyantha
ref|XP_010911278.1|  PREDICTED: amino acid permease 3-like isofor...    278   4e-87    Elaeis guineensis
ref|XP_011002449.1|  PREDICTED: amino acid permease 3-like              278   4e-87    Populus euphratica
ref|XP_009801366.1|  PREDICTED: amino acid permease 3-like              277   5e-87    Nicotiana sylvestris
ref|XP_010911284.1|  PREDICTED: amino acid permease 3-like isofor...    278   6e-87    Elaeis guineensis
ref|XP_010063933.1|  PREDICTED: amino acid permease 3-like              277   6e-87    Eucalyptus grandis [rose gum]
gb|EEC81839.1|  hypothetical protein OsI_25597                          276   8e-87    Oryza sativa Indica Group [Indian rice]
ref|XP_008788441.1|  PREDICTED: amino acid permease 4-like              278   8e-87    Phoenix dactylifera
ref|XP_009609434.1|  PREDICTED: amino acid permease 3-like              277   9e-87    Nicotiana tomentosiformis
emb|CAN77083.1|  hypothetical protein VITISV_003992                     278   1e-86    Vitis vinifera
ref|XP_007137460.1|  hypothetical protein PHAVU_009G128600g             277   1e-86    Phaseolus vulgaris [French bean]
ref|XP_006300985.1|  hypothetical protein CARUB_v10021374mg             276   1e-86    Capsella rubella
ref|XP_009390074.1|  PREDICTED: amino acid permease 4-like isofor...    277   1e-86    Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE52230.1|  hypothetical protein OsJ_34158                          275   1e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011003419.1|  PREDICTED: amino acid permease 3-like              276   2e-86    Populus euphratica
ref|NP_001067425.1|  Os11g0195600                                       276   2e-86    
gb|KEH35329.1|  transmembrane amino acid transporter family protein     273   3e-86    Medicago truncatula
ref|XP_010527720.1|  PREDICTED: amino acid permease 5-like isofor...    275   3e-86    Tarenaya hassleriana [spider flower]
ref|XP_012081757.1|  PREDICTED: amino acid permease 4-like              276   3e-86    Jatropha curcas
gb|AAX56951.1|  amino acid transporter                                  275   5e-86    Pisum sativum [garden pea]
dbj|BAO45885.1|  amino acid permease                                    275   6e-86    Acacia mangium
ref|XP_010416679.1|  PREDICTED: amino acid permease 3-like              275   7e-86    Camelina sativa [gold-of-pleasure]
ref|XP_009390766.1|  PREDICTED: amino acid permease 4-like              275   7e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010530203.1|  PREDICTED: amino acid permease 5                   274   8e-86    Tarenaya hassleriana [spider flower]
gb|KEH40510.1|  transmembrane amino acid transporter family protein     274   1e-85    Medicago truncatula
emb|CDY71454.1|  BnaAnng37520D                                          267   2e-85    Brassica napus [oilseed rape]
ref|XP_008679681.1|  PREDICTED: amino acid permease 3-like              273   3e-85    Zea mays [maize]
ref|XP_008810907.1|  PREDICTED: amino acid permease 3-like              272   3e-85    
ref|XP_010428816.1|  PREDICTED: amino acid permease 3                   273   3e-85    Camelina sativa [gold-of-pleasure]
emb|CAC51425.1|  amino acid permease AAP4                               273   4e-85    Vicia faba var. minor [tick bean]
ref|XP_002449174.1|  hypothetical protein SORBIDRAFT_05g006010          273   4e-85    Sorghum bicolor [broomcorn]
ref|XP_004978920.1|  PREDICTED: amino acid permease 3-like              272   4e-85    
ref|XP_006473027.1|  PREDICTED: amino acid permease 3-like              272   5e-85    
ref|XP_010471931.1|  PREDICTED: amino acid permease 3-like              272   5e-85    Camelina sativa [gold-of-pleasure]
ref|XP_006847199.1|  PREDICTED: amino acid permease 4                   273   7e-85    Amborella trichopoda
ref|XP_006365537.1|  PREDICTED: amino acid permease 3-like              271   1e-84    Solanum tuberosum [potatoes]
ref|XP_008442173.1|  PREDICTED: amino acid permease 4-like              271   1e-84    Cucumis melo [Oriental melon]
ref|XP_010028716.1|  PREDICTED: amino acid permease 4-like              272   1e-84    Eucalyptus grandis [rose gum]
ref|XP_009411897.1|  PREDICTED: amino acid permease 3-like isofor...    271   1e-84    
ref|XP_009411898.1|  PREDICTED: amino acid permease 3-like isofor...    271   1e-84    
ref|XP_008236004.1|  PREDICTED: amino acid permease 3-like              272   2e-84    Prunus mume [ume]
gb|EPS59884.1|  hypothetical protein M569_14923                         263   2e-84    Genlisea aurea
gb|AIS71894.1|  amino acid transporter                                  270   5e-84    Nicotiana tabacum [American tobacco]
gb|AIL30502.1|  amino acid transporter                                  270   5e-84    Nicotiana tabacum [American tobacco]
gb|AII99817.1|  amino acid transporter                                  269   7e-84    Nicotiana tabacum [American tobacco]
gb|AFW56243.1|  hypothetical protein ZEAMMB73_107595                    262   8e-84    
ref|NP_001234606.1|  amino acid transporter                             269   9e-84    
gb|KEH35328.1|  transmembrane amino acid transporter family protein     269   1e-83    Medicago truncatula
ref|XP_006351135.1|  PREDICTED: amino acid permease 3-like              269   1e-83    Solanum tuberosum [potatoes]
ref|XP_010322323.1|  PREDICTED: amino acid transporter isoform X1       269   1e-83    Solanum lycopersicum
ref|XP_009404321.1|  PREDICTED: amino acid permease 4-like              269   1e-83    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008368062.1|  PREDICTED: amino acid permease 3-like              269   1e-83    
gb|KEH35330.1|  transmembrane amino acid transporter family protein     268   1e-83    Medicago truncatula
ref|XP_004503904.1|  PREDICTED: amino acid permease 2-like              268   2e-83    Cicer arietinum [garbanzo]
ref|XP_002278086.1|  PREDICTED: amino acid permease 3                   269   2e-83    Vitis vinifera
ref|XP_007198986.1|  hypothetical protein PRUPE_ppa020916mg             269   2e-83    Prunus persica
ref|XP_003542145.1|  PREDICTED: amino acid permease 3 isoform X1        268   2e-83    Glycine max [soybeans]
ref|XP_009767545.1|  PREDICTED: amino acid permease 3-like              268   4e-83    Nicotiana sylvestris
ref|XP_009596720.1|  PREDICTED: amino acid permease 3-like isofor...    268   4e-83    Nicotiana tomentosiformis
ref|XP_009596721.1|  PREDICTED: amino acid permease 3-like isofor...    267   4e-83    
ref|NP_001233979.1|  amino acid transporter                             266   8e-83    Solanum lycopersicum
gb|EYU37943.1|  hypothetical protein MIMGU_mgv1a004721mg                267   9e-83    Erythranthe guttata [common monkey flower]
ref|XP_009388107.1|  PREDICTED: amino acid permease 3-like              265   2e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011046334.1|  PREDICTED: amino acid permease 3-like              266   2e-82    Populus euphratica
ref|XP_009145052.1|  PREDICTED: amino acid permease 5                   265   3e-82    Brassica rapa
ref|XP_007224395.1|  hypothetical protein PRUPE_ppa021701mg             265   3e-82    Prunus persica
ref|XP_006646758.1|  PREDICTED: amino acid permease 3-like              266   4e-82    
ref|XP_008219720.1|  PREDICTED: amino acid permease 3-like              264   8e-82    Prunus mume [ume]
ref|XP_004289864.1|  PREDICTED: amino acid permease 4-like              265   9e-82    Fragaria vesca subsp. vesca
gb|EEC68963.1|  hypothetical protein OsI_37697                          264   1e-81    Oryza sativa Indica Group [Indian rice]
gb|KJB15783.1|  hypothetical protein B456_002G196200                    265   1e-81    Gossypium raimondii
ref|XP_004977213.1|  PREDICTED: amino acid permease 3-like              263   1e-81    Setaria italica
ref|XP_006422618.1|  hypothetical protein CICLE_v10028230mg             264   1e-81    Citrus clementina [clementine]
ref|XP_003578826.1|  PREDICTED: amino acid permease 3-like              263   1e-81    Brachypodium distachyon [annual false brome]
gb|KDO68035.1|  hypothetical protein CISIN_1g010376mg                   264   2e-81    Citrus sinensis [apfelsine]
emb|CDY36017.1|  BnaA08g04440D                                          263   2e-81    Brassica napus [oilseed rape]
ref|XP_006486755.1|  PREDICTED: amino acid permease 3-like              264   2e-81    Citrus sinensis [apfelsine]
ref|XP_004977210.1|  PREDICTED: amino acid permease 3-like              263   2e-81    Setaria italica
dbj|BAK02045.1|  predicted protein                                      263   2e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008442267.1|  PREDICTED: amino acid permease 4-like              263   2e-81    Cucumis melo [Oriental melon]
ref|XP_003578825.1|  PREDICTED: amino acid permease 4-like              263   2e-81    Brachypodium distachyon [annual false brome]
ref|XP_004977211.1|  PREDICTED: amino acid permease 3-like              263   2e-81    Setaria italica
gb|KHG27248.1|  Amino acid permease 3 -like protein                     262   2e-81    Gossypium arboreum [tree cotton]
ref|XP_009339433.1|  PREDICTED: amino acid permease 3-like              263   3e-81    Pyrus x bretschneideri [bai li]
gb|KHN19623.1|  Amino acid permease 3                                   262   4e-81    Glycine soja [wild soybean]
ref|XP_006596218.1|  PREDICTED: amino acid permease 3-like isofor...    262   4e-81    Glycine max [soybeans]
ref|XP_008377748.1|  PREDICTED: amino acid permease 3-like              263   4e-81    
ref|NP_001066316.1|  Os12g0181500                                       262   5e-81    
gb|EAY82481.1|  hypothetical protein OsI_37698                          262   5e-81    Oryza sativa Indica Group [Indian rice]
ref|XP_009604405.1|  PREDICTED: amino acid permease 4-like              263   6e-81    Nicotiana tomentosiformis
ref|XP_002442925.1|  hypothetical protein SORBIDRAFT_08g004990          261   7e-81    Sorghum bicolor [broomcorn]
ref|XP_004977212.1|  PREDICTED: amino acid permease 3-like              261   7e-81    Setaria italica
ref|XP_002442926.1|  hypothetical protein SORBIDRAFT_08g005000          261   7e-81    Sorghum bicolor [broomcorn]
ref|XP_003630316.1|  Amino acid permease                                261   9e-81    
gb|AFW56244.1|  hypothetical protein ZEAMMB73_131551                    261   1e-80    
ref|XP_008662536.1|  PREDICTED: amino acid permease 3-like              261   1e-80    Zea mays [maize]
dbj|BAK03497.1|  predicted protein                                      261   2e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001142349.1|  hypothetical protein                               261   2e-80    Zea mays [maize]
ref|XP_007226332.1|  hypothetical protein PRUPE_ppa022253mg             260   2e-80    Prunus persica
gb|AFW56242.1|  hypothetical protein ZEAMMB73_107595                    261   2e-80    
ref|XP_002534252.1|  amino acid transporter, putative                   260   2e-80    
ref|XP_007041865.1|  Amino acid permease 2 isoform 1                    261   2e-80    
ref|NP_001066317.1|  Os12g0181600                                       260   3e-80    
ref|XP_009107481.1|  PREDICTED: amino acid permease 5-like              260   3e-80    Brassica rapa
ref|XP_004505788.1|  PREDICTED: amino acid permease 2-like              261   3e-80    Cicer arietinum [garbanzo]
ref|NP_001045010.1|  Os01g0882800                                       260   3e-80    
gb|KHN25477.1|  Amino acid permease 2                                   260   4e-80    Glycine soja [wild soybean]
ref|XP_003568418.2|  PREDICTED: amino acid permease 3-like isofor...    260   4e-80    Brachypodium distachyon [annual false brome]
ref|XP_003540867.1|  PREDICTED: amino acid permease 2                   260   5e-80    Glycine max [soybeans]
ref|XP_002458869.1|  hypothetical protein SORBIDRAFT_03g041840          259   6e-80    
ref|XP_006307383.1|  hypothetical protein CARUB_v10009009mg             259   8e-80    Capsella rubella
ref|XP_010231354.1|  PREDICTED: amino acid permease 3-like isofor...    259   1e-79    Brachypodium distachyon [annual false brome]
ref|XP_011653944.1|  PREDICTED: amino acid permease 4                   258   1e-79    Cucumis sativus [cucumbers]
emb|CDY47793.1|  BnaC06g00580D                                          258   1e-79    Brassica napus [oilseed rape]
ref|XP_006578773.1|  PREDICTED: amino acid permease 3-like isofor...    258   1e-79    Glycine max [soybeans]
ref|XP_002442923.1|  hypothetical protein SORBIDRAFT_08g004960          258   1e-79    Sorghum bicolor [broomcorn]
ref|XP_009764609.1|  PREDICTED: amino acid permease 4-like isofor...    259   2e-79    Nicotiana sylvestris
gb|KHF99365.1|  Amino acid permease 2                                   253   2e-79    Gossypium arboreum [tree cotton]
ref|XP_002439825.1|  hypothetical protein SORBIDRAFT_09g020790          258   2e-79    
ref|XP_006393747.1|  hypothetical protein EUTSA_v10011449mg             258   2e-79    Eutrema salsugineum [saltwater cress]
ref|XP_009123048.1|  PREDICTED: amino acid permease 5                   258   2e-79    Brassica rapa
ref|XP_010090330.1|  hypothetical protein L484_024995                   259   2e-79    Morus notabilis
gb|KEH30491.1|  transmembrane amino acid transporter family protein     258   2e-79    Medicago truncatula
ref|XP_006581782.1|  PREDICTED: amino acid permease 3-like isofor...    258   3e-79    Glycine max [soybeans]
ref|XP_006581783.1|  PREDICTED: amino acid permease 3-like isofor...    257   3e-79    Glycine max [soybeans]
ref|XP_006645132.1|  PREDICTED: amino acid permease 2-like              258   3e-79    Oryza brachyantha
emb|CAA70778.1|  amino acid transporter                                 258   3e-79    Vicia faba [broad bean]
gb|KEH30492.1|  transmembrane amino acid transporter family protein     258   3e-79    Medicago truncatula
ref|XP_010266973.1|  PREDICTED: amino acid permease 3-like              257   3e-79    Nelumbo nucifera [Indian lotus]
ref|XP_002441927.1|  hypothetical protein SORBIDRAFT_08g004980          257   4e-79    Sorghum bicolor [broomcorn]
gb|AFK37021.1|  unknown                                                 258   4e-79    Medicago truncatula
ref|XP_006578775.1|  PREDICTED: amino acid permease 3-like isofor...    256   6e-79    Glycine max [soybeans]
ref|XP_004962032.1|  PREDICTED: amino acid permease 3-like isofor...    257   6e-79    Setaria italica
ref|XP_006590854.1|  PREDICTED: amino acid permease 2-like              257   7e-79    Glycine max [soybeans]
ref|XP_004978919.1|  PREDICTED: amino acid permease 3-like              256   1e-78    Setaria italica
gb|AFK39617.1|  unknown                                                 253   2e-78    Medicago truncatula
ref|XP_007137760.1|  hypothetical protein PHAVU_009G153600g             255   2e-78    Phaseolus vulgaris [French bean]
ref|NP_001045595.1|  Os02g0102200                                       256   2e-78    
ref|XP_010232650.1|  PREDICTED: amino acid permease 3-like              255   3e-78    
gb|EAY84081.1|  hypothetical protein OsI_05462                          254   4e-78    
gb|EMS49682.1|  hypothetical protein TRIUR3_22806                       250   4e-78    
gb|AAK33098.1|  amino acid transporter                                  255   4e-78    
dbj|BAJ86012.1|  predicted protein                                      254   8e-78    
ref|XP_002893978.1|  hypothetical protein ARALYDRAFT_473798             253   9e-78    
ref|NP_175076.2|  amino acid permease 5                                 253   1e-77    
emb|CAA54632.1|  amino acid permease                                    253   1e-77    
gb|EMT14141.1|  hypothetical protein F775_19210                         251   1e-77    
gb|AAF15945.1|AF061435_1  amino acid transporter b                      246   1e-77    
ref|XP_002442927.1|  hypothetical protein SORBIDRAFT_08g005010          254   1e-77    
ref|NP_001055592.1|  Os05g0424000                                       253   1e-77    
ref|XP_010527719.1|  PREDICTED: amino acid permease 5-like isofor...    254   1e-77    
ref|XP_003602669.1|  Amino acid permease                                253   2e-77    
gb|ABR18002.1|  unknown                                                 253   2e-77    
emb|CAA10608.1|  amino acid carrier                                     252   2e-77    
ref|XP_004502978.1|  PREDICTED: amino acid permease 2-like isofor...    253   2e-77    
ref|NP_001149036.1|  amino acid carrier                                 252   2e-77    
ref|XP_008654977.1|  PREDICTED: amino acid carrier isoform X1           252   2e-77    
gb|AAD16014.1|  amino acid transporter                                  249   2e-77    
gb|KHG27393.1|  Amino acid permease 6 -like protein                     244   3e-77    
ref|XP_008674422.1|  PREDICTED: amino acid permease 3-like              252   5e-77    
ref|XP_010051542.1|  PREDICTED: amino acid permease 3-like              251   5e-77    
gb|KCW44733.1|  hypothetical protein EUGRSUZ_L017182                    246   6e-77    
dbj|BAK03421.1|  predicted protein                                      251   6e-77    
ref|XP_008377310.1|  PREDICTED: amino acid permease 3-like              251   7e-77    
dbj|BAJ95327.1|  predicted protein                                      251   7e-77    
ref|XP_003602666.1|  Amino acid permease                                250   1e-76    
gb|KJB64023.1|  hypothetical protein B456_010G029800                    244   2e-76    
emb|CDM85443.1|  unnamed protein product                                250   2e-76    
emb|CDM85442.1|  unnamed protein product                                250   2e-76    
gb|ABR16450.1|  unknown                                                 250   3e-76    
gb|AAX56952.1|  amino acid transporter                                  249   4e-76    
ref|XP_006356925.1|  PREDICTED: amino acid permease 3-like              249   5e-76    
ref|XP_006366236.1|  PREDICTED: amino acid permease 3-like              249   5e-76    
ref|NP_001140430.1|  hypothetical protein                               249   5e-76    
ref|XP_010479037.1|  PREDICTED: amino acid permease 5 isoform X1        248   8e-76    
gb|KJB64020.1|  hypothetical protein B456_010G029800                    243   1e-75    
ref|XP_008219153.1|  PREDICTED: amino acid permease 6-like              247   3e-75    
ref|XP_007222665.1|  hypothetical protein PRUPE_ppa004980mg             247   3e-75    
ref|XP_007137763.1|  hypothetical protein PHAVU_009G153700g             247   4e-75    
gb|AFK45667.1|  unknown                                                 240   5e-75    
ref|XP_008663834.1|  PREDICTED: uncharacterized protein LOC103642302    257   5e-75    
ref|XP_010040981.1|  PREDICTED: amino acid permease 3-like              246   6e-75    
ref|XP_010500132.1|  PREDICTED: amino acid permease 5-like isofor...    246   8e-75    
emb|CAC51423.1|  amino acid permease AAP1                               246   8e-75    
ref|XP_007137761.1|  hypothetical protein PHAVU_009G153700g             246   1e-74    
gb|AAO40029.1|  amino acid transporter AAP4                             237   1e-74    
ref|XP_006654425.1|  PREDICTED: amino acid permease 3-like              246   1e-74    
ref|XP_002510013.1|  amino acid transporter, putative                   245   2e-74    
emb|CDP00979.1|  unnamed protein product                                245   2e-74    
ref|XP_012068118.1|  PREDICTED: amino acid permease 6-like isofor...    244   3e-74    
gb|KDO81358.1|  hypothetical protein CISIN_1g011548mg                   238   3e-74    
gb|AFW56250.1|  hypothetical protein ZEAMMB73_465553                    254   4e-74    
gb|KJB14684.1|  hypothetical protein B456_002G137400                    244   4e-74    
ref|XP_012068117.1|  PREDICTED: amino acid permease 6-like isofor...    244   5e-74    
ref|XP_008219593.1|  PREDICTED: amino acid permease 3-like              243   1e-73    
gb|ACU18748.1|  unknown                                                 234   1e-73    
ref|XP_008789212.1|  PREDICTED: amino acid permease 8-like              243   1e-73    
ref|XP_004502977.1|  PREDICTED: amino acid permease 3-like              243   1e-73    
tpg|DAA38913.1|  TPA: hypothetical protein ZEAMMB73_639977              241   2e-73    
ref|XP_009335480.1|  PREDICTED: amino acid permease 6-like              242   2e-73    
ref|XP_010051603.1|  PREDICTED: amino acid permease 3-like              242   3e-73    
ref|XP_008339056.1|  PREDICTED: amino acid permease 6                   242   3e-73    
ref|XP_008668462.1|  PREDICTED: uncharacterized protein LOC100383...    241   4e-73    
gb|AAG50558.1|AC074228_13  amino acid permease, putative                241   4e-73    
gb|KDO81357.1|  hypothetical protein CISIN_1g011548mg                   237   5e-73    
ref|XP_009793584.1|  PREDICTED: amino acid permease 6-like              241   5e-73    
gb|KHG24473.1|  Amino acid permease 6 -like protein                     241   6e-73    
gb|KJB64021.1|  hypothetical protein B456_010G029800                    241   7e-73    
gb|KJB58749.1|  hypothetical protein B456_009G224500                    243   9e-73    
ref|XP_010442428.1|  PREDICTED: amino acid permease 6                   240   1e-72    
ref|XP_003588450.1|  Amino acid transporter                             240   1e-72    
ref|XP_010482241.1|  PREDICTED: amino acid permease 6-like isofor...    240   1e-72    
ref|XP_004299846.1|  PREDICTED: amino acid permease 6-like              240   1e-72    
ref|XP_010440833.1|  PREDICTED: amino acid permease 6-like              240   1e-72    
ref|XP_002301129.2|  amino acid transport protein AAP2                  240   2e-72    
gb|ACJ84392.1|  unknown                                                 237   2e-72    
gb|KJB64022.1|  hypothetical protein B456_010G029800                    241   2e-72    
ref|XP_007137762.1|  hypothetical protein PHAVU_009G153700g             239   2e-72    
emb|CAA70969.1|  amino acid transporter                                 236   2e-72    
gb|EMT28481.1|  hypothetical protein F775_18207                         238   3e-72    
ref|XP_004498452.1|  PREDICTED: amino acid permease 6-like              239   4e-72    
ref|XP_003523211.1|  PREDICTED: amino acid permease 2-like              239   4e-72    
emb|CAA70968.2|  amino acid transporter                                 238   5e-72    
ref|XP_011017028.1|  PREDICTED: amino acid permease 6-like              239   5e-72    
ref|XP_002888218.1|  hypothetical protein ARALYDRAFT_893658             238   7e-72    
gb|ADB92670.1|  amino acid permease 6                                   238   8e-72    
ref|XP_010915382.1|  PREDICTED: amino acid permease 1-like              238   1e-71    
gb|KHN37208.1|  Amino acid permease 6                                   237   1e-71    
ref|XP_009357221.1|  PREDICTED: amino acid permease 6-like              238   1e-71    
ref|XP_010245602.1|  PREDICTED: amino acid permease 6                   238   2e-71    
gb|KHN09641.1|  Amino acid permease 2                                   237   2e-71    
ref|XP_003602671.1|  Amino acid permease                                236   2e-71    
ref|XP_003526513.1|  PREDICTED: amino acid permease 6-like              237   2e-71    
gb|KEH36106.1|  transmembrane amino acid transporter family protein     234   2e-71    
ref|XP_004973184.1|  PREDICTED: amino acid permease 3-like              237   2e-71    
ref|NP_176132.1|  amino acid permease 1                                 237   3e-71    
gb|AAB87674.1|  neutral amino acid transport system II                  237   3e-71    
ref|XP_002285557.1|  PREDICTED: amino acid permease 6                   237   3e-71    
ref|XP_003602670.1|  Amino acid permease                                236   3e-71    
ref|XP_002865746.1|  hypothetical protein ARALYDRAFT_495022             237   4e-71    
gb|KDO81356.1|  hypothetical protein CISIN_1g011548mg                   236   4e-71    
ref|XP_006433701.1|  hypothetical protein CICLE_v10000981mg             236   4e-71    
ref|XP_006472367.1|  PREDICTED: amino acid permease 6-like              236   4e-71    
ref|XP_004502980.1|  PREDICTED: amino acid permease 2-like isofor...    236   5e-71    
ref|XP_007018375.1|  Amino acid permease 6                              236   7e-71    
ref|XP_007137276.1|  hypothetical protein PHAVU_009G113800g             235   9e-71    
ref|XP_010250334.1|  PREDICTED: amino acid permease 4-like              237   9e-71    
gb|EAY82539.1|  hypothetical protein OsI_37761                          235   9e-71    
gb|KHN08198.1|  Amino acid permease 6                                   235   1e-70    
ref|NP_001242816.1|  uncharacterized protein LOC100777963               235   1e-70    
ref|XP_010104540.1|  hypothetical protein L484_025514                   235   1e-70    
ref|XP_008678533.1|  PREDICTED: amino acid permease 4-like              235   1e-70    
ref|XP_010320244.1|  PREDICTED: LOW QUALITY PROTEIN: amino acid p...    234   2e-70    
ref|XP_010556498.1|  PREDICTED: amino acid permease 6                   234   2e-70    
emb|CDP00978.1|  unnamed protein product                                234   2e-70    
ref|XP_010470262.1|  PREDICTED: amino acid permease 1                   234   2e-70    
ref|NP_001066354.2|  Os12g0195100                                       234   2e-70    
emb|CAC51424.1|  amino acid permease AAP3                               234   2e-70    
ref|XP_006280391.1|  hypothetical protein CARUB_v10026318mg             234   2e-70    
ref|XP_004501076.1|  PREDICTED: amino acid permease 6-like              234   2e-70    
emb|CDY46779.1|  BnaCnng14480D                                          234   3e-70    
gb|AFK42490.1|  unknown                                                 234   3e-70    
ref|XP_003603665.1|  Amino acid permease                                234   3e-70    
ref|XP_009127448.1|  PREDICTED: amino acid permease 6                   234   3e-70    
ref|XP_003638241.1|  Amino acid permease                                236   3e-70    
gb|KHG12273.1|  Amino acid permease 6 -like protein                     233   3e-70    
ref|XP_004136237.1|  PREDICTED: amino acid permease 6                   234   3e-70    
ref|XP_010667459.1|  PREDICTED: amino acid permease 6-like              234   3e-70    
emb|CAD92450.1|  amino acid permease 6                                  234   3e-70    
ref|XP_010553668.1|  PREDICTED: amino acid permease 1-like              234   5e-70    
ref|XP_010458325.1|  PREDICTED: amino acid permease 8                   233   9e-70    
ref|XP_004301080.1|  PREDICTED: amino acid permease 3-like              233   9e-70    
ref|XP_003577747.1|  PREDICTED: amino acid permease 3                   233   9e-70    
ref|XP_003550117.1|  PREDICTED: amino acid permease 6                   233   1e-69    
ref|XP_009629042.1|  PREDICTED: amino acid permease 6-like              233   1e-69    
ref|XP_009138576.1|  PREDICTED: amino acid permease 1-like              232   2e-69    
ref|NP_172472.1|  amino acid permease 8                                 232   2e-69    
emb|CDY04349.1|  BnaC04g18440D                                          232   2e-69    
ref|XP_010051604.1|  PREDICTED: amino acid permease 3-like              231   2e-69    
ref|XP_010240058.1|  PREDICTED: amino acid permease 3-like              232   3e-69    
gb|AES94687.2|  transmembrane amino acid transporter family protein     225   3e-69    
gb|KJB59872.1|  hypothetical protein B456_009G278100                    231   3e-69    
ref|XP_002449171.1|  hypothetical protein SORBIDRAFT_05g005980          231   3e-69    
ref|XP_009102845.1|  PREDICTED: amino acid permease 1                   231   4e-69    
ref|XP_010061591.1|  PREDICTED: amino acid permease 6-like              231   4e-69    
emb|CDY60248.1|  BnaC01g42990D                                          231   5e-69    
ref|XP_006302194.1|  hypothetical protein CARUB_v10020203mg             231   5e-69    
ref|XP_002444093.1|  hypothetical protein SORBIDRAFT_07g007570          231   5e-69    
emb|CDY44564.1|  BnaA01g21750D                                          231   6e-69    
gb|EYU34219.1|  hypothetical protein MIMGU_mgv1a005305mg                231   7e-69    
gb|EYU36417.1|  hypothetical protein MIMGU_mgv1a005426mg                230   8e-69    
ref|XP_010051607.1|  PREDICTED: amino acid permease 3-like              230   1e-68    
emb|CDY53793.1|  BnaCnng25620D                                          230   1e-68    
ref|XP_007161529.1|  hypothetical protein PHAVU_001G077000g             230   1e-68    
ref|XP_006392303.1|  hypothetical protein EUTSA_v10023431mg             230   1e-68    
gb|KCW68582.1|  hypothetical protein EUGRSUZ_F02192                     229   2e-68    
emb|CAA92992.1|  amino acid carrier                                     224   2e-68    
ref|XP_010414737.1|  PREDICTED: amino acid permease 1-like              229   2e-68    
gb|ADE75660.1|  unknown                                                 229   3e-68    
emb|CDY48843.1|  BnaA09g14700D                                          229   3e-68    
emb|CAD92449.1|  amino acid permease 1                                  229   4e-68    
gb|KFK40897.1|  hypothetical protein AALP_AA2G057600                    228   4e-68    
ref|XP_010269102.1|  PREDICTED: amino acid permease 6-like              228   5e-68    
emb|CDY04448.1|  BnaA03g59400D                                          230   5e-68    
ref|XP_010064702.1|  PREDICTED: LOW QUALITY PROTEIN: amino acid p...    228   5e-68    
ref|NP_001170050.1|  uncharacterized protein LOC100383966               227   5e-68    
ref|XP_009113317.1|  PREDICTED: amino acid permease 1                   229   7e-68    
ref|XP_009381189.1|  PREDICTED: amino acid permease 3-like              228   7e-68    
emb|CDO97307.1|  unnamed protein product                                226   8e-68    
ref|XP_010051605.1|  PREDICTED: amino acid permease 3-like              228   8e-68    
gb|KDO80519.1|  hypothetical protein CISIN_1g0115801mg                  217   9e-68    
ref|XP_002889785.1|  hypothetical protein ARALYDRAFT_471112             227   1e-67    
gb|KDO80520.1|  hypothetical protein CISIN_1g0115801mg                  216   1e-67    
gb|ABE65611.1|  amino acid permease                                     218   2e-67    
ref|XP_010490519.1|  PREDICTED: amino acid permease 8-like              226   3e-67    
ref|XP_004290906.1|  PREDICTED: amino acid permease 3-like              226   3e-67    
ref|XP_002975129.1|  hypothetical protein SELMODRAFT_442676             226   3e-67    
ref|XP_006346279.1|  PREDICTED: amino acid permease 6-like              225   4e-67    
ref|XP_010668714.1|  PREDICTED: amino acid permease 8-like              226   5e-67    
ref|XP_002977532.1|  hypothetical protein SELMODRAFT_176236             226   6e-67    
ref|NP_001233983.1|  amino acid transporter                             225   6e-67    
ref|XP_011074307.1|  PREDICTED: amino acid permease 6                   225   7e-67    
gb|KFK43300.1|  hypothetical protein AALP_AA1G106400                    223   9e-67    
ref|XP_006596180.1|  PREDICTED: amino acid permease 8-like isofor...    222   2e-66    
ref|XP_006487060.1|  PREDICTED: amino acid permease 6-like              224   2e-66    
ref|XP_009148321.1|  PREDICTED: amino acid permease 8                   224   2e-66    
emb|CDP08191.1|  unnamed protein product                                224   3e-66    
ref|XP_006306441.1|  hypothetical protein CARUB_v10012383mg             223   3e-66    
emb|CAH67344.1|  OSIGBa0130B08.4                                        223   4e-66    
emb|CAE01664.2|  OSJNBa0084K20.15                                       223   5e-66    
ref|XP_002516531.1|  amino acid transporter, putative                   223   6e-66    
ref|XP_003545599.1|  PREDICTED: amino acid permease 8-like isofor...    222   1e-65    
gb|KCW82236.1|  hypothetical protein EUGRSUZ_C03655                     221   1e-65    
ref|XP_010668707.1|  PREDICTED: amino acid permease 8-like isofor...    218   1e-65    
gb|KFK43301.1|  hypothetical protein AALP_AA1G106500                    221   1e-65    
ref|XP_010269103.1|  PREDICTED: amino acid permease 6-like              221   2e-65    
ref|XP_003560665.1|  PREDICTED: amino acid permease 1-like              221   2e-65    
ref|XP_002442913.1|  hypothetical protein SORBIDRAFT_08g004810          221   2e-65    
ref|NP_199774.1|  amino acid permease 6                                 221   2e-65    
ref|XP_001784036.1|  predicted protein                                  220   4e-65    
gb|KCW62470.1|  hypothetical protein EUGRSUZ_H05110                     221   4e-65    
ref|XP_011078457.1|  PREDICTED: amino acid permease 6-like              221   4e-65    
ref|NP_001057853.1|  Os06g0556000                                       220   6e-65    
dbj|BAK07020.1|  predicted protein                                      219   6e-65    
ref|XP_010025741.1|  PREDICTED: amino acid permease 4-like              221   6e-65    
ref|XP_006417504.1|  hypothetical protein EUTSA_v10007516mg             220   7e-65    
emb|CBI20574.3|  unnamed protein product                                220   8e-65    
ref|XP_003551130.1|  PREDICTED: amino acid permease 8-like isofor...    219   8e-65    
ref|XP_002277844.1|  PREDICTED: amino acid permease 8-like              219   9e-65    
ref|NP_001149517.1|  amino acid permease 1                              219   9e-65    
emb|CAN69378.1|  hypothetical protein VITISV_008204                     220   9e-65    
ref|XP_002437146.1|  hypothetical protein SORBIDRAFT_10g021980          219   1e-64    
ref|XP_010268969.1|  PREDICTED: amino acid permease 6-like isofor...    216   2e-64    
ref|XP_004965605.1|  PREDICTED: amino acid permease 6-like              219   2e-64    
ref|XP_008658969.1|  PREDICTED: uncharacterized protein LOC100501...    219   2e-64    
ref|XP_006656161.1|  PREDICTED: amino acid permease 1-like              218   3e-64    
ref|XP_010668697.1|  PREDICTED: amino acid permease 8-like isofor...    218   4e-64    
ref|XP_010025740.1|  PREDICTED: amino acid permease 4-like              218   5e-64    



>ref|XP_006464914.1| PREDICTED: amino acid permease 2-like [Citrus sinensis]
Length=485

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 161/193 (83%), Gaps = 1/193 (1%)
 Frame = +3

Query  117  MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            MQMG++ AAT NH     VSID P   G K  DDDGR  RTGTVWTASAHIITAVIGSGV
Sbjct  1    MQMGDNIAAT-NHHQVFDVSIDVPSQNGSKCFDDDGRLNRTGTVWTASAHIITAVIGSGV  59

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWAI QLGWVAGP+VM LFS + YYTS+LL DCYR  DPV GKRNYTYMDAVRS LG
Sbjct  60   LSLAWAIAQLGWVAGPAVMFLFSFLTYYTSSLLTDCYRTADPVSGKRNYTYMDAVRSILG  119

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G +VK CGLIQY NLFGIAIGYTIAASISMMAIKRSNCFHESGG NPCHMSSNPYMI FG
Sbjct  120  GAKVKACGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHESGGNNPCHMSSNPYMILFG  179

Query  657  IIEIILSQIPXFD  695
            ++EI LSQIP FD
Sbjct  180  VMEIFLSQIPDFD  192



>ref|XP_011099674.1| PREDICTED: amino acid permease 2-like [Sesamum indicum]
 ref|XP_011099676.1| PREDICTED: amino acid permease 2-like [Sesamum indicum]
Length=491

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 167/197 (85%), Gaps = 6/197 (3%)
 Frame = +3

Query  123  MGESAAATKNH------RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVI  284
            MGES A T +H           VS++ PP +  K +DDDGRPQRTGTVWTASAHIITAVI
Sbjct  1    MGESTATTNHHHHHHHGSQVFDVSVNVPPHFCSKVVDDDGRPQRTGTVWTASAHIITAVI  60

Query  285  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVR  464
            GSGVLSLAWAI QLGW+AGP+VM +FS V+YYTSTLLADCYR+GD +FGKRNYTYMDAVR
Sbjct  61   GSGVLSLAWAIAQLGWIAGPTVMFMFSFVIYYTSTLLADCYRSGDSLFGKRNYTYMDAVR  120

Query  465  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  644
            SNLGG +VKICG+IQY NLFG+AIGYTIAASISMMAIKRSNCFH SG K+PCHMSSNPYM
Sbjct  121  SNLGGSKVKICGIIQYLNLFGVAIGYTIAASISMMAIKRSNCFHASGEKDPCHMSSNPYM  180

Query  645  IAFGIIEIILSQIPXFD  695
            IAFGI +I+ SQIP FD
Sbjct  181  IAFGITQILFSQIPDFD  197



>ref|XP_010270272.1| PREDICTED: amino acid permease 3 [Nelumbo nucifera]
Length=483

 Score =   308 bits (790),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 164/193 (85%), Gaps = 3/193 (2%)
 Frame = +3

Query  117  MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            M MGE A  T+N+  HL  SID  P  G K  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MTMGEDAV-TRNNNQHL--SIDMLPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  57

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWAI QLGW+AGP+VM LFS V+YYTS+LL DCYR+GDPV GKRNYTY DAVRSNLG
Sbjct  58   LSLAWAIAQLGWIAGPAVMFLFSFVIYYTSSLLTDCYRSGDPVSGKRNYTYTDAVRSNLG  117

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G +VKICG+IQY NLFG+AIGYTIAASISMMAIKRSNCFHESGG NPCH+SSNPYMI FG
Sbjct  118  GVKVKICGIIQYLNLFGVAIGYTIAASISMMAIKRSNCFHESGGDNPCHISSNPYMIIFG  177

Query  657  IIEIILSQIPXFD  695
            + EI+ SQIP FD
Sbjct  178  VTEILFSQIPDFD  190



>emb|CDY21569.1| BnaC09g47230D [Brassica napus]
Length=485

 Score =   308 bits (790),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  302
            MG +AAA  +H+HH    +  P    FK  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGATAAANNHHQHHQVFDMAVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  60

Query  303  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  482
            LAWAI QLGWVAGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDAVRS LGG+
Sbjct  61   LAWAIAQLGWVAGPAVMLLFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILGGF  120

Query  483  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  662
            + KICGLIQY NLFG+AIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG+ 
Sbjct  121  KFKICGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVT  180

Query  663  EIILSQIPXFD  695
            EI+LSQ+P FD
Sbjct  181  EILLSQVPDFD  191



>ref|XP_010674405.1| PREDICTED: amino acid permease 4 [Beta vulgaris subsp. vulgaris]
Length=485

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 162/193 (84%), Gaps = 1/193 (1%)
 Frame = +3

Query  117  MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            M MG+ AA   NH H   VS D       K  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MTMGDGAAKINNH-HVFDVSFDVLGQNPSKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  59

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWAI QLGW+AGP+VM LFS V+YYTSTLLADCYR+GDP  GKRNYTYMDAVRSNLG
Sbjct  60   LSLAWAIAQLGWIAGPAVMFLFSFVIYYTSTLLADCYRSGDPDSGKRNYTYMDAVRSNLG  119

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G +VK CG+IQY NLFG+AIGYTIAASISMMAIKRSNCFH+SGGKNPCHMSSNPYMIAFG
Sbjct  120  GGKVKFCGMIQYLNLFGVAIGYTIAASISMMAIKRSNCFHDSGGKNPCHMSSNPYMIAFG  179

Query  657  IIEIILSQIPXFD  695
            I EI+ SQIP FD
Sbjct  180  IAEILFSQIPDFD  192



>ref|XP_007019168.1| Amino acid permease isoform 2 [Theobroma cacao]
 gb|EOY16393.1| Amino acid permease isoform 2 [Theobroma cacao]
Length=488

 Score =   306 bits (785),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 165/196 (84%), Gaps = 4/196 (2%)
 Frame = +3

Query  117  MQMGESAAATKNHRHH---LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIG  287
            M+M E+ A  KNH  H     +SID  P  G K  D+DGR +RTGTVWTASAHIITAVIG
Sbjct  1    MKMAENGAG-KNHLQHNQVFDLSIDVLPQGGSKCFDEDGRLKRTGTVWTASAHIITAVIG  59

Query  288  SGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRS  467
            SGVLSLAWA  QLGWVAGP+VM LFS V YYTSTLLA CYR+GDP+ GKRNYTYMDAVRS
Sbjct  60   SGVLSLAWATAQLGWVAGPAVMFLFSFVTYYTSTLLAACYRSGDPINGKRNYTYMDAVRS  119

Query  468  NLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI  647
            NLGG++VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH SGGKNPCH++SNPYMI
Sbjct  120  NLGGFKVKICGWVQYLNLFGVAIGYTIASSISMMAIKRSNCFHASGGKNPCHLNSNPYMI  179

Query  648  AFGIIEIILSQIPXFD  695
            AFGI+EII SQIP FD
Sbjct  180  AFGIVEIIFSQIPGFD  195



>ref|XP_006432100.1| hypothetical protein CICLE_v10000986mg [Citrus clementina]
 gb|ESR45340.1| hypothetical protein CICLE_v10000986mg [Citrus clementina]
Length=483

 Score =   306 bits (785),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  302
            MG++ AAT NH     VSID P   G K  DDDGR  RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGDNIAAT-NHHQVFDVSIDVPSQNGSKCFDDDGRLNRTGTVWTASAHIITAVIGSGVLS  59

Query  303  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  482
            LAWAI QLGWVAGP+VM LFS + YYTS+LL DCYR  DPV GKRNYTYMDAVRS LGG 
Sbjct  60   LAWAIAQLGWVAGPAVMFLFSFLTYYTSSLLTDCYRTADPVSGKRNYTYMDAVRSILGGA  119

Query  483  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  662
            +VK CGLIQY NLFGIAIGYTIAASISMMAIKRSNCFHESGG NPCHMSSNPYMI FG++
Sbjct  120  KVKACGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHESGGNNPCHMSSNPYMILFGVM  179

Query  663  EIILSQIPXFD  695
            EI LSQIP FD
Sbjct  180  EIFLSQIPDFD  190



>ref|XP_010652912.1| PREDICTED: amino acid permease 3 isoform X1 [Vitis vinifera]
Length=489

 Score =   306 bits (783),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 166/197 (84%), Gaps = 5/197 (3%)
 Frame = +3

Query  117  MQMGESAAATKNHRHH---LGVSIDAPPLYGF-KGLDDDGRPQRTGTVWTASAHIITAVI  284
            MQMGE+AA TKNH HH     +SID  P     K  DDDGR +RTGTVWTASAHIITAVI
Sbjct  1    MQMGENAA-TKNHHHHHQVFDISIDVLPHQNTSKCFDDDGRLKRTGTVWTASAHIITAVI  59

Query  285  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVR  464
            GSGVLSLAWAI QLGW+AGP+VM LFS V+YYTS+LLADCYR+GD V GKRNYTYMDAVR
Sbjct  60   GSGVLSLAWAIAQLGWIAGPAVMFLFSFVIYYTSSLLADCYRSGDRVSGKRNYTYMDAVR  119

Query  465  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  644
            SNLGG +VK+CGLIQY N+FG+AIGYTIAASISMMA+KRSNCFHESG KNPCH+SS PYM
Sbjct  120  SNLGGVKVKVCGLIQYLNIFGVAIGYTIAASISMMAVKRSNCFHESGRKNPCHISSYPYM  179

Query  645  IAFGIIEIILSQIPXFD  695
            I FGI EI  SQIP FD
Sbjct  180  IMFGIAEIAFSQIPDFD  196



>ref|XP_008219592.1| PREDICTED: amino acid permease 3-like isoform X2 [Prunus mume]
Length=487

 Score =   305 bits (782),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 164/194 (85%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  MQMGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  293
            M MG++    + H H +  VS+D PP  G K  DDDGR +RTGTVWT+SAHIITAVIGSG
Sbjct  1    MTMGDNTKNQQLHHHQIFDVSVDVPPQGGSKCFDDDGRLKRTGTVWTSSAHIITAVIGSG  60

Query  294  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  473
            VLSLAWA  QLGWVAGPSVMLLFS V YYTSTLL+ CYR+GD V GKRNYTYMDAVRSNL
Sbjct  61   VLSLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLSACYRSGDSVTGKRNYTYMDAVRSNL  120

Query  474  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  653
            GG +VKICG +QY NLFG++IGYTIA+SISMMAIKRSNCFH+SGGKNPCH++SNPYMIAF
Sbjct  121  GGAKVKICGYVQYLNLFGVSIGYTIASSISMMAIKRSNCFHKSGGKNPCHINSNPYMIAF  180

Query  654  GIIEIILSQIPXFD  695
            GI EII SQIP FD
Sbjct  181  GITEIIFSQIPNFD  194



>ref|XP_006386354.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
 gb|ERP64151.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
Length=487

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  MQMGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  293
            M MGE+ +A     H +  VSID  P  G K  DDDGRP+RTG VWTASAHIITAVIGSG
Sbjct  1    MTMGENTSAKNQLPHQVFSVSIDTNPQSGSKWFDDDGRPKRTGNVWTASAHIITAVIGSG  60

Query  294  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  473
            VLSLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKRNYTYMDAVR+NL
Sbjct  61   VLSLAWAIGQLGWIAGPAVMLLFSLVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANL  120

Query  474  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  653
            GG +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGG++PCHM++ PYMIAF
Sbjct  121  GGGKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGQDPCHMNAYPYMIAF  180

Query  654  GIIEIILSQIPXFD  695
            GI EI+LSQIP FD
Sbjct  181  GIAEILLSQIPGFD  194



>ref|XP_006386360.1| hypothetical protein POPTR_0002s08040g [Populus trichocarpa]
 gb|ERP64157.1| hypothetical protein POPTR_0002s08040g [Populus trichocarpa]
Length=485

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 165/192 (86%), Gaps = 1/192 (1%)
 Frame = +3

Query  123  MGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  299
            MGE+ +A     H +  VSID  P  G K  DDDGRP+RTGTVWTASAHIITAVIGSGVL
Sbjct  1    MGENTSAKNQLPHQVFSVSIDTNPQSGSKWFDDDGRPKRTGTVWTASAHIITAVIGSGVL  60

Query  300  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  479
            SLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKRNYTYMDAVR+NLGG
Sbjct  61   SLAWAIGQLGWIAGPAVMLLFSLVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANLGG  120

Query  480  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  659
             +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGG++PCHM++ PYMIAFGI
Sbjct  121  GKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGQDPCHMNAYPYMIAFGI  180

Query  660  IEIILSQIPXFD  695
             EI+LSQIP FD
Sbjct  181  AEILLSQIPGFD  192



>ref|XP_008219591.1| PREDICTED: amino acid permease 3-like isoform X1 [Prunus mume]
Length=488

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 1/193 (1%)
 Frame = +3

Query  120  QMGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            +MG++    + H H +  VS+D PP  G K  DDDGR +RTGTVWT+SAHIITAVIGSGV
Sbjct  3    KMGDNTKNQQLHHHQIFDVSVDVPPQGGSKCFDDDGRLKRTGTVWTSSAHIITAVIGSGV  62

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWA  QLGWVAGPSVMLLFS V YYTSTLL+ CYR+GD V GKRNYTYMDAVRSNLG
Sbjct  63   LSLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLSACYRSGDSVTGKRNYTYMDAVRSNLG  122

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G +VKICG +QY NLFG++IGYTIA+SISMMAIKRSNCFH+SGGKNPCH++SNPYMIAFG
Sbjct  123  GAKVKICGYVQYLNLFGVSIGYTIASSISMMAIKRSNCFHKSGGKNPCHINSNPYMIAFG  182

Query  657  IIEIILSQIPXFD  695
            I EII SQIP FD
Sbjct  183  ITEIIFSQIPNFD  195



>gb|KHG20963.1| Amino acid permease 3 -like protein [Gossypium arboreum]
Length=486

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 165/194 (85%), Gaps = 4/194 (2%)
 Frame = +3

Query  123  MGESAAATKNHRHH---LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  293
            MG+  AA +NH H+     +SID  P  G K  DDDGR +R+GTVWTASAHIITAVIGSG
Sbjct  1    MGDDGAA-RNHLHNNQVFDLSIDVLPQGGTKCYDDDGRLKRSGTVWTASAHIITAVIGSG  59

Query  294  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  473
            VLSLAWA  QLGW+AGP VM+LFS V YYTSTLLA CYR+GDPV GKRNYTYMDAVRSNL
Sbjct  60   VLSLAWATAQLGWIAGPIVMILFSFVTYYTSTLLAACYRSGDPVNGKRNYTYMDAVRSNL  119

Query  474  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  653
            GG++VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH SGGKNPCHM+SNPYMIAF
Sbjct  120  GGFKVKICGWVQYLNLFGVAIGYTIASSISMMAIKRSNCFHASGGKNPCHMNSNPYMIAF  179

Query  654  GIIEIILSQIPXFD  695
            GI+EII SQIP FD
Sbjct  180  GIVEIIFSQIPDFD  193



>ref|XP_007019167.1| Amino acid permease isoform 1 [Theobroma cacao]
 gb|EOY16392.1| Amino acid permease isoform 1 [Theobroma cacao]
Length=486

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 163/194 (84%), Gaps = 4/194 (2%)
 Frame = +3

Query  123  MGESAAATKNHRHH---LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  293
            M E+ A  KNH  H     +SID  P  G K  D+DGR +RTGTVWTASAHIITAVIGSG
Sbjct  1    MAENGAG-KNHLQHNQVFDLSIDVLPQGGSKCFDEDGRLKRTGTVWTASAHIITAVIGSG  59

Query  294  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  473
            VLSLAWA  QLGWVAGP+VM LFS V YYTSTLLA CYR+GDP+ GKRNYTYMDAVRSNL
Sbjct  60   VLSLAWATAQLGWVAGPAVMFLFSFVTYYTSTLLAACYRSGDPINGKRNYTYMDAVRSNL  119

Query  474  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  653
            GG++VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH SGGKNPCH++SNPYMIAF
Sbjct  120  GGFKVKICGWVQYLNLFGVAIGYTIASSISMMAIKRSNCFHASGGKNPCHLNSNPYMIAF  179

Query  654  GIIEIILSQIPXFD  695
            GI+EII SQIP FD
Sbjct  180  GIVEIIFSQIPGFD  193



>ref|XP_011002450.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=487

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 165/195 (85%), Gaps = 3/195 (2%)
 Frame = +3

Query  117  MQMGESAAATKNHR--HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  290
            M+MGE+ A TKNH       VS+D  P    K  DDDGRP+RTG VWTASAH+ITAVIGS
Sbjct  1    MKMGENTA-TKNHLPPQAFSVSVDTDPQSDSKWFDDDGRPKRTGNVWTASAHVITAVIGS  59

Query  291  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSN  470
            GVLSLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKRNYTYMDAVR+N
Sbjct  60   GVLSLAWAIGQLGWIAGPAVMLLFSFVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRAN  119

Query  471  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  650
            LGG +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGK+PC M++NPYMI 
Sbjct  120  LGGVKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGKDPCRMNANPYMIG  179

Query  651  FGIIEIILSQIPXFD  695
            FGI EI+LSQIP FD
Sbjct  180  FGIAEILLSQIPGFD  194



>ref|XP_011003418.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=487

 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 165/195 (85%), Gaps = 3/195 (2%)
 Frame = +3

Query  117  MQMGESAAATKNHR--HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  290
            M+MGE+ A TKNH       VS+D  P    K  DDDGRP+RTG VWTASAH+ITAVIGS
Sbjct  1    MKMGENTA-TKNHLPPQAFSVSVDTDPQSDSKWFDDDGRPKRTGNVWTASAHVITAVIGS  59

Query  291  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSN  470
            GVLSLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKRNYTYMDAVR+N
Sbjct  60   GVLSLAWAIGQLGWIAGPAVMLLFSFVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRAN  119

Query  471  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  650
            LGG +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGK+PC M++NPYMI 
Sbjct  120  LGGVKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGKDPCRMNANPYMIG  179

Query  651  FGIIEIILSQIPXFD  695
            FGI EI+LSQIP FD
Sbjct  180  FGIAEILLSQIPGFD  194



>ref|XP_007222588.1| hypothetical protein PRUPE_ppa004920mg [Prunus persica]
 gb|EMJ23787.1| hypothetical protein PRUPE_ppa004920mg [Prunus persica]
Length=485

 Score =   303 bits (776),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 163/192 (85%), Gaps = 1/192 (1%)
 Frame = +3

Query  123  MGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  299
            MG++    + H H +  VS+D PP  G K  DDDGR +RTGTVWT+SAHIITAVIGSGVL
Sbjct  1    MGDNTKNQQLHHHQIFDVSVDVPPQGGSKCFDDDGRLKRTGTVWTSSAHIITAVIGSGVL  60

Query  300  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  479
            SLAWA  QLGWVAGPSVMLLFS V YYTSTLL+ CYR+GD V GKRNYTYMDAVRSNLGG
Sbjct  61   SLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLSACYRSGDSVTGKRNYTYMDAVRSNLGG  120

Query  480  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  659
             +VKICG +QY NLFG++IGYTIA+SISMMAIKRSNCFH+SGGKNPCH++SNPYMIAFGI
Sbjct  121  AKVKICGYVQYLNLFGVSIGYTIASSISMMAIKRSNCFHKSGGKNPCHINSNPYMIAFGI  180

Query  660  IEIILSQIPXFD  695
             EII SQIP FD
Sbjct  181  TEIIFSQIPNFD  192



>emb|CDX69918.1| BnaA10g22670D [Brassica napus]
Length=485

 Score =   303 bits (776),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  302
            MG +AAA  +H  H    +  P    FK  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGATAAANNHHHGHQVFDMAVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  60

Query  303  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  482
            LAWAI QLGWVAGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDAVRS LGG+
Sbjct  61   LAWAIAQLGWVAGPAVMLLFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILGGF  120

Query  483  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  662
            + KICGLIQY NLFG+AIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG+ 
Sbjct  121  KFKICGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVT  180

Query  663  EIILSQIPXFD  695
            EI+LSQ+P FD
Sbjct  181  EILLSQVPDFD  191



>emb|CBI21586.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   300 bits (769),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 164/195 (84%), Gaps = 5/195 (3%)
 Frame = +3

Query  123  MGESAAATKNHRHH---LGVSIDAPPLYGF-KGLDDDGRPQRTGTVWTASAHIITAVIGS  290
            MGE+AA TKNH HH     +SID  P     K  DDDGR +RTGTVWTASAHIITAVIGS
Sbjct  1    MGENAA-TKNHHHHHQVFDISIDVLPHQNTSKCFDDDGRLKRTGTVWTASAHIITAVIGS  59

Query  291  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSN  470
            GVLSLAWAI QLGW+AGP+VM LFS V+YYTS+LLADCYR+GD V GKRNYTYMDAVRSN
Sbjct  60   GVLSLAWAIAQLGWIAGPAVMFLFSFVIYYTSSLLADCYRSGDRVSGKRNYTYMDAVRSN  119

Query  471  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  650
            LGG +VK+CGLIQY N+FG+AIGYTIAASISMMA+KRSNCFHESG KNPCH+SS PYMI 
Sbjct  120  LGGVKVKVCGLIQYLNIFGVAIGYTIAASISMMAVKRSNCFHESGRKNPCHISSYPYMIM  179

Query  651  FGIIEIILSQIPXFD  695
            FGI EI  SQIP FD
Sbjct  180  FGIAEIAFSQIPDFD  194



>ref|XP_011022870.1| PREDICTED: amino acid permease 4-like [Populus euphratica]
Length=493

 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 164/200 (82%), Gaps = 7/200 (4%)
 Frame = +3

Query  117  MQMGESAAATKNHRHHL-------GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIIT  275
            MQMGE+AA+   H +HL        +SID  P  G K  D+DGR +RTGT+WTASAHIIT
Sbjct  1    MQMGENAASKNCHNNHLHSHHQVFDISIDVLPQNGSKCFDEDGRLKRTGTLWTASAHIIT  60

Query  276  AVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMD  455
            AVIGSGVLSLAWA+ QLGWVAGP+VM LFS V YYTS+LL DCYR GDP  GKRNYTYMD
Sbjct  61   AVIGSGVLSLAWAVAQLGWVAGPAVMFLFSLVTYYTSSLLTDCYRTGDPDTGKRNYTYMD  120

Query  456  AVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSN  635
            AVRS LGG +VK+CG IQY  LFGIAIGYTIA+SISMMAIKRSNCFH+SGG+NPCH+SSN
Sbjct  121  AVRSILGGVKVKLCGFIQYLGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHLSSN  180

Query  636  PYMIAFGIIEIILSQIPXFD  695
            PYMI FGI EI+LSQIP FD
Sbjct  181  PYMIMFGITEILLSQIPDFD  200



>ref|XP_011027479.1| PREDICTED: amino acid permease 3-like isoform X2 [Populus euphratica]
Length=485

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 165/192 (86%), Gaps = 1/192 (1%)
 Frame = +3

Query  123  MGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  299
            MGE+ +A     H +  VSID  P  G +  DDDGRP+RTGTVWTASAHIITAVIGSGVL
Sbjct  1    MGENTSAENQLPHQVFSVSIDTHPRSGSEWFDDDGRPKRTGTVWTASAHIITAVIGSGVL  60

Query  300  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  479
            SLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKRNYTYMDAVR+NLGG
Sbjct  61   SLAWAIGQLGWIAGPAVMLLFSLVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANLGG  120

Query  480  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  659
             +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGK+PCHM++ PYMIAFGI
Sbjct  121  GKVKICGYVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGKDPCHMNAYPYMIAFGI  180

Query  660  IEIILSQIPXFD  695
             EI+LSQIP FD
Sbjct  181  AEILLSQIPGFD  192



>ref|XP_008338673.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=489

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 162/196 (83%), Gaps = 3/196 (2%)
 Frame = +3

Query  117  MQMGESAAATKNHRHHLGV---SIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIG  287
            M MG++ A      HH  V   S+D PP  G K  DDDGR +RTGTVWT+SAHIITAVIG
Sbjct  1    MTMGDNTATKNQQLHHHQVFDFSVDMPPQGGSKXFDDDGRLKRTGTVWTSSAHIITAVIG  60

Query  288  SGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRS  467
            SGVLSLAWA  QLGWVAGPSVMLLFS V YYTSTLL+ CYR+GD V GKRNYTYMDAVRS
Sbjct  61   SGVLSLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLSACYRSGDSVXGKRNYTYMDAVRS  120

Query  468  NLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI  647
            NLGG +VKICG +QY NLFG++IGYTIA+SISMMAIKRSNCFH+SGGKNPC ++SNPYMI
Sbjct  121  NLGGAKVKICGYVQYLNLFGVSIGYTIASSISMMAIKRSNCFHKSGGKNPCRINSNPYMI  180

Query  648  AFGIIEIILSQIPXFD  695
            AFG+ EII SQIP FD
Sbjct  181  AFGVTEIIFSQIPDFD  196



>ref|XP_002306650.2| hypothetical protein POPTR_0005s20400g [Populus trichocarpa]
 gb|ABK95777.1| unknown [Populus trichocarpa]
 gb|EEE93646.2| hypothetical protein POPTR_0005s20400g [Populus trichocarpa]
Length=487

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 165/195 (85%), Gaps = 3/195 (2%)
 Frame = +3

Query  117  MQMGESAAATKNHR--HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  290
            M+MGE+ A TKNH      GVS+D  P    K  DDDGRP+RTG VWTASAHIITAVIGS
Sbjct  1    MKMGENTA-TKNHLPPQAFGVSVDTDPQSDSKWFDDDGRPKRTGNVWTASAHIITAVIGS  59

Query  291  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSN  470
            GVLSLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDP  GKRNYTYM+AVR+N
Sbjct  60   GVLSLAWAIGQLGWIAGPAVMLLFSFVTYYTSILLSACYRSGDPDNGKRNYTYMEAVRAN  119

Query  471  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  650
            LGG +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGK+PC M++NPYMI 
Sbjct  120  LGGVKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGKDPCRMNANPYMIG  179

Query  651  FGIIEIILSQIPXFD  695
            FGI EI+LSQIP FD
Sbjct  180  FGIAEILLSQIPGFD  194



>ref|XP_002302223.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
 gb|EEE81496.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
Length=485

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 164/192 (85%), Gaps = 1/192 (1%)
 Frame = +3

Query  123  MGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  299
            MGE+ +A     H +  VSID  P  G K  DDDGRP+RTG VWTASAHIITAVIGSGVL
Sbjct  1    MGENTSAKNQLPHQVFSVSIDTNPQSGSKWFDDDGRPKRTGNVWTASAHIITAVIGSGVL  60

Query  300  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  479
            SLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKRNYTYMDAVR+NLGG
Sbjct  61   SLAWAIGQLGWIAGPAVMLLFSLVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANLGG  120

Query  480  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  659
             +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGG++PCHM++ PYMIAFGI
Sbjct  121  GKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGQDPCHMNAYPYMIAFGI  180

Query  660  IEIILSQIPXFD  695
             EI+LSQIP FD
Sbjct  181  AEILLSQIPGFD  192



>ref|XP_002520322.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF42108.1| amino acid transporter, putative [Ricinus communis]
Length=485

 Score =   301 bits (772),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 163/193 (84%), Gaps = 3/193 (2%)
 Frame = +3

Query  123  MGESAAATKNH--RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            MGE+ A TKNH       V++D PP  G K  DDDG+ +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MGENTA-TKNHFPPQVFSVNVDMPPQAGSKWYDDDGKLKRTGTVWTASAHIITAVIGSGV  59

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWA+ QLGWVAGP+VM LFS V YYTSTLL+ CYR GDPV GKRNYTYMDAVRSNLG
Sbjct  60   LSLAWAVAQLGWVAGPAVMFLFSLVTYYTSTLLSACYRTGDPVNGKRNYTYMDAVRSNLG  119

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G + KICG +QY NL G+AIGYTIA+SISMMA+KRSNCFH+SGGKNPCHM++NPYMIAFG
Sbjct  120  GAKFKICGYVQYVNLIGVAIGYTIASSISMMAVKRSNCFHKSGGKNPCHMNANPYMIAFG  179

Query  657  IIEIILSQIPXFD  695
            ++EII SQIP FD
Sbjct  180  VVEIIFSQIPDFD  192



>ref|XP_009339426.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009339427.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009342935.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
Length=489

 Score =   301 bits (772),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 161/196 (82%), Gaps = 3/196 (2%)
 Frame = +3

Query  117  MQMGESAAATKNHRHH---LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIG  287
            M MG++ A      HH      S+D PP  G K  DDDGR +RTGTVWT+SAHIITAVIG
Sbjct  1    MTMGDNTATKNQQLHHDQVFDFSVDMPPQGGSKCFDDDGRLKRTGTVWTSSAHIITAVIG  60

Query  288  SGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRS  467
            SGVLSLAWA  QLGWVAGPSVMLLFS V YYTSTLL+ CYR+GD + GKRNYTYMDAVRS
Sbjct  61   SGVLSLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLSACYRSGDSITGKRNYTYMDAVRS  120

Query  468  NLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI  647
            NLGG +VKICG +QY NLFG++IGYTIA+SISMMAIKRSNCFH+SGGKNPC ++SNPYMI
Sbjct  121  NLGGAKVKICGYVQYLNLFGVSIGYTIASSISMMAIKRSNCFHKSGGKNPCRINSNPYMI  180

Query  648  AFGIIEIILSQIPXFD  695
            AFG+ EII SQIP FD
Sbjct  181  AFGVTEIIFSQIPDFD  196



>ref|XP_009122500.1| PREDICTED: amino acid permease 2 [Brassica rapa]
Length=485

 Score =   301 bits (771),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  302
            MG +AA   +H  H    +  P    FK  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGATAAVNNHHHGHQVFDMAVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  60

Query  303  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  482
            LAWAI QLGWVAGP+VMLLFS V  Y+STLL+DCYR GD + GKRNYTYMDAVRS LGG+
Sbjct  61   LAWAIAQLGWVAGPAVMLLFSLVTLYSSTLLSDCYRTGDAISGKRNYTYMDAVRSILGGF  120

Query  483  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  662
            + KICGLIQY NLFG+AIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG+ 
Sbjct  121  KFKICGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVT  180

Query  663  EIILSQIPXFD  695
            EI+LSQ+P FD
Sbjct  181  EILLSQVPDFD  191



>ref|XP_002275881.1| PREDICTED: amino acid permease 3 isoform X2 [Vitis vinifera]
 ref|XP_010652913.1| PREDICTED: amino acid permease 3 isoform X2 [Vitis vinifera]
Length=487

 Score =   301 bits (771),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 164/195 (84%), Gaps = 5/195 (3%)
 Frame = +3

Query  123  MGESAAATKNHRHH---LGVSIDAPPLYGF-KGLDDDGRPQRTGTVWTASAHIITAVIGS  290
            MGE+AA TKNH HH     +SID  P     K  DDDGR +RTGTVWTASAHIITAVIGS
Sbjct  1    MGENAA-TKNHHHHHQVFDISIDVLPHQNTSKCFDDDGRLKRTGTVWTASAHIITAVIGS  59

Query  291  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSN  470
            GVLSLAWAI QLGW+AGP+VM LFS V+YYTS+LLADCYR+GD V GKRNYTYMDAVRSN
Sbjct  60   GVLSLAWAIAQLGWIAGPAVMFLFSFVIYYTSSLLADCYRSGDRVSGKRNYTYMDAVRSN  119

Query  471  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  650
            LGG +VK+CGLIQY N+FG+AIGYTIAASISMMA+KRSNCFHESG KNPCH+SS PYMI 
Sbjct  120  LGGVKVKVCGLIQYLNIFGVAIGYTIAASISMMAVKRSNCFHESGRKNPCHISSYPYMIM  179

Query  651  FGIIEIILSQIPXFD  695
            FGI EI  SQIP FD
Sbjct  180  FGIAEIAFSQIPDFD  194



>emb|CAF22024.1| amino acid permease [Brassica napus]
Length=487

 Score =   301 bits (770),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 164/193 (85%), Gaps = 2/193 (1%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDA--PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            MGE+AAA  +H HH     DA  PP   FK  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MGETAAANHHHHHHGHQVFDAYVPPQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWAI QLGWVAGP+VML+FS V  Y+STLL+DCYR GD V GKRNYTYMDAVRS LG
Sbjct  61   LSLAWAIAQLGWVAGPAVMLVFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILG  120

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G++ KICGLIQY NLFGIAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG
Sbjct  121  GFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFG  180

Query  657  IIEIILSQIPXFD  695
            + EI+LSQ+P FD
Sbjct  181  VTEILLSQVPDFD  193



>ref|XP_008444195.1| PREDICTED: amino acid permease 3-like [Cucumis melo]
Length=480

 Score =   300 bits (769),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 160/185 (86%), Gaps = 3/185 (2%)
 Frame = +3

Query  150  NHRHHLGVSIDAPPLYGF---KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIG  320
            N+ HH  ++I APP          DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWA  
Sbjct  3    NNHHHHSLNISAPPHAAVGADTAFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWATA  62

Query  321  QLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICG  500
            QLGWVAGP VM+LFS V YYTSTLLA CYR+GD V GKRNYTYMDAVR+NLGG++VK+CG
Sbjct  63   QLGWVAGPVVMMLFSFVTYYTSTLLAACYRSGDSVNGKRNYTYMDAVRNNLGGFKVKLCG  122

Query  501  LIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQ  680
            L+QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGKNPCHM+SNPYMI+FGI+EI LSQ
Sbjct  123  LVQYVNLFGVAIGYTIASSISMMAIKRSNCFHKSGGKNPCHMNSNPYMISFGIMEIFLSQ  182

Query  681  IPXFD  695
            IP FD
Sbjct  183  IPDFD  187



>ref|XP_011653779.1| PREDICTED: amino acid permease 3-like [Cucumis sativus]
 gb|KGN54544.1| Amino acid permease [Cucumis sativus]
Length=480

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 160/185 (86%), Gaps = 3/185 (2%)
 Frame = +3

Query  150  NHRHHLGVSIDAPP---LYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIG  320
            N+ HH  ++I APP          DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWA  
Sbjct  3    NNHHHHSLNISAPPHPASAADTAFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWATA  62

Query  321  QLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICG  500
            QLGWVAGP VM+LFS V YYTSTLLA CYR+GD V GKRNYTYMDAVR+NLGG++VK+CG
Sbjct  63   QLGWVAGPVVMMLFSFVTYYTSTLLAACYRSGDSVNGKRNYTYMDAVRNNLGGFKVKLCG  122

Query  501  LIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQ  680
            L+QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGKNPCHM+SNPYMI+FGI+EI LSQ
Sbjct  123  LVQYVNLFGVAIGYTIASSISMMAIKRSNCFHKSGGKNPCHMNSNPYMISFGIMEIFLSQ  182

Query  681  IPXFD  695
            IP FD
Sbjct  183  IPDFD  187



>ref|XP_011458812.1| PREDICTED: amino acid permease 3-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=486

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = +3

Query  117  MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            M MG++      H     VS++ PP  G K  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MTMGDNKNQMLQHNQVFDVSVNMPPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWAI QLGWVAGP+VM LFS V YYTSTLL+ CYR+GD   GKRNYTYMDAV+SNLG
Sbjct  61   LSLAWAIAQLGWVAGPAVMFLFSLVTYYTSTLLSACYRSGDSDTGKRNYTYMDAVQSNLG  120

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G +VKICG +QY NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCH++SNPYMIAFG
Sbjct  121  GVKVKICGYVQYLNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHINSNPYMIAFG  180

Query  657  IIEIILSQIPXFD  695
            I+EII SQIP FD
Sbjct  181  IVEIIFSQIPDFD  193



>ref|XP_011027478.1| PREDICTED: amino acid permease 3-like isoform X1 [Populus euphratica]
Length=486

 Score =   299 bits (765),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 165/194 (85%), Gaps = 2/194 (1%)
 Frame = +3

Query  117  MQMGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  293
            M MGE+ +A     H +  VSID  P  G K  D+D RP+RTGTVWTASAHIITAVIGSG
Sbjct  1    MTMGENTSAKNQLPHQIFSVSIDTNPQSG-KWFDEDHRPKRTGTVWTASAHIITAVIGSG  59

Query  294  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  473
            VLSLAWAIGQLGW+AGP+VMLLFS V YYTS LL+ CYR+GDPV GKRNYTYMDAVR+NL
Sbjct  60   VLSLAWAIGQLGWIAGPAVMLLFSLVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANL  119

Query  474  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  653
            GG +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGK+PCHM++ PYMIAF
Sbjct  120  GGGKVKICGYVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGKDPCHMNAYPYMIAF  179

Query  654  GIIEIILSQIPXFD  695
            GI EI+LSQIP FD
Sbjct  180  GIAEILLSQIPGFD  193



>ref|XP_002520323.1| amino acid transporter, putative [Ricinus communis]
 emb|CAA07563.1| amino acid carrier [Ricinus communis]
 gb|EEF42109.1| amino acid transporter, putative [Ricinus communis]
Length=486

 Score =   298 bits (764),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 166/193 (86%), Gaps = 3/193 (2%)
 Frame = +3

Query  123  MGESAAATKNHRHHL-GVSID-APPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            M E+ AA KNH H +  VSI+    + G K LDDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MVENTAA-KNHPHQVFDVSINMQTQVVGSKWLDDDGRTKRTGTVWTASAHIITAVIGSGV  59

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWAI QLGW+AGP+VM LFS V YYTSTLL+ CYR+GDPV GKRNYTYMDAVR+NLG
Sbjct  60   LSLAWAIAQLGWIAGPAVMFLFSLVTYYTSTLLSACYRSGDPVNGKRNYTYMDAVRTNLG  119

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G +VK+CG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGKNPCH+++NPYMIAFG
Sbjct  120  GAKVKLCGFVQYLNLFGVAIGYTIASSISMMAIKRSNCFHKSGGKNPCHINANPYMIAFG  179

Query  657  IIEIILSQIPXFD  695
            I EII SQIP FD
Sbjct  180  IAEIIFSQIPDFD  192



>ref|XP_007048506.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 ref|XP_007048507.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX92663.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX92664.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
Length=485

 Score =   298 bits (763),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 162/193 (84%), Gaps = 3/193 (2%)
 Frame = +3

Query  123  MGESAAATKNHRHH--LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            MGE+AA TKNH +H    VS+  P   G +  DDDGR +RTGT+WTASAHIITAVIGSGV
Sbjct  1    MGENAA-TKNHDNHQVFDVSLGIPSKGGSECFDDDGRIKRTGTLWTASAHIITAVIGSGV  59

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWAI QLGW+AGP+VM LFS V  YTS+LL DCYR GDPV GKRNYTYMDAVRS LG
Sbjct  60   LSLAWAIAQLGWIAGPAVMFLFSLVTCYTSSLLTDCYRTGDPVSGKRNYTYMDAVRSILG  119

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            GY+VK CGLIQY NL GI++GYTIAAS+SMMAIKRSNCFHESGGKNPCHMSS PYMI FG
Sbjct  120  GYKVKACGLIQYLNLCGISVGYTIAASVSMMAIKRSNCFHESGGKNPCHMSSTPYMIMFG  179

Query  657  IIEIILSQIPXFD  695
            + EI+LSQIP FD
Sbjct  180  VTEILLSQIPDFD  192



>ref|XP_010095435.1| hypothetical protein L484_013392 [Morus notabilis]
 gb|EXB60127.1| hypothetical protein L484_013392 [Morus notabilis]
Length=482

 Score =   298 bits (762),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 157/191 (82%), Gaps = 3/191 (2%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  302
            MGE       HR    VS+D P   G K  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGEQQL---QHRQVFDVSLDVPQQPGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  57

Query  303  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  482
            LAWA  QLGW+AGP+VM LFS V YYTSTLL+ CYR GDPV GKRNYTYMDAVRSNLGG 
Sbjct  58   LAWATAQLGWIAGPAVMFLFSFVTYYTSTLLSACYRTGDPVTGKRNYTYMDAVRSNLGGL  117

Query  483  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  662
            +V+ICGL QY NLFG+AIGYTIA++ISMMAIKRSNCFH+SG K+PCHMSSNPYMIAFG+ 
Sbjct  118  RVRICGLFQYLNLFGVAIGYTIASAISMMAIKRSNCFHKSGRKDPCHMSSNPYMIAFGVT  177

Query  663  EIILSQIPXFD  695
            EII SQIP FD
Sbjct  178  EIIFSQIPNFD  188



>ref|XP_010452897.1| PREDICTED: amino acid permease 2 [Camelina sativa]
Length=493

 Score =   298 bits (763),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 162/199 (81%), Gaps = 8/199 (4%)
 Frame = +3

Query  123  MGESAAATKN--------HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  278
            MGE+AAA ++            +  S   PP   FK  DDDGR +RTGTVWTASAHIITA
Sbjct  1    MGETAAANRHHHNHHHGHQVFDVASSDVVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  279  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDA  458
            VIGSGVLSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  459  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  638
            VRS LGG++ KICGLIQY NLFGIAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNP
Sbjct  121  VRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  639  YMIAFGIIEIILSQIPXFD  695
            YMI FG+ EI+LSQIP FD
Sbjct  181  YMIIFGVTEILLSQIPDFD  199



>ref|XP_006399392.1| hypothetical protein EUTSA_v10013363mg [Eutrema salsugineum]
 gb|ESQ40845.1| hypothetical protein EUTSA_v10013363mg [Eutrema salsugineum]
Length=492

 Score =   298 bits (762),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 166/198 (84%), Gaps = 7/198 (4%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSI-DA------PPLYGFKGLDDDGRPQRTGTVWTASAHIITAV  281
            MGE+AAA  +H HH G  + DA      PP   FK  DDDGR +RTGTVWTASAHI+TAV
Sbjct  1    MGETAAAKNHHHHHHGHQVFDAAIHDVVPPQPAFKCFDDDGRLKRTGTVWTASAHIVTAV  60

Query  282  IGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAV  461
            IGSGVLSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDAV
Sbjct  61   IGSGVLSLAWAIAQLGWIAGPAVMLLFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAV  120

Query  462  RSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPY  641
            RS LGG++ KICGLIQY NLFGIAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPY
Sbjct  121  RSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPY  180

Query  642  MIAFGIIEIILSQIPXFD  695
            MI FG+ EI+LSQIP FD
Sbjct  181  MIIFGVTEILLSQIPDFD  198



>ref|XP_004290907.1| PREDICTED: amino acid permease 3-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=484

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  302
            MG++      H     VS++ PP  G K  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGDNKNQMLQHNQVFDVSVNMPPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  60

Query  303  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  482
            LAWAI QLGWVAGP+VM LFS V YYTSTLL+ CYR+GD   GKRNYTYMDAV+SNLGG 
Sbjct  61   LAWAIAQLGWVAGPAVMFLFSLVTYYTSTLLSACYRSGDSDTGKRNYTYMDAVQSNLGGV  120

Query  483  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  662
            +VKICG +QY NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCH++SNPYMIAFGI+
Sbjct  121  KVKICGYVQYLNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHINSNPYMIAFGIV  180

Query  663  EIILSQIPXFD  695
            EII SQIP FD
Sbjct  181  EIIFSQIPDFD  191



>ref|XP_010491540.1| PREDICTED: amino acid permease 2-like [Camelina sativa]
Length=493

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 162/199 (81%), Gaps = 8/199 (4%)
 Frame = +3

Query  123  MGESAAATKN--------HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  278
            MGE+AAAT++            +  +   PP   FK  DDDGR +RTGTVWTASAHIITA
Sbjct  1    MGETAAATRHHHNHHHGHQVFDVASNEVVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  279  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDA  458
            VIGSGVLSLAWAI QLGW+AGP+VM+LFS V  Y+STLL+DCYR GD V GKRNYTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMILFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  459  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  638
            VRS LGG++ KICGLIQY NLFGIAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNP
Sbjct  121  VRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  639  YMIAFGIIEIILSQIPXFD  695
            YMI FG+ EI LSQ+P FD
Sbjct  181  YMIIFGVTEIFLSQVPDFD  199



>ref|XP_010546306.1| PREDICTED: amino acid permease 4 isoform X1 [Tarenaya hassleriana]
Length=472

 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +3

Query  189  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  368
            P   FK  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWAI QLGW+AGP+VMLLFS 
Sbjct  10   PQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMLLFSF  69

Query  369  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  548
            V YY+STLL+DCYR GDPV GKRNYTYMDAVRS LGG++ KICGLIQY NLFGIA+GYTI
Sbjct  70   VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFGIAVGYTI  129

Query  549  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            AASISMMAIKRSNCFH+SGGKNPCHMSSNPYMI FG+ EI+LSQIP FD
Sbjct  130  AASISMMAIKRSNCFHKSGGKNPCHMSSNPYMIMFGLTEILLSQIPDFD  178



>ref|XP_006434261.1| hypothetical protein CICLE_v10000991mg [Citrus clementina]
 gb|ESR47501.1| hypothetical protein CICLE_v10000991mg [Citrus clementina]
Length=480

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 157/185 (85%), Gaps = 3/185 (2%)
 Frame = +3

Query  141  ATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIG  320
            A KN      VS+   P  G K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWA  
Sbjct  6    AAKNQHQVFDVSL---PESGPKCFDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWATA  62

Query  321  QLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICG  500
            QLGW+AGPSVM LFS V YYTSTLLA CYR+GDPV GKRNYTY+DAVRSNLGG+QVKICG
Sbjct  63   QLGWIAGPSVMFLFSFVTYYTSTLLAACYRSGDPVTGKRNYTYVDAVRSNLGGFQVKICG  122

Query  501  LIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQ  680
            L+QY NLFG+AIGYTIA+SISMMAI+RSNCFH  G KNPCHM+SNPYMIAFGI+EI+LSQ
Sbjct  123  LVQYLNLFGVAIGYTIASSISMMAIERSNCFHSKGDKNPCHMNSNPYMIAFGIVEIVLSQ  182

Query  681  IPXFD  695
            IP FD
Sbjct  183  IPDFD  187



>emb|CDX81121.1| BnaC03g03750D [Brassica napus]
Length=487

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 163/193 (84%), Gaps = 2/193 (1%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDA--PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            MGE+AAA  +H HH     DA  P    FK  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MGETAAANHHHHHHGHQVFDASVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDAVRS LG
Sbjct  61   LSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILG  120

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G++ KICGLIQY NLFGIA+GYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG
Sbjct  121  GFKFKICGLIQYLNLFGIAVGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFG  180

Query  657  IIEIILSQIPXFD  695
            + EI+LSQ+P FD
Sbjct  181  VTEILLSQVPDFD  193



>gb|AAO40028.1| amino acid transporter AAP2 [Brassica napus]
Length=186

 Score =   286 bits (733),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  186  PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFS  365
            PP   FK  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWAI QLGWVAGP+VML+FS
Sbjct  5    PPQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMLVFS  64

Query  366  CVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYT  545
             V  Y+STLL+DCYR GD V GKRNYTYM AVRS LGG++ KICGLIQY NLFGIA+GYT
Sbjct  65   LVTLYSSTLLSDCYRTGDAVSGKRNYTYMGAVRSILGGFKFKICGLIQYLNLFGIAVGYT  124

Query  546  IAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            IAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG+ EI+LSQ+P FD
Sbjct  125  IAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVTEILLSQVPDFD  174



>ref|XP_002302224.2| hypothetical protein POPTR_0002s08000g [Populus trichocarpa]
 gb|EEE81497.2| hypothetical protein POPTR_0002s08000g [Populus trichocarpa]
Length=485

 Score =   296 bits (758),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 160/192 (83%), Gaps = 1/192 (1%)
 Frame = +3

Query  123  MGESAAATKNHRHHL-GVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  299
            MGE+ +A     H +  VSID  P  G +  DDDGRP+RTGTVWTASAHIITAVIGSGVL
Sbjct  1    MGENTSAENQLPHQVFSVSIDTNPRSGSEWFDDDGRPKRTGTVWTASAHIITAVIGSGVL  60

Query  300  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  479
            SLAWAIGQLGW+AGP+VMLLFS V YYTSTLL+ CYR+GDP+ GKRNYTYMD VR+NLG 
Sbjct  61   SLAWAIGQLGWIAGPAVMLLFSLVTYYTSTLLSACYRSGDPITGKRNYTYMDVVRANLGD  120

Query  480  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  659
             +VKICG + Y N FG+A GYTIA+SISMMAIKRSNCFH+SGGKNPC M++NPYMI FGI
Sbjct  121  VKVKICGFVLYLNPFGVATGYTIASSISMMAIKRSNCFHKSGGKNPCRMNANPYMIGFGI  180

Query  660  IEIILSQIPXFD  695
             EI+LSQIP FD
Sbjct  181  TEILLSQIPGFD  192



>ref|XP_002871360.1| hypothetical protein ARALYDRAFT_487723 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47619.1| hypothetical protein ARALYDRAFT_487723 [Arabidopsis lyrata subsp. 
lyrata]
Length=493

 Score =   296 bits (759),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 161/199 (81%), Gaps = 8/199 (4%)
 Frame = +3

Query  123  MGESAAATKN--------HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  278
            MGE+AAA  +            +      PP   FK  DDDGR +RTGTVWTASAHIITA
Sbjct  1    MGETAAANNHRHHHHHGHQVFDVASHDVVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  279  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDA  458
            VIGSGVLSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  459  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  638
            VRS LGG++ KICGLIQY NLFGIAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNP
Sbjct  121  VRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  639  YMIAFGIIEIILSQIPXFD  695
            YMIAFG+ EI+LSQ+P FD
Sbjct  181  YMIAFGVAEILLSQVPDFD  199



>ref|XP_010269036.1| PREDICTED: amino acid permease 3-like [Nelumbo nucifera]
Length=476

 Score =   295 bits (756),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  153  HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  332
             +    +SID  P  G +  DDDGR +RTGT WTASAHI+TAVIGSGVLSLAWAI QLGW
Sbjct  3    EKQVFDLSIDVSPQGGSECFDDDGRLKRTGTFWTASAHIVTAVIGSGVLSLAWAIAQLGW  62

Query  333  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQY  512
            +AGP++M+LFS V+YYTS+LLADCYR+GDPV GKRNYTYMDAVRSNLGG +VKICG+IQY
Sbjct  63   IAGPAMMILFSFVIYYTSSLLADCYRSGDPVSGKRNYTYMDAVRSNLGGVKVKICGVIQY  122

Query  513  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXF  692
             NLFG++IGYTIAASISMMAI+RSNCFHESGGKN CH+SSNPYMI FG+ EI+LSQIP F
Sbjct  123  LNLFGVSIGYTIAASISMMAIRRSNCFHESGGKNSCHVSSNPYMIIFGVTEILLSQIPDF  182

Query  693  D  695
            D
Sbjct  183  D  183



>emb|CAA54631.1| amino acid transporter [Arabidopsis thaliana]
Length=466

 Score =   295 bits (755),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  189  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  368
            P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VMLLFS 
Sbjct  4    PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPTVMLLFSF  63

Query  369  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  548
            V YY+STLL+DCYR GDPV GKRNYTYMDAVRS LGG++ KICGLIQY NLFGI +GYTI
Sbjct  64   VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTI  123

Query  549  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI  FD
Sbjct  124  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFD  172



>ref|NP_201190.1| amino acid permease 4 [Arabidopsis thaliana]
 sp|Q9FN04.1|AAP4_ARATH RecName: Full=Amino acid permease 4; AltName: Full=Amino acid 
transporter AAP4 [Arabidopsis thaliana]
 dbj|BAB11033.1| amino acid transporter AAP4 [Arabidopsis thaliana]
 gb|AED97804.1| amino acid permease 4 [Arabidopsis thaliana]
Length=466

 Score =   295 bits (755),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  189  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  368
            P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VMLLFS 
Sbjct  4    PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPTVMLLFSF  63

Query  369  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  548
            V YY+STLL+DCYR GDPV GKRNYTYMDAVRS LGG++ KICGLIQY NLFGI +GYTI
Sbjct  64   VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTI  123

Query  549  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI  FD
Sbjct  124  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFD  172



>gb|AAM13223.1| amino acid transporter AAP4 [Arabidopsis thaliana]
 gb|AAO30058.1| amino acid transporter AAP4 [Arabidopsis thaliana]
Length=466

 Score =   295 bits (755),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  189  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  368
            P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VMLLFS 
Sbjct  4    PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPTVMLLFSF  63

Query  369  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  548
            V YY+STLL+DCYR GDPV GKRNYTYMDAVRS LGG++ KICGLIQY NLFGI +GYTI
Sbjct  64   VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTI  123

Query  549  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI  FD
Sbjct  124  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFD  172



>ref|XP_010423021.1| PREDICTED: amino acid permease 2-like [Camelina sativa]
Length=493

 Score =   296 bits (757),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 161/199 (81%), Gaps = 8/199 (4%)
 Frame = +3

Query  123  MGESAAATKN--------HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  278
            MGE+AAA ++            +  +   PP   FK  DDDGR +RTGTVWTASAHIITA
Sbjct  1    MGETAAANRHHHTHHHGHQVFDVASNDAVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  279  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDA  458
            VIGSGVLSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  459  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  638
            VRS LGG++ KICGLIQY NLFGIAIGYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNP
Sbjct  121  VRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  639  YMIAFGIIEIILSQIPXFD  695
            YMI FG+ EI+ SQIP FD
Sbjct  181  YMIIFGVTEILFSQIPDFD  199



>ref|XP_010484145.1| PREDICTED: amino acid permease 4 [Camelina sativa]
Length=466

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  189  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  368
            P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4    PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSF  63

Query  369  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  548
            V YY+STLL+DCYR GDPV GKRNYTYMDAVRS LGG++ KICGLIQY NLFGI IGYTI
Sbjct  64   VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITIGYTI  123

Query  549  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI  FD
Sbjct  124  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFD  172



>ref|XP_006390096.1| hypothetical protein EUTSA_v10018484mg [Eutrema salsugineum]
 gb|ESQ27382.1| hypothetical protein EUTSA_v10018484mg [Eutrema salsugineum]
Length=476

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = +3

Query  150  NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  329
            NH      ++D P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLG
Sbjct  2    NHNQQAAFAVDMPQPGGSKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLG  61

Query  330  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQ  509
            W+AGP VMLLFS V Y+TSTLLA CYR+GDP+ GKRNYTYMDAVRSNLGG +VK+CG++Q
Sbjct  62   WLAGPVVMLLFSVVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQ  121

Query  510  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPX  689
            Y NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++II SQIP 
Sbjct  122  YLNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPD  181

Query  690  FD  695
            FD
Sbjct  182  FD  183



>ref|NP_196484.1| amino acid permease 2 [Arabidopsis thaliana]
 sp|Q38967.1|AAP2_ARATH RecName: Full=Amino acid permease 2; AltName: Full=Amino acid 
transporter AAP2 [Arabidopsis thaliana]
 emb|CAA50672.1| amine acid permease [Arabidopsis thaliana]
 emb|CAC05448.1| amino acid transport protein AAP2 [Arabidopsis thaliana]
 gb|AAL91247.1| AT5g09220/T5E8_20 [Arabidopsis thaliana]
 gb|AED91352.1| amino acid permease 2 [Arabidopsis thaliana]
Length=493

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  186  PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFS  365
            PP   FK  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWAI QLGW+AGP+VMLLFS
Sbjct  30   PPQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMLLFS  89

Query  366  CVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYT  545
             V  Y+STLL+DCYR GD V GKRNYTYMDAVRS LGG++ KICGLIQY NLFGIAIGYT
Sbjct  90   LVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFGIAIGYT  149

Query  546  IAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            IAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG+ EI+LSQ+P FD
Sbjct  150  IAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIVFGVAEILLSQVPDFD  199



>ref|XP_006279782.1| hypothetical protein CARUB_v10027867mg [Capsella rubella]
 gb|EOA12680.1| hypothetical protein CARUB_v10027867mg [Capsella rubella]
Length=466

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  189  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  368
            P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4    PQPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSF  63

Query  369  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  548
            V YY+STLL+DCYR GDPV GKRNYTYMDAVRS LGG++ KICGLIQY NLFGI IGYTI
Sbjct  64   VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITIGYTI  123

Query  549  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI  FD
Sbjct  124  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMILFGVTEILLSQIKDFD  172



>ref|XP_010444306.1| PREDICTED: amino acid permease 4-like [Camelina sativa]
Length=466

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  189  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  368
            P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4    PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSF  63

Query  369  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  548
            V YY+STLL+DCYR GDPV GKRNYTYMDAVRS LGG++ KICGLIQY NLFG+ IGYTI
Sbjct  64   VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGVTIGYTI  123

Query  549  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI  FD
Sbjct  124  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFD  172



>ref|XP_007213109.1| hypothetical protein PRUPE_ppa023539mg [Prunus persica]
 gb|EMJ14308.1| hypothetical protein PRUPE_ppa023539mg [Prunus persica]
Length=480

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 158/186 (85%), Gaps = 1/186 (1%)
 Frame = +3

Query  141  ATKNHRHHLGVSIDA-PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  317
            +  N++    +SID  P + G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWAI
Sbjct  2    SENNNQQVFDISIDVVPKINGSKCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAI  61

Query  318  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKIC  497
             QLGW+AGPSVM LFS V YYTS LL+DCYR+GDP+ GKRNYTY+DAVRS LGG +VK C
Sbjct  62   AQLGWIAGPSVMFLFSFVSYYTSCLLSDCYRSGDPLTGKRNYTYIDAVRSILGGARVKAC  121

Query  498  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  677
            GLIQY NLFGIAIGYTIAAS+SMMAIKRSNCFHESGGK PCHMSSNPYMI FG+ E++LS
Sbjct  122  GLIQYLNLFGIAIGYTIAASVSMMAIKRSNCFHESGGKKPCHMSSNPYMILFGVTEVLLS  181

Query  678  QIPXFD  695
            QIP FD
Sbjct  182  QIPDFD  187



>gb|AAM61320.1| amino acid transporter AAP4 [Arabidopsis thaliana]
Length=466

 Score =   293 bits (750),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  189  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  368
            P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4    PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPTVMXLFSF  63

Query  369  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  548
            V YY+STLL+DCYR GDPV GKRNYTYMDAVRS LGG++ KICGLIQY NLFGI +GYTI
Sbjct  64   VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTI  123

Query  549  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI  FD
Sbjct  124  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFD  172



>ref|XP_011074825.1| PREDICTED: amino acid permease 3-like [Sesamum indicum]
Length=484

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  302
            M ESA + + H     +S++ P   G K  DDDGR +R+GT+WTASAHIITAVIGSGVLS
Sbjct  1    MSESAGSRQAHNQVFDISVNVPNQGGSKCFDDDGRLKRSGTLWTASAHIITAVIGSGVLS  60

Query  303  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  482
            LAWA  QLGWVAGPSVM +FS V YYTSTLLA CYR+GDP  GKRNYTYMDAVR+NLGG+
Sbjct  61   LAWATAQLGWVAGPSVMFMFSIVTYYTSTLLAACYRSGDPDTGKRNYTYMDAVRANLGGF  120

Query  483  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  662
            QVK+CG IQY NLFG+AIGYTIA+SISMMAI+RSNCFH  G  +PC +SSNPYMIAFG++
Sbjct  121  QVKLCGAIQYLNLFGVAIGYTIASSISMMAIERSNCFHSKGDDSPCRVSSNPYMIAFGVV  180

Query  663  EIILSQIPXFD  695
            EIILSQIP FD
Sbjct  181  EIILSQIPDFD  191



>ref|XP_002864872.1| hypothetical protein ARALYDRAFT_496573 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41131.1| hypothetical protein ARALYDRAFT_496573 [Arabidopsis lyrata subsp. 
lyrata]
Length=466

 Score =   293 bits (749),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  189  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  368
            P   FK  DDDGR +R+GT+WTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4    PRPAFKCFDDDGRLKRSGTIWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSF  63

Query  369  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  548
            V YY+STLL+DCYR GDPV GKRNYTYMDAVRS LGG++ KICGLIQY NLFGI +GYTI
Sbjct  64   VTYYSSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTI  123

Query  549  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI  FD
Sbjct  124  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFD  172



>gb|AFK34945.1| unknown [Lotus japonicus]
Length=213

 Score =   284 bits (726),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 156/194 (80%), Gaps = 1/194 (1%)
 Frame = +3

Query  117  MQMGESAAATKNHRHH-LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  293
            M+M E   +  NH H    VS+D     G K  DDDGR +RTG VWTASAHIITAVIGSG
Sbjct  1    MKMNEKNGSKNNHHHQAFDVSLDMQQQGGSKCFDDDGRLKRTGAVWTASAHIITAVIGSG  60

Query  294  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  473
            VLSLAW I QLGWVAGP+VM+LFS V YYTS LL  CYR GDPV GKRNYTYMD V SN+
Sbjct  61   VLSLAWTIAQLGWVAGPAVMILFSLVTYYTSILLCACYRNGDPVNGKRNYTYMDVVHSNM  120

Query  474  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  653
            GG QVK+CG++QY NLFG+AIGYTIA+SISM+AI+RSNCFH++ GK+PCHM+ N YMI+F
Sbjct  121  GGIQVKLCGIVQYLNLFGVAIGYTIASSISMIAIERSNCFHKNEGKDPCHMNGNIYMISF  180

Query  654  GIIEIILSQIPXFD  695
            G++EI+LSQIP FD
Sbjct  181  GLVEIVLSQIPDFD  194



>emb|CAN65437.1| hypothetical protein VITISV_038918 [Vitis vinifera]
Length=487

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 163/196 (83%), Gaps = 6/196 (3%)
 Frame = +3

Query  123  MGESAAATKNHR----HHLGVSIDAPPLYGF-KGLDDDGRPQRTGTVWTASAHIITAVIG  287
            MGE+AA TKNH         +SID  P     K  DDDGR +RTGTVWTASAHIITAVIG
Sbjct  1    MGENAA-TKNHHHHHHQVFDISIDVLPHQNTSKCFDDDGRLKRTGTVWTASAHIITAVIG  59

Query  288  SGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRS  467
            SGVLSLAWAI QLGW+AGP+VM LFS V+YYTS+LLADCYR+GD V GKRNYTYMDAVRS
Sbjct  60   SGVLSLAWAIAQLGWIAGPAVMFLFSFVIYYTSSLLADCYRSGDRVSGKRNYTYMDAVRS  119

Query  468  NLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI  647
            NLGG +VK+CGLIQY N+FG+AIGYTIAASISMMA+KRSNCFHESGGKNPCH+SS PYMI
Sbjct  120  NLGGVKVKVCGLIQYLNIFGVAIGYTIAASISMMAVKRSNCFHESGGKNPCHISSYPYMI  179

Query  648  AFGIIEIILSQIPXFD  695
             FGI EI  SQIP FD
Sbjct  180  MFGIAEIAFSQIPDFD  195



>ref|XP_008227520.1| PREDICTED: amino acid permease 4 isoform X3 [Prunus mume]
Length=481

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 157/186 (84%), Gaps = 1/186 (1%)
 Frame = +3

Query  141  ATKNHRHHLGVSIDA-PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  317
            +  N++    +SID  P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWAI
Sbjct  2    SENNNQQVFDISIDVVPKNNGSKCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAI  61

Query  318  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKIC  497
             QLGW+AGPSVM LFS V YYTS LL+DCYR+GDP+ GKRNYTY+DAVRS LGG +VK C
Sbjct  62   AQLGWIAGPSVMFLFSFVSYYTSCLLSDCYRSGDPLTGKRNYTYIDAVRSILGGARVKAC  121

Query  498  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  677
            GLIQY NLFGIAIGYTIAAS+SMMAIKRSNCFHESGGK PCHMSSNPYMI FG+ E++LS
Sbjct  122  GLIQYLNLFGIAIGYTIAASVSMMAIKRSNCFHESGGKKPCHMSSNPYMILFGVTEVLLS  181

Query  678  QIPXFD  695
            QIP FD
Sbjct  182  QIPDFD  187



>ref|XP_008227518.1| PREDICTED: amino acid permease 4 isoform X1 [Prunus mume]
Length=480

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 157/186 (84%), Gaps = 1/186 (1%)
 Frame = +3

Query  141  ATKNHRHHLGVSIDA-PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  317
            +  N++    +SID  P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWAI
Sbjct  2    SENNNQQVFDISIDVVPKNNGSKCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAI  61

Query  318  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKIC  497
             QLGW+AGPSVM LFS V YYTS LL+DCYR+GDP+ GKRNYTY+DAVRS LGG +VK C
Sbjct  62   AQLGWIAGPSVMFLFSFVSYYTSCLLSDCYRSGDPLTGKRNYTYIDAVRSILGGARVKAC  121

Query  498  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  677
            GLIQY NLFGIAIGYTIAAS+SMMAIKRSNCFHESGGK PCHMSSNPYMI FG+ E++LS
Sbjct  122  GLIQYLNLFGIAIGYTIAASVSMMAIKRSNCFHESGGKKPCHMSSNPYMILFGVTEVLLS  181

Query  678  QIPXFD  695
            QIP FD
Sbjct  182  QIPDFD  187



>gb|AAM61227.1| amino acid transport protein AAP2 [Arabidopsis thaliana]
Length=493

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  186  PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFS  365
            PP   FK  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWAI QLGW+AGP+VMLLFS
Sbjct  30   PPQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMLLFS  89

Query  366  CVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYT  545
             V  Y+STLL+DCYR GD V GKRNYTYMDAVRS LGG++ KICGLIQY NLF IAIGYT
Sbjct  90   LVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFVIAIGYT  149

Query  546  IAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            IAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG+ EI+LSQ+P FD
Sbjct  150  IAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIVFGVAEILLSQVPDFD  199



>ref|XP_008227519.1| PREDICTED: amino acid permease 4 isoform X2 [Prunus mume]
Length=482

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 157/186 (84%), Gaps = 1/186 (1%)
 Frame = +3

Query  141  ATKNHRHHLGVSIDA-PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  317
            +  N++    +SID  P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWAI
Sbjct  2    SENNNQQVFDISIDVVPKNNGSKCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAI  61

Query  318  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKIC  497
             QLGW+AGPSVM LFS V YYTS LL+DCYR+GDP+ GKRNYTY+DAVRS LGG +VK C
Sbjct  62   AQLGWIAGPSVMFLFSFVSYYTSCLLSDCYRSGDPLTGKRNYTYIDAVRSILGGARVKAC  121

Query  498  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  677
            GLIQY NLFGIAIGYTIAAS+SMMAIKRSNCFHESGGK PCHMSSNPYMI FG+ E++LS
Sbjct  122  GLIQYLNLFGIAIGYTIAASVSMMAIKRSNCFHESGGKKPCHMSSNPYMILFGVTEVLLS  181

Query  678  QIPXFD  695
            QIP FD
Sbjct  182  QIPDFD  187



>emb|CDX78353.1| BnaA03g02650D [Brassica napus]
Length=487

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 163/193 (84%), Gaps = 2/193 (1%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDA--PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            MGE+AAA  +H HH     DA  P    FK  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MGETAAANNHHHHHGHQVFDASVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDAVRS LG
Sbjct  61   LSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILG  120

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G++ KICGLIQY NLFGIA+GYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG
Sbjct  121  GFKFKICGLIQYLNLFGIAVGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFG  180

Query  657  IIEIILSQIPXFD  695
            + EI+LSQ+P FD
Sbjct  181  VTEILLSQVPDFD  193



>ref|XP_009131105.1| PREDICTED: amino acid permease 2 [Brassica rapa]
Length=487

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 163/193 (84%), Gaps = 2/193 (1%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDA--PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            MGE+AAA  +H HH     DA  P    FK  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MGETAAANNHHHHHGHQVFDASVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDAVRS LG
Sbjct  61   LSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILG  120

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G++ KICGLIQY NLFGIA+GYTIAASISMMAIKRSNCFH+SGGK+PCHMSSNPYMI FG
Sbjct  121  GFKFKICGLIQYLNLFGIAVGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFG  180

Query  657  IIEIILSQIPXFD  695
            + EI+LSQ+P FD
Sbjct  181  VTEILLSQVPDFD  193



>ref|XP_010461080.1| PREDICTED: amino acid permease 4-like [Camelina sativa]
Length=466

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  189  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  368
            P   FK  DDDG+ +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP VM LFS 
Sbjct  4    PRPAFKCFDDDGKLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPVVMFLFSF  63

Query  369  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  548
            V YY STLL+DCYR GDPV GKRNYTYMDAVRS LGG++ KICGLIQY NLFGI IGYTI
Sbjct  64   VTYYCSTLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITIGYTI  123

Query  549  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            AASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI  FD
Sbjct  124  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFD  172



>emb|CDX88365.1| BnaC06g38090D [Brassica napus]
Length=476

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  153  HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  332
                   S+D P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3    QNQQEAFSVDMPRTGGSKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  333  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQY  512
            +AGP VMLLFS V Y+TSTLLA CYR+GDP+ GKRNYTYMDAVRSNLGG +VK+CG++QY
Sbjct  63   LAGPVVMLLFSIVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQY  122

Query  513  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXF  692
             NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++II SQIP F
Sbjct  123  LNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPDF  182

Query  693  D  695
            D
Sbjct  183  D  183



>emb|CDX88364.1| BnaC06g38080D [Brassica napus]
Length=476

 Score =   291 bits (744),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  153  HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  332
                   S+D P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3    QNQQEAFSVDMPRTGGSKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  333  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQY  512
            +AGP VMLLFS V Y+TSTLLA CYR+GDP+ GKRNYTYMDAVRSNLGG +VK+CG++QY
Sbjct  63   LAGPVVMLLFSIVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQY  122

Query  513  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXF  692
             NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++II SQIP F
Sbjct  123  LNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPDF  182

Query  693  D  695
            D
Sbjct  183  D  183



>ref|XP_008219594.1| PREDICTED: amino acid permease 3-like [Prunus mume]
Length=484

 Score =   291 bits (744),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +3

Query  150  NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  329
            NH     VS+D PP  G K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWA  QLG
Sbjct  10   NHHQVFDVSVDVPPEGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLG  69

Query  330  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQ  509
            WVAGPSVMLLFS V YYTSTLLA CYR GDP+ GKRNYTY DAVRSNLGG++ KICG +Q
Sbjct  70   WVAGPSVMLLFSFVTYYTSTLLAACYRTGDPLTGKRNYTYTDAVRSNLGGFKEKICGFVQ  129

Query  510  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPX  689
            Y NLFG+AIGYTIA+SISM+AIKRSNCF+++G   PCH++SNPYMIAFGI EII SQIP 
Sbjct  130  YLNLFGVAIGYTIASSISMVAIKRSNCFYKNGDTAPCHVNSNPYMIAFGIAEIIFSQIPN  189

Query  690  FD  695
            FD
Sbjct  190  FD  191



>gb|KJB59301.1| hypothetical protein B456_009G248600 [Gossypium raimondii]
Length=468

 Score =   290 bits (743),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  180  DAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLL  359
            +  P  G K  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWA  QLGWVAGP VM+L
Sbjct  4    EVLPQGGTKCYDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPLVMIL  63

Query  360  FSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIG  539
            FS V Y+TSTLLA CYR+GDPV GKRNYTYMDAVRSNLGG++VKICG +QY NLFG+AIG
Sbjct  64   FSFVTYFTSTLLAACYRSGDPVNGKRNYTYMDAVRSNLGGFKVKICGWVQYLNLFGVAIG  123

Query  540  YTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            YTIA+SISMMAIKRSNCFH SGGKNPCHM+SNPYMIAFGI+EII SQIP FD
Sbjct  124  YTIASSISMMAIKRSNCFHASGGKNPCHMNSNPYMIAFGIVEIIFSQIPDFD  175



>ref|XP_009106399.1| PREDICTED: amino acid permease 3 [Brassica rapa]
Length=476

 Score =   290 bits (743),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  153  HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  332
                   ++D P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3    QNQQEAFAVDMPQTGGSKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  333  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQY  512
            +AGP VMLLFS V Y+TSTLLA CYR+GDP+ GKRNYTYMDAVRSNLGG +VK+CG++QY
Sbjct  63   LAGPVVMLLFSIVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQY  122

Query  513  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXF  692
             NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++II SQIP F
Sbjct  123  LNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPDF  182

Query  693  D  695
            D
Sbjct  183  D  183



>gb|KFK42132.1| hypothetical protein AALP_AA2G215300 [Arabis alpina]
Length=476

 Score =   290 bits (742),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  153  HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  332
            H      ++D P     K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3    HNKQTSFAVDLPQTGDSKCYDDDGRTKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  333  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQY  512
            +AGP VMLLFS V Y+TSTLLA CYR+GDP+ GKRNYTYMDAVRSNLGG +VK+CG++QY
Sbjct  63   LAGPVVMLLFSIVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQY  122

Query  513  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXF  692
             NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++II SQIP F
Sbjct  123  LNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPDF  182

Query  693  D  695
            D
Sbjct  183  D  183



>ref|XP_002307053.2| hypothetical protein POPTR_0005s06990g [Populus trichocarpa]
 gb|EEE94049.2| hypothetical protein POPTR_0005s06990g [Populus trichocarpa]
Length=494

 Score =   290 bits (743),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 161/201 (80%), Gaps = 8/201 (4%)
 Frame = +3

Query  117  MQMGESAAATKNHR--------HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHII  272
            MQMGE+AA+   H             VS+D  P  G K  DDDGR +RTGT+WTAS+HII
Sbjct  1    MQMGENAASKNYHNNHHLHNHHQVFDVSVDVLPQNGSKCFDDDGRLKRTGTLWTASSHII  60

Query  273  TAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYM  452
            TAVIGSGVLSLAWAI QLGW+AGP+VM LFS V YYTS+LL DCYR GDP  GKRNYTYM
Sbjct  61   TAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYTSSLLTDCYRTGDPDTGKRNYTYM  120

Query  453  DAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSS  632
            DAV+S LGG +V +CGL+QY  LFGIAIGYTIA+SISMMAIKRSNCFH+SGG+NPCH+SS
Sbjct  121  DAVQSILGGVKVNLCGLVQYIGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHISS  180

Query  633  NPYMIAFGIIEIILSQIPXFD  695
            NPYMI FGI EI+LSQIP FD
Sbjct  181  NPYMIIFGITEILLSQIPDFD  201



>ref|XP_007222611.1| hypothetical protein PRUPE_ppa004936mg [Prunus persica]
 gb|EMJ23810.1| hypothetical protein PRUPE_ppa004936mg [Prunus persica]
Length=484

 Score =   290 bits (742),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 157/192 (82%), Gaps = 3/192 (2%)
 Frame = +3

Query  120  QMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  299
            +MG++      H     VS+D PP  G K  DDDGR +RTGTVWTASAHIITAVIGSGVL
Sbjct  3    KMGDNQL---THHQVFDVSVDVPPEGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  59

Query  300  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  479
            SLAWA  QLGWVAGPSVMLLFS V YYTSTLLA CYR GDPV GKRNYTY DAVRSNLGG
Sbjct  60   SLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLAACYRTGDPVTGKRNYTYTDAVRSNLGG  119

Query  480  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  659
            ++ KICG +QY NLFG+AIGYTIA+SISM+AIKRSNCF+++G   PCH++SNPYMIAFGI
Sbjct  120  FKEKICGFVQYLNLFGVAIGYTIASSISMVAIKRSNCFYKNGDTAPCHVNSNPYMIAFGI  179

Query  660  IEIILSQIPXFD  695
             EII SQIP FD
Sbjct  180  AEIIFSQIPNFD  191



>emb|CDX87522.1| BnaA07g33510D [Brassica napus]
Length=476

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  153  HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  332
                   ++D P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3    QNQQEAFAVDMPQSGGSKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  333  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQY  512
            +AGP VMLLFS V Y+TSTLLA CYR+GDP+ GKRNYTYMDAVRSNLGG +VK+CG++QY
Sbjct  63   LAGPVVMLLFSIVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQY  122

Query  513  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXF  692
             NLFG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++II SQIP F
Sbjct  123  LNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPDF  182

Query  693  D  695
            D
Sbjct  183  D  183



>gb|KJB75356.1| hypothetical protein B456_012G038000 [Gossypium raimondii]
Length=519

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = +3

Query  150  NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  329
            N R    VS+  P     + +DDDGR +RTGT+ TA+AHIITAVIGSGVLSLAWAI QLG
Sbjct  44   NQRQVFDVSMAIPSHNVSECVDDDGRLKRTGTICTATAHIITAVIGSGVLSLAWAIAQLG  103

Query  330  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQ  509
            W+AGP+VMLLFS V YYTS+LL DCYR GDPV GKRNYTY DAVRS LGGY+VK CGLIQ
Sbjct  104  WIAGPAVMLLFSFVTYYTSSLLTDCYRTGDPVSGKRNYTYTDAVRSILGGYKVKACGLIQ  163

Query  510  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPX  689
            Y NLFGI+IGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQIP 
Sbjct  164  YLNLFGISIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIPD  223

Query  690  FD  695
            FD
Sbjct  224  FD  225



>ref|XP_010537371.1| PREDICTED: amino acid permease 3 [Tarenaya hassleriana]
Length=480

 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 157/185 (85%), Gaps = 1/185 (1%)
 Frame = +3

Query  141  ATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIG  320
            + K+H      ++D PP  G +  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  
Sbjct  4    SAKSHDRQ-AFAVDMPPSGGSEIFDDDGRHKRTGSVWTASAHIITAVIGSGVLSLAWATA  62

Query  321  QLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICG  500
            QLGWVAGP+ MLLFS V Y+TSTLL+ CYR+GDP+ GKRNYTYMDAVRSNLGG +VK+CG
Sbjct  63   QLGWVAGPAAMLLFSAVTYFTSTLLSSCYRSGDPLSGKRNYTYMDAVRSNLGGVKVKLCG  122

Query  501  LIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQ  680
            L+QY NLFG+AIGYTIA++ SMMAIKRSNCFH+S GKNPC M+SNPYMIAFG++EII SQ
Sbjct  123  LVQYLNLFGVAIGYTIASATSMMAIKRSNCFHKSRGKNPCRMNSNPYMIAFGVVEIIFSQ  182

Query  681  IPXFD  695
            IP FD
Sbjct  183  IPDFD  187



>ref|XP_009130275.1| PREDICTED: amino acid permease 4 [Brassica rapa]
 ref|XP_009130276.1| PREDICTED: amino acid permease 4 [Brassica rapa]
Length=466

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  198  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  377
             FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS V Y
Sbjct  7    AFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTY  66

Query  378  YTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  557
            ++STLL+DCYR GDPV GKRNYTYMDAV+S LGG++ KICGLIQ+ NLFGI +GYTIAAS
Sbjct  67   FSSTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLIQFLNLFGITVGYTIAAS  126

Query  558  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            ISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI  FD
Sbjct  127  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFD  172



>ref|XP_011027477.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=480

 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 158/183 (86%), Gaps = 1/183 (1%)
 Frame = +3

Query  147  KNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQL  326
            +NH+  L +SID     G K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWAIGQL
Sbjct  6    RNHQV-LDISIDTHQQGGSKWFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIGQL  64

Query  327  GWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLI  506
            GW+AGP+VM LFS V  YTSTLL+ CYR+GDP+ GKRNYTYMDAVRSNLGG +VKICG +
Sbjct  65   GWIAGPAVMFLFSFVTCYTSTLLSACYRSGDPITGKRNYTYMDAVRSNLGGVKVKICGFV  124

Query  507  QYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  686
            QY NLFG+AIGYTIA+SISMMAIKRSNCF++SGGKNPC M++NPYMI FGI EI+LSQIP
Sbjct  125  QYLNLFGVAIGYTIASSISMMAIKRSNCFYKSGGKNPCRMNANPYMIGFGIAEILLSQIP  184

Query  687  XFD  695
             FD
Sbjct  185  GFD  187



>emb|CDY39844.1| BnaC02g42740D [Brassica napus]
Length=466

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  198  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  377
             FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS V Y
Sbjct  7    AFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTY  66

Query  378  YTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  557
            ++STLL+DCYR GDPV GKRNYTYMDAV+S LGG++ KICGLIQ+ NLFGI +GYTIAAS
Sbjct  67   FSSTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLIQFLNLFGITVGYTIAAS  126

Query  558  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            ISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI  FD
Sbjct  127  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFD  172



>emb|CDY31348.1| BnaA02g33930D [Brassica napus]
Length=466

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  198  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  377
             FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS V Y
Sbjct  7    AFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTY  66

Query  378  YTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  557
            ++STLL+DCYR GDPV GKRNYTYMDAV+S LGG++ KICGLIQ+ NLFGI +GYTIAAS
Sbjct  67   FSSTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLIQFLNLFGITVGYTIAAS  126

Query  558  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            ISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI  FD
Sbjct  127  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFD  172



>emb|CDP10973.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 159/194 (82%), Gaps = 3/194 (2%)
 Frame = +3

Query  123  MGESAAATK---NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  293
            M ES A  +   NH    GVS++ PP  G K  DDDG+ +RTG+VWTASAHIITAVIGSG
Sbjct  1    MVESTAPKQGPQNHHQVFGVSVNVPPQGGSKCFDDDGKLKRTGSVWTASAHIITAVIGSG  60

Query  294  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  473
            VLSLAWA  QLGW+AGP+V+LLF+ V YYTS LLA CYR+GDP  GKRNYTYMDAVR+NL
Sbjct  61   VLSLAWATAQLGWIAGPTVLLLFAFVTYYTSVLLAACYRSGDPDGGKRNYTYMDAVRANL  120

Query  474  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  653
            GG+QVK+CG IQY NLFG+AIGYTIAASISM AIK+SNCFH SGGK+PC +SS PYMI F
Sbjct  121  GGFQVKVCGAIQYMNLFGVAIGYTIAASISMTAIKKSNCFHSSGGKDPCKVSSTPYMIIF  180

Query  654  GIIEIILSQIPXFD  695
            G++EI+ SQIP FD
Sbjct  181  GVVEILFSQIPDFD  194



>ref|XP_006380397.1| hypothetical protein POPTR_0007s04710g [Populus trichocarpa]
 gb|ERP58194.1| hypothetical protein POPTR_0007s04710g [Populus trichocarpa]
Length=492

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 158/199 (79%), Gaps = 8/199 (4%)
 Frame = +3

Query  123  MGESAAATKNHR--------HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  278
            MGE+AA+   H             +SID  P  G K  DDDGR +RTGT+WTASAHIITA
Sbjct  1    MGENAASKNCHNNHHLHNHHQVFDISIDVLPQNGSKCFDDDGRLKRTGTLWTASAHIITA  60

Query  279  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDA  458
            VIGSGVLSLAWA+ QLGWVAGP+VM LFS V YYTS+LL DCYR GDP  GKRNYTYMDA
Sbjct  61   VIGSGVLSLAWAVAQLGWVAGPAVMFLFSLVTYYTSSLLTDCYRTGDPDTGKRNYTYMDA  120

Query  459  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  638
            V S LGG +VK+CG IQY  LFGIAIGYTIA+SISMMAIKRSNCFH+SGG+NPCH+SSNP
Sbjct  121  VESILGGVKVKLCGFIQYLGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHLSSNP  180

Query  639  YMIAFGIIEIILSQIPXFD  695
            YMI FGI EI+LSQIP FD
Sbjct  181  YMIMFGITEILLSQIPDFD  199



>ref|XP_006394236.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
 ref|XP_006394237.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
 gb|ESQ31522.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
 gb|ESQ31523.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
Length=466

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  189  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  368
            P   FK  DDDGR +R+GTVWTASAHIITAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4    PRPAFKCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSF  63

Query  369  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  548
            V YY+STLL+DCYR GD V GKRNYTYMDAVRS LGG++ KICGLIQY NLFGI +GYTI
Sbjct  64   VTYYSSTLLSDCYRTGDHVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTI  123

Query  549  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            AA+ISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LSQI  FD
Sbjct  124  AAAISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFD  172



>ref|XP_011031113.1| PREDICTED: amino acid permease 4-like isoform X1 [Populus euphratica]
Length=494

 Score =   289 bits (739),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 161/201 (80%), Gaps = 8/201 (4%)
 Frame = +3

Query  117  MQMGESAAATKNHR--------HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHII  272
            MQMGE+AA+   H             VS+D  P  G K  DDDGR +RTGT+WTAS+HII
Sbjct  1    MQMGENAASKNYHNNHHLHNHHQVFDVSVDVLPQNGSKCYDDDGRLKRTGTLWTASSHII  60

Query  273  TAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYM  452
            TAVIGSGVLSLAWAI QLGW+AGP+VM LFS V YYTS+LL DCYR GDP  G+RNYTYM
Sbjct  61   TAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYTSSLLTDCYRTGDPYTGERNYTYM  120

Query  453  DAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSS  632
            DAV+S LGG +V +CGL+QY  LFGIAIGYTIA+SISMMAIKRSNCFH+SGG+NPCH+SS
Sbjct  121  DAVQSILGGVKVNLCGLVQYIGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHISS  180

Query  633  NPYMIAFGIIEIILSQIPXFD  695
            NPYMI FGI EI+LSQIP FD
Sbjct  181  NPYMIMFGITEILLSQIPDFD  201



>gb|ERN18219.1| hypothetical protein AMTR_s00055p00034230 [Amborella trichopoda]
Length=305

 Score =   283 bits (723),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = +3

Query  156  RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  335
            +  + V  D P     KGLDDDGRP+RTG VWT+S+HIITAVIGSGVLSLAWAI QLGW+
Sbjct  20   QQQIDVEQDTPQPGYLKGLDDDGRPKRTGNVWTSSSHIITAVIGSGVLSLAWAIAQLGWI  79

Query  336  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYF  515
            AGP+VM+LF+ V +YTS LLA CYR+GDP+ GKRNYTYMDAVR+NLGG +VK+CG IQY 
Sbjct  80   AGPAVMVLFALVNFYTSNLLAGCYRSGDPISGKRNYTYMDAVRANLGGSKVKLCGAIQYI  139

Query  516  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            NL G+AIGYTIAASISMMAIKRSNCFH S GK+PCHMSSN YMI FG+ EI  SQIP F+
Sbjct  140  NLLGVAIGYTIAASISMMAIKRSNCFHRSKGKDPCHMSSNGYMIMFGVTEIFFSQIPDFN  199



>ref|XP_006287587.1| hypothetical protein CARUB_v10000805mg [Capsella rubella]
 gb|EOA20485.1| hypothetical protein CARUB_v10000805mg [Capsella rubella]
Length=493

 Score =   288 bits (738),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 160/199 (80%), Gaps = 8/199 (4%)
 Frame = +3

Query  123  MGESAAATKNHRHHLG-------VSIDAPPLY-GFKGLDDDGRPQRTGTVWTASAHIITA  278
            MGE+AAA  +   H          S D  P    FK  DDDGR +RTGTVWTASAHIITA
Sbjct  1    MGETAAANHHRHQHHHGHQVFDVASNDVVPTQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  279  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDA  458
            VIGSGVLSLAWAI QLGW+AGP+VMLLFS V  Y+STLL+DCYR GD V GKRNYTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  459  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  638
            VRS LGG++ KICGLIQY NLFGIA+GYTIAASISMMAIKRSNCFH+SGGK+PCHMSSN 
Sbjct  121  VRSILGGFKFKICGLIQYLNLFGIAVGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNS  180

Query  639  YMIAFGIIEIILSQIPXFD  695
            YMI FG+ EI+LSQ+P FD
Sbjct  181  YMIVFGVTEILLSQVPDFD  199



>ref|NP_177862.1| amino acid permease 3 [Arabidopsis thaliana]
 sp|Q39134.2|AAP3_ARATH RecName: Full=Amino acid permease 3; AltName: Full=Amino acid 
transporter AAP3 [Arabidopsis thaliana]
 gb|AAG29203.1|AC078898_13 amino acid carrier, putative [Arabidopsis thaliana]
 emb|CAA54630.1| amino acid permease [Arabidopsis thaliana]
 gb|AAM20639.1| putative amino acid carrier [Arabidopsis thaliana]
 gb|AAM91305.1| putative amino acid carrier [Arabidopsis thaliana]
 gb|AEE35971.1| amino acid permease 3 [Arabidopsis thaliana]
Length=476

 Score =   288 bits (736),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  153  HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  332
              H   +++D P   G K LDDDG+ +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3    QNHQTVLAVDMPQTGGSKYLDDDGKNKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  333  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQY  512
            +AGP VMLLFS V Y+TS+LLA CYR+GDP+ GKRNYTYMDAVRSNLGG +V +CG++QY
Sbjct  63   LAGPVVMLLFSAVTYFTSSLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVTLCGIVQY  122

Query  513  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXF  692
             N+FG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++I+ SQIP F
Sbjct  123  LNIFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQILFSQIPDF  182

Query  693  D  695
            D
Sbjct  183  D  183



>ref|XP_010025744.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 ref|XP_010025745.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 gb|KCW62473.1| hypothetical protein EUGRSUZ_H05115 [Eucalyptus grandis]
 gb|KCW62474.1| hypothetical protein EUGRSUZ_H05115 [Eucalyptus grandis]
Length=494

 Score =   288 bits (738),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 160/201 (80%), Gaps = 10/201 (5%)
 Frame = +3

Query  123  MGESAAATKNHRHHL-------GVSIDAPPLYG---FKGLDDDGRPQRTGTVWTASAHII  272
            MGESAA   N  HH         +SI+  P      F   DDDGR +RTGT+WTASAHII
Sbjct  1    MGESAATKNNQNHHHHHHHQVRDMSIEMLPQSASNCFDSFDDDGRLKRTGTLWTASAHII  60

Query  273  TAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYM  452
            TAVIGSGVLSLAWAI QLGW+AGP+VM LFS V YYTS LL+DCYRAGDPV GKRNYTYM
Sbjct  61   TAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSFVSYYTSCLLSDCYRAGDPVSGKRNYTYM  120

Query  453  DAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSS  632
            D+VRS LGG +VK CG IQYFNLFGIAIGYTIAASISMMAIKRSNCFHES G+NPCHMSS
Sbjct  121  DSVRSILGGAKVKACGFIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESNGENPCHMSS  180

Query  633  NPYMIAFGIIEIILSQIPXFD  695
             PYMI FGI EI+LSQIP FD
Sbjct  181  TPYMIMFGITEILLSQIPDFD  201



>ref|XP_011102302.1| PREDICTED: amino acid permease 3 isoform X2 [Sesamum indicum]
Length=486

 Score =   288 bits (736),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 156/193 (81%), Gaps = 0/193 (0%)
 Frame = +3

Query  117  MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            M M ES  + +       VSI+ P   G K  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MTMSESTGSRQYQHQVFDVSINVPNQGGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWA+ QLGW+AGP+VM LFS V YYTS LL+ CYR+GDP  GKRNYTYMDAVR+NLG
Sbjct  61   LSLAWAVAQLGWIAGPTVMFLFSFVTYYTSALLSTCYRSGDPDTGKRNYTYMDAVRANLG  120

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G++VK+CG IQY NLFG+AIGYTIA+SISMMAI+RSNCFH  G  +PC +SSNPYMIAFG
Sbjct  121  GFKVKLCGAIQYVNLFGVAIGYTIASSISMMAIERSNCFHSKGDSSPCRVSSNPYMIAFG  180

Query  657  IIEIILSQIPXFD  695
            +IEII SQIP FD
Sbjct  181  VIEIIFSQIPDFD  193



>gb|AAM62803.1| amino acid carrier, putative [Arabidopsis thaliana]
Length=476

 Score =   288 bits (736),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  153  HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  332
              H   +++D P   G K LDDDG+ +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3    QNHQTVLAVDMPQTGGSKYLDDDGKNKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  333  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQY  512
            +AGP VMLLFS V Y+TS+LLA CYR+GDP+ GKRNYTYMDAVRSNLGG +V +CG++QY
Sbjct  63   LAGPVVMLLFSVVTYFTSSLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVTLCGIVQY  122

Query  513  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXF  692
             N+FG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++I+ SQIP F
Sbjct  123  LNIFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQILFSQIPDF  182

Query  693  D  695
            D
Sbjct  183  D  183



>ref|XP_012078267.1| PREDICTED: amino acid permease 3-like [Jatropha curcas]
 ref|XP_012078268.1| PREDICTED: amino acid permease 3-like [Jatropha curcas]
 gb|KDP32820.1| hypothetical protein JCGZ_12112 [Jatropha curcas]
Length=487

 Score =   288 bits (736),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 158/187 (84%), Gaps = 4/187 (2%)
 Frame = +3

Query  147  KNHRHH----LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWA  314
            ++H HH    + +++      G K LDDDGR +RTGTVWTASAHIITAVIGSGVLSLAWA
Sbjct  8    RSHSHHQVFDVSINMHTQMSNGSKLLDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWA  67

Query  315  IGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKI  494
            I QLGW+AGP+VM LFS V YYTSTLL+ CYR+GD V GKRNYTYMD +RSNLGG +VKI
Sbjct  68   IAQLGWIAGPAVMFLFSFVTYYTSTLLSACYRSGDSVTGKRNYTYMDVIRSNLGGAKVKI  127

Query  495  CGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIIL  674
            CG++QY NLFG+AIGYTIA+SISMMA+KRSNCFH+SGGKNPC M++NPYMIAFGI EII 
Sbjct  128  CGIVQYLNLFGVAIGYTIASSISMMAVKRSNCFHKSGGKNPCKMNANPYMIAFGIAEIIF  187

Query  675  SQIPXFD  695
            SQIP FD
Sbjct  188  SQIPDFD  194



>ref|XP_003634405.1| PREDICTED: amino acid permease 3 [Vitis vinifera]
Length=483

 Score =   287 bits (735),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 154/189 (81%), Gaps = 0/189 (0%)
 Frame = +3

Query  129  ESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLA  308
            + ++A K+ + H    ID  P    K  DDDGR +RTGT WTASAHIITAVIGSGVLSLA
Sbjct  2    KMSSAPKDLQPHQVFDIDGVPQGASKCFDDDGRLKRTGTFWTASAHIITAVIGSGVLSLA  61

Query  309  WAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQV  488
            WA  QLGW+AGP+V+ LFS V YYTS LL+ CYR GD V GKRNYTYMDAVRSNLGG ++
Sbjct  62   WATAQLGWIAGPAVLFLFSFVTYYTSVLLSSCYRTGDSVTGKRNYTYMDAVRSNLGGAKM  121

Query  489  KICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEI  668
            KICGLIQY NLFG+AIGYTIAASISMMAIKRSNCFHES  KNPCH+SSNPYMI FGI EI
Sbjct  122  KICGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHESHDKNPCHISSNPYMIMFGIFEI  181

Query  669  ILSQIPXFD  695
            ILSQIP FD
Sbjct  182  ILSQIPDFD  190



>emb|CAN61092.1| hypothetical protein VITISV_005276 [Vitis vinifera]
 emb|CBI18979.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   287 bits (735),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = +3

Query  135  AAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWA  314
            ++A K+ + H    ID  P    K  DDDGR +RTGT WTASAHIITAVIGSGVLSLAWA
Sbjct  2    SSAPKDLQPHQVFDIDGVPQGASKCFDDDGRLKRTGTFWTASAHIITAVIGSGVLSLAWA  61

Query  315  IGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKI  494
              QLGW+AGP+V+ LFS V YYTS LL+ CYR GD V GKRNYTYMDAVRSNLGG ++KI
Sbjct  62   TAQLGWIAGPAVLFLFSFVTYYTSVLLSSCYRTGDSVTGKRNYTYMDAVRSNLGGAKMKI  121

Query  495  CGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIIL  674
            CGLIQY NLFG+AIGYTIAASISMMAIKRSNCFHES  KNPCH+SSNPYMI FGI EIIL
Sbjct  122  CGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHESHDKNPCHISSNPYMIMFGIFEIIL  181

Query  675  SQIPXFD  695
            SQIP FD
Sbjct  182  SQIPDFD  188



>ref|XP_003522571.1| PREDICTED: amino acid permease 3-like isoform X1 [Glycine max]
 ref|XP_006578960.1| PREDICTED: amino acid permease 3-like isoform X2 [Glycine max]
Length=487

 Score =   287 bits (734),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 158/186 (85%), Gaps = 2/186 (1%)
 Frame = +3

Query  144  TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  323
            +K H+  L  SID       K  DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI Q
Sbjct  9    SKYHQQTLNFSIDIHQQGISKCFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAIAQ  68

Query  324  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG--GYQVKIC  497
            LGW+AGP VM+LFS + YYTSTLL+DCYR GDPV GKRNYTYMDA++SN G  G++VK+C
Sbjct  69   LGWIAGPIVMVLFSAITYYTSTLLSDCYRTGDPVTGKRNYTYMDAIQSNFGGNGFKVKLC  128

Query  498  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  677
            GL+QY NLFG+AIGYTIAAS SMMAI+RSNC+H+SGGK+PCHM+SN YMI+FGI+EII S
Sbjct  129  GLVQYINLFGVAIGYTIAASTSMMAIERSNCYHKSGGKDPCHMNSNMYMISFGIVEIIFS  188

Query  678  QIPXFD  695
            QIP FD
Sbjct  189  QIPGFD  194



>ref|XP_009377726.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009343981.1| PREDICTED: amino acid permease 3 [Pyrus x bretschneideri]
Length=484

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +3

Query  150  NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  329
            N R    +S+  PP  G K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWA+ QLG
Sbjct  10   NPRQGFELSVPMPPEVGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAVAQLG  69

Query  330  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQ  509
            WVAGP+VMLLFS V YYTSTLL+ CYR+GDPV GKRNYTY +AVRSNLGG++VKICG +Q
Sbjct  70   WVAGPAVMLLFSFVTYYTSTLLSACYRSGDPVTGKRNYTYTNAVRSNLGGFKVKICGFVQ  129

Query  510  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPX  689
            Y NLFG+AIGYTIA+SISM+AIKRSNCF+++G   PCH++SNPYMIAFG+ EII SQIP 
Sbjct  130  YLNLFGVAIGYTIASSISMVAIKRSNCFYKNGDTAPCHVNSNPYMIAFGVAEIIFSQIPD  189

Query  690  FD  695
            FD
Sbjct  190  FD  191



>ref|XP_006386355.1| amino acid permease which transports basic amino acids family 
protein [Populus trichocarpa]
 gb|ERP64152.1| amino acid permease which transports basic amino acids family 
protein [Populus trichocarpa]
Length=480

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 157/183 (86%), Gaps = 1/183 (1%)
 Frame = +3

Query  147  KNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQL  326
            +NH+    +SID     G K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWAIGQL
Sbjct  6    RNHQV-FDISIDTHQQGGSKWFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIGQL  64

Query  327  GWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLI  506
            GW+AGP+VM LFS V  YTSTLL+ CYR+GDP+ GKRNYTYMDAVRSNLGG +VKICG +
Sbjct  65   GWIAGPAVMFLFSFVTCYTSTLLSACYRSGDPITGKRNYTYMDAVRSNLGGVKVKICGFV  124

Query  507  QYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  686
            QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGG++PCHM++ PYMI FGI EI+LSQIP
Sbjct  125  QYLNLFGVAIGYTIASSISMMAIKRSNCFHKSGGQDPCHMNAYPYMIGFGIAEILLSQIP  184

Query  687  XFD  695
             FD
Sbjct  185  GFD  187



>ref|XP_008338672.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=484

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = +3

Query  150  NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  329
            N R    +S+  PP  G K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWA+ QLG
Sbjct  10   NPRQGFELSVPMPPEVGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAVAQLG  69

Query  330  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQ  509
            WVAGP+VMLLFS V  YTSTLL+ CYR+GDPV GKRNYTY DAVRSNLGG++VKICG +Q
Sbjct  70   WVAGPAVMLLFSFVTXYTSTLLSACYRSGDPVIGKRNYTYTDAVRSNLGGFKVKICGFVQ  129

Query  510  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPX  689
            Y NLFG+AIGYTIA+SISM+AIKRSNCF+++G   PCH++SNPYMIAFG+ EII SQIP 
Sbjct  130  YLNLFGVAIGYTIASSISMVAIKRSNCFYKNGDTAPCHVNSNPYMIAFGVAEIIFSQIPD  189

Query  690  FD  695
            FD
Sbjct  190  FD  191



>ref|XP_006382883.1| amino acid permease AAP1 family protein [Populus trichocarpa]
 gb|ERP60680.1| amino acid permease AAP1 family protein [Populus trichocarpa]
Length=492

 Score =   286 bits (731),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 159/199 (80%), Gaps = 8/199 (4%)
 Frame = +3

Query  123  MGESAAATKNHR--------HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITA  278
            MGE+AA+   H             VS+D  P  G K  DDDGR +RTGT+WTAS+HIITA
Sbjct  1    MGENAASKNYHNNHHLHNHHQVFDVSVDVLPQNGSKCFDDDGRLKRTGTLWTASSHIITA  60

Query  279  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDA  458
            VIGSGVLSLAWAI QLGW+AGP+VM LFS V YYTS+LL DCYR GDP  GKRNYTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYTSSLLTDCYRTGDPDTGKRNYTYMDA  120

Query  459  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  638
            V+S LGG +V +CGL+QY  LFGIAIGYTIA+SISMMAIKRSNCFH+SGG+NPCH+SSNP
Sbjct  121  VQSILGGVKVNLCGLVQYIGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHISSNP  180

Query  639  YMIAFGIIEIILSQIPXFD  695
            YMI FGI EI+LSQIP FD
Sbjct  181  YMIIFGITEILLSQIPDFD  199



>gb|KJB16325.1| hypothetical protein B456_002G223200 [Gossypium raimondii]
Length=477

 Score =   285 bits (730),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 154/191 (81%), Gaps = 7/191 (4%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  302
            MGE  A    +R H  +  D P      G DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGEKGAV--KNRLHNNLVFDHP-----IGFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  53

Query  303  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  482
            LAWA  QLGW+AGP+V+ LFS V YYTSTLLA CYR  DPV GKRNYTYM+AVR+NLGG+
Sbjct  54   LAWATAQLGWIAGPAVIFLFSFVTYYTSTLLAACYRCDDPVNGKRNYTYMEAVRANLGGF  113

Query  483  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  662
            +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH S GKNPCHM+SNPYMI FGI 
Sbjct  114  EVKICGWVQYLNLFGVAIGYTIASSISMMAIKRSNCFHASRGKNPCHMNSNPYMIGFGIA  173

Query  663  EIILSQIPXFD  695
            EII SQIP FD
Sbjct  174  EIIFSQIPDFD  184



>ref|XP_011102300.1| PREDICTED: amino acid permease 3 isoform X1 [Sesamum indicum]
Length=491

 Score =   286 bits (731),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 155/191 (81%), Gaps = 0/191 (0%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  302
            M ES  + +       VSI+ P   G K  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  8    MSESTGSRQYQHQVFDVSINVPNQGGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGVLS  67

Query  303  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  482
            LAWA+ QLGW+AGP+VM LFS V YYTS LL+ CYR+GDP  GKRNYTYMDAVR+NLGG+
Sbjct  68   LAWAVAQLGWIAGPTVMFLFSFVTYYTSALLSTCYRSGDPDTGKRNYTYMDAVRANLGGF  127

Query  483  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  662
            +VK+CG IQY NLFG+AIGYTIA+SISMMAI+RSNCFH  G  +PC +SSNPYMIAFG+I
Sbjct  128  KVKLCGAIQYVNLFGVAIGYTIASSISMMAIERSNCFHSKGDSSPCRVSSNPYMIAFGVI  187

Query  663  EIILSQIPXFD  695
            EII SQIP FD
Sbjct  188  EIIFSQIPDFD  198



>ref|XP_004290905.1| PREDICTED: amino acid permease 3-like [Fragaria vesca subsp. 
vesca]
Length=480

 Score =   285 bits (730),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  153  HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  332
                  VS+D  P  G K  DDDGR +RTGTVWTASAHIITAVIGSGVL+LAWA  QLGW
Sbjct  7    QHQAFDVSVDVQPQSGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLALAWATAQLGW  66

Query  333  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQY  512
            VAGP+VMLLF+ V YYTSTLL+ CYR GDPV GKRNYTY DAVRSNLGGY+VKICG +QY
Sbjct  67   VAGPAVMLLFAFVTYYTSTLLSFCYRTGDPVTGKRNYTYTDAVRSNLGGYKVKICGFVQY  126

Query  513  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXF  692
             NLFG+AIGYTIA+SISM+AIKRSNCFH S GK+ CH++SNPYMIAFGI EII SQI  F
Sbjct  127  LNLFGVAIGYTIASSISMVAIKRSNCFHSSDGKDECHVNSNPYMIAFGIAEIIFSQIENF  186

Query  693  D  695
            D
Sbjct  187  D  187



>ref|XP_007137459.1| hypothetical protein PHAVU_009G128500g [Phaseolus vulgaris]
 gb|ESW09453.1| hypothetical protein PHAVU_009G128500g [Phaseolus vulgaris]
Length=487

 Score =   285 bits (730),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 158/193 (82%), Gaps = 2/193 (1%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  302
            +G     ++  +    VS+D       K  DDDGRP+RTGTVWTASAHIITAVIGSGVLS
Sbjct  2    VGMDGHGSRYDQQTFNVSLDMHEQGDSKCFDDDGRPKRTGTVWTASAHIITAVIGSGVLS  61

Query  303  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG--  476
            LAWAI QLGW+AGP+VMLLFS + Y+TS LL DCYR GDP+ GKRNYTYMDA+RSN G  
Sbjct  62   LAWAIAQLGWIAGPAVMLLFSAITYFTSLLLTDCYRTGDPLTGKRNYTYMDAIRSNFGGN  121

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G++VK+CGL+QY NLFGI+IGYTIAASISMMAI+RSNCFH+SGGKNPC M+SN YMI+FG
Sbjct  122  GFKVKMCGLVQYVNLFGISIGYTIAASISMMAIERSNCFHKSGGKNPCRMNSNMYMISFG  181

Query  657  IIEIILSQIPXFD  695
            I+EII SQIP FD
Sbjct  182  IVEIIFSQIPGFD  194



>emb|CDY43761.1| BnaA06g22970D [Brassica napus]
Length=466

 Score =   285 bits (728),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  189  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  368
            P   FK  DDDGRP+R+GTVWTASAHI+TAVIGSGVLSLAWAI QLGW+AGP+VM LFS 
Sbjct  4    PRPAFKCFDDDGRPKRSGTVWTASAHILTAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSF  63

Query  369  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  548
            V YY++TLL+DCYR GDPV GKRNYTYMDAV+S LGG++ KICGL+Q+ NLFG  IGYTI
Sbjct  64   VTYYSTTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLMQFLNLFGTTIGYTI  123

Query  549  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            A+SISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LS I  FD
Sbjct  124  ASSISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSTIKDFD  172



>ref|XP_002889140.1| hypothetical protein ARALYDRAFT_476902 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65399.1| hypothetical protein ARALYDRAFT_476902 [Arabidopsis lyrata subsp. 
lyrata]
Length=476

 Score =   285 bits (729),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = +3

Query  159  HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVA  338
            H   +++D P   G K LDDDG+ +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW+A
Sbjct  5    HQTVLAVDMPQTGGSKYLDDDGKVKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWLA  64

Query  339  GPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFN  518
            GP VMLLFS V Y+TS+LLA CYR+G+P+ GKRNYTYMDAVRSNLGG +V +CG++QY N
Sbjct  65   GPVVMLLFSAVTYFTSSLLAACYRSGNPISGKRNYTYMDAVRSNLGGVKVTLCGIVQYLN  124

Query  519  LFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            +FG+AIGYTIA++ISMMAIKRSNCFH+SGGK+PCHM+SNPYMIAFG+++I+ SQIP FD
Sbjct  125  IFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQILFSQIPDFD  183



>ref|XP_010912574.1| PREDICTED: amino acid permease 3-like [Elaeis guineensis]
Length=488

 Score =   285 bits (729),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 162/195 (83%), Gaps = 5/195 (3%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSID----APPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  290
            MGE+ AA K ++H + VSI+         G K  DDDGR +RTGT WTASAHIITAVIGS
Sbjct  1    MGENGAA-KYYQHPMEVSIELGHQQQQQGGSKFHDDDGRLKRTGTFWTASAHIITAVIGS  59

Query  291  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSN  470
            GVLSLAWAI QLGWVAGP+VMLLF+ V+YYTSTLLADCYR+ DP+ G RNYTYMDAV + 
Sbjct  60   GVLSLAWAIAQLGWVAGPAVMLLFAFVIYYTSTLLADCYRSEDPITGPRNYTYMDAVHAY  119

Query  471  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  650
            LGG +VK+CG IQY NLFG+AIGYTIAASISMMAI+RSNCFHE G KNPCH++SNPYMIA
Sbjct  120  LGGLKVKMCGFIQYANLFGVAIGYTIAASISMMAIRRSNCFHEKGHKNPCHVNSNPYMIA  179

Query  651  FGIIEIILSQIPXFD  695
            FG++EII SQIP FD
Sbjct  180  FGVLEIIFSQIPDFD  194



>gb|EYU23867.1| hypothetical protein MIMGU_mgv1a005496mg [Erythranthe guttata]
Length=481

 Score =   285 bits (728),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 150/175 (86%), Gaps = 0/175 (0%)
 Frame = +3

Query  171  VSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSV  350
            VSI+ PP    K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW+AGP+V
Sbjct  15   VSINVPPQLPSKCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPTV  74

Query  351  MLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGI  530
            M LFS V YYTSTLLA CYR+GDP  GKRNYTYMDAVRSNLGG+QVK+CG IQY NLFG+
Sbjct  75   MFLFSFVTYYTSTLLAACYRSGDPDSGKRNYTYMDAVRSNLGGFQVKLCGAIQYLNLFGV  134

Query  531  AIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            AIGYTIA+SISMMAI RSNCFH  G ++PC +SSNPYMIAFG++EI+ SQIP FD
Sbjct  135  AIGYTIASSISMMAIDRSNCFHSKGHESPCRVSSNPYMIAFGVVEIVFSQIPDFD  189



>ref|XP_010063420.1| PREDICTED: amino acid permease 3-like [Eucalyptus grandis]
 gb|KCW70648.1| hypothetical protein EUGRSUZ_F03820 [Eucalyptus grandis]
Length=480

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 160/193 (83%), Gaps = 5/193 (3%)
 Frame = +3

Query  123  MGESAAATKNHRHH--LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            MG ++A    H ++    VSI+ PP  G K  DDDGR +RTGTVWTAS+HIITAVIGSGV
Sbjct  1    MGVNSAVKNQHPNNQVFDVSINIPPQGGSKCFDDDGRLKRTGTVWTASSHIITAVIGSGV  60

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWA  QLGW+AGP+VMLLF+ V YYTSTLLA CYR+GD   GKRNYTYMDAV +NLG
Sbjct  61   LSLAWATAQLGWIAGPAVMLLFALVTYYTSTLLAACYRSGD---GKRNYTYMDAVSANLG  117

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G++VK+CGL+QY NLFG+AIGYTIA+SISMMAI RSNCFH++G K+PCH +S PYMIAFG
Sbjct  118  GFKVKLCGLVQYVNLFGVAIGYTIASSISMMAISRSNCFHKNGEKSPCHFNSTPYMIAFG  177

Query  657  IIEIILSQIPXFD  695
            IIEII SQIP FD
Sbjct  178  IIEIIFSQIPDFD  190



>gb|EYU32509.1| hypothetical protein MIMGU_mgv1a005226mg [Erythranthe guttata]
Length=492

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 159/195 (82%), Gaps = 5/195 (3%)
 Frame = +3

Query  117  MQMGESAAATKNHRHHL-GVSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGS  290
            M M ESAA T   RH +  VS++ P   G  K  DDDGR +RTGTVWTASAHIITAVIGS
Sbjct  1    MTMSESAAGT---RHQVFDVSVNMPSQTGGSKCYDDDGRLKRTGTVWTASAHIITAVIGS  57

Query  291  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSN  470
            GVLSLAWA  QLGWVAGP+++ LFS V YYTS+LLA CYR GDP  GKRNYTYMDAVR+N
Sbjct  58   GVLSLAWATAQLGWVAGPTMLFLFSFVTYYTSSLLATCYRTGDPDTGKRNYTYMDAVRAN  117

Query  471  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  650
            LGG+QVK+CG IQY NLFG+AIGYTIAASIS+MAI+RSNCFH  G  +PC +SSNPYMIA
Sbjct  118  LGGFQVKVCGAIQYMNLFGVAIGYTIAASISLMAIERSNCFHSKGDNSPCRVSSNPYMIA  177

Query  651  FGIIEIILSQIPXFD  695
            FG++EI+ SQIP FD
Sbjct  178  FGVVEIVFSQIPDFD  192



>gb|KHN44307.1| Amino acid permease 3 [Glycine soja]
Length=487

 Score =   283 bits (725),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 157/186 (84%), Gaps = 2/186 (1%)
 Frame = +3

Query  144  TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  323
            +K H+  L  SID       K  DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI Q
Sbjct  9    SKYHQQTLNFSIDIHQQGISKCFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAIAQ  68

Query  324  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG--GYQVKIC  497
            LGW+AGP VM+LFS + YYTSTLL+DCYR GDPV GKRNYTYM A++SN G  G++VK+C
Sbjct  69   LGWIAGPIVMVLFSAITYYTSTLLSDCYRTGDPVTGKRNYTYMGAIQSNFGGNGFKVKLC  128

Query  498  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  677
            GL+QY NLFG+AIGYTIAAS SMMAI+RSNC+H+SGGK+PCHM+SN YMI+FGI+EII S
Sbjct  129  GLVQYINLFGVAIGYTIAASTSMMAIERSNCYHKSGGKDPCHMNSNMYMISFGIVEIIFS  188

Query  678  QIPXFD  695
            QIP FD
Sbjct  189  QIPGFD  194



>gb|KJB33339.1| hypothetical protein B456_006G007300 [Gossypium raimondii]
Length=476

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 152/183 (83%), Gaps = 4/183 (2%)
 Frame = +3

Query  147  KNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQL  326
            +NHR    V ID P L   +  DDDGR +RTGT WTASAHIITAVIGSGVLSLAWAI QL
Sbjct  3    ENHR----VFIDNPSLNDSQCFDDDGRLKRTGTFWTASAHIITAVIGSGVLSLAWAIAQL  58

Query  327  GWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLI  506
            GW+AGP+VMLLFS + +YTS LL DCYR GDPV GKRNYTY  AV S LGGY+VK+CG I
Sbjct  59   GWIAGPAVMLLFSIITFYTSCLLTDCYRTGDPVSGKRNYTYTQAVGSLLGGYKVKVCGFI  118

Query  507  QYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  686
            QY NLFG++IGYTIAASISMMAIKRSNCFH SGGKNPCHMSS+PYM+ FG+ EI+LSQIP
Sbjct  119  QYVNLFGVSIGYTIAASISMMAIKRSNCFHNSGGKNPCHMSSSPYMMMFGVAEILLSQIP  178

Query  687  XFD  695
             FD
Sbjct  179  DFD  181



>emb|CBI21597.3| unnamed protein product [Vitis vinifera]
Length=344

 Score =   279 bits (713),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  204  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  383
            K LDDDGRP+RTGTVWTASAHIIT++IGSGVLSLAWA+ QLGW+ GP+V+L+F+ V+ YT
Sbjct  15   KCLDDDGRPKRTGTVWTASAHIITSIIGSGVLSLAWAVAQLGWIGGPTVILMFAVVICYT  74

Query  384  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  563
            S+LLADCYR+GDP+ GKRNYTYM+ V+SNLGG +VKICGLIQY NLFGI +GYTIA S+S
Sbjct  75   SSLLADCYRSGDPISGKRNYTYMEVVQSNLGGAKVKICGLIQYCNLFGITVGYTIATSVS  134

Query  564  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            MMA+ RSNCFH SG KNPCH SSNPYMI FGIIEI+LSQIP FD
Sbjct  135  MMAVMRSNCFHRSGNKNPCHESSNPYMIMFGIIEIVLSQIPDFD  178



>gb|KHG16478.1| Amino acid permease 2 -like protein [Gossypium arboreum]
Length=476

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 152/183 (83%), Gaps = 4/183 (2%)
 Frame = +3

Query  147  KNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQL  326
            +NHR    V ID P L   +  DDDGR +RTGT WTASAHIITAVIGSGVLSLAWAI QL
Sbjct  3    ENHR----VFIDNPSLNDSQCFDDDGRLKRTGTFWTASAHIITAVIGSGVLSLAWAIAQL  58

Query  327  GWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLI  506
            GW+AGP+VMLLFS + +YTS LL DCYR GDPV GKRNYTY  AV S LGGY+VK+CG I
Sbjct  59   GWIAGPAVMLLFSIITFYTSCLLTDCYRTGDPVSGKRNYTYTQAVGSLLGGYKVKVCGFI  118

Query  507  QYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIP  686
            QY NLFG++IGYTIAASISMMAIKRSNCFH SGGKNPCHMSS+PYM+ FG+ EI+LSQIP
Sbjct  119  QYVNLFGVSIGYTIAASISMMAIKRSNCFHNSGGKNPCHMSSSPYMMMFGVAEILLSQIP  178

Query  687  XFD  695
             FD
Sbjct  179  DFD  181



>emb|CDX84450.1| BnaC03g50500D [Brassica napus]
Length=466

 Score =   282 bits (721),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  368
            P   FK  DDDGRP+R+GTVWTASAHI+TAVIGSGVLSLAWAIGQLGW+AGP+VM LFS 
Sbjct  4    PRPAFKCFDDDGRPKRSGTVWTASAHILTAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSF  63

Query  369  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  548
            V YY++TLL+DCYR GDPV GKRNYTYMDAV+S LGG++ KICGL+Q+ NLFG  IGYTI
Sbjct  64   VTYYSTTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLMQFLNLFGTTIGYTI  123

Query  549  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXF  692
            A+SISMMAIKRSNCFHESGGKN CHMSSNPYMI FG+IEI+LS I  F
Sbjct  124  ASSISMMAIKRSNCFHESGGKNLCHMSSNPYMIMFGVIEILLSTIKDF  171



>ref|XP_003527948.1| PREDICTED: amino acid permease 3 [Glycine max]
 gb|KHN46995.1| Amino acid permease 3 [Glycine soja]
Length=487

 Score =   283 bits (723),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 159/191 (83%), Gaps = 2/191 (1%)
 Frame = +3

Query  129  ESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLA  308
            +    +K  +  L VSID       K  DDDGRP+RTGTVWT+SAHIITAVIGSGVLSLA
Sbjct  4    KDGVGSKYLQQTLNVSIDMHQHGISKCFDDDGRPKRTGTVWTSSAHIITAVIGSGVLSLA  63

Query  309  WAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG--GY  482
            WAI QLGW+AGP VM++FS + YYTSTLLADCYR GDPV GKRNYTYMDA++SN G  G+
Sbjct  64   WAIAQLGWIAGPIVMVIFSAITYYTSTLLADCYRTGDPVTGKRNYTYMDAIQSNFGGNGF  123

Query  483  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  662
            +VK+CGL+QY NLFG+AIGYTIAAS SMMAI+RSNCFH+SGGK+PCH++SN YMI+FGI+
Sbjct  124  KVKLCGLVQYVNLFGVAIGYTIAASTSMMAIERSNCFHKSGGKDPCHINSNMYMISFGIV  183

Query  663  EIILSQIPXFD  695
            EI+ SQIP FD
Sbjct  184  EILFSQIPGFD  194



>ref|XP_008799058.1| PREDICTED: amino acid permease 3-like [Phoenix dactylifera]
Length=492

 Score =   283 bits (723),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 163/199 (82%), Gaps = 9/199 (5%)
 Frame = +3

Query  123  MGESAAATKNHRHH----LGVSIDAPPLYGFKG----LDDDGRPQRTGTVWTASAHIITA  278
            MGE+ A TK H+      + VSI+       +G     DDDGR +RTGT+WTASAHIITA
Sbjct  1    MGENGA-TKYHQQAGIPPMEVSIELGHQKQLQGGSKCYDDDGRLKRTGTLWTASAHIITA  59

Query  279  VIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDA  458
            VIGSGVLSLAWAI QLGWVAGP+VM LFS V++YTSTLLADCYR+GDP+ GKRNYTYMDA
Sbjct  60   VIGSGVLSLAWAIAQLGWVAGPAVMFLFSFVIFYTSTLLADCYRSGDPITGKRNYTYMDA  119

Query  459  VRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNP  638
            V + LGG +VK+CG IQY NLFG+AIGYTIAASISMMAI+RSNCFHE G K+PCH+SSNP
Sbjct  120  VHAYLGGLKVKMCGYIQYANLFGVAIGYTIAASISMMAIRRSNCFHEKGHKSPCHVSSNP  179

Query  639  YMIAFGIIEIILSQIPXFD  695
            YMIAFG++EII SQIP FD
Sbjct  180  YMIAFGVLEIIFSQIPDFD  198



>ref|XP_009150448.1| PREDICTED: amino acid permease 4 [Brassica rapa]
Length=466

 Score =   282 bits (721),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  368
            P   FK  DDDGRP+R+GTVWTASAHI+TAVIGSGVLSLAWAI QLGW+AGP+VM LFS 
Sbjct  4    PRPAFKCFDDDGRPKRSGTVWTASAHILTAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSF  63

Query  369  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  548
            V YY++TLL+DCYR GDPV GKRNYTYMDAV+S LGG++ KICGL+Q+ NLFG  IGYTI
Sbjct  64   VTYYSTTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLMQFLNLFGTTIGYTI  123

Query  549  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXF  692
            A+SISMMAIKRSNCFHESGGKNPCHMSSNPYMI FG+ EI+LS I  F
Sbjct  124  ASSISMMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSTIKDF  171



>ref|XP_010653015.1| PREDICTED: amino acid permease 4-like [Vitis vinifera]
Length=504

 Score =   283 bits (724),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 162/200 (81%), Gaps = 6/200 (3%)
 Frame = +3

Query  96   GIGGSKIMQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIIT  275
            G  G+ ++Q+ E     K H+  L +  D  P    K LDDDGRP+RTGTVWTASAHIIT
Sbjct  30   GKAGTTMLQVDE-----KPHQM-LHLPSDVLPHDISKCLDDDGRPKRTGTVWTASAHIIT  83

Query  276  AVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMD  455
            ++IGSGVLSLAWA+ QLGW+ GP+V+L+F+ V+ YTS+LLADCYR+GDP+ GKRNYTYM+
Sbjct  84   SIIGSGVLSLAWAVAQLGWIGGPTVILMFAVVICYTSSLLADCYRSGDPISGKRNYTYME  143

Query  456  AVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSN  635
             V+SNLGG +VKICGLIQY NLFGI +GYTIA S+SMMA+ RSNCFH SG KNPCH SSN
Sbjct  144  VVQSNLGGAKVKICGLIQYCNLFGITVGYTIATSVSMMAVMRSNCFHRSGNKNPCHESSN  203

Query  636  PYMIAFGIIEIILSQIPXFD  695
            PYMI FGIIEI+LSQIP FD
Sbjct  204  PYMIMFGIIEIVLSQIPDFD  223



>ref|XP_008781630.1| PREDICTED: amino acid permease 3 [Phoenix dactylifera]
Length=492

 Score =   283 bits (723),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 160/198 (81%), Gaps = 7/198 (4%)
 Frame = +3

Query  123  MGESAAATKNHRHH---LGVSID----APPLYGFKGLDDDGRPQRTGTVWTASAHIITAV  281
            MGE+ A   N +     + VSI+      P  G K  DDD R +RTGT+WTASAHIITAV
Sbjct  1    MGENGAEKHNQQASFPAMEVSIELGHHQQPQGGSKFYDDDQRLKRTGTLWTASAHIITAV  60

Query  282  IGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAV  461
            IGSGVLSLAWAI QLGWVAGP+VMLLFS V+YYTS+LLADCYR GDP+ GKRNYTYMDAV
Sbjct  61   IGSGVLSLAWAIAQLGWVAGPAVMLLFSFVIYYTSSLLADCYRFGDPITGKRNYTYMDAV  120

Query  462  RSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPY  641
             + LGG++VK CG+IQY NLFG+AIGYTIAASISMMAI+RS+CFHE G K+PCH+SSNPY
Sbjct  121  HAYLGGFKVKFCGVIQYANLFGVAIGYTIAASISMMAIRRSDCFHEKGDKSPCHISSNPY  180

Query  642  MIAFGIIEIILSQIPXFD  695
            MI FG+ EII SQIP FD
Sbjct  181  MIIFGVSEIIFSQIPDFD  198



>ref|XP_012078266.1| PREDICTED: amino acid permease 3-like [Jatropha curcas]
Length=484

 Score =   282 bits (722),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 157/193 (81%), Gaps = 3/193 (2%)
 Frame = +3

Query  117  MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            M+MG+ +           VS+D P   G K  DDDGR +RTG+VWTASAHIITAVIGSGV
Sbjct  1    MKMGDKSFPPP---QPFNVSVDMPNQAGSKWYDDDGRLKRTGSVWTASAHIITAVIGSGV  57

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWA+ QLGW+AGP+VM LFS V YYTSTLL+ CYR GD V GKRNYTYMDAVRSNLG
Sbjct  58   LSLAWAVAQLGWIAGPAVMFLFSIVTYYTSTLLSACYRTGDSVNGKRNYTYMDAVRSNLG  117

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G +VKICG +QY NL G+AIGYTIA+SISMMA+KRSNCFH++GGK+PCHM++NPYMIAFG
Sbjct  118  GAKVKICGYVQYLNLLGVAIGYTIASSISMMAVKRSNCFHKTGGKDPCHMNANPYMIAFG  177

Query  657  IIEIILSQIPXFD  695
            I EII SQI  F+
Sbjct  178  IAEIIFSQIQDFE  190



>ref|XP_006383588.1| hypothetical protein POPTR_0005s20390g [Populus trichocarpa]
 gb|ERP61385.1| hypothetical protein POPTR_0005s20390g [Populus trichocarpa]
Length=484

 Score =   282 bits (722),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 153/191 (80%), Gaps = 0/191 (0%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  302
            MGE+   +        VSI        K  DDDGR +R GTVWTASAHIITAVIGSGVLS
Sbjct  1    MGETENTSAERHQVFDVSIGMHQQGSSKWFDDDGRQKRAGTVWTASAHIITAVIGSGVLS  60

Query  303  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  482
            LAWAI QLGW+AGP+ M LFS V  YTS+LL+ CYR+GDP+ GKRNYTYMDAVRSNLGG 
Sbjct  61   LAWAIAQLGWIAGPAFMFLFSIVTCYTSSLLSVCYRSGDPITGKRNYTYMDAVRSNLGGV  120

Query  483  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  662
            +VKICG +QY NLFG+A+GYTIA+SISMMAIKRSNCFH+SGGK+PC M++NPYMI FGI 
Sbjct  121  KVKICGFVQYLNLFGVAVGYTIASSISMMAIKRSNCFHQSGGKDPCRMNANPYMIGFGIA  180

Query  663  EIILSQIPXFD  695
            EI+LSQIP FD
Sbjct  181  EILLSQIPGFD  191



>ref|XP_011031114.1| PREDICTED: amino acid permease 4-like isoform X2 [Populus euphratica]
Length=493

 Score =   282 bits (722),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 160/201 (80%), Gaps = 9/201 (4%)
 Frame = +3

Query  117  MQMGESAAATKNHR--------HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHII  272
            MQMGE+AA+   H             VS+D  P  G K  DDDGR +RTGT+WTAS+HII
Sbjct  1    MQMGENAASKNYHNNHHLHNHHQVFDVSVDVLPQNGSKCYDDDGRLKRTGTLWTASSHII  60

Query  273  TAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYM  452
            TAVIGSGVLSLAWAI QLGW+AGP+VM LFS V YYTS+LL DCYR GDP  G+RNYTYM
Sbjct  61   TAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYTSSLLTDCYRTGDPYTGERNYTYM  120

Query  453  DAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSS  632
            DAV+S L G +V +CGL+QY  LFGIAIGYTIA+SISMMAIKRSNCFH+SGG+NPCH+SS
Sbjct  121  DAVQSIL-GVKVNLCGLVQYIGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHISS  179

Query  633  NPYMIAFGIIEIILSQIPXFD  695
            NPYMI FGI EI+LSQIP FD
Sbjct  180  NPYMIMFGITEILLSQIPDFD  200



>ref|XP_004149429.1| PREDICTED: amino acid permease 3-like [Cucumis sativus]
Length=478

 Score =   282 bits (721),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 158/193 (82%), Gaps = 8/193 (4%)
 Frame = +3

Query  117  MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            M+MGE+ A         G+S D  P  G K  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MKMGENQA--------FGISNDVVPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  52

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWA  QLGWVAGP+VM LFS V YYTS LL+ CYR+GDPV GKRNYTYMDAV++NLG
Sbjct  53   LSLAWATAQLGWVAGPAVMFLFSMVTYYTSVLLSACYRSGDPVSGKRNYTYMDAVQANLG  112

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G+ VK+CG++QY N+ G+AIGYTIA++ISMMAIKRSNCFH SGGK+PC ++SNPYMIAFG
Sbjct  113  GWNVKLCGVVQYANIVGVAIGYTIASAISMMAIKRSNCFHASGGKDPCQINSNPYMIAFG  172

Query  657  IIEIILSQIPXFD  695
            ++EI+ SQI  FD
Sbjct  173  VVEIVFSQIKDFD  185



>ref|XP_004498350.1| PREDICTED: amino acid permease 3-like isoform X1 [Cicer arietinum]
 ref|XP_004498351.1| PREDICTED: amino acid permease 3-like isoform X2 [Cicer arietinum]
Length=487

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 156/195 (80%), Gaps = 6/195 (3%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSID----APPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  290
            M     + KNH+     SID     P   G K  DDDGR +R+G  WTASAHIITAVIGS
Sbjct  1    MTMEKDSNKNHQQPFEFSIDNLQQGPA--GSKCFDDDGRLKRSGNTWTASAHIITAVIGS  58

Query  291  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSN  470
            GVLSLAWAI QLGWVAGPS+MLLFS V YYTSTLL+ CYR+GD + GKRNYTY DAVR+ 
Sbjct  59   GVLSLAWAIAQLGWVAGPSMMLLFSFVTYYTSTLLSVCYRSGDQLNGKRNYTYTDAVRAY  118

Query  471  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  650
            LGG++VKICG +QY NLFG+AIGYTIAASISMMAIKRSNCFH SGGKNPCHM+SN YMI+
Sbjct  119  LGGFKVKICGFVQYANLFGVAIGYTIAASISMMAIKRSNCFHSSGGKNPCHMNSNVYMIS  178

Query  651  FGIIEIILSQIPXFD  695
            FGI+EII SQIP FD
Sbjct  179  FGIVEIIFSQIPDFD  193



>gb|KDP32819.1| hypothetical protein JCGZ_12111 [Jatropha curcas]
Length=482

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = +3

Query  159  HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVA  338
                VS+D P   G K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA+ QLGW+A
Sbjct  10   QPFNVSVDMPNQAGSKWYDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAVAQLGWIA  69

Query  339  GPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFN  518
            GP+VM LFS V YYTSTLL+ CYR GD V GKRNYTYMDAVRSNLGG +VKICG +QY N
Sbjct  70   GPAVMFLFSIVTYYTSTLLSACYRTGDSVNGKRNYTYMDAVRSNLGGAKVKICGYVQYLN  129

Query  519  LFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            L G+AIGYTIA+SISMMA+KRSNCFH++GGK+PCHM++NPYMIAFGI EII SQI  F+
Sbjct  130  LLGVAIGYTIASSISMMAVKRSNCFHKTGGKDPCHMNANPYMIAFGIAEIIFSQIQDFE  188



>gb|EYU32508.1| hypothetical protein MIMGU_mgv1a005226mg [Erythranthe guttata]
Length=490

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 158/193 (82%), Gaps = 5/193 (3%)
 Frame = +3

Query  123  MGESAAATKNHRHHL-GVSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            M ESAA T   RH +  VS++ P   G  K  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MSESAAGT---RHQVFDVSVNMPSQTGGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGV  57

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWA  QLGWVAGP+++ LFS V YYTS+LLA CYR GDP  GKRNYTYMDAVR+NLG
Sbjct  58   LSLAWATAQLGWVAGPTMLFLFSFVTYYTSSLLATCYRTGDPDTGKRNYTYMDAVRANLG  117

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G+QVK+CG IQY NLFG+AIGYTIAASIS+MAI+RSNCFH  G  +PC +SSNPYMIAFG
Sbjct  118  GFQVKVCGAIQYMNLFGVAIGYTIAASISLMAIERSNCFHSKGDNSPCRVSSNPYMIAFG  177

Query  657  IIEIILSQIPXFD  695
            ++EI+ SQIP FD
Sbjct  178  VVEIVFSQIPDFD  190



>ref|XP_009379863.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=495

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 159/201 (79%), Gaps = 7/201 (3%)
 Frame = +3

Query  114  IMQMGESAAATKNHRHH---LGVSIDAPPLYGFKGL----DDDGRPQRTGTVWTASAHII  272
            + +MGE+ AA  N R     + VS++       +GL    DDDGR +R+GT WTASAHI+
Sbjct  1    MQKMGENGAAKYNQRPTFTPMEVSVELSHGNQLQGLGKCYDDDGRLKRSGTFWTASAHIV  60

Query  273  TAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYM  452
            TAVIGSGVLSLAWAI QLGWVAGP VMLLFS V YYTSTLLADCYR+GDP  GKRNY YM
Sbjct  61   TAVIGSGVLSLAWAIAQLGWVAGPVVMLLFSFVTYYTSTLLADCYRSGDPDTGKRNYNYM  120

Query  453  DAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSS  632
            DAV + LGG +VK+CG IQY NLFG+A+GYTIAASISMMAI+RSNCFHE G KNPCH SS
Sbjct  121  DAVHAYLGGLKVKLCGCIQYANLFGVAVGYTIAASISMMAIRRSNCFHEKGHKNPCHTSS  180

Query  633  NPYMIAFGIIEIILSQIPXFD  695
            NPYMI FG++EI LSQIP FD
Sbjct  181  NPYMIMFGVVEIFLSQIPDFD  201



>ref|XP_008466753.1| PREDICTED: amino acid permease 3-like [Cucumis melo]
Length=478

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 157/193 (81%), Gaps = 8/193 (4%)
 Frame = +3

Query  117  MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            M+MGE+ A         G+S D  P  G K  DDDGR +RTGTVWTASAHIITAVIGSGV
Sbjct  1    MKMGENQA--------FGISNDVVPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  52

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWA  QLGWVAGP+VM LFS V YYTS LL+ CYR+GDPV GKRNYTYMDAV++NLG
Sbjct  53   LSLAWATAQLGWVAGPAVMFLFSLVTYYTSVLLSACYRSGDPVSGKRNYTYMDAVQANLG  112

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G+ VK+CG++QY N+ G+AIGYTIA++ISMMAIKRSNCFH SGGK+PC ++SNPYMI FG
Sbjct  113  GWNVKLCGVVQYANIVGVAIGYTIASAISMMAIKRSNCFHASGGKDPCQINSNPYMIGFG  172

Query  657  IIEIILSQIPXFD  695
            I+EII SQI  FD
Sbjct  173  IVEIIFSQIKDFD  185



>ref|XP_010684694.1| PREDICTED: amino acid permease 3-like [Beta vulgaris subsp. vulgaris]
Length=494

 Score =   281 bits (719),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 156/198 (79%), Gaps = 2/198 (1%)
 Frame = +3

Query  105  GSKIMQMGESAAATKNHRHHLGV-SIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAV  281
            GSK ++  E      N   HL    +D+    G K  DDDGR +R GT+WTASAHIITAV
Sbjct  4    GSKQLK-NEYNFDNGNQSFHLTTFDVDSATGSGSKLFDDDGRLKRRGTMWTASAHIITAV  62

Query  282  IGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAV  461
            IGSGVLSLAWA  QLGWVAGP VMLLFS V YYTS LLADCYR+GDPV GKRNYTYMDAV
Sbjct  63   IGSGVLSLAWATAQLGWVAGPIVMLLFSIVTYYTSVLLADCYRSGDPVSGKRNYTYMDAV  122

Query  462  RSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPY  641
            ++NLGG QVKICGLIQY NLFG+AIGYTIAASISM AIKRSNCFHE G K+ C +S+NPY
Sbjct  123  QANLGGLQVKICGLIQYLNLFGVAIGYTIAASISMTAIKRSNCFHEKGEKSKCDISTNPY  182

Query  642  MIAFGIIEIILSQIPXFD  695
            MIAFG+ EII SQIP FD
Sbjct  183  MIAFGVAEIIFSQIPDFD  200



>ref|XP_003524313.1| PREDICTED: amino acid permease 2-like [Glycine max]
 gb|KHN17398.1| Amino acid permease 2 [Glycine soja]
Length=484

 Score =   281 bits (718),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 152/194 (78%), Gaps = 3/194 (2%)
 Frame = +3

Query  123  MGESAAATK-NHRHHLGVSIDAPP--LYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  293
            M E+AA T  NH    G+  D P       K  DDDGR +RTG VWTAS+HIITAVIGSG
Sbjct  1    MPENAATTNLNHLQVFGIEDDVPSHSQNNSKCYDDDGRLKRTGNVWTASSHIITAVIGSG  60

Query  294  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  473
            VLSLAWAI QLGW+AGP+VM LFS V +YTS+LLADCYRAGDP  GKRNYTYMDAVRS L
Sbjct  61   VLSLAWAIAQLGWIAGPTVMFLFSLVTFYTSSLLADCYRAGDPNSGKRNYTYMDAVRSIL  120

Query  474  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  653
            GG  V +CG+ QY NL GI IGYTIAASISMMAIKRSNCFH+SGGKNPCHMSSN YMI F
Sbjct  121  GGANVTLCGIFQYLNLLGIVIGYTIAASISMMAIKRSNCFHKSGGKNPCHMSSNVYMIIF  180

Query  654  GIIEIILSQIPXFD  695
            G  EI LSQIP FD
Sbjct  181  GATEIFLSQIPDFD  194



>ref|XP_009389175.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=513

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 155/194 (80%), Gaps = 10/194 (5%)
 Frame = +3

Query  144  TKNHRHHLGVSIDA----------PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  293
            ++N R +L V              P +   K  DDDGR +RTGTVWTA++HIITAVIGSG
Sbjct  20   SRNERAYLQVETQPKIQEDTESLNPQVAHSKCFDDDGRLKRTGTVWTATSHIITAVIGSG  79

Query  294  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  473
            VLSLAWAI QLGW+AGP VM+LF+ V+YYTS LL+DCYR+GDPV G+RNYTY DAVRSNL
Sbjct  80   VLSLAWAIAQLGWIAGPIVMILFAFVIYYTSNLLSDCYRSGDPVTGRRNYTYTDAVRSNL  139

Query  474  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  653
            GG +VKICG IQY NLFG+AIGYTIAASISMMAIKRSNCFH SGGK+PCHMSSN YMI F
Sbjct  140  GGAKVKICGAIQYVNLFGVAIGYTIAASISMMAIKRSNCFHASGGKDPCHMSSNMYMIIF  199

Query  654  GIIEIILSQIPXFD  695
            GI EI+ SQIP FD
Sbjct  200  GITEIVFSQIPDFD  213



>emb|CDO96925.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   281 bits (718),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 157/193 (81%), Gaps = 10/193 (5%)
 Frame = +3

Query  147  KNHRHHLGVSIDAPPLYGFKGL----------DDDGRPQRTGTVWTASAHIITAVIGSGV  296
            ++ RH+L V +   P    + +          DDDGR +RTGT+WTA++HIITAVIGSGV
Sbjct  21   QDFRHYLQVEVQPKPQQEAEAINLQANYSKCFDDDGRLKRTGTLWTATSHIITAVIGSGV  80

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWAIGQLGWVAGP+VMLLF+ V+ YTS LL+ CYR+G+PV G RNYTYMDAV++ LG
Sbjct  81   LSLAWAIGQLGWVAGPTVMLLFAFVILYTSNLLSQCYRSGNPVTGPRNYTYMDAVKATLG  140

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G +VKICGLIQY NLFG+AIGYTIAAS+SMMA+KRSNCFHES GK+PCHM+SN YMI FG
Sbjct  141  GRKVKICGLIQYINLFGVAIGYTIAASVSMMAVKRSNCFHESNGKDPCHMTSNGYMITFG  200

Query  657  IIEIILSQIPXFD  695
            IIEII SQIP FD
Sbjct  201  IIEIIFSQIPDFD  213



>gb|KGN47695.1| hypothetical protein Csa_6G381850 [Cucumis sativus]
Length=476

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  153  HRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  332
                 G+S D  P  G K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  3    ENQAFGISNDVVPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGW  62

Query  333  VAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQY  512
            VAGP+VM LFS V YYTS LL+ CYR+GDPV GKRNYTYMDAV++NLGG+ VK+CG++QY
Sbjct  63   VAGPAVMFLFSMVTYYTSVLLSACYRSGDPVSGKRNYTYMDAVQANLGGWNVKLCGVVQY  122

Query  513  FNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXF  692
             N+ G+AIGYTIA++ISMMAIKRSNCFH SGGK+PC ++SNPYMIAFG++EI+ SQI  F
Sbjct  123  ANIVGVAIGYTIASAISMMAIKRSNCFHASGGKDPCQINSNPYMIAFGVVEIVFSQIKDF  182

Query  693  D  695
            D
Sbjct  183  D  183



>ref|XP_009390075.1| PREDICTED: amino acid permease 4-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 158/205 (77%), Gaps = 15/205 (7%)
 Frame = +3

Query  114  IMQMGESAAATKNHRHH-------LGVSIDAPPLY----GFKGLDDDGRPQRTGTVWTAS  260
            + QMGE    T N +H+       + VSI+    +     F+  DDDGR +RTGTVWTAS
Sbjct  1    MQQMGE----TGNAKHYQQPAVVPMNVSIELGHAHRLEKAFECYDDDGRLKRTGTVWTAS  56

Query  261  AHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRN  440
            AHI+TAVIGSGVLSLAWAI QLGWVAGP VMLLFS V YYTSTLLADCYR+GDP+ GKRN
Sbjct  57   AHIVTAVIGSGVLSLAWAIAQLGWVAGPVVMLLFSFVTYYTSTLLADCYRSGDPISGKRN  116

Query  441  YTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPC  620
            Y Y DAV S LGG +VK+CG IQY NLFG+A+GYTIAASISMMAI+RSNCFHE G  NPC
Sbjct  117  YKYTDAVHSYLGGLKVKLCGFIQYANLFGVAVGYTIAASISMMAIRRSNCFHERGHDNPC  176

Query  621  HMSSNPYMIAFGIIEIILSQIPXFD  695
            H SSNPYMI FG+ EI LSQIP FD
Sbjct  177  HTSSNPYMIMFGVAEIFLSQIPDFD  201



>ref|XP_010063423.1| PREDICTED: amino acid permease 3-like [Eucalyptus grandis]
 gb|KCW70652.1| hypothetical protein EUGRSUZ_F03827 [Eucalyptus grandis]
Length=483

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 160/196 (82%), Gaps = 8/196 (4%)
 Frame = +3

Query  123  MGESAAATKNHRHH--LGVSIDAPPLYGFKGLDDDGRPQR---TGTVWTASAHIITAVIG  287
            MG ++A    H ++    VSI+ PP  G K  DDDGR +R   TGTVWTAS+HIITAVIG
Sbjct  1    MGVNSAVKNQHPNNQVFDVSINIPPQGGSKCFDDDGRLKRLKRTGTVWTASSHIITAVIG  60

Query  288  SGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRS  467
            SGVLSLAWA  QLGW+AGP+VMLLF+ V YYTSTLLA CYR+GD   GKRNYTYMDAV +
Sbjct  61   SGVLSLAWATAQLGWIAGPAVMLLFALVTYYTSTLLAACYRSGD---GKRNYTYMDAVSA  117

Query  468  NLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI  647
            NLGG++VK+CGL+QY NLFG+AIGYTIA+SISMMAI RSNCFH++G K+PCH +S PYMI
Sbjct  118  NLGGFKVKLCGLVQYVNLFGVAIGYTIASSISMMAISRSNCFHKNGEKSPCHFNSTPYMI  177

Query  648  AFGIIEIILSQIPXFD  695
            AFGIIEII SQIP FD
Sbjct  178  AFGIIEIIFSQIPDFD  193



>ref|XP_009414606.1| PREDICTED: amino acid permease 3-like [Musa acuminata subsp. 
malaccensis]
Length=491

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 160/197 (81%), Gaps = 6/197 (3%)
 Frame = +3

Query  120  QMGESAAATKNHRHHLGVSIDAPPLYGF-----KGLDDDGRPQRTGTVWTASAHIITAVI  284
            +MGE+ AA   H+H     ++     GF     K  DDDGR +RTGTVWTASAHIITAVI
Sbjct  3    KMGENGAA-NCHQHVALAPVEVSVELGFQHGASKCFDDDGRLKRTGTVWTASAHIITAVI  61

Query  285  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVR  464
            GSGVLSLAWAIGQLGWVAGP+VMLLFS V +YTS LLADCYR+GDPV G+RNYTYMDAV+
Sbjct  62   GSGVLSLAWAIGQLGWVAGPAVMLLFSFVTFYTSALLADCYRSGDPVTGRRNYTYMDAVQ  121

Query  465  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  644
            +NL G +VKICG +QY N+ G+AIGYTIAASISM+AIKRSNCF++ G  +PCH++SNPYM
Sbjct  122  ANLNGIKVKICGYLQYLNIVGVAIGYTIAASISMVAIKRSNCFNKEGDDSPCHVNSNPYM  181

Query  645  IAFGIIEIILSQIPXFD  695
            I FG+ EI+LSQIP FD
Sbjct  182  IMFGVAEIVLSQIPDFD  198



>gb|KCW70650.1| hypothetical protein EUGRSUZ_F03824 [Eucalyptus grandis]
Length=464

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = +3

Query  156  RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  335
                G+S+D P     K LDDDGR +RTGTVWTASAHIITAVIGSGVLSLAWA  QLGW+
Sbjct  8    NQAFGLSLDIPRQGSSKSLDDDGRVKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWI  67

Query  336  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYF  515
            AGP VM LF+ V YYTSTLLA CYR+GDP+ G+RNYTYMDAV +NLGG++VK+CGL+QY 
Sbjct  68   AGPIVMFLFASVTYYTSTLLAACYRSGDPITGRRNYTYMDAVNANLGGFKVKLCGLVQYL  127

Query  516  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            NLFG+AIGYT+A+S SMMAI RSNCFH+ G KNPCH +  PYMIAFGI EII SQIP FD
Sbjct  128  NLFGVAIGYTMASSFSMMAIDRSNCFHKKGEKNPCHANGYPYMIAFGITEIIFSQIPSFD  187



>ref|XP_010920126.1| PREDICTED: amino acid permease 4-like [Elaeis guineensis]
Length=513

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 155/193 (80%), Gaps = 10/193 (5%)
 Frame = +3

Query  147  KNHRHHLGVSIDAPPLYGF----------KGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            ++ R +L V     PL             K  DDDGR +RTGTVWTAS+HIITAVIGSGV
Sbjct  21   RDVRAYLQVETQPKPLKDIEATSARPEYSKLFDDDGRLKRTGTVWTASSHIITAVIGSGV  80

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWAIGQLGW+AGP+VM+LF+ V+YYTS LL+DCYR GDPV GKRNYTYMDAV +NLG
Sbjct  81   LSLAWAIGQLGWIAGPAVMILFAFVIYYTSNLLSDCYRIGDPVTGKRNYTYMDAVGANLG  140

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G +VKICG IQY NLFG+AIGYTIAASISM AIKRSNCFH SGGK+PCH+SSN YMI FG
Sbjct  141  GAKVKICGAIQYVNLFGVAIGYTIAASISMTAIKRSNCFHASGGKDPCHISSNMYMIIFG  200

Query  657  IIEIILSQIPXFD  695
            I+E+I SQIP FD
Sbjct  201  IMEVIFSQIPDFD  213



>ref|XP_011627960.1| PREDICTED: LOW QUALITY PROTEIN: amino acid permease 3 [Amborella 
trichopoda]
Length=507

 Score =   279 bits (714),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 157/196 (80%), Gaps = 5/196 (3%)
 Frame = +3

Query  123  MGESAAATKNHRH-----HLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIG  287
            M +   +++N++       + V  D P     KGLDDDGRP+RTG VWT+S+HIITAVIG
Sbjct  19   MRDENRSSRNYQQIELQQQIDVEQDTPQPGYLKGLDDDGRPKRTGNVWTSSSHIITAVIG  78

Query  288  SGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRS  467
            SGVLSLAWAI QLGW+AGP+VM+LF+ V +YTS LLA CYR+GDP+ GKRNYTYMDAVR+
Sbjct  79   SGVLSLAWAIAQLGWIAGPAVMVLFALVNFYTSNLLAGCYRSGDPISGKRNYTYMDAVRA  138

Query  468  NLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI  647
            NLGG +VK+CG IQY NL G+AIGYTIAASISMMAIKRSNCFH S GK+PCHMSSN YMI
Sbjct  139  NLGGSKVKLCGAIQYINLLGVAIGYTIAASISMMAIKRSNCFHRSKGKDPCHMSSNGYMI  198

Query  648  AFGIIEIILSQIPXFD  695
             FG+ EI  SQIP F+
Sbjct  199  MFGVTEIFFSQIPDFN  214



>ref|XP_006662801.1| PREDICTED: amino acid permease 3-like [Oryza brachyantha]
Length=475

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +3

Query  213  DDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTL  392
            DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI QLGWVAGP+VMLLF+ V+YYTSTL
Sbjct  27   DDDGRPRRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMLLFAFVIYYTSTL  86

Query  393  LADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMA  572
            LA+CYR+GDP  GKRNYTYMDAVR+NLGG +V++CG+IQY NLFG+AIGYTIAASISM+A
Sbjct  87   LAECYRSGDPCSGKRNYTYMDAVRANLGGAKVRLCGVIQYANLFGVAIGYTIAASISMLA  146

Query  573  IKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            IKR++CFHE G KN C  SSNPYMI FG +EI+ SQIP FD
Sbjct  147  IKRADCFHEKGHKNACRSSSNPYMILFGAVEIVFSQIPDFD  187



>ref|XP_010911278.1| PREDICTED: amino acid permease 3-like isoform X1 [Elaeis guineensis]
Length=492

 Score =   278 bits (711),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 161/197 (82%), Gaps = 6/197 (3%)
 Frame = +3

Query  120  QMGESAAATKNHRHH----LGVSIDAPPLYGF-KGLDDDGRPQRTGTVWTASAHIITAVI  284
            +MGE+ AA K H+H     + V+I+     G  K  D+DGR +RTGTVWTAS+HIITAVI
Sbjct  3    KMGENGAA-KYHQHANFTPMEVAIELGHQQGSSKCFDNDGRLKRTGTVWTASSHIITAVI  61

Query  285  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVR  464
            GSGVLSLAWAIGQLGWVAGP+ MLLFS V YYTS LL+DCYR+GDP+ GKRNYTYMDAV 
Sbjct  62   GSGVLSLAWAIGQLGWVAGPAAMLLFSYVTYYTSALLSDCYRSGDPMTGKRNYTYMDAVH  121

Query  465  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  644
            +NL G++VKICG +QY N+FG++IGYTIAASISM+AIKRSNCFHE G KNPC  SSNPYM
Sbjct  122  ANLNGFKVKICGFLQYANIFGVSIGYTIAASISMLAIKRSNCFHEKGHKNPCQASSNPYM  181

Query  645  IAFGIIEIILSQIPXFD  695
            I FG+ EI+ SQIP FD
Sbjct  182  IMFGVAEILFSQIPDFD  198



>ref|XP_011002449.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=484

 Score =   278 bits (710),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 151/191 (79%), Gaps = 0/191 (0%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  302
            MGE    +        VSI        +  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGEPENTSAEKHQVFDVSIAMHQQGSSEWFDDDGRQKRTGTVWTASAHIITAVIGSGVLS  60

Query  303  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  482
            LAWAI QLGW+AGP+ M LFS V  YTS+LL+ CYR+GDP+ GKRNYTYMDAVRSNLGG 
Sbjct  61   LAWAIAQLGWIAGPAFMFLFSIVTCYTSSLLSVCYRSGDPLTGKRNYTYMDAVRSNLGGV  120

Query  483  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  662
            +VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH+SGGKN C M++NPYMI FGI 
Sbjct  121  KVKICGFVQYLNLFGVAIGYTIASSISMMAIKRSNCFHKSGGKNSCRMNANPYMIGFGIA  180

Query  663  EIILSQIPXFD  695
            E +LSQIP FD
Sbjct  181  ETLLSQIPGFD  191



>ref|XP_009801366.1| PREDICTED: amino acid permease 3-like [Nicotiana sylvestris]
Length=481

 Score =   277 bits (709),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 155/193 (80%), Gaps = 4/193 (2%)
 Frame = +3

Query  117  MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            M+MGE+      H+    VSI+       K  DDDGR +RTG+VWTASAHIITAVIGSGV
Sbjct  1    MKMGENNNVASKHQV-FDVSINVTES---KCFDDDGRLKRTGSVWTASAHIITAVIGSGV  56

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWA+ QLGW+AGP VM+LFS V YYTS LLADCYR+GD V GKRNYTYMDAV++NLG
Sbjct  57   LSLAWAVAQLGWIAGPIVMILFSFVTYYTSALLADCYRSGDSVSGKRNYTYMDAVQANLG  116

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G QVKICG IQY NLFG+AIGYTIA+SISM+AIKRSNCFH+ G + PC +SS PYMI FG
Sbjct  117  GLQVKICGWIQYANLFGVAIGYTIASSISMIAIKRSNCFHKHGDQAPCQVSSTPYMIMFG  176

Query  657  IIEIILSQIPXFD  695
            IIEII SQIP FD
Sbjct  177  IIEIIFSQIPDFD  189



>ref|XP_010911284.1| PREDICTED: amino acid permease 3-like isoform X2 [Elaeis guineensis]
Length=489

 Score =   278 bits (710),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 160/196 (82%), Gaps = 6/196 (3%)
 Frame = +3

Query  123  MGESAAATKNHRHH----LGVSIDAPPLYGF-KGLDDDGRPQRTGTVWTASAHIITAVIG  287
            MGE+ AA K H+H     + V+I+     G  K  D+DGR +RTGTVWTAS+HIITAVIG
Sbjct  1    MGENGAA-KYHQHANFTPMEVAIELGHQQGSSKCFDNDGRLKRTGTVWTASSHIITAVIG  59

Query  288  SGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRS  467
            SGVLSLAWAIGQLGWVAGP+ MLLFS V YYTS LL+DCYR+GDP+ GKRNYTYMDAV +
Sbjct  60   SGVLSLAWAIGQLGWVAGPAAMLLFSYVTYYTSALLSDCYRSGDPMTGKRNYTYMDAVHA  119

Query  468  NLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMI  647
            NL G++VKICG +QY N+FG++IGYTIAASISM+AIKRSNCFHE G KNPC  SSNPYMI
Sbjct  120  NLNGFKVKICGFLQYANIFGVSIGYTIAASISMLAIKRSNCFHEKGHKNPCQASSNPYMI  179

Query  648  AFGIIEIILSQIPXFD  695
             FG+ EI+ SQIP FD
Sbjct  180  MFGVAEILFSQIPDFD  195



>ref|XP_010063933.1| PREDICTED: amino acid permease 3-like [Eucalyptus grandis]
 gb|KCW71231.1| hypothetical protein EUGRSUZ_F04329 [Eucalyptus grandis]
Length=478

 Score =   277 bits (709),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 151/176 (86%), Gaps = 1/176 (1%)
 Frame = +3

Query  171  VSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPS  347
            V++D P   G  K  DDDGR +RTGTVWTAS+HIITAVIGSGVLSLAWA  QLGW+AGP+
Sbjct  10   VALDLPQQGGGSKCFDDDGRLKRTGTVWTASSHIITAVIGSGVLSLAWATAQLGWIAGPA  69

Query  348  VMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFG  527
            VM LFS V YYTS+LLA CYR+GDPV GKRNYTYMDAV SNLGG +VK+CG++QY NLFG
Sbjct  70   VMFLFSFVTYYTSSLLAACYRSGDPVTGKRNYTYMDAVHSNLGGAKVKLCGMVQYLNLFG  129

Query  528  IAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            +AIGYTIA+SISMMAI RSNCFH++G  +PCH SSNPYMIAFG+IEI LSQIP FD
Sbjct  130  VAIGYTIASSISMMAIARSNCFHKNGDDSPCHTSSNPYMIAFGVIEIFLSQIPDFD  185



>gb|EEC81839.1| hypothetical protein OsI_25597 [Oryza sativa Indica Group]
Length=451

 Score =   276 bits (706),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +3

Query  213  DDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTL  392
            DDDGR +RTGT WTASAHIITAVIGSGVLSLAWAI QLGWVAGP+VMLLF+ V+YYTSTL
Sbjct  28   DDDGRARRTGTAWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMLLFAFVIYYTSTL  87

Query  393  LADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMA  572
            LA+CYR+GDP  GKRNYTYMDAVR+NLGG +V++CG+IQY NLFG+AIGYTIAASISM+A
Sbjct  88   LAECYRSGDPCTGKRNYTYMDAVRANLGGAKVRLCGVIQYANLFGVAIGYTIAASISMLA  147

Query  573  IKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            IKR++CFHE G KNPC  SSNPYMI FG+++I+ SQIP FD
Sbjct  148  IKRADCFHEKGHKNPCRSSSNPYMILFGVVQIVFSQIPDFD  188



>ref|XP_008788441.1| PREDICTED: amino acid permease 4-like [Phoenix dactylifera]
Length=514

 Score =   278 bits (711),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 149/171 (87%), Gaps = 1/171 (1%)
 Frame = +3

Query  183  APPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLF  362
            A P Y  K  DDDGR +RTGT WTAS+HIITAVIGSGVLSLAW +GQLGW+AGP+VM+LF
Sbjct  45   AQPEYS-KLFDDDGRLKRTGTFWTASSHIITAVIGSGVLSLAWGVGQLGWIAGPAVMILF  103

Query  363  SCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGY  542
            + V+ YTS LL+DCYR GDPV GKRNYTYMDAV +NLGG +VKICG IQY NLFG+AIGY
Sbjct  104  AFVIQYTSNLLSDCYRTGDPVTGKRNYTYMDAVGANLGGAKVKICGAIQYVNLFGVAIGY  163

Query  543  TIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            TIAASISMMAIKRSNCFH SGGK+PCH+SSN YMI FGIIE+ILSQIP FD
Sbjct  164  TIAASISMMAIKRSNCFHASGGKDPCHVSSNIYMIIFGIIEVILSQIPDFD  214



>ref|XP_009609434.1| PREDICTED: amino acid permease 3-like [Nicotiana tomentosiformis]
Length=482

 Score =   277 bits (708),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 155/193 (80%), Gaps = 4/193 (2%)
 Frame = +3

Query  117  MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            M+MGE+      H+    VSI+       K  DDDGR +RTG+VWTASAHIITAVIGSGV
Sbjct  1    MKMGENNNVASKHQV-FDVSINVTES---KCFDDDGRLKRTGSVWTASAHIITAVIGSGV  56

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWA+ QLGW+AGP VM+LFS V YYTS LLADCYR+GD V GKRNYTYMDAV++NLG
Sbjct  57   LSLAWAVAQLGWIAGPIVMILFSFVTYYTSALLADCYRSGDSVSGKRNYTYMDAVQANLG  116

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G QVKICG IQY NLFG+AIGYTIA+SISM+AIKRSNCFH+ G + PC +SS PYMI FG
Sbjct  117  GLQVKICGWIQYANLFGVAIGYTIASSISMIAIKRSNCFHKHGDQAPCQVSSTPYMIMFG  176

Query  657  IIEIILSQIPXFD  695
            I+EII SQIP FD
Sbjct  177  IVEIIFSQIPDFD  189



>emb|CAN77083.1| hypothetical protein VITISV_003992 [Vitis vinifera]
Length=546

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 158/198 (80%), Gaps = 1/198 (1%)
 Frame = +3

Query  102  GGSKIMQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAV  281
            GG     M ++    K H+  L +  D  P    K LDDDG P+RTGTVWTASAHIIT++
Sbjct  57   GGKAGTTMLQTKVDEKPHQM-LHLPSDVLPHDISKCLDDDGXPKRTGTVWTASAHIITSI  115

Query  282  IGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAV  461
            IGSGVLSLAWA+ QLGW+ GP+V+L+F+ V+ YTS+LLADCYR+GDP+ GKRNYTYM+ V
Sbjct  116  IGSGVLSLAWAVAQLGWIGGPTVILMFAVVICYTSSLLADCYRSGDPISGKRNYTYMEVV  175

Query  462  RSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPY  641
            +SNLGG +VKICGLIQY NLFGI +GYTIA S+SMMA+ RSNCFH SG KNPCH SSNPY
Sbjct  176  QSNLGGAKVKICGLIQYCNLFGITVGYTIATSVSMMAVMRSNCFHRSGNKNPCHESSNPY  235

Query  642  MIAFGIIEIILSQIPXFD  695
            MI FGIIEI+LSQIP FD
Sbjct  236  MIMFGIIEIVLSQIPDFD  253



>ref|XP_007137460.1| hypothetical protein PHAVU_009G128600g [Phaseolus vulgaris]
 gb|ESW09454.1| hypothetical protein PHAVU_009G128600g [Phaseolus vulgaris]
Length=487

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 156/186 (84%), Gaps = 2/186 (1%)
 Frame = +3

Query  144  TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  323
            +K+ +    VS+D       K  DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI Q
Sbjct  9    SKSDQETFSVSLDMHEQGDSKCFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAIAQ  68

Query  324  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG--YQVKIC  497
            LGW+AGP+VMLLFS + Y+TS LL DCYR GDP+ GKRNYTYMDA+RSN GG  ++VK+C
Sbjct  69   LGWIAGPAVMLLFSAITYFTSLLLTDCYRTGDPLTGKRNYTYMDAIRSNFGGNDFKVKMC  128

Query  498  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  677
            GL+QY NLFGI+IGYTIAASISMMAI+RS+CFH++GGK+ C M+SN YMI+FGI+E+I S
Sbjct  129  GLVQYVNLFGISIGYTIAASISMMAIERSDCFHKNGGKSHCRMNSNMYMISFGIVEMIFS  188

Query  678  QIPXFD  695
            QIP FD
Sbjct  189  QIPDFD  194



>ref|XP_006300985.1| hypothetical protein CARUB_v10021374mg [Capsella rubella]
 gb|EOA33883.1| hypothetical protein CARUB_v10021374mg [Capsella rubella]
Length=475

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = +3

Query  171  VSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSV  350
            +++  P   G K  DDDG+ +RTG+ WTASAHIITAVIGSGVLSLAWA  QLGW+AGP V
Sbjct  8    LAVIMPQTAGSKCFDDDGKIKRTGSAWTASAHIITAVIGSGVLSLAWATAQLGWIAGPVV  67

Query  351  MLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGI  530
            MLLFS V Y+TS+LLA CYR+GDP+ GKRNYTYMDAVRSNLGG +V +CG++QY N+FG+
Sbjct  68   MLLFSIVTYFTSSLLASCYRSGDPISGKRNYTYMDAVRSNLGGVKVTLCGIVQYLNIFGV  127

Query  531  AIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            AIGYTIA++ISMMAIKRSNCFH+SGGK+ CHM+SNPYMIAFG+++I+ SQIP FD
Sbjct  128  AIGYTIASAISMMAIKRSNCFHKSGGKDACHMNSNPYMIAFGLVQILFSQIPDFD  182



>ref|XP_009390074.1| PREDICTED: amino acid permease 4-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 157/203 (77%), Gaps = 15/203 (7%)
 Frame = +3

Query  120  QMGESAAATKNHRHH-------LGVSIDAPPLY----GFKGLDDDGRPQRTGTVWTASAH  266
            +MGE    T N +H+       + VSI+    +     F+  DDDGR +RTGTVWTASAH
Sbjct  17   KMGE----TGNAKHYQQPAVVPMNVSIELGHAHRLEKAFECYDDDGRLKRTGTVWTASAH  72

Query  267  IITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYT  446
            I+TAVIGSGVLSLAWAI QLGWVAGP VMLLFS V YYTSTLLADCYR+GDP+ GKRNY 
Sbjct  73   IVTAVIGSGVLSLAWAIAQLGWVAGPVVMLLFSFVTYYTSTLLADCYRSGDPISGKRNYK  132

Query  447  YMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHM  626
            Y DAV S LGG +VK+CG IQY NLFG+A+GYTIAASISMMAI+RSNCFHE G  NPCH 
Sbjct  133  YTDAVHSYLGGLKVKLCGFIQYANLFGVAVGYTIAASISMMAIRRSNCFHERGHDNPCHT  192

Query  627  SSNPYMIAFGIIEIILSQIPXFD  695
            SSNPYMI FG+ EI LSQIP FD
Sbjct  193  SSNPYMIMFGVAEIFLSQIPDFD  215



>gb|EEE52230.1| hypothetical protein OsJ_34158 [Oryza sativa Japonica Group]
Length=451

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +3

Query  213  DDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTL  392
            DDDGR +R GTVWTASAHIITAVIGSGVLSLAWAI QLGWVAGP+VMLLF+ V+YYTSTL
Sbjct  28   DDDGRARRMGTVWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMLLFAFVIYYTSTL  87

Query  393  LADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMA  572
            LA+CYR+GDP  GKRNYTYMDAVR+NLGG +V++CG+IQY NLFG+AIGYTIAASISM+A
Sbjct  88   LAECYRSGDPCTGKRNYTYMDAVRANLGGSKVRLCGVIQYANLFGVAIGYTIAASISMLA  147

Query  573  IKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            IKR++CFHE G KNPC  SSNPYMI FG+++I+ SQIP FD
Sbjct  148  IKRADCFHEKGHKNPCRSSSNPYMILFGVVQIVFSQIPDFD  188



>ref|XP_011003419.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=484

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 150/191 (79%), Gaps = 0/191 (0%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  302
            MGE    +        VSI        +  DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGEPENTSAEKHQVFDVSIAMHQQGSSEWFDDDGRQKRTGTVWTASAHIITAVIGSGVLS  60

Query  303  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  482
            LAWAI QLGW+AGP+ M LFS V  YTS+LL+ CYR+GDP+ GKRNYTYMDAVRSNLGG 
Sbjct  61   LAWAIAQLGWIAGPAFMFLFSIVTCYTSSLLSVCYRSGDPLTGKRNYTYMDAVRSNLGGV  120

Query  483  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  662
            +VKICG +QY NLFG+A GYTIA+SISMMAIKRSNCFH+SGGKN C M++NPYMI FGI 
Sbjct  121  KVKICGFVQYLNLFGVAFGYTIASSISMMAIKRSNCFHKSGGKNSCRMNANPYMIGFGIA  180

Query  663  EIILSQIPXFD  695
            E +LSQIP FD
Sbjct  181  ETLLSQIPGFD  191



>ref|NP_001067425.1| Os11g0195600 [Oryza sativa Japonica Group]
 gb|AAX96051.1| Transmembrane amino acid transporter protein [Oryza sativa Japonica 
Group]
 gb|ABA91874.1| amino acid carrier, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27788.1| Os11g0195600 [Oryza sativa Japonica Group]
 dbj|BAG90706.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96629.1| unnamed protein product [Oryza sativa Japonica Group]
Length=476

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +3

Query  213  DDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTL  392
            DDDGR +R GTVWTASAHIITAVIGSGVLSLAWAI QLGWVAGP+VMLLF+ V+YYTSTL
Sbjct  28   DDDGRARRMGTVWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMLLFAFVIYYTSTL  87

Query  393  LADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMA  572
            LA+CYR+GDP  GKRNYTYMDAVR+NLGG +V++CG+IQY NLFG+AIGYTIAASISM+A
Sbjct  88   LAECYRSGDPCTGKRNYTYMDAVRANLGGSKVRLCGVIQYANLFGVAIGYTIAASISMLA  147

Query  573  IKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            IKR++CFHE G KNPC  SSNPYMI FG+++I+ SQIP FD
Sbjct  148  IKRADCFHEKGHKNPCRSSSNPYMILFGVVQIVFSQIPDFD  188



>gb|KEH35329.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=409

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 149/184 (81%), Gaps = 2/184 (1%)
 Frame = +3

Query  144  TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  323
            + NH     VSID      F   DDDGR +RTGT WTASAH+ITAVIGSGVLSLAWAI Q
Sbjct  7    STNHHQTFDVSIDQQRDSKF--FDDDGRVKRTGTAWTASAHVITAVIGSGVLSLAWAIAQ  64

Query  324  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGL  503
            LGW+AGP VM+LF+ V YYTS LL +CYR GDP+ GKRNYTYMD V SNLGG+QV +CG+
Sbjct  65   LGWIAGPIVMILFAWVTYYTSILLCECYRTGDPISGKRNYTYMDVVHSNLGGFQVTLCGI  124

Query  504  IQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  683
            +QY NL G+AIGYTIA++ISMMAI+RSNCFH SGGK+PCHM+SN YMI+FG ++II SQI
Sbjct  125  VQYLNLVGVAIGYTIASAISMMAIERSNCFHRSGGKDPCHMNSNIYMISFGAVQIIFSQI  184

Query  684  PXFD  695
            P FD
Sbjct  185  PDFD  188



>ref|XP_010527720.1| PREDICTED: amino acid permease 5-like isoform X2 [Tarenaya hassleriana]
Length=480

 Score =   275 bits (704),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = +3

Query  144  TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  323
            T N     GVS+D  P       DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWA+ Q
Sbjct  4    TVNGTQSFGVSMDVLPKNRSDLFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQ  63

Query  324  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGL  503
            LGWVAGP+VM LFS V YYTS LL  CYR+GD V GKRNYTYMDAV++NLGG +VK+CGL
Sbjct  64   LGWVAGPAVMFLFSLVTYYTSILLCSCYRSGDSVSGKRNYTYMDAVQANLGGVKVKLCGL  123

Query  504  IQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  683
            +QY NLFG AIGYTIA+++SM+AI+RSNC H+S GK+PCH++ NPYMIAFG+ +I+ SQI
Sbjct  124  VQYLNLFGTAIGYTIASAVSMIAIQRSNCHHKSHGKDPCHINGNPYMIAFGVAQIVFSQI  183

Query  684  PXFD  695
            P FD
Sbjct  184  PDFD  187



>ref|XP_012081757.1| PREDICTED: amino acid permease 4-like [Jatropha curcas]
 gb|KDP29639.1| hypothetical protein JCGZ_18801 [Jatropha curcas]
Length=522

 Score =   276 bits (707),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 155/195 (79%), Gaps = 1/195 (1%)
 Frame = +3

Query  111  KIMQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  290
            ++  + +S     N   +   +I+  P Y  K  DDDGR +RTGT WTA++HIITAVIGS
Sbjct  30   EVQPVAKSTRNNPNPNENGSEAINPQPNYS-KCFDDDGRLKRTGTFWTAASHIITAVIGS  88

Query  291  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSN  470
            GVLSLAWAIGQLGWVAGP+VMLLF+ V  YTS LLA CYR GDPV G RNYTYMDAV++N
Sbjct  89   GVLSLAWAIGQLGWVAGPAVMLLFAFVNLYTSNLLAQCYRTGDPVKGHRNYTYMDAVKAN  148

Query  471  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  650
            LGG +V  CGLIQY NLFG+AIGYTIAAS+SMMAIKRSNCFH SGGK+PCHMSSN YMIA
Sbjct  149  LGGKKVFFCGLIQYLNLFGVAIGYTIAASVSMMAIKRSNCFHASGGKDPCHMSSNGYMIA  208

Query  651  FGIIEIILSQIPXFD  695
            FGI E+I SQIP FD
Sbjct  209  FGITEVIFSQIPDFD  223



>gb|AAX56951.1| amino acid transporter [Pisum sativum]
Length=482

 Score =   275 bits (703),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 152/186 (82%), Gaps = 3/186 (2%)
 Frame = +3

Query  141  ATKNHRHH-LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  317
            A+KNH H    VSID       K  DDDGR +RTGT WTASAH+ITAVIGSGVLSLAWAI
Sbjct  7    ASKNHHHQTFDVSIDQQ--LDSKFFDDDGRVKRTGTSWTASAHVITAVIGSGVLSLAWAI  64

Query  318  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKIC  497
             QLGW+AGP VM+LF+ V YYTS LLA+CYR GDPV GKRNYTYM+ V SNLGG QV+ C
Sbjct  65   AQLGWIAGPVVMILFAWVTYYTSVLLAECYRNGDPVNGKRNYTYMEVVHSNLGGLQVQFC  124

Query  498  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  677
            G IQY NL G+AIGYT+A++ISMMAI+RSNC+H SGGK+PCHM+SN YMIAFG ++II+S
Sbjct  125  GFIQYLNLIGVAIGYTVASAISMMAIERSNCYHRSGGKDPCHMNSNAYMIAFGAVQIIVS  184

Query  678  QIPXFD  695
            QIP FD
Sbjct  185  QIPDFD  190



>dbj|BAO45885.1| amino acid permease [Acacia mangium]
Length=486

 Score =   275 bits (703),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = +3

Query  171  VSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSV  350
            V I+  P    K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWAI QLGW+AGP+V
Sbjct  12   VDIEVAPQGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAV  71

Query  351  MLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGI  530
            M+LFS V YYTS+LLA CYR+GDP+ GKRNYTYMDAVRSNLGG++VKICGLIQY NLFG+
Sbjct  72   MILFSLVTYYTSSLLAACYRSGDPLTGKRNYTYMDAVRSNLGGFKVKICGLIQYVNLFGV  131

Query  531  AIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            AIGYTIAASISMMA+++SNC H++G K+ C M+ + Y+IAFGI+EII SQIP FD
Sbjct  132  AIGYTIAASISMMAVQKSNCIHKTGSKDECKMNGDIYIIAFGIVEIIFSQIPDFD  186



>ref|XP_010416679.1| PREDICTED: amino acid permease 3-like [Camelina sativa]
Length=477

 Score =   275 bits (702),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 152/176 (86%), Gaps = 1/176 (1%)
 Frame = +3

Query  171  VSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPS  347
            ++ID PP  G  K  DDDG+ +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW+AGP 
Sbjct  9    LAIDMPPQTGGSKCFDDDGKVKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPV  68

Query  348  VMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFG  527
             MLLFS V Y+TS+LLA CYR+GDP+ GKRNYTYM AVRSNLGG +V +CG++QY N+FG
Sbjct  69   AMLLFSVVTYFTSSLLATCYRSGDPISGKRNYTYMGAVRSNLGGVKVTLCGIVQYLNIFG  128

Query  528  IAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            +AIGYTIA++ISMMAIKRSNCFH+SGGK+PC M+S PYMIAFG+++I+ SQIP FD
Sbjct  129  VAIGYTIASAISMMAIKRSNCFHKSGGKDPCQMNSTPYMIAFGLVQILFSQIPDFD  184



>ref|XP_009390766.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009390767.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=492

 Score =   275 bits (703),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 151/188 (80%), Gaps = 8/188 (4%)
 Frame = +3

Query  132  SAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAW  311
            S +   +H H L  +        F+  DDDGR +RTGT+WTASAHI+TAVIGSGVLSLAW
Sbjct  19   SVSVEVSHAHKLQEA--------FECYDDDGRAKRTGTLWTASAHIVTAVIGSGVLSLAW  70

Query  312  AIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVK  491
            AI QLGWVAGP VMLLFS V +YTSTLLADCYR+GDP+ GKRNY+Y DAV + LGG +VK
Sbjct  71   AIAQLGWVAGPVVMLLFSFVTHYTSTLLADCYRSGDPIAGKRNYSYTDAVHAYLGGLKVK  130

Query  492  ICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEII  671
            +CG IQY NLFG+AIGYTIA+SISMMAIKRSNCFHE G +NPCH SSNPYMI FGI EI 
Sbjct  131  LCGFIQYANLFGVAIGYTIASSISMMAIKRSNCFHERGHENPCHASSNPYMIMFGIAEIF  190

Query  672  LSQIPXFD  695
            LSQIP FD
Sbjct  191  LSQIPDFD  198



>ref|XP_010530203.1| PREDICTED: amino acid permease 5 [Tarenaya hassleriana]
 ref|XP_010530205.1| PREDICTED: amino acid permease 5 [Tarenaya hassleriana]
Length=480

 Score =   274 bits (701),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +3

Query  144  TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  323
            T  +     VSID  P       DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWA+ Q
Sbjct  4    TVKNTQSFVVSIDVLPKSSSDLFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAMAQ  63

Query  324  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGL  503
            LGWVAGP+VM LFS V YYTS LL+ CYR+GD V GKRNYTYMDAV++NLGG +VK+CGL
Sbjct  64   LGWVAGPAVMFLFSLVTYYTSILLSSCYRSGDSVSGKRNYTYMDAVQANLGGVKVKLCGL  123

Query  504  IQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  683
            +QY NLFG AIGYTIA++ISM+AI+RSNC H S GK+PCH++ NPYMIAFG+ +I+ SQI
Sbjct  124  VQYLNLFGTAIGYTIASAISMIAIQRSNCHHRSHGKDPCHINGNPYMIAFGVAQIVFSQI  183

Query  684  PXFD  695
            P FD
Sbjct  184  PDFD  187



>gb|KEH40510.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=483

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 152/192 (79%), Gaps = 4/192 (2%)
 Frame = +3

Query  123  MGESAAATKNHRHH-LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  299
            M     +  NH+     VSID     G K  DDDGR +RTG  WTASAHIITAVIGSGVL
Sbjct  1    MTVEKGSNMNHQQQPFEVSIDTA---GSKCFDDDGRLKRTGNEWTASAHIITAVIGSGVL  57

Query  300  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  479
            SLAWAI QLGW+AGPS+MLLFS V YYTSTLL+ CYR GD + GKRNYTY DAVR+ LGG
Sbjct  58   SLAWAIAQLGWIAGPSMMLLFSFVTYYTSTLLSVCYRTGDQLNGKRNYTYTDAVRAYLGG  117

Query  480  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  659
            ++ KICG++QY NLFG+AIGYTIAASISMMAIKRSNCFH SGGKNPCHM+ N YMI+FGI
Sbjct  118  FKYKICGVVQYANLFGVAIGYTIAASISMMAIKRSNCFHSSGGKNPCHMNGNIYMISFGI  177

Query  660  IEIILSQIPXFD  695
            +EI  SQIP FD
Sbjct  178  VEIFFSQIPDFD  189



>emb|CDY71454.1| BnaAnng37520D, partial [Brassica napus]
Length=280

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +3

Query  165  LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  344
            LGVS+D  P       D+DGRP+RTGTVWTASAHIITAVIGSGVLSLAWA+ Q+GWV GP
Sbjct  11   LGVSMDVLPRNSSDLFDEDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIGWVGGP  70

Query  345  SVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLF  524
            +VM+LFS V YYTS LL  CYR+GD V GKRNYTYMDA+ SNLGG +VKICG++QY NLF
Sbjct  71   TVMMLFSLVTYYTSILLCSCYRSGDSVTGKRNYTYMDAIHSNLGGIKVKICGVVQYVNLF  130

Query  525  GIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            G AIGYTIA+++SM+AI+R++C   +G K+PCH++ NPYMIAFG+I+I+ SQIP FD
Sbjct  131  GTAIGYTIASAVSMIAIQRTSCQQSNGDKDPCHVNGNPYMIAFGVIQIVFSQIPDFD  187



>ref|XP_008679681.1| PREDICTED: amino acid permease 3-like [Zea mays]
 gb|AFW65568.1| hypothetical protein ZEAMMB73_193502 [Zea mays]
Length=472

 Score =   273 bits (697),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +3

Query  198  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  377
             + G DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI QLGW AGP+VMLLF+ V+Y
Sbjct  19   AYGGRDDDGRPRRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWAAGPAVMLLFAVVIY  78

Query  378  YTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  557
            YTSTLLA+CYR+GDPV GKRNYTYMDAVR++LGG +V++CG IQY NLFG+AIGYTIAAS
Sbjct  79   YTSTLLAECYRSGDPVAGKRNYTYMDAVRASLGGAKVRLCGAIQYANLFGVAIGYTIAAS  138

Query  558  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            ISM+AIKR++CFH  G K+ C  SSNPYMI FG+ E++ SQIP FD
Sbjct  139  ISMLAIKRADCFHAKGHKHACRSSSNPYMILFGVAEVVFSQIPDFD  184



>ref|XP_008810907.1| PREDICTED: amino acid permease 3-like [Phoenix dactylifera]
Length=468

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  198  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  377
            G K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP+ MLLFS V Y
Sbjct  9    GSKCYDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPAAMLLFSYVTY  68

Query  378  YTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  557
            YTS LLADCYR+ DP+ GKRNYTYMDAV++NL G++VK+CG IQY N+FG++IGYTIAA+
Sbjct  69   YTSALLADCYRSCDPINGKRNYTYMDAVQANLNGFKVKLCGFIQYANIFGVSIGYTIAAA  128

Query  558  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            ISM AIKRSNCFHE G  NPC +SSNPYMI FG+ EI LSQIP FD
Sbjct  129  ISMTAIKRSNCFHEKGHSNPCQVSSNPYMIIFGVAEIFLSQIPDFD  174



>ref|XP_010428816.1| PREDICTED: amino acid permease 3 [Camelina sativa]
Length=477

 Score =   273 bits (697),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 152/176 (86%), Gaps = 1/176 (1%)
 Frame = +3

Query  171  VSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPS  347
            ++ID P   G  K  DDDG+ +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW+AGP 
Sbjct  9    LAIDMPQQTGGSKCFDDDGKVKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPV  68

Query  348  VMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFG  527
            VMLLFS V Y+TS+LLA CYR+GDP+ GKRNYTYM AVRSNLGG +V +CG++QY N+FG
Sbjct  69   VMLLFSVVTYFTSSLLASCYRSGDPISGKRNYTYMGAVRSNLGGVKVTLCGIVQYLNIFG  128

Query  528  IAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            +AIGYTIA++ISMMAIKRSNCFH+SGGK+PC M+S PYMIAFG+++I+ SQIP FD
Sbjct  129  VAIGYTIASAISMMAIKRSNCFHKSGGKDPCQMNSTPYMIAFGLVQILFSQIPDFD  184



>emb|CAC51425.1| amino acid permease AAP4 [Vicia faba var. minor]
Length=481

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 149/185 (81%), Gaps = 2/185 (1%)
 Frame = +3

Query  141  ATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIG  320
            A+ NH     VSID       K  DDDGR +RTGT WTASAH+ITAVIGSGVLSLAWAI 
Sbjct  7    ASNNHHQTFYVSIDQQ--IDSKFFDDDGRVKRTGTSWTASAHVITAVIGSGVLSLAWAIA  64

Query  321  QLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICG  500
            QLGW+AGP VM LF+ V YYTS LL +CYR GDPV GKRNYTYM+ V SNLGG+QV++CG
Sbjct  65   QLGWIAGPIVMFLFAWVTYYTSVLLCECYRNGDPVNGKRNYTYMEVVHSNLGGFQVQLCG  124

Query  501  LIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQ  680
            LIQY NL G+AIGYT+A++ISMMAI RSNCFH SGGK+PCHM+SN YMIAFG ++II SQ
Sbjct  125  LIQYLNLVGVAIGYTVASAISMMAIVRSNCFHRSGGKDPCHMNSNIYMIAFGAVQIIFSQ  184

Query  681  IPXFD  695
            IP FD
Sbjct  185  IPDFD  189



>ref|XP_002449174.1| hypothetical protein SORBIDRAFT_05g006010 [Sorghum bicolor]
 gb|EES08162.1| hypothetical protein SORBIDRAFT_05g006010 [Sorghum bicolor]
Length=481

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +3

Query  213  DDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTL  392
            DDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI QLGW AGP+VM+LF+ V+YYTSTL
Sbjct  32   DDDGRPRRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWAAGPAVMILFAVVIYYTSTL  91

Query  393  LADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMA  572
            LA+CYR+GDPV GKRNYTYMDAVRS+LGG +V +CG IQY NLFG+AIGYTIAASISM+A
Sbjct  92   LAECYRSGDPVAGKRNYTYMDAVRSSLGGAKVTLCGSIQYANLFGVAIGYTIAASISMLA  151

Query  573  IKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            IKR++CFH  G +NPC  SSNPYMI FG+ E++ SQIP FD
Sbjct  152  IKRADCFHVKGHRNPCRSSSNPYMILFGVAEVVFSQIPDFD  192



>ref|XP_004978920.1| PREDICTED: amino acid permease 3-like [Setaria italica]
Length=473

 Score =   272 bits (696),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 152/178 (85%), Gaps = 1/178 (1%)
 Frame = +3

Query  165  LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  344
            L VS++A        LDDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI QLGW AGP
Sbjct  8    LEVSVEAGNGRDGAWLDDDGRPRRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWAAGP  67

Query  345  SVMLLFSCVVYYTSTLLADCYRAG-DPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNL  521
            +VMLLF+ V+YYTSTLLA+CYR+G DPV GKRNYTYMDAVR++LGG +V++CG IQY NL
Sbjct  68   AVMLLFAFVIYYTSTLLAECYRSGGDPVAGKRNYTYMDAVRASLGGAKVRLCGAIQYANL  127

Query  522  FGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            FG+AIGYTIAASISM+AIKR++CFH  G +NPC  SSNPYMI FG+ E++ SQIP FD
Sbjct  128  FGVAIGYTIAASISMLAIKRADCFHAKGHRNPCRSSSNPYMILFGVAEVVFSQIPDFD  185



>ref|XP_006473027.1| PREDICTED: amino acid permease 3-like [Citrus sinensis]
Length=479

 Score =   272 bits (696),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 150/187 (80%), Gaps = 6/187 (3%)
 Frame = +3

Query  138  AATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  317
             A KN      VS+   P  G K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWA 
Sbjct  5    TAAKNQHQVFDVSL---PQSGSKCFDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWAT  61

Query  318  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKIC  497
             QLGW+AGPSVM LFS V YYTSTLLA CYR+GDPV GKRNYTY+DAVRSNLGG+QVKIC
Sbjct  62   AQLGWIAGPSVMFLFSFVTYYTSTLLAACYRSGDPVTGKRNYTYVDAVRSNLGGFQVKIC  121

Query  498  GLIQYFNLFGIAIG-YTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIIL  674
            GL+QY NLFG+A   Y+  +SI   AI+RSNCFH  G KNPCHM+SNPYMIAFGI+EI+L
Sbjct  122  GLVQYLNLFGVAFTRYSFFSSIR--AIERSNCFHSKGDKNPCHMNSNPYMIAFGIVEIVL  179

Query  675  SQIPXFD  695
            SQIP FD
Sbjct  180  SQIPDFD  186



>ref|XP_010471931.1| PREDICTED: amino acid permease 3-like [Camelina sativa]
Length=477

 Score =   272 bits (696),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  198  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  377
            G K  DDDG+ +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGW+AGP VMLLFS V Y
Sbjct  19   GSKCFDDDGKVKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPVVMLLFSVVTY  78

Query  378  YTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  557
            +TS+LLA CYR+GDP+ GKRNYTYM AVRSNLGG +V +CG++QY N+FG+AIGYTIA++
Sbjct  79   FTSSLLASCYRSGDPISGKRNYTYMGAVRSNLGGVKVTLCGIVQYLNIFGVAIGYTIASA  138

Query  558  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            ISMMAIKRSNCFH+SGGK+PC M+S PYMIAFG+++I+ SQIP FD
Sbjct  139  ISMMAIKRSNCFHKSGGKDPCQMNSTPYMIAFGLVQILFSQIPDFD  184



>ref|XP_006847199.1| PREDICTED: amino acid permease 4 [Amborella trichopoda]
 ref|XP_011624376.1| PREDICTED: amino acid permease 4 [Amborella trichopoda]
 gb|ERN08780.1| hypothetical protein AMTR_s00017p00252280 [Amborella trichopoda]
Length=497

 Score =   273 bits (697),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  198  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  377
            G K  DDDGR +RTGTVWTASAHIITAVIGSGVLSLA+AIGQLGWVAGP+VM+LFS V Y
Sbjct  31   GSKCYDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAFAIGQLGWVAGPTVMVLFSFVTY  90

Query  378  YTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  557
            YTSTLL+DCYR+GDP+ GKRNYTY+DAVR+N+  + V++CG +QY  L G+AIGYTIA+S
Sbjct  91   YTSTLLSDCYRSGDPLTGKRNYTYVDAVRANMSEFNVRLCGWLQYAGLVGVAIGYTIASS  150

Query  558  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            ISMMAIKRSNCFHE+ GKNPCH+SSNPYMI FGI EI+LSQIP FD
Sbjct  151  ISMMAIKRSNCFHETRGKNPCHVSSNPYMIMFGITEIVLSQIPDFD  196



>ref|XP_006365537.1| PREDICTED: amino acid permease 3-like [Solanum tuberosum]
Length=473

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = +3

Query  204  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  383
            K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGWVAGP+V+LLFS V YYT
Sbjct  18   KCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVLLLFSFVTYYT  77

Query  384  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  563
            S LL+DCYR GDPV GKRNYTYMDAVR+NLGG+QVKICG+IQY NLFG+AIGYTIAASIS
Sbjct  78   SALLSDCYRTGDPVTGKRNYTYMDAVRANLGGFQVKICGVIQYANLFGVAIGYTIAASIS  137

Query  564  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            M+A+ RSNCFH+ G +  C++SS PYMI FG++EII SQIP FD
Sbjct  138  MVAVNRSNCFHKQGHRAACNVSSTPYMIIFGVMEIIFSQIPDFD  181



>ref|XP_008442173.1| PREDICTED: amino acid permease 4-like [Cucumis melo]
Length=466

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  189  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  368
            P+      DDDGRP+RTGT WTASAHIITAVIGSGVLSLAWAI QLGW+AGPSVMLLFS 
Sbjct  5    PVNDSASFDDDGRPKRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPSVMLLFSF  64

Query  369  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  548
            + YYTS LLADCYR+GDPV GKRN TYM AVRS LG   +  CG++QY NL GI IGYTI
Sbjct  65   IGYYTSCLLADCYRSGDPVSGKRNPTYMHAVRSLLGETHMVACGIMQYINLIGITIGYTI  124

Query  549  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            A+SISMMAIKRSNCFH SGGKNPCH+SSNP+M++FGI+EIILSQIP FD
Sbjct  125  ASSISMMAIKRSNCFHSSGGKNPCHISSNPFMLSFGIVEIILSQIPNFD  173



>ref|XP_010028716.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 gb|KCW55513.1| hypothetical protein EUGRSUZ_I01405 [Eucalyptus grandis]
Length=512

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  204  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  383
            K  DDDGR +RTGT WTAS+HIITAVIGSGVLSLAWAIGQLGWVAGP+VM+LF+ V +YT
Sbjct  50   KCFDDDGRLKRTGTFWTASSHIITAVIGSGVLSLAWAIGQLGWVAGPTVMVLFAFVNFYT  109

Query  384  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  563
            + LL+ CYR+GDP+ G+RNYTYMD V++NLGG +V +CGLIQY NLFG+AIGYTIAAS+S
Sbjct  110  TNLLSQCYRSGDPITGQRNYTYMDVVKANLGGKRVMLCGLIQYLNLFGVAIGYTIAASVS  169

Query  564  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            MMAIKRSNCFH+SGGK+PCHMSSN +MI FG++EI LSQIP FD
Sbjct  170  MMAIKRSNCFHKSGGKDPCHMSSNGFMITFGVMEIFLSQIPDFD  213



>ref|XP_009411897.1| PREDICTED: amino acid permease 3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=478

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = +3

Query  204  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  383
            K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWAIGQLGWVAGP+VM+LFS V YYT
Sbjct  22   KCFDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPAVMILFSFVTYYT  81

Query  384  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  563
            S LLADCYR+GDPV GKRNYTYMDAVR+NL G++V++CG +QY N+ G+AIGYTIAASIS
Sbjct  82   SALLADCYRSGDPVAGKRNYTYMDAVRANLNGFKVELCGYLQYLNIVGVAIGYTIAASIS  141

Query  564  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            M+AIKRSNCFHE+G  +PC ++SNPY+I FG+ EI+ SQIP FD
Sbjct  142  MVAIKRSNCFHENGDDSPCQVNSNPYIIMFGVAEIVFSQIPDFD  185



>ref|XP_009411898.1| PREDICTED: amino acid permease 3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=471

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = +3

Query  204  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  383
            K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWAIGQLGWVAGP+VM+LFS V YYT
Sbjct  15   KCFDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPAVMILFSFVTYYT  74

Query  384  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  563
            S LLADCYR+GDPV GKRNYTYMDAVR+NL G++V++CG +QY N+ G+AIGYTIAASIS
Sbjct  75   SALLADCYRSGDPVAGKRNYTYMDAVRANLNGFKVELCGYLQYLNIVGVAIGYTIAASIS  134

Query  564  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            M+AIKRSNCFHE+G  +PC ++SNPY+I FG+ EI+ SQIP FD
Sbjct  135  MVAIKRSNCFHENGDDSPCQVNSNPYIIMFGVAEIVFSQIPDFD  178



>ref|XP_008236004.1| PREDICTED: amino acid permease 3-like [Prunus mume]
Length=511

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 157/197 (80%), Gaps = 11/197 (6%)
 Frame = +3

Query  138  AATKNH--RHHLGVSIDA---------PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVI  284
            A  + H  RH+L V +           P     K  DDDGR +RTGT WT+++HIITAVI
Sbjct  16   AVEERHDIRHYLQVEVQPKVTESEAINPQSSYIKCFDDDGRLKRTGTFWTSASHIITAVI  75

Query  285  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVR  464
            GSGVLSLAWAI QLGWVAGPSV+LLF+ V  YTS LLA CYR+GDPV G+RNYTYMDA++
Sbjct  76   GSGVLSLAWAIAQLGWVAGPSVLLLFALVNLYTSNLLAMCYRSGDPVTGQRNYTYMDAIK  135

Query  465  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  644
            +NLGG +V +CGL+QYFNLFG+AIGYTIA+S+SMMAIKRSNC+H+SGGK+PCHMSSN YM
Sbjct  136  ANLGGRKVMLCGLVQYFNLFGVAIGYTIASSVSMMAIKRSNCYHKSGGKDPCHMSSNGYM  195

Query  645  IAFGIIEIILSQIPXFD  695
            I FGIIE+I SQIP F+
Sbjct  196  ITFGIIEVIFSQIPDFN  212



>gb|EPS59884.1| hypothetical protein M569_14923, partial [Genlisea aurea]
Length=237

 Score =   263 bits (671),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +3

Query  213  DDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTL  392
            DDDGRP+RTG++WTASAHIITAVIGSGVLSLAWA+ QLGW+AGP VMLLFS V YYTS L
Sbjct  1    DDDGRPKRTGSLWTASAHIITAVIGSGVLSLAWAMAQLGWIAGPVVMLLFSFVTYYTSVL  60

Query  393  LADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMA  572
            LA CYR G+P  GKRNYTY+DAVRSNLG   VK+CG IQY NLFG+AIGYTIA++ISMMA
Sbjct  61   LAACYRTGNPDTGKRNYTYVDAVRSNLGELHVKLCGGIQYLNLFGVAIGYTIASAISMMA  120

Query  573  IKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            ++RSNCFH  G  +PC  SSNPYMIAFG +EI+ SQIP FD
Sbjct  121  VERSNCFHAKGDDSPCKASSNPYMIAFGAVEILFSQIPDFD  161



>gb|AIS71894.1| amino acid transporter [Nicotiana tabacum]
Length=480

 Score =   270 bits (690),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 152/191 (80%), Gaps = 4/191 (2%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  302
            MGE+      H+    VSI+       K  DDDGR +RTG+VWTASAHIITAVIGSGVLS
Sbjct  1    MGENNNVASKHQV-FDVSINVTES---KCFDDDGRLKRTGSVWTASAHIITAVIGSGVLS  56

Query  303  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  482
            LAWA+ QLGW+AGP VM+LFS V YYTS LLADCYR+GD V GKRNYTYMDAV++NLGG 
Sbjct  57   LAWAVAQLGWIAGPIVMILFSFVTYYTSALLADCYRSGDSVSGKRNYTYMDAVQANLGGL  116

Query  483  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  662
            QVKICG IQY NLFG+AIGYTIA+SISM+AIKRSNCFH+ G + PC +SS PYM+ FGII
Sbjct  117  QVKICGWIQYANLFGVAIGYTIASSISMIAIKRSNCFHKHGDQAPCQVSSTPYMVMFGII  176

Query  663  EIILSQIPXFD  695
             II SQIP FD
Sbjct  177  AIIFSQIPDFD  187



>gb|AIL30502.1| amino acid transporter [Nicotiana tabacum]
Length=480

 Score =   270 bits (689),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 152/191 (80%), Gaps = 4/191 (2%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  302
            MGE+      H+    VSI+       K  DDDGR +RTG+VWTASAHIITAVIGSGVLS
Sbjct  1    MGENNNVASKHQV-FDVSINVTES---KCFDDDGRLKRTGSVWTASAHIITAVIGSGVLS  56

Query  303  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  482
            LAWA+ QLGW+AGP VM+LFS V YYTS LLADCYR+GD V GKRNYTYMDAV++NLGG 
Sbjct  57   LAWAVAQLGWIAGPIVMILFSFVTYYTSALLADCYRSGDSVSGKRNYTYMDAVQANLGGL  116

Query  483  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  662
            QVKICG IQY NLFG+AIGYTIA+SISM+AIKRSNCFH+ G + PC +SS PYM+ FGII
Sbjct  117  QVKICGWIQYANLFGVAIGYTIASSISMIAIKRSNCFHKHGDQAPCQVSSTPYMVMFGII  176

Query  663  EIILSQIPXFD  695
             II SQIP FD
Sbjct  177  AIIFSQIPDFD  187



>gb|AII99817.1| amino acid transporter [Nicotiana tabacum]
Length=479

 Score =   269 bits (688),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 156/194 (80%), Gaps = 9/194 (5%)
 Frame = +3

Query  117  MQMGESAAATKNHRHHLGVSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGSG  293
            M MG++     NH     VS +    YG  K  DDDGR +R+G+VWTASAHIITAVIGSG
Sbjct  1    MTMGDN-----NHHQVFDVSANG---YGESKCFDDDGRLKRSGSVWTASAHIITAVIGSG  52

Query  294  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  473
            VLSLAWA  QLGW+AGP+V+LLFS V YYTS LLADCYR+GD V GKRNYTYMDAVR+NL
Sbjct  53   VLSLAWATAQLGWIAGPTVLLLFSFVTYYTSALLADCYRSGDQVSGKRNYTYMDAVRANL  112

Query  474  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  653
            GG QVKICG+IQY NLFG+A+GYTIA+SISMMA+KRS+CFH+ G +  C++SS PYMI F
Sbjct  113  GGLQVKICGVIQYVNLFGVAVGYTIASSISMMAVKRSDCFHKHGHRAACNVSSTPYMIMF  172

Query  654  GIIEIILSQIPXFD  695
            GIIEII SQIP FD
Sbjct  173  GIIEIIFSQIPDFD  186



>gb|AFW56243.1| hypothetical protein ZEAMMB73_107595, partial [Zea mays]
Length=250

 Score =   262 bits (669),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = +3

Query  165  LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  344
            L VS++A      + LDDDGRP+RTGT WTASAHI+TAVIGSGVLSLAWAI QLGWVAGP
Sbjct  16   LEVSVEAGNGGAAEWLDDDGRPRRTGTFWTASAHIVTAVIGSGVLSLAWAIAQLGWVAGP  75

Query  345  SVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLF  524
            + MLLF+ V YYT+TLLA+CYR GDP  GKRNYTYMDAVRSNLGG +V  CG+IQY NL 
Sbjct  76   AAMLLFAFVTYYTATLLAECYRTGDPETGKRNYTYMDAVRSNLGGAKVAFCGVIQYANLV  135

Query  525  GIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            G+AIGYTIAASISM A++R+ CFH  G  +PC+ SS PYMI FG+++I+ SQIP FD
Sbjct  136  GVAIGYTIAASISMKAVRRAGCFHAHGHADPCNSSSTPYMILFGVVQILFSQIPDFD  192



>ref|NP_001234606.1| amino acid transporter [Solanum lycopersicum]
 gb|AAO13689.1|AF013280_1 amino acid transporter [Solanum lycopersicum]
Length=471

 Score =   269 bits (687),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = +3

Query  204  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  383
            K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGWVAGP+V+LLFS V YYT
Sbjct  16   KCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVLLLFSFVTYYT  75

Query  384  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  563
            S LL+DCYR GDPV GKRNYTYMDAVR+NLGG+QVKICG+IQY NLFG+AIGYTIA+SIS
Sbjct  76   SALLSDCYRTGDPVTGKRNYTYMDAVRANLGGFQVKICGVIQYANLFGVAIGYTIASSIS  135

Query  564  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            M+A+ RSNCFH+ G    C++SS PYMI FG++EII SQIP FD
Sbjct  136  MVAVNRSNCFHKQGHHAACNVSSTPYMIMFGVMEIIFSQIPDFD  179



>gb|KEH35328.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=479

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 149/184 (81%), Gaps = 2/184 (1%)
 Frame = +3

Query  144  TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  323
            +KNH     VSID       K  DDDGR +RTGT WTASAH+ITAV+GSGVLSL+WAI Q
Sbjct  7    SKNHHQTFDVSIDQQR--DSKYFDDDGRIKRTGTAWTASAHVITAVVGSGVLSLSWAIAQ  64

Query  324  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGL  503
            LGW+AGP VM+LF+ V YYTS LL +CYR  DP+ GKRNYTYMDAV SNLGG+QV +CG+
Sbjct  65   LGWIAGPIVMILFAWVTYYTSILLCECYRNDDPINGKRNYTYMDAVHSNLGGFQVTLCGI  124

Query  504  IQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  683
            +QY NL G AIGYTIA++ISMMAI+RSNCFH SGGK+PCHM+SN YMI+FG ++II SQI
Sbjct  125  VQYLNLAGAAIGYTIASAISMMAIERSNCFHRSGGKDPCHMNSNIYMISFGAVQIIFSQI  184

Query  684  PXFD  695
            P FD
Sbjct  185  PDFD  188



>ref|XP_006351135.1| PREDICTED: amino acid permease 3-like [Solanum tuberosum]
Length=479

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 155/192 (81%), Gaps = 6/192 (3%)
 Frame = +3

Query  123  MGESAA-ATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  299
            MG+S   A+K+    + V++        K  DDDGR +RTG+VWTASAHIITAVIGSGVL
Sbjct  1    MGDSTNFASKHQLFDVSVNVTES-----KRFDDDGRIKRTGSVWTASAHIITAVIGSGVL  55

Query  300  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  479
            SLAWA+ QLGW+AGP VMLLFS V YYTS+LL+DCYR+GDP+ GKRNYTYMDAV++NLGG
Sbjct  56   SLAWAVAQLGWIAGPIVMLLFSFVTYYTSSLLSDCYRSGDPLSGKRNYTYMDAVQANLGG  115

Query  480  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  659
             QVKICG IQY NLFG+AIGYTIA+SISMMA+KRS+CFH+ G K PC   + PYMI FG+
Sbjct  116  LQVKICGWIQYVNLFGVAIGYTIASSISMMAVKRSDCFHKHGHKAPCLEPNTPYMIIFGV  175

Query  660  IEIILSQIPXFD  695
            IEI+ SQIP FD
Sbjct  176  IEIVFSQIPDFD  187



>ref|XP_010322323.1| PREDICTED: amino acid transporter isoform X1 [Solanum lycopersicum]
Length=473

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = +3

Query  204  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  383
            K  DDDGR +RTG+VWTASAHIITAVIGSGVLSLAWA  QLGWVAGP+V+LLFS V YYT
Sbjct  18   KCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVLLLFSFVTYYT  77

Query  384  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  563
            S LL+DCYR GDPV GKRNYTYMDAVR+NLGG+QVKICG+IQY NLFG+AIGYTIA+SIS
Sbjct  78   SALLSDCYRTGDPVTGKRNYTYMDAVRANLGGFQVKICGVIQYANLFGVAIGYTIASSIS  137

Query  564  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            M+A+ RSNCFH+ G    C++SS PYMI FG++EII SQIP FD
Sbjct  138  MVAVNRSNCFHKQGHHAACNVSSTPYMIMFGVMEIIFSQIPDFD  181



>ref|XP_009404321.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404322.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  204  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  383
            K  DDDGR +RTGTVWTA+AHI+TAVIGSGVLSLAW I QLGWVAGP VM LFS V YYT
Sbjct  28   KSYDDDGRLKRTGTVWTATAHIVTAVIGSGVLSLAWTIAQLGWVAGPVVMFLFSFVTYYT  87

Query  384  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  563
            STLLADCYR+GDP+ GKRNY Y DAV + LGG +VK+CG IQY NLFG+AIGYTIAASIS
Sbjct  88   STLLADCYRSGDPINGKRNYNYTDAVHAYLGGLKVKLCGFIQYANLFGVAIGYTIAASIS  147

Query  564  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            MMAIKRS+CFHE G KNPC  SSNPYMI FG+ EI LSQIP FD
Sbjct  148  MMAIKRSDCFHEKGHKNPCLTSSNPYMIMFGVAEIFLSQIPDFD  191



>ref|XP_008368062.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=484

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 152/195 (78%), Gaps = 8/195 (4%)
 Frame = +3

Query  123  MGESAAATKNHRHH----LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGS  290
            M E+ A     + H      VS++     G K +DDDGRP+RTGTVWTAS+HIITA+IGS
Sbjct  1    MSENTATRNQLQLHYNPVFDVSLNVQG--GSKYIDDDGRPKRTGTVWTASSHIITAIIGS  58

Query  291  GVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSN  470
            GVLSLAWAI QLGW+AGP+ M +FS + YYTSTLLA CYR  DPV GKRNY+Y DAVRSN
Sbjct  59   GVLSLAWAIAQLGWIAGPAAMAIFSFITYYTSTLLASCYR--DPVTGKRNYSYSDAVRSN  116

Query  471  LGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIA  650
            LG + VK CG +Q  NLFGI IGYT+AASISMMAIKRSNCFH SGGK+PCH++ NPYMIA
Sbjct  117  LGEFLVKXCGFVQQLNLFGITIGYTVAASISMMAIKRSNCFHNSGGKDPCHINYNPYMIA  176

Query  651  FGIIEIILSQIPXFD  695
            FG  EIILSQIP FD
Sbjct  177  FGTSEIILSQIPNFD  191



>gb|KEH35330.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=480

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 148/184 (80%), Gaps = 2/184 (1%)
 Frame = +3

Query  144  TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  323
            + NH     VSID       K  DDDGR +RTGTVWTASAH+ITAV+GSGVLSLAWAI Q
Sbjct  7    STNHHQTFDVSIDQQR--DSKYFDDDGRVKRTGTVWTASAHVITAVVGSGVLSLAWAIAQ  64

Query  324  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGL  503
            LGW+AGP VM+LF+ V YYT+ LL +CYR  DP+ GKRNYTYMD V SNLGG+QV +CG+
Sbjct  65   LGWIAGPIVMILFAWVTYYTAILLCECYRNDDPINGKRNYTYMDVVHSNLGGFQVTLCGI  124

Query  504  IQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  683
            +QY NL G+AIGYTIA++ISMMAI+RSNCFH SGGK+PCHM SN YMI+FG ++II SQI
Sbjct  125  VQYLNLVGVAIGYTIASAISMMAIERSNCFHRSGGKDPCHMKSNIYMISFGAVQIIFSQI  184

Query  684  PXFD  695
            P FD
Sbjct  185  PDFD  188



>ref|XP_004503904.1| PREDICTED: amino acid permease 2-like [Cicer arietinum]
Length=486

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  204  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  383
            K  DDDGR +RTG+VWTAS+HIITAVIGSGVLSLAWAI QLGW+AGP+VM+LFS V  YT
Sbjct  33   KSYDDDGRLKRTGSVWTASSHIITAVIGSGVLSLAWAIAQLGWIAGPAVMILFSMVTIYT  92

Query  384  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  563
            S+ LADCYR+GD   GKRNYTYMDAVRS LGG  V  CG+ QY NLFGI IGYTIAASIS
Sbjct  93   SSFLADCYRSGDLNSGKRNYTYMDAVRSILGGVNVTFCGIFQYLNLFGIVIGYTIAASIS  152

Query  564  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            M AIKRSNCFH+SGGKNPCHMSSN YMI FGI EI LSQIP FD
Sbjct  153  MTAIKRSNCFHQSGGKNPCHMSSNQYMIIFGITEIFLSQIPDFD  196



>ref|XP_002278086.1| PREDICTED: amino acid permease 3 [Vitis vinifera]
 emb|CBI37884.3| unnamed protein product [Vitis vinifera]
Length=512

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 154/194 (79%), Gaps = 12/194 (6%)
 Frame = +3

Query  147  KNHRHHLGVSIDAPPLYG-----------FKGLDDDGRPQRTGTVWTASAHIITAVIGSG  293
            ++ RH+L V +   P +G            K  DDDGR +RTGT WTAS+HIITAVIGSG
Sbjct  21   QDIRHYLQVEVQPKP-HGESEAINPQANYSKCFDDDGRLKRTGTFWTASSHIITAVIGSG  79

Query  294  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  473
            VLSLAWAIGQLGWVAGP VM+LF+ V  Y+S LLA CYR+GDP+ G+RNYTYM+AV++NL
Sbjct  80   VLSLAWAIGQLGWVAGPIVMILFAFVNLYSSNLLAQCYRSGDPLTGQRNYTYMEAVKANL  139

Query  474  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  653
            GG +V  CG IQY NLFG AIGYTIAAS+SMMAIKRSNCFH+SGGK+PCHMSSN YMI F
Sbjct  140  GGKKVLACGWIQYLNLFGTAIGYTIAASVSMMAIKRSNCFHKSGGKDPCHMSSNGYMITF  199

Query  654  GIIEIILSQIPXFD  695
            GIIEII SQIP FD
Sbjct  200  GIIEIIFSQIPDFD  213



>ref|XP_007198986.1| hypothetical protein PRUPE_ppa020916mg [Prunus persica]
 gb|EMJ00185.1| hypothetical protein PRUPE_ppa020916mg [Prunus persica]
Length=511

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 156/197 (79%), Gaps = 11/197 (6%)
 Frame = +3

Query  138  AATKNH--RHHLGVSIDA---------PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVI  284
            A  + H  RH+L V +           P     K  DDDGR +RTG  WT+++HIITAVI
Sbjct  16   AVEERHDIRHYLQVEVQPKVTESEAINPQSSYSKCFDDDGRLKRTGNFWTSASHIITAVI  75

Query  285  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVR  464
            GSGVLSLAWAI QLGWVAGPSV+LLF+ V  YTS LLA CYR+GDPV G+RNYTYMDA++
Sbjct  76   GSGVLSLAWAIAQLGWVAGPSVLLLFALVNLYTSNLLAMCYRSGDPVTGQRNYTYMDAIK  135

Query  465  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  644
            +NLGG +V +CGL+QYFNLFG+AIGYTIA+S+SMMAIKRSNC+H+SGGK+PCHMSSN YM
Sbjct  136  ANLGGRKVMLCGLVQYFNLFGVAIGYTIASSVSMMAIKRSNCYHKSGGKDPCHMSSNGYM  195

Query  645  IAFGIIEIILSQIPXFD  695
            I FGIIE+I SQIP F+
Sbjct  196  ITFGIIEVIFSQIPDFN  212



>ref|XP_003542145.1| PREDICTED: amino acid permease 3 isoform X1 [Glycine max]
 ref|XP_006593825.1| PREDICTED: amino acid permease 3 isoform X2 [Glycine max]
 ref|XP_006593826.1| PREDICTED: amino acid permease 3 isoform X3 [Glycine max]
 gb|KHN05187.1| Amino acid permease 2 [Glycine soja]
Length=479

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = +3

Query  156  RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  335
            +    VS D     G K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWAI QLGW+
Sbjct  7    KQTFEVSNDTLQRVGSKSFDDDGRLKRTGTIWTASAHIITAVIGSGVLSLAWAIAQLGWI  66

Query  336  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYF  515
            AGP VM+LFS V YYTSTLLA CYR+GD + GKRNYTY  AVRS LGG+ VK CG +QY 
Sbjct  67   AGPVVMILFSIVTYYTSTLLATCYRSGDQLSGKRNYTYTQAVRSYLGGFSVKFCGWVQYA  126

Query  516  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXF  692
            NLFG+AIGYTIAASISMMAIKRSNC+H SGGKNPC M+SN YMI++G+ EII SQIP F
Sbjct  127  NLFGVAIGYTIAASISMMAIKRSNCYHSSGGKNPCKMNSNWYMISYGVSEIIFSQIPDF  185



>ref|XP_009767545.1| PREDICTED: amino acid permease 3-like [Nicotiana sylvestris]
Length=480

 Score =   268 bits (684),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 156/194 (80%), Gaps = 9/194 (5%)
 Frame = +3

Query  117  MQMGESAAATKNHRHHLGVSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGSG  293
            M MG++     NH     VS +    YG  K  DDDGR +R+G+VWTASAHIITAVIGSG
Sbjct  1    MTMGDN-----NHHQVFDVSANG---YGESKCFDDDGRLKRSGSVWTASAHIITAVIGSG  52

Query  294  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  473
            VLSLAWA  QLGWVAGP+V+LLFS V YYTS LLADCYR+GD V GKRNYTYMDAVR+NL
Sbjct  53   VLSLAWATAQLGWVAGPAVLLLFSFVTYYTSALLADCYRSGDQVSGKRNYTYMDAVRANL  112

Query  474  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  653
            GG QVKICG+IQY NLFG+A+GYTIA+SISMMA+KRS+CFH+ G +  C++SS PYMI F
Sbjct  113  GGLQVKICGVIQYVNLFGVAVGYTIASSISMMAVKRSDCFHKHGHRAACNVSSTPYMIMF  172

Query  654  GIIEIILSQIPXFD  695
            G++EI+ SQIP FD
Sbjct  173  GVMEILFSQIPDFD  186



>ref|XP_009596720.1| PREDICTED: amino acid permease 3-like isoform X1 [Nicotiana tomentosiformis]
Length=480

 Score =   268 bits (684),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 156/194 (80%), Gaps = 9/194 (5%)
 Frame = +3

Query  117  MQMGESAAATKNHRHHLGVSIDAPPLYG-FKGLDDDGRPQRTGTVWTASAHIITAVIGSG  293
            M MG++     NH     VS +    YG  K  DDDGR +R+G+VWTASAHIITAVIGSG
Sbjct  1    MTMGDN-----NHHQVFDVSANG---YGESKCFDDDGRLKRSGSVWTASAHIITAVIGSG  52

Query  294  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  473
            VLSLAWA  QLGW+AGP+V+LLFS V YYTS LLADCYR+GD V GKRNYTYMDAVR+NL
Sbjct  53   VLSLAWATAQLGWIAGPTVLLLFSFVTYYTSALLADCYRSGDQVSGKRNYTYMDAVRANL  112

Query  474  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  653
            GG QVKICG+IQY NLFG+A+GYTIA+SISMMA+KRS+CFH+ G +  C++SS PYMI F
Sbjct  113  GGLQVKICGVIQYVNLFGVAVGYTIASSISMMAVKRSDCFHKHGHRAACNVSSTPYMIMF  172

Query  654  GIIEIILSQIPXFD  695
            GI+EI+ SQIP FD
Sbjct  173  GIMEILFSQIPDFD  186



>ref|XP_009596721.1| PREDICTED: amino acid permease 3-like isoform X2 [Nicotiana tomentosiformis]
Length=478

 Score =   267 bits (683),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +3

Query  150  NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  329
            ++ HH    + A      K  DDDGR +R+G+VWTASAHIITAVIGSGVLSLAWA  QLG
Sbjct  3    DNNHHQVFDVSANGYGESKCFDDDGRLKRSGSVWTASAHIITAVIGSGVLSLAWATAQLG  62

Query  330  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQ  509
            W+AGP+V+LLFS V YYTS LLADCYR+GD V GKRNYTYMDAVR+NLGG QVKICG+IQ
Sbjct  63   WIAGPTVLLLFSFVTYYTSALLADCYRSGDQVSGKRNYTYMDAVRANLGGLQVKICGVIQ  122

Query  510  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPX  689
            Y NLFG+A+GYTIA+SISMMA+KRS+CFH+ G +  C++SS PYMI FGI+EI+ SQIP 
Sbjct  123  YVNLFGVAVGYTIASSISMMAVKRSDCFHKHGHRAACNVSSTPYMIMFGIMEILFSQIPD  182

Query  690  FD  695
            FD
Sbjct  183  FD  184



>ref|NP_001233979.1| amino acid transporter [Solanum lycopersicum]
 gb|AAO13687.1|AF013278_1 amino acid transporter [Solanum lycopersicum]
Length=476

 Score =   266 bits (681),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 149/180 (83%), Gaps = 5/180 (3%)
 Frame = +3

Query  156  RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  335
            +H + ++I    L+     DDDGR +R+G+VWTASAHIITAVIGSGVLSLAWA+ QLGW+
Sbjct  10   KHPVSINITESKLF-----DDDGRIKRSGSVWTASAHIITAVIGSGVLSLAWAVAQLGWI  64

Query  336  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYF  515
            AGP VMLLFS V YYTS+LL+DCYR+GDP+FGKRNYTYMD V++NL G QVKICG IQY 
Sbjct  65   AGPIVMLLFSFVTYYTSSLLSDCYRSGDPLFGKRNYTYMDVVQANLSGLQVKICGWIQYV  124

Query  516  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            NLFG+AIGYTIA+SIS+MA+KRS+CFH+ G K PC   + PYMI FG+IEII SQIP FD
Sbjct  125  NLFGVAIGYTIASSISLMAVKRSDCFHKHGHKAPCLQPNTPYMIIFGVIEIIFSQIPDFD  184



>gb|EYU37943.1| hypothetical protein MIMGU_mgv1a004721mg [Erythranthe guttata]
Length=513

 Score =   267 bits (683),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 153/194 (79%), Gaps = 11/194 (6%)
 Frame = +3

Query  147  KNHRHHLGVSIDAPPLYGF-----------KGLDDDGRPQRTGTVWTASAHIITAVIGSG  293
            ++ RH+L V     P               K  DDDGR +RTGT+WTA++HIITAVIGSG
Sbjct  21   QDVRHYLQVETQPKPQETESRAINLQENYSKCFDDDGRLKRTGTLWTATSHIITAVIGSG  80

Query  294  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  473
            VLSLAWA+GQLGWVAGP VM+LF+ V  YTS LL+ CYR+GDPV G+RNYTYMDAV++NL
Sbjct  81   VLSLAWAVGQLGWVAGPIVMILFAFVNLYTSDLLSKCYRSGDPVVGQRNYTYMDAVKANL  140

Query  474  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  653
            GG +VKICGLIQY NLFG+AIGYTIAAS+SM+AIKRSNCFH++  K+ CHMSSN YMI F
Sbjct  141  GGVKVKICGLIQYINLFGVAIGYTIAASVSMLAIKRSNCFHKTHKKSRCHMSSNGYMITF  200

Query  654  GIIEIILSQIPXFD  695
            GIIEI+ SQIP FD
Sbjct  201  GIIEILFSQIPDFD  214



>ref|XP_009388107.1| PREDICTED: amino acid permease 3-like [Musa acuminata subsp. 
malaccensis]
Length=471

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = +3

Query  204  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  383
            K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  MLLFS V YYT
Sbjct  15   KCFDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPIAMLLFSFVTYYT  74

Query  384  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  563
            S LLADCYR+GDP  GKRNYTYMD VR+NL G++VK+CG +QY N+ G+AIGYTIAASIS
Sbjct  75   SALLADCYRSGDPNTGKRNYTYMDTVRANLDGFKVKLCGYLQYLNIVGVAIGYTIAASIS  134

Query  564  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            M+AI+RSNCFH++G  +PC ++SNPYMI FG+ EII SQIP FD
Sbjct  135  MVAIERSNCFHKNGDDSPCQVNSNPYMIMFGVAEIIFSQIPDFD  178



>ref|XP_011046334.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
 ref|XP_011046342.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=511

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 149/189 (79%), Gaps = 9/189 (5%)
 Frame = +3

Query  156  RHHLGVSIDA---------PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLA  308
            RH+L V +           P     K  DDDGR +RTG  WT+S+HIITAVIGSGVLSLA
Sbjct  24   RHYLEVEVQPKVSESEAINPQSNYSKCFDDDGRLKRTGNFWTSSSHIITAVIGSGVLSLA  83

Query  309  WAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQV  488
            WAI QLGWVAGP+VM+LF+ V  YTS LLA CYR+GDPV G+RNYTYMDAV+S LGG +V
Sbjct  84   WAIAQLGWVAGPAVMVLFAFVNLYTSNLLAQCYRSGDPVTGQRNYTYMDAVKSYLGGRKV  143

Query  489  KICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEI  668
             +CGLIQY NLFG+AIGYTIAAS+SMMAIKRSNCFH SGGK+PCHMS N +MI FGIIEI
Sbjct  144  MLCGLIQYLNLFGVAIGYTIAASVSMMAIKRSNCFHSSGGKDPCHMSCNGFMITFGIIEI  203

Query  669  ILSQIPXFD  695
            + SQIP FD
Sbjct  204  LFSQIPDFD  212



>ref|XP_009145052.1| PREDICTED: amino acid permease 5 [Brassica rapa]
 ref|XP_009145053.1| PREDICTED: amino acid permease 5 [Brassica rapa]
 ref|XP_009145054.1| PREDICTED: amino acid permease 5 [Brassica rapa]
 emb|CDY43854.1| BnaA05g18660D [Brassica napus]
Length=487

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +3

Query  165  LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  344
            LGVS+D  P       D+DGRP+RTGTVWTASAHIITAVIGSGVLSLAWA+ Q+GWV GP
Sbjct  11   LGVSMDVLPRNSSDLFDEDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIGWVGGP  70

Query  345  SVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLF  524
            +VM+LFS V YYTS LL  CYR+GD V GKRNYTYMDA+ SNLGG +VKICG++QY NLF
Sbjct  71   AVMILFSLVTYYTSILLCTCYRSGDSVTGKRNYTYMDAIHSNLGGIKVKICGVVQYVNLF  130

Query  525  GIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            G AIGYTIA+++SM+AI+R++C   +G K+PCH++ NPYMIAFG+I+I+ SQIP FD
Sbjct  131  GTAIGYTIASAVSMIAIQRTSCQQSNGDKDPCHVNGNPYMIAFGVIQIVFSQIPDFD  187



>ref|XP_007224395.1| hypothetical protein PRUPE_ppa021701mg [Prunus persica]
 gb|EMJ25594.1| hypothetical protein PRUPE_ppa021701mg [Prunus persica]
Length=483

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 152/194 (78%), Gaps = 7/194 (4%)
 Frame = +3

Query  123  MGESAAATKNHRHH---LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  293
            MG+         HH     VS++     G K +DDDGRP+RTGTVWT+SAHIITAVIGSG
Sbjct  1    MGDHTTTRNLQLHHNPVFDVSLNVRG--GSKYIDDDGRPKRTGTVWTSSAHIITAVIGSG  58

Query  294  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  473
            VLSLAWAI QLGW+AGP VM+LFS + YYTSTLLA CYR  DPV GKRNYTY DAVRSNL
Sbjct  59   VLSLAWAIAQLGWIAGPVVMVLFSFITYYTSTLLAACYR--DPVTGKRNYTYSDAVRSNL  116

Query  474  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  653
            G  QVK C  +Q   L G+ IGYTIAA+ISM+AIKRSNC+H+SGGKNPCH+++NPYMIAF
Sbjct  117  GELQVKFCASVQNVVLIGVTIGYTIAAAISMVAIKRSNCYHKSGGKNPCHINNNPYMIAF  176

Query  654  GIIEIILSQIPXFD  695
            GI EI+LSQIP FD
Sbjct  177  GISEIVLSQIPNFD  190



>ref|XP_006646758.1| PREDICTED: amino acid permease 3-like [Oryza brachyantha]
Length=508

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 141/162 (87%), Gaps = 1/162 (1%)
 Frame = +3

Query  213  DDDGR-PQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTST  389
            DDDGR P+RTGTVWTA++HIITAVIGSGVLSLAWAI QLGWV GP+VMLLF+ V+Y+TS 
Sbjct  48   DDDGRAPRRTGTVWTAASHIITAVIGSGVLSLAWAIAQLGWVVGPAVMLLFALVIYFTSN  107

Query  390  LLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMM  569
            LLADCYR GDP  G+RNYTYMDAV++NLGG +VK+CG IQY NL G+AIGYTIAASISMM
Sbjct  108  LLADCYRTGDPATGRRNYTYMDAVKANLGGAKVKVCGCIQYLNLLGVAIGYTIAASISMM  167

Query  570  AIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            A++RSNCFH  G K+PCH SSN YMI FGI+++  SQIP FD
Sbjct  168  AMERSNCFHAKGAKDPCHASSNVYMIVFGIVQVFFSQIPDFD  209



>ref|XP_008219720.1| PREDICTED: amino acid permease 3-like [Prunus mume]
Length=483

 Score =   264 bits (675),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 154/193 (80%), Gaps = 5/193 (3%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDAPPLY--GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            MG+    T+N + H     D   +   G K +DDDGRP+RTGTVWT+SAHIITAVIGSGV
Sbjct  1    MGDHTT-TRNLQLHHNPVFDVSLIVQGGSKYIDDDGRPKRTGTVWTSSAHIITAVIGSGV  59

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWA+ QLGW+AGP VM++FS + YYTSTLLA CYR  DPV GKRNYTY DAVRSNLG
Sbjct  60   LSLAWAVAQLGWIAGPVVMVMFSFITYYTSTLLAACYR--DPVTGKRNYTYSDAVRSNLG  117

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
              QVK CG +Q   L G+ IGYTIAA+ISM+AIKRSNC+H+SGGKNPCH+++NPYMIAFG
Sbjct  118  ELQVKFCGSVQNVVLTGVTIGYTIAAAISMVAIKRSNCYHKSGGKNPCHINNNPYMIAFG  177

Query  657  IIEIILSQIPXFD  695
            I EI+LSQIP FD
Sbjct  178  ISEILLSQIPNFD  190



>ref|XP_004289864.1| PREDICTED: amino acid permease 4-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   265 bits (676),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 154/197 (78%), Gaps = 11/197 (6%)
 Frame = +3

Query  138  AATKNH--RHHLGVSIDA---------PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVI  284
            A  + H  RH+L V +           P     K  DDDGR +RTGT WT+++HIITAVI
Sbjct  16   AVEERHDVRHYLQVEVQPKVGESEAINPQSNYSKCFDDDGRLKRTGTFWTSTSHIITAVI  75

Query  285  GSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVR  464
            GSGVLSLAWAI QLGWVAGP+V+ LF+ V  YTS LLA CYRAGDPV G+RNYTYMDAV+
Sbjct  76   GSGVLSLAWAIAQLGWVAGPTVLALFAIVNLYTSNLLAMCYRAGDPVTGQRNYTYMDAVK  135

Query  465  SNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYM  644
            +NLGG +V +CGL+QY NLFG+AIGYTIA+S+SMMAIKRSNC+H+SGGK+PCHMSSN YM
Sbjct  136  ANLGGRRVMLCGLVQYLNLFGVAIGYTIASSVSMMAIKRSNCYHKSGGKDPCHMSSNGYM  195

Query  645  IAFGIIEIILSQIPXFD  695
            I FGIIE+I SQI  F+
Sbjct  196  ITFGIIEVIFSQIKDFN  212



>gb|EEC68963.1| hypothetical protein OsI_37697 [Oryza sativa Indica Group]
Length=482

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 149/192 (78%), Gaps = 0/192 (0%)
 Frame = +3

Query  120  QMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVL  299
             M     A +     + VS++A        LDDDGR +RTGT WTASAHIITAVIGSGVL
Sbjct  3    DMASGQKAKQQVMKPMEVSVEAGNAGDAAWLDDDGRARRTGTFWTASAHIITAVIGSGVL  62

Query  300  SLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGG  479
            SLAWAI QLGWVAGP+VMLLF+ V+YYTSTLLA+CYR GDP  GKRNYTYMDAVR+NLGG
Sbjct  63   SLAWAIAQLGWVAGPAVMLLFAFVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANLGG  122

Query  480  YQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGI  659
             +V  CG+IQY NL G+AIGYTIA+SISM AI+R+ CFH +G  +PC  SSNPYMI FG+
Sbjct  123  AKVTFCGVIQYANLVGVAIGYTIASSISMRAIRRAGCFHHNGHGDPCRSSSNPYMILFGV  182

Query  660  IEIILSQIPXFD  695
            ++I+ SQIP FD
Sbjct  183  VQIVFSQIPDFD  194



>gb|KJB15783.1| hypothetical protein B456_002G196200 [Gossypium raimondii]
Length=512

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = +3

Query  204  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  383
            K  DDDGR +RTGT WTA++HIITAVIGSGVLSLAWAI QLGWVAGP+V++LF+ V  YT
Sbjct  50   KCFDDDGRLKRTGTFWTATSHIITAVIGSGVLSLAWAIAQLGWVAGPTVLVLFAFVNLYT  109

Query  384  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  563
            S LLA+CYR+GD V G+RNYTYM+AV+++LGG++VK+CG IQY NLFG+AIGYTIAAS+S
Sbjct  110  SNLLAECYRSGDLVTGQRNYTYMEAVKAHLGGWKVKLCGWIQYLNLFGVAIGYTIAASVS  169

Query  564  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            MMAIKRSNCFH+SGGK+PCHMSSN YMI+FGI E+I SQIP F 
Sbjct  170  MMAIKRSNCFHKSGGKDPCHMSSNGYMISFGIAEVIFSQIPNFS  213



>ref|XP_004977213.1| PREDICTED: amino acid permease 3-like [Setaria italica]
Length=477

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = +3

Query  150  NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  329
            NH   + VS++A      + LDDDGRP+RTGT WTAS+HIITAVIGSGVLSLAWAI QLG
Sbjct  8    NHVAPMEVSVEAGNAGAAEWLDDDGRPRRTGTFWTASSHIITAVIGSGVLSLAWAIAQLG  67

Query  330  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQ  509
            WVAGP+ MLLF+ V YYT+TLLA+CYR GDP  GKRNYTYMDAVRSNLGG +V  CG+IQ
Sbjct  68   WVAGPAAMLLFAFVTYYTATLLAECYRTGDPETGKRNYTYMDAVRSNLGGAKVVFCGVIQ  127

Query  510  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPX  689
            Y NL G+AIGYTIA+SISM AI+R++CFH +G  +PC  SS PYMI FG+++I+ SQIP 
Sbjct  128  YANLVGVAIGYTIASSISMRAIRRADCFHTNGHADPCKSSSTPYMILFGVVQILFSQIPD  187

Query  690  FD  695
            FD
Sbjct  188  FD  189



>ref|XP_006422618.1| hypothetical protein CICLE_v10028230mg [Citrus clementina]
 gb|ESR35858.1| hypothetical protein CICLE_v10028230mg [Citrus clementina]
Length=512

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = +3

Query  156  RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  335
            + H+      P        DDDGR +RTG  WT S+HIITAVIGSGVLSLAWAI QLGWV
Sbjct  34   KAHIETEATNPQANYSNCFDDDGRLKRTGNFWTTSSHIITAVIGSGVLSLAWAIAQLGWV  93

Query  336  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYF  515
            AGP+V++LF+ V  YT+ LL+ CYR+GDPV G+RNYTYMDAV++NLGG +V  CGLIQY 
Sbjct  94   AGPTVLILFALVNLYTANLLSQCYRSGDPVTGQRNYTYMDAVKANLGGKKVIFCGLIQYL  153

Query  516  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            NLFG+AIGYTIAAS+SMMAIKRSNCF +SGGK+PCHMSSN YMI FGIIE++ SQIP FD
Sbjct  154  NLFGVAIGYTIAASVSMMAIKRSNCFQKSGGKDPCHMSSNGYMITFGIIEVLFSQIPDFD  213



>ref|XP_003578826.1| PREDICTED: amino acid permease 3-like [Brachypodium distachyon]
Length=479

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +3

Query  138  AATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  317
            AA K     + VS++A        LDDDGRP+R+GT WTASAHIITAVIGSGVLSLAWAI
Sbjct  2    AAGKKLVSPMEVSVEAGNADQASWLDDDGRPRRSGTFWTASAHIITAVIGSGVLSLAWAI  61

Query  318  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKIC  497
             QLGWVAGP+VMLLF+ V+YYTSTLLA+CYR GDP  GKRNYTYMDAVR+NLGG +V  C
Sbjct  62   AQLGWVAGPAVMLLFAAVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANLGGGRVVFC  121

Query  498  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  677
            G+IQY NL G+AIGYTIA+SISM AI+R+ CFH +G   PC  SSNPYMI FG+++I+ S
Sbjct  122  GVIQYANLVGVAIGYTIASSISMRAIRRAGCFHANGHGVPCKSSSNPYMILFGLVQIVFS  181

Query  678  QIPXFD  695
            QIP FD
Sbjct  182  QIPDFD  187



>gb|KDO68035.1| hypothetical protein CISIN_1g010376mg [Citrus sinensis]
Length=512

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = +3

Query  156  RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  335
            + H+      P        DDDGR +RTG  WT S+HIITAVIGSGVLSLAWAI QLGWV
Sbjct  34   KAHIETEATNPQANYSNCFDDDGRLKRTGNFWTTSSHIITAVIGSGVLSLAWAIAQLGWV  93

Query  336  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYF  515
            AGP+V++LF+ V  YT+ LL+ CYR+GDPV G+RNYTYMDAV++NLGG +V  CGLIQY 
Sbjct  94   AGPTVLILFALVNLYTANLLSQCYRSGDPVTGQRNYTYMDAVKANLGGKKVIFCGLIQYL  153

Query  516  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            NLFG+AIGYTIAAS+SMMAIKRSNCF +SGGK+PCHMSSN YMI FGIIE++ SQIP FD
Sbjct  154  NLFGVAIGYTIAASVSMMAIKRSNCFQKSGGKDPCHMSSNGYMITFGIIEVLFSQIPDFD  213



>emb|CDY36017.1| BnaA08g04440D [Brassica napus]
Length=481

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = +3

Query  150  NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  329
             +R  LG+SID  P       D+DGR +RTGTVWTASAHIITAVIGSGVLSLAWA+ Q+G
Sbjct  6    KNRQELGISIDVLPRNSSDLFDEDGRVKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIG  65

Query  330  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQ  509
            WV GP VM+LFS V YYTS LL  CYR+GD V GKRNYTYMDA+ SNLGG +VK+CG++Q
Sbjct  66   WVGGPVVMILFSLVTYYTSILLCACYRSGDSVTGKRNYTYMDAIHSNLGGIKVKLCGVVQ  125

Query  510  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPX  689
            Y NLFG AIGYTIA++ISM+AI+R++C   +G K+PCH++ NPYMIAFG I+II SQIP 
Sbjct  126  YVNLFGTAIGYTIASAISMIAIQRTSCQQSNGDKDPCHVNGNPYMIAFGAIQIIFSQIPD  185

Query  690  FD  695
            FD
Sbjct  186  FD  187



>ref|XP_006486755.1| PREDICTED: amino acid permease 3-like [Citrus sinensis]
Length=512

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = +3

Query  156  RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  335
            + H+      P        DDDGR +RTG  WT S+HIITAVIGSGVLSLAWAI QLGWV
Sbjct  34   KAHIETEATNPQANYSNCFDDDGRLKRTGNFWTTSSHIITAVIGSGVLSLAWAIAQLGWV  93

Query  336  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYF  515
            AGP+V++LF+ V  YT+ LL+ CYR+GDPV G+RNYTYMDAV++NLGG +V  CGLIQY 
Sbjct  94   AGPTVLILFALVNLYTANLLSQCYRSGDPVTGQRNYTYMDAVKANLGGKKVIFCGLIQYL  153

Query  516  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            NLFG+AIGYTIAAS+SMMAIKRSNCF +SGGK+PCHMSSN YMI FGIIE++ SQIP FD
Sbjct  154  NLFGVAIGYTIAASVSMMAIKRSNCFQKSGGKDPCHMSSNGYMITFGIIEVLFSQIPDFD  213



>ref|XP_004977210.1| PREDICTED: amino acid permease 3-like [Setaria italica]
Length=480

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 149/185 (81%), Gaps = 3/185 (2%)
 Frame = +3

Query  150  NHRHHLG---VSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIG  320
            N+ H +    VS++A      + LDDDGRP+RTGT WTASAHIITAVIGSGVLSLAWAI 
Sbjct  8    NNMHEVAPMEVSVEAGNFQDAERLDDDGRPRRTGTFWTASAHIITAVIGSGVLSLAWAIA  67

Query  321  QLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICG  500
            QLGWVAGP+ MLLF+ V YYT+TLLA+CYR GDP  GKRNYTYMDAVRSNLGG +V  CG
Sbjct  68   QLGWVAGPAAMLLFAFVTYYTATLLAECYRTGDPETGKRNYTYMDAVRSNLGGAKVVFCG  127

Query  501  LIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQ  680
            +IQY NL G+AIGYTIA+SISM AI+R++CFH +G  +PC  SS PYMI FG+++I+ SQ
Sbjct  128  VIQYANLVGVAIGYTIASSISMRAIRRADCFHTNGHADPCKSSSTPYMILFGVVQILFSQ  187

Query  681  IPXFD  695
            IP FD
Sbjct  188  IPDFD  192



>dbj|BAK02045.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91867.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = +3

Query  210  LDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTST  389
            +DDDGRP+R+GT WTASAHIITAVIGSGVLSLAWAI QLGWVAGP+VMLLF+ V+YYTST
Sbjct  30   MDDDGRPRRSGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMLLFAAVIYYTST  89

Query  390  LLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMM  569
            LLA+CYR GDP  GKRNYTYMDAVRSNLGG +V  CG+IQY NL G+AIGYTIA+SISM 
Sbjct  90   LLAECYRTGDPATGKRNYTYMDAVRSNLGGPKVIFCGVIQYANLVGVAIGYTIASSISMR  149

Query  570  AIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            AI+R++CFH +G  +PC  SSNPYMI FG+++I+ SQIP FD
Sbjct  150  AIRRADCFHANGHADPCKSSSNPYMILFGLVQIVFSQIPDFD  191



>ref|XP_008442267.1| PREDICTED: amino acid permease 4-like [Cucumis melo]
Length=466

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +3

Query  189  PLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSC  368
            P+     LDDDG P+RTGT WTASAHIIT VIGSGVLSLAWAI QLGW+ GPSVMLLF+ 
Sbjct  5    PVNDSASLDDDGHPKRTGTFWTASAHIITTVIGSGVLSLAWAIAQLGWIVGPSVMLLFAF  64

Query  369  VVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTI  548
            + YYTS LLADCYR+GDP+ GKRN+TYM AVRS LG   +  CG++Q  NL GI IGYTI
Sbjct  65   IGYYTSCLLADCYRSGDPLNGKRNHTYMHAVRSLLGEAHMVACGVMQNINLIGITIGYTI  124

Query  549  AASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            A+SISMMAIKRSNCFH SGGKNPCH+SSNP+M++FG++EIILSQIP FD
Sbjct  125  ASSISMMAIKRSNCFHSSGGKNPCHISSNPFMVSFGVLEIILSQIPNFD  173



>ref|XP_003578825.1| PREDICTED: amino acid permease 4-like [Brachypodium distachyon]
Length=479

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +3

Query  138  AATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAI  317
            AA K     + VS++A        LDDDGRP+R+GT WTASAHIITAVIGSGVLSLAWAI
Sbjct  2    AAGKKLVSPMEVSVEAGNADQASWLDDDGRPRRSGTFWTASAHIITAVIGSGVLSLAWAI  61

Query  318  GQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKIC  497
             QLGWVAGP+VMLLF+ V+YYTSTLLA+CYR GDP  GKRNYTYMDAVR+NLGG +V  C
Sbjct  62   AQLGWVAGPAVMLLFAAVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANLGGGRVVFC  121

Query  498  GLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILS  677
            G+IQY NL G+AIGYTIA+SISM AI+R+ CFH +G   PC  SSNPYMI FG+++I+ S
Sbjct  122  GVIQYANLVGVAIGYTIASSISMRAIRRAGCFHANGHGVPCKSSSNPYMILFGLVQIVFS  181

Query  678  QIPXFD  695
            QIP FD
Sbjct  182  QIPDFD  187



>ref|XP_004977211.1| PREDICTED: amino acid permease 3-like [Setaria italica]
Length=477

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = +3

Query  150  NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  329
             H   + VS++A      + LDDDGRP+RTGTVWTASAHIITAVIGSGVLSLAWAI QLG
Sbjct  8    KHVAPMEVSVEAGNGGAAEWLDDDGRPRRTGTVWTASAHIITAVIGSGVLSLAWAIAQLG  67

Query  330  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQ  509
            WVAGP+ MLLF+ V YYT+TLLA+CYR GDP  GKRNYTYMDAVRSNLGG +V  CG+IQ
Sbjct  68   WVAGPAAMLLFAFVTYYTATLLAECYRTGDPDTGKRNYTYMDAVRSNLGGAKVAFCGIIQ  127

Query  510  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPX  689
            Y NL G+AIGYTIA+SISM AI+R+ CFH++G   PC  SSNPYMI FGI +I+ SQIP 
Sbjct  128  YANLVGVAIGYTIASSISMQAIRRAGCFHKNGHGVPCKSSSNPYMILFGITQILFSQIPD  187

Query  690  FD  695
            FD
Sbjct  188  FD  189



>gb|KHG27248.1| Amino acid permease 3 -like protein [Gossypium arboreum]
Length=468

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 145/191 (76%), Gaps = 16/191 (8%)
 Frame = +3

Query  123  MGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLS  302
            MGE  A  KNH H+  +  D P      G DDDGR +RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGEKGAV-KNHLHN-NLVFDHP-----IGFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  53

Query  303  LAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGY  482
            LAWA  QLGW+A P+VM LFS V  YTSTLLA CYR  DPV GKRNYTYMDA        
Sbjct  54   LAWATAQLGWIASPAVMFLFSFVTDYTSTLLAACYRCDDPVNGKRNYTYMDA--------  105

Query  483  QVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGII  662
             VKICG +QY NLFG+AIGYTIA+SISMMAIKRSNCFH S GKNPCHM+SNPYMI FGI 
Sbjct  106  -VKICGWVQYLNLFGVAIGYTIASSISMMAIKRSNCFHASRGKNPCHMNSNPYMIGFGIA  164

Query  663  EIILSQIPXFD  695
            EII SQIP FD
Sbjct  165  EIIFSQIPDFD  175



>ref|XP_009339433.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
Length=484

 Score =   263 bits (671),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 155/198 (78%), Gaps = 14/198 (7%)
 Frame = +3

Query  123  MGESAAATKNHR--HH-----LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAV  281
            M E+ A T+N    HH     + +++D     G K +DDDGRP+RTGTVWTAS+HIITAV
Sbjct  1    MSENTA-TRNQLQLHHNPVFDVSLNVDG----GSKYIDDDGRPKRTGTVWTASSHIITAV  55

Query  282  IGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAV  461
            IGSGVLSLAWAI QLGW+AGP+ M +FS + YYTSTLL  CYR  DPV GKRNY+Y DAV
Sbjct  56   IGSGVLSLAWAIAQLGWIAGPAAMAIFSFITYYTSTLLTSCYR--DPVTGKRNYSYSDAV  113

Query  462  RSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPY  641
            +S LG +QVK+CG +Q  NLFGI IGYT+AA+ISMMAIKRSN FH SGGK+PCH++ NPY
Sbjct  114  QSTLGEFQVKMCGFVQQLNLFGITIGYTVAAAISMMAIKRSNYFHNSGGKDPCHINYNPY  173

Query  642  MIAFGIIEIILSQIPXFD  695
            MIAFG  EIILSQIP FD
Sbjct  174  MIAFGTSEIILSQIPNFD  191



>gb|KHN19623.1| Amino acid permease 3 [Glycine soja]
Length=478

 Score =   262 bits (670),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = +3

Query  156  RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  335
            +    VS D     G K  DDDGR +RTGT+WTASAHI+TAVIGSGVLSLAWAI QLGW+
Sbjct  6    KQTFEVSNDTLQQGGSKSFDDDGRLKRTGTIWTASAHIVTAVIGSGVLSLAWAIAQLGWL  65

Query  336  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYF  515
            AGP VM+LFS V YYTSTLLA CYR+GD + GKRNYTY  AVRSNLGG  V  CG +QY 
Sbjct  66   AGPIVMILFSIVTYYTSTLLACCYRSGDQLSGKRNYTYTQAVRSNLGGLAVMFCGWVQYA  125

Query  516  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXF  692
            NLFG+AIGYTIAASISMMA+KRSNC+H SGGKNPC M+SN YMI++G+ EII SQIP F
Sbjct  126  NLFGVAIGYTIAASISMMAVKRSNCYHSSGGKNPCKMNSNWYMISYGVAEIIFSQIPDF  184



>ref|XP_006596218.1| PREDICTED: amino acid permease 3-like isoform X1 [Glycine max]
 ref|XP_006596219.1| PREDICTED: amino acid permease 3-like isoform X2 [Glycine max]
Length=479

 Score =   262 bits (670),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = +3

Query  156  RHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWV  335
            +    VS D     G K  DDDGR +RTGT+WTASAHI+TAVIGSGVLSLAWAI QLGW+
Sbjct  7    KQTFEVSNDTLQQGGSKSFDDDGRLKRTGTIWTASAHIVTAVIGSGVLSLAWAIAQLGWL  66

Query  336  AGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYF  515
            AGP VM+LFS V YYTSTLLA CYR+GD + GKRNYTY  AVRSNLGG  V  CG +QY 
Sbjct  67   AGPIVMILFSIVTYYTSTLLACCYRSGDQLSGKRNYTYTQAVRSNLGGLAVMFCGWVQYA  126

Query  516  NLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXF  692
            NLFG+AIGYTIAASISMMA+KRSNC+H SGGKNPC M+SN YMI++G+ EII SQIP F
Sbjct  127  NLFGVAIGYTIAASISMMAVKRSNCYHSSGGKNPCKMNSNWYMISYGVAEIIFSQIPDF  185



>ref|XP_008377748.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=514

 Score =   263 bits (672),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 156/198 (79%), Gaps = 13/198 (7%)
 Frame = +3

Query  138  AATKNH--RHHLGVSIDAPPLYGFKGL----------DDDGRPQRTGTVWTASAHIITAV  281
            A  + H  RH+L V +  P +   K +          DDDGR +RTGT WT+++HIITAV
Sbjct  19   AVEERHDIRHYLQVEVQ-PKVSESKAINPQSNYSTCFDDDGRLKRTGTFWTSASHIITAV  77

Query  282  IGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAV  461
            IGSGVLSLAWAI QLGWVAGP+V+LLF+ V  YTS LLA CYR G+P+ G+RNYTYMDAV
Sbjct  78   IGSGVLSLAWAIAQLGWVAGPTVLLLFAFVNLYTSNLLAMCYRTGNPITGQRNYTYMDAV  137

Query  462  RSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPY  641
            ++NLGG +V +CGL+QY NLFG+AIGYTIA+S+SMMAIKRSNC+H SGG++PCHMSSN Y
Sbjct  138  KANLGGRKVMMCGLVQYLNLFGVAIGYTIASSVSMMAIKRSNCYHRSGGRDPCHMSSNGY  197

Query  642  MIAFGIIEIILSQIPXFD  695
            MI FGIIE+I SQIP F+
Sbjct  198  MITFGIIEVIFSQIPDFN  215



>ref|NP_001066316.1| Os12g0181500 [Oryza sativa Japonica Group]
 gb|ABA95951.1| amino acid transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29335.1| Os12g0181500 [Oryza sativa Japonica Group]
 gb|EAZ19852.1| hypothetical protein OsJ_35437 [Oryza sativa Japonica Group]
 dbj|BAG87933.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93965.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97560.1| unnamed protein product [Oryza sativa Japonica Group]
Length=475

 Score =   262 bits (669),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +3

Query  165  LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  344
            + VS++A        LDDDGR +RTGT WTASAHIITAVIGSGVLSLAWAI QLGWVAGP
Sbjct  11   MEVSVEAGNAGEAAWLDDDGRARRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVAGP  70

Query  345  SVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLF  524
            +VMLLF+ V+YYTSTLLA+CYR GDP  GKRNYTYMDAVR+NLGG +V  CG+IQY NL 
Sbjct  71   AVMLLFAFVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANLGGAKVTFCGVIQYANLV  130

Query  525  GIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            G+AIGYTIA+SISM AI+R+ CFH +G  +PC  SSNPYMI FG+++I+ SQIP FD
Sbjct  131  GVAIGYTIASSISMRAIRRAGCFHHNGHGDPCRSSSNPYMILFGVVQIVFSQIPDFD  187



>gb|EAY82481.1| hypothetical protein OsI_37698 [Oryza sativa Indica Group]
Length=475

 Score =   262 bits (669),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +3

Query  165  LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  344
            + VS++A        LDDDGR +RTGT WTASAHIITAVIGSGVLSLAWAI QLGWVAGP
Sbjct  11   MEVSVEAGNAGEAAWLDDDGRARRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVAGP  70

Query  345  SVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLF  524
            +VMLLF+ V+YYTSTLLA+CYR GDP  GKRNYTYMDAVR+NLGG +V  CG+IQY NL 
Sbjct  71   AVMLLFAFVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANLGGAKVTFCGVIQYANLV  130

Query  525  GIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            G+AIGYTIA+SISM AI+R+ CFH +G  +PC  SSNPYMI FG+++I+ SQIP FD
Sbjct  131  GVAIGYTIASSISMRAIRRAGCFHHNGHGDPCRSSSNPYMILFGVVQIVFSQIPDFD  187



>ref|XP_009604405.1| PREDICTED: amino acid permease 4-like [Nicotiana tomentosiformis]
Length=512

 Score =   263 bits (671),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = +3

Query  204  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  383
            K  DDDGR +RTGT WTA++HIITAVIGSGVLSLAWAIGQLGWVAGP+VM+LF+ V+ YT
Sbjct  50   KCFDDDGRLKRTGTFWTATSHIITAVIGSGVLSLAWAIGQLGWVAGPAVMILFAFVILYT  109

Query  384  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  563
            S LL+ CYR GDP  G RN+TYM+AV+  LGG +VK+CGLIQY NLFG+AIGYTIAAS+S
Sbjct  110  SNLLSQCYRTGDPANGPRNHTYMEAVKGILGGKKVKVCGLIQYLNLFGVAIGYTIAASVS  169

Query  564  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            M+AIKRSNCFH+S  ++PCHMSSN YMIAFG+IEI+ SQIP FD
Sbjct  170  MLAIKRSNCFHKSHRRDPCHMSSNGYMIAFGVIEILFSQIPDFD  213



>ref|XP_002442925.1| hypothetical protein SORBIDRAFT_08g004990 [Sorghum bicolor]
 gb|EES16763.1| hypothetical protein SORBIDRAFT_08g004990 [Sorghum bicolor]
Length=481

 Score =   261 bits (668),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 146/193 (76%), Gaps = 0/193 (0%)
 Frame = +3

Query  117  MQMGESAAATKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            M M      T  H   + VS++A      + LDDDGRP+RTGT WTASAHIITAVIGSGV
Sbjct  1    MAMASHNGGTTKHLPPMEVSMEAGNGDAAEYLDDDGRPRRTGTFWTASAHIITAVIGSGV  60

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWAI QLGWVAGP+ MLLF+ V YYT+TLLA+CYR GDP  GKRNYTYMDAVRSNLG
Sbjct  61   LSLAWAIAQLGWVAGPAAMLLFAFVTYYTATLLAECYRTGDPDTGKRNYTYMDAVRSNLG  120

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G +V  CG IQY NL G+AIGYTIA+SISM AI R+ CFH+ G   PC  SSNPYMI FG
Sbjct  121  GARVAFCGCIQYANLVGVAIGYTIASSISMQAISRAGCFHKRGHAVPCKSSSNPYMILFG  180

Query  657  IIEIILSQIPXFD  695
             ++I+ SQIP FD
Sbjct  181  AVQILFSQIPDFD  193



>ref|XP_004977212.1| PREDICTED: amino acid permease 3-like [Setaria italica]
Length=481

 Score =   261 bits (668),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 150/193 (78%), Gaps = 2/193 (1%)
 Frame = +3

Query  123  MGESAAATKNHR--HHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            M   +    NH     + VS++A      + LDDDGRP+RTGT WTAS+HIITAVIGSGV
Sbjct  1    MAAHSGLNSNHAVVAPMEVSVEAGNAGAAEWLDDDGRPRRTGTFWTASSHIITAVIGSGV  60

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSLAWAI QLGWVAGP+ MLLF+ V YYT+TLLA+CYR GDP  GKRNYTYMDAVRSNLG
Sbjct  61   LSLAWAIAQLGWVAGPAAMLLFAFVTYYTATLLAECYRTGDPETGKRNYTYMDAVRSNLG  120

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G +V  CG+IQY NL G+AIGYTIA+SISM AI+R++CFH++G  +PC  SS PYMI FG
Sbjct  121  GAKVVFCGIIQYANLVGVAIGYTIASSISMKAIRRADCFHKNGHGDPCESSSTPYMILFG  180

Query  657  IIEIILSQIPXFD  695
            I EI+ SQIP FD
Sbjct  181  ITEILFSQIPDFD  193



>ref|XP_002442926.1| hypothetical protein SORBIDRAFT_08g005000 [Sorghum bicolor]
 gb|EES16764.1| hypothetical protein SORBIDRAFT_08g005000 [Sorghum bicolor]
Length=482

 Score =   261 bits (668),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = +3

Query  165  LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  344
            + VS++A        LDDDGRP+RTGT WTASAHIITAVIGSGVLSLAWAI QLGWVAGP
Sbjct  18   MEVSVEAGNAGAAAWLDDDGRPRRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVAGP  77

Query  345  SVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLF  524
            + MLLF+ V YYT+TLLA+CYR GDP  GKRNYTYMDAVRSNLGG +V  CG+IQY NL 
Sbjct  78   TAMLLFAFVTYYTATLLAECYRTGDPETGKRNYTYMDAVRSNLGGAKVVFCGIIQYANLV  137

Query  525  GIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            G+AIGYTIA+SISM AI+R+ CFH  G ++PC  SS PYMI FG++EI+ SQIP FD
Sbjct  138  GVAIGYTIASSISMKAIRRAGCFHSHGHEDPCKSSSTPYMILFGVVEILFSQIPDFD  194



>ref|XP_003630316.1| Amino acid permease [Medicago truncatula]
 gb|AET04792.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=475

 Score =   261 bits (667),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +3

Query  213  DDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTL  392
            DDDGR +RTG+VWTAS+HIITAVIGSGVLSLAWAI QLGW+AGP+VM+LFS V   TS+ 
Sbjct  25   DDDGRLKRTGSVWTASSHIITAVIGSGVLSLAWAIAQLGWIAGPAVMILFSLVTVSTSSF  84

Query  393  LADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASISMMA  572
            LADCYRAGDP  GKRNYTYMDAVRS LGG +V  CG+ QY NLFGI IGYTIAASISM A
Sbjct  85   LADCYRAGDPHSGKRNYTYMDAVRSILGGAKVTFCGIFQYLNLFGIVIGYTIAASISMTA  144

Query  573  IKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            IK+SNCFH+ G K+PCHMSSN YMI FG+I+I LSQIP FD
Sbjct  145  IKKSNCFHQHGDKSPCHMSSNLYMIMFGVIQIFLSQIPDFD  185



>gb|AFW56244.1| hypothetical protein ZEAMMB73_131551 [Zea mays]
Length=477

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 147/188 (78%), Gaps = 3/188 (2%)
 Frame = +3

Query  141  ATKNHRHHLG---VSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAW  311
            A+ N   HL    VS++A    G + LDDDGRP+RTGT WTASAHIITAVIGSGVLSLAW
Sbjct  2    ASHNGTKHLAPMEVSVEAGNGGGAEWLDDDGRPRRTGTFWTASAHIITAVIGSGVLSLAW  61

Query  312  AIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVK  491
            AI QLGWVAGP+ MLLF+ V YYT+TLLA+CYR GDP  GKRNYTYMDAVRSNLGG +V 
Sbjct  62   AIAQLGWVAGPAAMLLFAFVTYYTATLLAECYRTGDPDTGKRNYTYMDAVRSNLGGAKVA  121

Query  492  ICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEII  671
             CG IQY NL G+AIGYTIA+SISM A+ R+ CFH+ G   PC  SSNPYMI FG ++I+
Sbjct  122  FCGAIQYANLVGVAIGYTIASSISMQAVSRAGCFHKRGHAVPCKSSSNPYMILFGAVQIL  181

Query  672  LSQIPXFD  695
             SQIP FD
Sbjct  182  FSQIPDFD  189



>ref|XP_008662536.1| PREDICTED: amino acid permease 3-like [Zea mays]
 gb|AFW56241.1| hypothetical protein ZEAMMB73_107595 [Zea mays]
Length=480

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +3

Query  144  TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  323
            +K+    L VS++A      + LDDDGRP+RTGT WTASAHI+TAVIGSGVLSLAWAI Q
Sbjct  9    SKHGVAPLEVSVEAGNGGAAEWLDDDGRPRRTGTFWTASAHIVTAVIGSGVLSLAWAIAQ  68

Query  324  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGL  503
            LGWVAGP+ MLLF+ V YYT+TLLA+CYR GDP  GKRNYTYMDAVRSNLGG +V  CG+
Sbjct  69   LGWVAGPAAMLLFAFVTYYTATLLAECYRTGDPETGKRNYTYMDAVRSNLGGAKVAFCGV  128

Query  504  IQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  683
            IQY NL G+AIGYTIAASISM A++R+ CFH  G  +PC+ SS PYMI FG+++I+ SQI
Sbjct  129  IQYANLVGVAIGYTIAASISMKAVRRAGCFHAHGHADPCNSSSTPYMILFGVVQILFSQI  188

Query  684  PXFD  695
            P FD
Sbjct  189  PDFD  192



>dbj|BAK03497.1| predicted protein [Hordeum vulgare subsp. vulgare]
 emb|CCI51007.2| amino acid permease [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  204  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  383
            K  DDDGR +RTGT+WTASAHIITAVIGSGVLSLAWAIGQLGWVAGP+VMLLFS V YYT
Sbjct  33   KCYDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPAVMLLFSLVTYYT  92

Query  384  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  563
            S+LL+DCYR+GD   GKRNYTYMDAV +NL G +V++CG +QY N+ G+AIGYTIAASIS
Sbjct  93   SSLLSDCYRSGDETTGKRNYTYMDAVNANLSGIKVQLCGFLQYANIVGVAIGYTIAASIS  152

Query  564  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            M+AIK++NCFH  G  NPCH+SS PYMI FG+ EI  SQIP FD
Sbjct  153  MLAIKKANCFHVKGHVNPCHISSTPYMIIFGVAEIFFSQIPDFD  196



>ref|NP_001142349.1| hypothetical protein [Zea mays]
 ref|XP_008672537.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008672538.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008672539.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF88256.1| unknown [Zea mays]
 tpg|DAA56510.1| TPA: hypothetical protein ZEAMMB73_220445 [Zea mays]
Length=494

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  204  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  383
            K  DDDGRP+R GT+WTASAHIITAVIGSGVLSL WAI QLGWVAGP VMLLFS V YYT
Sbjct  34   KCFDDDGRPKRNGTMWTASAHIITAVIGSGVLSLGWAIAQLGWVAGPVVMLLFSLVTYYT  93

Query  384  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  563
            S+LLADCYR+GDP  GKRNYTYMDAV +NL G +V+ICG +QY N+ G+AIGYTIAASIS
Sbjct  94   SSLLADCYRSGDPSTGKRNYTYMDAVNANLSGIKVQICGFLQYANIVGVAIGYTIAASIS  153

Query  564  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            M+AI+R+NCFH+ G  NPC +SS PYMI FG+ EI  SQIP FD
Sbjct  154  MLAIRRANCFHQKGHGNPCKISSTPYMIIFGVAEIFFSQIPDFD  197



>ref|XP_007226332.1| hypothetical protein PRUPE_ppa022253mg [Prunus persica]
 gb|EMJ27531.1| hypothetical protein PRUPE_ppa022253mg [Prunus persica]
Length=483

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 151/194 (78%), Gaps = 7/194 (4%)
 Frame = +3

Query  123  MGESAAATKNHRHH---LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSG  293
            MG+  A      HH     VS++     G   +DDDGRP+RTGTVWT+SAHIITAVIGSG
Sbjct  1    MGDHTATGNLQLHHNPVFDVSLNVQE--GSNYIDDDGRPKRTGTVWTSSAHIITAVIGSG  58

Query  294  VLSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNL  473
            VLSLAWA+ QLGW+AGP VM+LFS + YYTSTLLA CYR  DPV GKRNYTY DAVRSNL
Sbjct  59   VLSLAWAMAQLGWIAGPIVMVLFSFITYYTSTLLAACYR--DPVTGKRNYTYSDAVRSNL  116

Query  474  GGYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAF  653
            G  QVK CG +Q   LFGI+IG+ IAA+ISM+AI+R NC H+SGGKNPCH++ NPYMIAF
Sbjct  117  GALQVKFCGSVQNVALFGISIGFNIAAAISMVAIQRCNCNHKSGGKNPCHININPYMIAF  176

Query  654  GIIEIILSQIPXFD  695
            GI EI+LSQIP FD
Sbjct  177  GISEILLSQIPNFD  190



>gb|AFW56242.1| hypothetical protein ZEAMMB73_107595, partial [Zea mays]
Length=492

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +3

Query  144  TKNHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQ  323
            +K+    L VS++A      + LDDDGRP+RTGT WTASAHI+TAVIGSGVLSLAWAI Q
Sbjct  9    SKHGVAPLEVSVEAGNGGAAEWLDDDGRPRRTGTFWTASAHIVTAVIGSGVLSLAWAIAQ  68

Query  324  LGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGL  503
            LGWVAGP+ MLLF+ V YYT+TLLA+CYR GDP  GKRNYTYMDAVRSNLGG +V  CG+
Sbjct  69   LGWVAGPAAMLLFAFVTYYTATLLAECYRTGDPETGKRNYTYMDAVRSNLGGAKVAFCGV  128

Query  504  IQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQI  683
            IQY NL G+AIGYTIAASISM A++R+ CFH  G  +PC+ SS PYMI FG+++I+ SQI
Sbjct  129  IQYANLVGVAIGYTIAASISMKAVRRAGCFHAHGHADPCNSSSTPYMILFGVVQILFSQI  188

Query  684  PXFD  695
            P FD
Sbjct  189  PDFD  192



>ref|XP_002534252.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF28130.1| amino acid transporter, putative [Ricinus communis]
Length=484

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  204  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  383
            K  DDDG  +RTGT WTA++HIITAVIG GVLSLAWAI QLGW+AGP+VM+LF+ V  YT
Sbjct  22   KCYDDDGHSKRTGTFWTAASHIITAVIGPGVLSLAWAIAQLGWIAGPAVMVLFAIVNLYT  81

Query  384  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  563
            S LLA CYRAGDPV G+ NYTYM+AV++NLGG +V  CGLIQY NLFG+ IGYTIAAS+S
Sbjct  82   SNLLAQCYRAGDPVTGQINYTYMEAVKANLGGRKVFFCGLIQYLNLFGVVIGYTIAASVS  141

Query  564  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            MMAIKRSNCFH SGGK+PCHMSSN YMI FGI E+I SQIP FD
Sbjct  142  MMAIKRSNCFHASGGKDPCHMSSNGYMITFGIAEVIFSQIPDFD  185



>ref|XP_007041865.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 ref|XP_007041866.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX97696.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX97697.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
Length=512

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 151/190 (79%), Gaps = 10/190 (5%)
 Frame = +3

Query  156  RHHLGVSIDA----------PPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSL  305
            RH+L V +            P     K  DDDGR +RTGT WTA++HIITAVIGSGVLSL
Sbjct  24   RHYLQVEVQPKAQNESEAMDPQANHSKCFDDDGRLKRTGTFWTATSHIITAVIGSGVLSL  83

Query  306  AWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQ  485
            AWAI QLGWVAGP+V++LF+ V  YTS LL +CYR+GDP+ G+RNYTYM+AV+++LGG++
Sbjct  84   AWAIAQLGWVAGPTVLVLFAFVNLYTSNLLTECYRSGDPITGQRNYTYMEAVKAHLGGWK  143

Query  486  VKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIE  665
            VK+CG IQY NLFG+A+GYTIAAS+SMMAIKR+NC H+SGG +PCHMSSN YMI+FGI E
Sbjct  144  VKLCGWIQYLNLFGVAVGYTIAASVSMMAIKRANCLHKSGGTDPCHMSSNGYMISFGIAE  203

Query  666  IILSQIPXFD  695
            +I SQIP F 
Sbjct  204  VIFSQIPDFS  213



>ref|NP_001066317.1| Os12g0181600 [Oryza sativa Japonica Group]
 gb|ABA95955.1| amino acid transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29336.1| Os12g0181600 [Oryza sativa Japonica Group]
 dbj|BAG87950.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97363.1| unnamed protein product [Oryza sativa Japonica Group]
Length=475

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = +3

Query  165  LGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGP  344
            + VS++A        LDDDGR +RTGT WTASAHIITAVIGSGVLSLAWAI QLGWVAGP
Sbjct  11   MEVSVEAGNAGEAAWLDDDGRARRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVAGP  70

Query  345  SVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLF  524
            +VMLLF+ V+YYTSTLLA+CYR GDP  GKRNYTYMDAVR+NLGG +V  CG+IQY NL 
Sbjct  71   AVMLLFAFVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANLGGAKVTFCGVIQYANLV  130

Query  525  GIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            G+AIGYTIA+SISM AI+R+ CFH +G  +PC  SSNPYMI FG ++I+ SQIP FD
Sbjct  131  GVAIGYTIASSISMRAIRRAGCFHHNGHGDPCRSSSNPYMILFGAVQIVFSQIPDFD  187



>ref|XP_009107481.1| PREDICTED: amino acid permease 5-like [Brassica rapa]
Length=481

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = +3

Query  150  NHRHHLGVSIDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLG  329
              R  LG+SID  P       D+DGR +RTGTVWTASAHIITAVIGSGVLSLAWA+ Q+G
Sbjct  6    KSRQELGISIDVLPRNSSDLFDEDGRVKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIG  65

Query  330  WVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQ  509
            WV GP VM+LFS V YYTS LL  CYR+GD   GKRNYTYMDA+ SNLGG +VK+CG++Q
Sbjct  66   WVGGPVVMILFSLVTYYTSILLCACYRSGDSDTGKRNYTYMDAIHSNLGGIKVKLCGVVQ  125

Query  510  YFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPX  689
            Y NLFG AIGYTIA++ISM+AI+R++C   +G K+PCH++ NPYMIAFG I+II SQIP 
Sbjct  126  YVNLFGTAIGYTIASAISMIAIQRTSCQQSNGDKDPCHVNGNPYMIAFGAIQIIFSQIPD  185

Query  690  FD  695
            FD
Sbjct  186  FD  187



>ref|XP_004505788.1| PREDICTED: amino acid permease 2-like [Cicer arietinum]
Length=513

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  204  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  383
            K  DDDGR +RTGT WTA+AHIITAVIGSGVLSLAWAI QLGW  GP VM LF+ V  YT
Sbjct  51   KCFDDDGRLKRTGTFWTATAHIITAVIGSGVLSLAWAIAQLGWAVGPVVMFLFAVVNLYT  110

Query  384  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  563
            S+LL  CYR  D V G+RNYTYMDAV+S LGG +VKICG+IQY NLFG+AIGYTIAAS+S
Sbjct  111  SSLLTQCYRTDDSVTGQRNYTYMDAVKSILGGKKVKICGVIQYVNLFGVAIGYTIAASVS  170

Query  564  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            MMAIKRSNC+HES GK+PCHMSSN YMI FG+ E++LSQIP FD
Sbjct  171  MMAIKRSNCYHESHGKDPCHMSSNGYMITFGVAEVLLSQIPDFD  214



>ref|NP_001045010.1| Os01g0882800 [Oryza sativa Japonica Group]
 dbj|BAB90366.1| putative amino acid carrier [Oryza sativa Japonica Group]
 dbj|BAF06924.1| Os01g0882800 [Oryza sativa Japonica Group]
 gb|EAY76727.1| hypothetical protein OsI_04682 [Oryza sativa Indica Group]
 gb|EAZ14390.1| hypothetical protein OsJ_04310 [Oryza sativa Japonica Group]
Length=488

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +3

Query  198  GFKGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVY  377
            G K  DDDGRP+R GT+WTASAHIITAVIGSGVLSL WAI QLGWVAGP+VM+LFS V Y
Sbjct  29   GSKLFDDDGRPRRNGTMWTASAHIITAVIGSGVLSLGWAIAQLGWVAGPAVMVLFSLVTY  88

Query  378  YTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAAS  557
            YTS+LL+DCYR+GDPV GKRNYTYMDAV +NL G++VKICG +QY N+ G+AIGYTIAAS
Sbjct  89   YTSSLLSDCYRSGDPVTGKRNYTYMDAVNANLSGFKVKICGFLQYANIVGVAIGYTIAAS  148

Query  558  ISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            ISM+AI R+NCFH  G  +PC++SS PYMI FG+ E+  SQIP FD
Sbjct  149  ISMLAIGRANCFHRKGHGDPCNVSSVPYMIVFGVAEVFFSQIPDFD  194



>gb|KHN25477.1| Amino acid permease 2 [Glycine soja]
Length=513

 Score =   260 bits (665),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  204  KGLDDDGRPQRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPSVMLLFSCVVYYT  383
            K  DDDGR +RTGT WTA+AHIITAVIGSGVLSLAWA+ QLGWVAGP VM LF+ V  YT
Sbjct  51   KCFDDDGRLKRTGTFWTATAHIITAVIGSGVLSLAWAVAQLGWVAGPVVMFLFAVVNLYT  110

Query  384  STLLADCYRAGDPVFGKRNYTYMDAVRSNLGGYQVKICGLIQYFNLFGIAIGYTIAASIS  563
            S LL  CYR GD V G RNYTYM+AV+S LGG +VK+CGLIQY NLFG+AIGYTIAAS+S
Sbjct  111  SNLLTQCYRTGDSVNGHRNYTYMEAVKSILGGKKVKLCGLIQYINLFGVAIGYTIAASVS  170

Query  564  MMAIKRSNCFHESGGKNPCHMSSNPYMIAFGIIEIILSQIPXFD  695
            MMAIKRSNC+H S GK+PCHMSSN YMI FGI E+I SQIP FD
Sbjct  171  MMAIKRSNCYHSSHGKDPCHMSSNGYMITFGIAEVIFSQIPDFD  214



>ref|XP_003568418.2| PREDICTED: amino acid permease 3-like isoform X1 [Brachypodium 
distachyon]
Length=488

 Score =   260 bits (664),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 149/193 (77%), Gaps = 1/193 (1%)
 Frame = +3

Query  120  QMGESAAATKNHRHHLGVS-IDAPPLYGFKGLDDDGRPQRTGTVWTASAHIITAVIGSGV  296
            +MGE+    + +   + VS ++     G K  DDDGR +RTGT+WTASAHIITAVIGSGV
Sbjct  6    EMGENGVGRQPYYPAMEVSGVENGHTAGSKCYDDDGRLKRTGTMWTASAHIITAVIGSGV  65

Query  297  LSLAWAIGQLGWVAGPSVMLLFSCVVYYTSTLLADCYRAGDPVFGKRNYTYMDAVRSNLG  476
            LSL WAI QLGWVAGP+VMLLFS V YYTS LL+DCYR+GD   GKRNYTYMDAV +NL 
Sbjct  66   LSLGWAIAQLGWVAGPAVMLLFSLVTYYTSALLSDCYRSGDETTGKRNYTYMDAVNANLS  125

Query  477  GYQVKICGLIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESGGKNPCHMSSNPYMIAFG  656
            G +V+ICG +QY N+ G+AIGYTIAASISM+AIKR+NCFH  G  NPCH+SS PYMI FG
Sbjct  126  GIKVQICGFLQYANIVGVAIGYTIAASISMLAIKRANCFHAKGHVNPCHISSTPYMIIFG  185

Query  657  IIEIILSQIPXFD  695
              +I  SQIP FD
Sbjct  186  AAQIFFSQIPDFD  198



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1197759904156